BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24647_g4_i1 len=2104 path=[1711:0-1190 2902:1191-1250
12308:1251-1258 991:1259-1303 12332:1304-1310 12339:1311-1328
8096:1329-2103]

Length=2104
                                                                      Score     E

emb|CDP20067.1|  unnamed protein product                                736   0.0      
ref|XP_006343504.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    727   0.0      
ref|XP_010313144.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    712   0.0      
ref|XP_009595101.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    706   0.0      
ref|XP_009786697.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    704   0.0      
ref|XP_009595104.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    703   0.0      
ref|XP_009595103.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    700   0.0      
gb|EYU37816.1|  hypothetical protein MIMGU_mgv1a003774mg                697   0.0      
ref|XP_009786699.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    698   0.0      
ref|XP_009600124.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    697   0.0      
ref|XP_009765680.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    694   0.0      
ref|XP_006365289.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    693   0.0      
ref|XP_009781458.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    689   0.0      
ref|XP_010327557.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    688   0.0      
ref|XP_006365127.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    687   0.0      
ref|XP_004230875.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    687   0.0      
ref|XP_009589910.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    685   0.0      
ref|XP_011092810.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    676   0.0      
gb|KDO47897.1|  hypothetical protein CISIN_1g008520mg                   667   0.0      
ref|XP_011088434.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    667   0.0      
ref|XP_004289637.1|  PREDICTED: uncharacterized protein LOC101312296    662   0.0      
ref|XP_008236928.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    657   0.0      
ref|XP_010097032.1|  Sec14 cytosolic factor                             657   0.0      
ref|XP_008377269.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    655   0.0      
ref|XP_009781459.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    650   0.0      
ref|XP_010526772.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    650   0.0      
ref|XP_010548310.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    650   0.0      
ref|XP_006383162.1|  hypothetical protein POPTR_0005s12160g             649   0.0      
ref|XP_009378652.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    649   0.0      
gb|EPS64124.1|  hypothetical protein M569_10657                         647   0.0      
ref|XP_010548313.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    645   0.0      
ref|XP_003548870.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    641   0.0      
ref|XP_009353404.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    642   0.0      
ref|XP_011025853.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    640   0.0      
ref|XP_006423352.1|  hypothetical protein CICLE_v10030083mg             642   0.0      
ref|XP_006487242.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    643   0.0      
ref|XP_006467150.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    640   0.0      
ref|XP_011025854.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    639   0.0      
gb|KGN61818.1|  hypothetical protein Csa_2G248750                       639   0.0      
ref|XP_010028612.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    638   0.0      
ref|XP_006285310.1|  hypothetical protein CARUB_v10006692mg             635   0.0      
gb|KHN27029.1|  Sec14 cytosolic factor                                  637   0.0      
ref|XP_006425618.1|  hypothetical protein CICLE_v10025176mg             638   0.0      
ref|XP_004169148.1|  PREDICTED: uncharacterized LOC101214906            635   0.0      
ref|XP_002867013.1|  hypothetical protein ARALYDRAFT_912720             634   0.0      
ref|NP_568006.1|  protein SEC14-like 12                                 634   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521526.1|  Sec14 cytosolic factor, putative                   634   0.0      Ricinus communis
gb|KFK30270.1|  hypothetical protein AALP_AA7G239600                    632   0.0      
ref|XP_004500796.1|  PREDICTED: uncharacterized protein LOC101489...    634   0.0      
gb|KFK30271.1|  hypothetical protein AALP_AA7G239600                    632   0.0      
ref|XP_006411998.1|  hypothetical protein EUTSA_v10024850mg             630   0.0      
ref|XP_010489517.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    630   0.0      
ref|XP_011028447.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    630   0.0      
ref|XP_002886154.1|  hypothetical protein ARALYDRAFT_900189             630   0.0      
ref|XP_010467629.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    630   0.0      
ref|XP_006574696.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    630   0.0      
ref|XP_010414002.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    630   0.0      
ref|XP_010467626.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    629   0.0      
ref|XP_008460963.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    631   0.0      
gb|AAK64378.1|AF366901_1  phosphatidylinositol transfer-like prot...    629   0.0      Lotus japonicus
emb|CAB16843.1|  hypothetical protein                                   628   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296648.1|  hypothetical protein CARUB_v10015446mg             627   0.0      
ref|XP_008460965.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    628   0.0      
ref|XP_004500798.1|  PREDICTED: uncharacterized protein LOC101489...    627   0.0      
ref|NP_179410.1|  Sec14p-like phosphatidylinositol transfer famil...    626   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690841.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    625   0.0      
ref|XP_007042121.1|  SEC14-like 3                                       625   0.0      
ref|XP_004500799.1|  PREDICTED: uncharacterized protein LOC101489...    623   0.0      
ref|XP_007156083.1|  hypothetical protein PHAVU_003G257000g             621   0.0      
ref|XP_009786700.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    619   0.0      
ref|XP_010444947.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    617   0.0      
emb|CBI17459.3|  unnamed protein product                                620   0.0      
ref|XP_009595106.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    618   0.0      
ref|XP_008241728.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    620   0.0      
ref|XP_010649108.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    619   0.0      
ref|XP_010436238.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    627   0.0      
ref|XP_004509308.1|  PREDICTED: SEC14 cytosolic factor-like isofo...    618   0.0      
ref|NP_001242548.1|  uncharacterized protein LOC100798374               619   0.0      
ref|XP_004509310.1|  PREDICTED: SEC14 cytosolic factor-like isofo...    618   0.0      
ref|XP_009144505.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    617   0.0      
ref|XP_002512942.1|  Sec14 cytosolic factor, putative                   616   0.0      Ricinus communis
ref|XP_008241729.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    618   0.0      
ref|XP_004148858.1|  PREDICTED: uncharacterized protein LOC101214906    615   0.0      
ref|XP_006581016.1|  PREDICTED: uncharacterized protein LOC100798...    614   0.0      
ref|NP_565514.1|  SEC14-like 3 protein                                  613   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189571.1|  SEC14-like 3 protein                               613   0.0      
ref|XP_002880389.1|  hypothetical protein ARALYDRAFT_481021             613   0.0      
ref|XP_007203119.1|  hypothetical protein PRUPE_ppa023962mg             613   0.0      
ref|XP_010416906.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    613   0.0      
ref|XP_010649109.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    614   0.0      
ref|XP_006404605.1|  hypothetical protein EUTSA_v10000115mg             612   0.0      
ref|XP_002313782.2|  hypothetical protein POPTR_0009s12220g             612   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002305440.1|  SEC14 cytosolic factor family protein              613   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006404606.1|  hypothetical protein EUTSA_v10000115mg             610   0.0      
ref|XP_011048002.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    612   0.0      
ref|XP_006581015.1|  PREDICTED: uncharacterized protein LOC100798...    611   0.0      
ref|XP_008795962.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    611   0.0      
ref|XP_006296006.1|  hypothetical protein CARUB_v10025149mg             608   0.0      
ref|XP_009140284.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    607   0.0      
ref|XP_009388836.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    609   0.0      
dbj|BAF98224.1|  CM0216.420.nc                                          607   0.0      Lotus japonicus
emb|CDX99586.1|  BnaC04g33430D                                          605   0.0      
emb|CDY15887.1|  BnaA04g12240D                                          605   0.0      
ref|XP_009140288.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    604   0.0      
ref|XP_008784932.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    607   0.0      
ref|XP_008795961.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    606   0.0      
ref|XP_010429071.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    603   0.0      
ref|XP_010029748.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    604   0.0      
gb|KCW55375.1|  hypothetical protein EUGRSUZ_I01285                     601   0.0      
ref|XP_010263589.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    604   0.0      
ref|XP_007135958.1|  hypothetical protein PHAVU_009G006100g             602   0.0      
ref|XP_010263590.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    602   0.0      
ref|XP_006577914.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    601   0.0      
ref|XP_004288801.1|  PREDICTED: uncharacterized protein LOC101297004    599   0.0      
ref|XP_006847541.1|  hypothetical protein AMTR_s00014p00130910          600   0.0      
ref|XP_006577915.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    598   0.0      
ref|XP_010940109.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    600   0.0      
gb|KHN20050.1|  Sec14 cytosolic factor                                  595   0.0      
ref|XP_007135959.1|  hypothetical protein PHAVU_009G006100g             596   0.0      
ref|XP_009403235.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    596   0.0      
ref|XP_009402009.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    595   0.0      
ref|XP_003629395.1|  Phosphatidylinositol transfer-like protein II      592   0.0      
ref|XP_010555282.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    591   0.0      
gb|KCW56705.1|  hypothetical protein EUGRSUZ_I02398                     590   0.0      
ref|XP_007199958.1|  hypothetical protein PRUPE_ppa026305mg             587   0.0      
ref|XP_010645212.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    587   0.0      
ref|XP_010531443.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    585   0.0      
ref|XP_010679780.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    585   0.0      
gb|EYU42604.1|  hypothetical protein MIMGU_mgv1a005833mg                577   0.0      
ref|XP_003606968.1|  Sec14 cytosolic factor                             580   0.0      
emb|CBI37682.3|  unnamed protein product                                579   0.0      
ref|XP_008237008.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    580   0.0      
ref|XP_006590887.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    578   0.0      
emb|CDX69225.1|  BnaC01g02280D                                          578   0.0      
ref|XP_006285920.1|  hypothetical protein CARUB_v10007432mg             573   0.0      
gb|KHN39805.1|  Sec14 cytosolic factor                                  573   0.0      
ref|NP_195184.2|  phosphatidylinositol transfer protein COW1            571   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAE82296.1|  can of worms 1 protein                                 570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507471.1|  PREDICTED: uncharacterized protein LOC101513836    570   0.0      
ref|XP_007131803.1|  hypothetical protein PHAVU_011G042900g             569   0.0      
ref|XP_006412209.1|  hypothetical protein EUTSA_v10024823mg             568   0.0      
emb|CAA18837.1|  putative protein                                       568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131805.1|  hypothetical protein PHAVU_011G042900g             568   0.0      
ref|XP_007131802.1|  hypothetical protein PHAVU_011G042900g             568   0.0      
ref|XP_004289116.1|  PREDICTED: uncharacterized protein LOC101306761    567   0.0      
ref|XP_007131804.1|  hypothetical protein PHAVU_011G042900g             568   0.0      
ref|XP_009108722.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    567   0.0      
ref|XP_002868891.1|  hypothetical protein ARALYDRAFT_912375             567   0.0      
ref|XP_010437021.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    567   0.0      
ref|XP_008440764.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    566   0.0      
emb|CDY17469.1|  BnaC03g65940D                                          566   0.0      
emb|CDX76291.1|  BnaA08g11090D                                          566   0.0      
ref|XP_010437024.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    564   0.0      
ref|XP_009108721.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    562   0.0      
ref|XP_010467630.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    559   0.0      
ref|XP_004150001.1|  PREDICTED: uncharacterized protein LOC101208423    563   0.0      
ref|XP_010414018.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    559   0.0      
ref|XP_010548065.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    562   0.0      
ref|XP_010255184.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    562   0.0      
ref|XP_004170475.1|  PREDICTED: uncharacterized LOC101208423            561   0.0      
ref|NP_195629.2|  protein SECRETION 14                                  559   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH36368.1|  Sec14p-like phosphatidylinositol transfer family ...    558   0.0      
gb|KHN41942.1|  Sec14 cytosolic factor                                  556   0.0      
ref|NP_001190963.1|  protein SECRETION 14                               557   0.0      
ref|NP_001045802.1|  Os02g0133200                                       559   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003603966.1|  Sec14 cytosolic factor                             556   0.0      
ref|XP_010431881.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    556   0.0      
ref|XP_010446449.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    555   0.0      
ref|XP_002283681.2|  PREDICTED: phosphatidylinositol/phosphatidyl...    557   0.0      Vitis vinifera
ref|XP_010446447.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    555   0.0      
ref|XP_006411720.1|  hypothetical protein EUTSA_v10024853mg             554   0.0      
emb|CAB43633.1|  SEC14-like protein                                     553   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432395.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    553   0.0      
ref|XP_010431883.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    553   0.0      
ref|XP_010645229.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    555   0.0      
ref|XP_006648288.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    551   0.0      
gb|EEE56248.1|  hypothetical protein OsJ_05270                          555   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437588.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    551   0.0      
ref|XP_006286142.1|  hypothetical protein CARUB_v10007697mg             549   0.0      
emb|CDY45318.1|  BnaA03g52910D                                          546   0.0      
ref|XP_004289639.1|  PREDICTED: uncharacterized protein LOC101312875    551   0.0      
ref|XP_003570886.2|  PREDICTED: phosphatidylinositol/phosphatidyl...    550   0.0      
ref|XP_002512943.1|  phosphatidylinositol transporter, putative         550   0.0      Ricinus communis
ref|XP_010233769.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    549   0.0      
ref|XP_010105353.1|  Sec14 cytosolic factor                             549   0.0      
emb|CDY12126.1|  BnaC03g60420D                                          545   0.0      
ref|XP_007131801.1|  hypothetical protein PHAVU_011G042800g             548   0.0      
ref|XP_010437589.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    545   0.0      
ref|XP_006847542.1|  hypothetical protein AMTR_s00014p00131390          547   0.0      
dbj|BAK05246.1|  predicted protein                                      546   0.0      
ref|XP_003537860.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    546   0.0      
ref|XP_003541004.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    546   0.0      
ref|XP_002869137.1|  predicted protein                                  543   0.0      
ref|XP_009109490.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    542   0.0      
ref|XP_010263587.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    545   0.0      
ref|XP_010531442.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    545   0.0      
dbj|BAF98225.1|  CM0216.430.nc                                          545   0.0      Lotus japonicus
ref|XP_007042119.1|  Sec14p-like phosphatidylinositol transfer fa...    545   0.0      
ref|XP_010936685.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    542   0.0      
ref|XP_007042117.1|  Sec14p-like phosphatidylinositol transfer fa...    544   0.0      
ref|XP_004968250.1|  PREDICTED: uncharacterized protein LOC101763275    543   0.0      
gb|KHN25399.1|  Sec14 cytosolic factor                                  546   0.0      
emb|CDX90317.1|  BnaA08g16670D                                          540   0.0      
emb|CDX75444.1|  BnaA01g02580D                                          540   0.0      
ref|XP_010555281.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    543   0.0      
ref|XP_003603968.1|  Sec14 cytosolic factor                             540   2e-180   
ref|XP_010263586.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    541   2e-180   
gb|KFK32889.1|  hypothetical protein AALP_AA6G300800                    541   2e-180   
ref|XP_009117393.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    540   3e-180   
ref|XP_004951982.1|  PREDICTED: uncharacterized protein LOC101773...    541   3e-180   
ref|XP_004951981.1|  PREDICTED: uncharacterized protein LOC101773...    541   4e-180   
ref|XP_011088432.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    540   4e-180   
ref|XP_002306120.1|  SEC14 cytosolic factor family protein              540   5e-180   Populus trichocarpa [western balsam poplar]
ref|XP_008377274.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    539   5e-180   
gb|KFK32888.1|  hypothetical protein AALP_AA6G300800                    540   5e-180   
ref|XP_004951980.1|  PREDICTED: uncharacterized protein LOC101773...    541   7e-180   
ref|XP_009117392.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    540   7e-180   
ref|XP_006646841.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    539   9e-180   
ref|XP_006423354.1|  hypothetical protein CICLE_v10028023mg             538   1e-179   
ref|XP_006384514.1|  hypothetical protein POPTR_0004s16510g             538   1e-179   
emb|CDX69071.1|  BnaC01g03820D                                          535   1e-179   
ref|XP_008349909.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    538   1e-179   
ref|XP_006423355.1|  hypothetical protein CICLE_v10028023mg             538   2e-179   
ref|XP_008681485.1|  PREDICTED: uncharacterized protein LOC100273...    538   2e-179   
ref|XP_009378657.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    538   2e-179   
ref|NP_001064068.2|  Os10g0122600                                       537   2e-179   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004500794.1|  PREDICTED: uncharacterized protein LOC101488984    538   3e-179   
ref|XP_008377272.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    538   3e-179   
ref|XP_008377273.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    537   3e-179   
ref|XP_006487243.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    537   3e-179   
ref|XP_003573065.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   3e-179   
ref|XP_010234172.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   3e-179   
ref|XP_003603967.1|  Sec14 cytosolic factor                             540   4e-179   
ref|XP_009111282.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   4e-179   
ref|XP_010940114.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    537   4e-179   
ref|XP_010068556.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    538   5e-179   
ref|XP_008349908.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   6e-179   
ref|XP_004968249.1|  PREDICTED: uncharacterized protein LOC101762865    536   8e-179   
ref|XP_009378656.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   1e-178   
emb|CDY13810.1|  BnaA09g43120D                                          536   1e-178   
ref|XP_009378655.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   1e-178   
ref|XP_008377271.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    536   2e-178   
ref|XP_006572840.1|  PREDICTED: uncharacterized protein LOC100527...    530   2e-178   
ref|XP_009418458.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    535   2e-178   
emb|CDX75576.1|  BnaA01g01260D                                          542   2e-178   
gb|KHG00771.1|  Sec14 cytosolic factor                                  536   2e-178   
ref|XP_006404603.1|  hypothetical protein EUTSA_v10000082mg             536   2e-178   
dbj|BAD07999.1|  putative phosphatidylinositol/ phophatidylcholin...    535   2e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004509311.1|  PREDICTED: SEC14 cytosolic factor-like isofo...    529   2e-178   
ref|XP_008681487.1|  PREDICTED: uncharacterized protein LOC100273...    535   2e-178   
ref|XP_006411719.1|  hypothetical protein EUTSA_v10024693mg             534   3e-178   
ref|XP_010254739.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   4e-178   
ref|XP_009380385.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   5e-178   
ref|XP_008236932.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   6e-178   
ref|XP_009380384.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   7e-178   
ref|XP_009378654.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    534   8e-178   
gb|KDP41761.1|  hypothetical protein JCGZ_26779                         533   1e-177   
ref|XP_007135956.1|  hypothetical protein PHAVU_009G006000g             533   1e-177   
ref|XP_009109488.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    533   2e-177   
ref|XP_010936680.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    533   2e-177   
ref|XP_006283268.1|  hypothetical protein CARUB_v10004299mg             534   2e-177   
ref|XP_004291849.1|  PREDICTED: uncharacterized protein LOC101290835    533   2e-177   
ref|XP_008795965.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    533   2e-177   
dbj|BAD16989.1|  putative SEC14 cytosolic factor                        532   2e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010254745.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   3e-177   
ref|XP_008236930.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    532   3e-177   
gb|AAK63247.1|AF367433_1  phosphatidylinositol transfer-like prot...    532   3e-177   Lotus japonicus
ref|XP_004148831.1|  PREDICTED: uncharacterized protein LOC101208172    532   4e-177   
ref|XP_007158599.1|  hypothetical protein PHAVU_002G166200g             527   5e-177   
ref|XP_010940115.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   5e-177   
ref|XP_006590699.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    526   6e-177   
ref|XP_008460966.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   7e-177   
ref|XP_009765681.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   8e-177   
ref|XP_010437027.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   8e-177   
ref|XP_011037488.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   8e-177   
ref|XP_003522898.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    531   9e-177   
ref|XP_002453900.1|  hypothetical protein SORBIDRAFT_04g021100          530   1e-176   Sorghum bicolor [broomcorn]
ref|XP_010437026.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    530   1e-176   
ref|XP_007046834.1|  Sec14p-like phosphatidylinositol transfer fa...    531   1e-176   
ref|XP_004169138.1|  PREDICTED: uncharacterized LOC101208172            530   2e-176   
ref|XP_010446446.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    530   2e-176   
gb|KDO47887.1|  hypothetical protein CISIN_1g006449mg                   531   2e-176   
ref|XP_011047984.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    530   2e-176   
ref|XP_007199757.1|  hypothetical protein PRUPE_ppa002840mg             530   2e-176   
ref|XP_010446445.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    530   2e-176   
ref|XP_011047991.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    530   2e-176   
gb|KDO47885.1|  hypothetical protein CISIN_1g006449mg                   530   3e-176   
emb|CAN82580.1|  hypothetical protein VITISV_008779                     530   3e-176   
ref|XP_010530819.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   4e-176   
ref|NP_179747.4|  Sec14p-like phosphatidylinositol transfer famil...    530   4e-176   
ref|XP_011037485.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    529   4e-176   
ref|XP_006647237.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    528   5e-176   
emb|CDX90316.1|  BnaA08g16680D                                          529   5e-176   
ref|XP_003527164.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    529   6e-176   
ref|XP_006595925.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    529   6e-176   
gb|KHN20956.1|  Sec14 cytosolic factor                                  529   7e-176   
ref|XP_010936679.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    529   7e-176   
ref|XP_007199758.1|  hypothetical protein PRUPE_ppa002840mg             529   8e-176   
ref|XP_006365292.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    528   9e-176   
ref|NP_568054.1|  Sec14p-like phosphatidylinositol transfer famil...    528   1e-175   
ref|NP_001118356.1|  Sec14p-like phosphatidylinositol transfer fa...    529   1e-175   
ref|XP_006296430.1|  hypothetical protein CARUB_v10025610mg             528   1e-175   
ref|XP_003544359.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    528   1e-175   
ref|XP_009600157.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    528   1e-175   
ref|XP_010437028.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   1e-175   
ref|XP_008679998.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    528   2e-175   
gb|AAK63248.1|AF367434_1  phosphatidylinositol transfer-like prot...    522   2e-175   
ref|XP_004951979.1|  PREDICTED: SEC14-like protein 1-like               526   2e-175   
ref|XP_009389342.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   2e-175   
ref|XP_011092814.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   3e-175   
dbj|BAJ96318.1|  predicted protein                                      526   4e-175   
ref|XP_002866832.1|  hypothetical protein ARALYDRAFT_912374             526   4e-175   
ref|XP_010690840.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   4e-175   
gb|KHN20049.1|  Sec14 cytosolic factor                                  527   4e-175   
ref|XP_009600133.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    527   4e-175   
ref|XP_010530818.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    523   4e-175   
gb|KDO47892.1|  hypothetical protein CISIN_1g006449mg                   526   4e-175   
gb|KDO47890.1|  hypothetical protein CISIN_1g006449mg                   526   5e-175   
ref|XP_009353403.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    526   5e-175   
gb|KDO71017.1|  hypothetical protein CISIN_1g011229mg                   521   7e-175   
ref|XP_006365291.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    526   7e-175   
ref|XP_011092815.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    526   8e-175   
ref|NP_001190962.1|  Sec14p-like phosphatidylinositol transfer fa...    525   8e-175   
ref|XP_004512075.1|  PREDICTED: sec14 cytosolic factor-like             520   1e-174   
emb|CDP20068.1|  unnamed protein product                                525   1e-174   
gb|KEH27570.1|  Sec14p-like phosphatidylinositol transfer family ...    520   2e-174   
gb|AAK59767.1|  AT4g39170/T22F8_70                                      523   2e-174   
ref|XP_004499192.1|  PREDICTED: uncharacterized protein LOC101495...    525   2e-174   
ref|XP_008784937.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    525   2e-174   
gb|AAD23650.1|  putative phosphatidylinositol/phophatidylcholine ...    515   2e-174   
ref|XP_009394504.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    525   2e-174   
emb|CDY12125.1|  BnaC03g60410D                                          524   3e-174   
ref|XP_003612077.1|  Phosphatidylinositol transfer-like protein IV      519   3e-174   
ref|XP_003574138.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    525   3e-174   
gb|EYU37817.1|  hypothetical protein MIMGU_mgv1a002892mg                525   3e-174   
ref|XP_008679999.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   4e-174   
ref|XP_009781464.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   4e-174   
ref|XP_009629974.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   5e-174   
ref|XP_002281429.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   5e-174   
ref|XP_002453266.1|  hypothetical protein SORBIDRAFT_04g002760          523   5e-174   
ref|XP_008644217.1|  PREDICTED: uncharacterized protein LOC100502...    523   6e-174   
ref|XP_010105354.1|  Sec14 cytosolic factor                             521   6e-174   
ref|XP_004230868.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   6e-174   
ref|XP_008644219.1|  PREDICTED: uncharacterized protein LOC100502...    523   8e-174   
ref|XP_010110037.1|  Sec14 cytosolic factor                             533   1e-173   
ref|XP_008644218.1|  PREDICTED: uncharacterized protein LOC100502...    523   1e-173   
gb|KDO47891.1|  hypothetical protein CISIN_1g006449mg                   522   1e-173   
ref|XP_010263585.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    524   1e-173   
ref|XP_010649110.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    520   1e-173   
ref|XP_004499191.1|  PREDICTED: uncharacterized protein LOC101495...    523   1e-173   
ref|XP_009629969.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    523   2e-173   
gb|KHN12687.1|  SEC14 cytosolic factor                                  523   2e-173   
ref|XP_004499190.1|  PREDICTED: uncharacterized protein LOC101495...    523   2e-173   
gb|ABF70041.1|  phosphatidylinositol transfer protein, putative         522   3e-173   
ref|XP_002310267.2|  phosphatidylinositol transfer-like protein II      517   4e-173   
gb|EEE56900.1|  hypothetical protein OsJ_06557                          517   4e-173   
emb|CDX82040.1|  BnaC08g35610D                                          520   5e-173   
ref|XP_006365129.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   6e-173   
ref|XP_010327434.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   6e-173   
ref|XP_003550393.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   7e-173   
ref|XP_009404707.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   7e-173   
ref|XP_006601320.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   8e-173   
ref|XP_008811091.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    521   9e-173   
ref|XP_004499188.1|  PREDICTED: uncharacterized protein LOC101495...    520   2e-172   
ref|XP_004499189.1|  PREDICTED: uncharacterized protein LOC101495...    520   3e-172   
ref|XP_004248700.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    519   3e-172   
gb|EEC73083.1|  hypothetical protein OsI_07048                          514   5e-172   
gb|KFK30497.1|  hypothetical protein AALP_AA7G269400                    518   5e-172   
ref|XP_010263584.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    520   6e-172   
ref|XP_007201093.1|  hypothetical protein PRUPE_ppa026080mg             514   7e-172   
gb|ABR17997.1|  unknown                                                 518   8e-172   
ref|XP_007160727.1|  hypothetical protein PHAVU_001G012100g             518   8e-172   
gb|KEH40180.1|  Sec14p-like phosphatidylinositol transfer family ...    518   1e-171   
gb|EMS62220.1|  Sec14 cytosolic factor                                  519   2e-171   
ref|XP_010472148.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    518   3e-171   
ref|XP_010922737.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    516   7e-171   
gb|KEH40183.1|  Sec14p-like phosphatidylinositol transfer family ...    514   2e-170   
ref|NP_001141937.1|  uncharacterized protein LOC100274086               514   3e-170   
ref|NP_565387.1|  Sec14p-like phosphatidylinositol transfer famil...    511   3e-170   
gb|KDP25703.1|  hypothetical protein JCGZ_24004                         510   3e-170   
dbj|BAD44210.1|  putative phosphatidylinositol/ phosphatidylcholi...    512   3e-170   
ref|XP_010922752.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    513   4e-170   
gb|EMT15221.1|  hypothetical protein F775_02667                         524   6e-170   
ref|XP_010416904.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    513   2e-169   
ref|XP_010429070.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    513   2e-169   
gb|EMT15220.1|  hypothetical protein F775_29178                         510   3e-169   
gb|EYU42601.1|  hypothetical protein MIMGU_mgv1a003028mg                511   4e-169   
gb|AES89172.2|  Sec14p-like phosphatidylinositol transfer family ...    511   4e-169   
ref|XP_002878555.1|  predicted protein                                  510   5e-169   
ref|XP_003606975.1|  Sec14 cytosolic factor                             511   6e-169   
gb|KEH40182.1|  Sec14p-like phosphatidylinositol transfer family ...    511   7e-169   
ref|XP_002884168.1|  predicted protein                                  508   8e-169   
ref|XP_007222014.1|  hypothetical protein PRUPE_ppa002936mg             510   1e-168   
ref|XP_008344289.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    498   2e-168   
ref|XP_006647233.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    507   3e-167   
ref|XP_008220844.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    506   4e-167   
ref|XP_003603969.1|  Sec14 cytosolic factor                             497   4e-166   
gb|KHN00514.1|  Sec14 cytosolic factor                                  506   4e-166   
ref|XP_007199968.1|  hypothetical protein PRUPE_ppa025972mg             495   5e-166   
ref|XP_004952458.1|  PREDICTED: uncharacterized protein LOC101769...    502   2e-165   
ref|XP_006297369.1|  hypothetical protein CARUB_v10013388mg             499   3e-165   
ref|XP_003573093.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    501   3e-165   
ref|XP_010234176.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    501   4e-165   
ref|XP_010489211.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    498   5e-165   
ref|XP_004952457.1|  PREDICTED: uncharacterized protein LOC101769...    500   9e-165   
ref|XP_010489212.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    497   9e-165   
ref|XP_007135955.1|  hypothetical protein PHAVU_009G006000g             494   1e-164   
ref|XP_011048799.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    499   3e-164   
ref|XP_010536338.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    498   4e-164   
gb|KDP38545.1|  hypothetical protein JCGZ_04470                         498   4e-164   
ref|XP_011048798.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    498   6e-164   
ref|XP_002300755.2|  hypothetical protein POPTR_0002s03400g             498   8e-164   
gb|KHN22234.1|  Sec14 cytosolic factor                                  496   1e-163   
gb|KDO47894.1|  hypothetical protein CISIN_1g006449mg                   491   2e-163   
gb|KHF99406.1|  SEC14 cytosolic factor                                  494   2e-163   
gb|KDO47893.1|  hypothetical protein CISIN_1g006449mg                   491   3e-163   
ref|XP_006581198.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    495   3e-163   
ref|XP_003527684.2|  PREDICTED: phosphatidylinositol/phosphatidyl...    495   3e-163   
gb|KDO47895.1|  hypothetical protein CISIN_1g006449mg                   491   3e-163   
ref|XP_007136641.1|  hypothetical protein PHAVU_009G061300g             495   4e-163   
ref|XP_002510428.1|  phosphatidylinositol transporter, putative         496   4e-163   
ref|XP_006423356.1|  hypothetical protein CICLE_v10028023mg             491   5e-163   
ref|XP_010060978.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    496   6e-163   
gb|KDO84631.1|  hypothetical protein CISIN_1g006989mg                   494   1e-162   
ref|XP_006423353.1|  hypothetical protein CICLE_v10028023mg             491   2e-162   
ref|XP_008385908.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    490   2e-162   
ref|XP_007042120.1|  Sec14p-like phosphatidylinositol transfer fa...    487   2e-162   
emb|CAB43632.1|  SEC14-like protein                                     493   4e-162   
ref|XP_010516782.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    490   4e-162   
ref|XP_010467361.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    490   6e-162   
gb|KHG12269.1|  SEC14 cytosolic factor                                  492   7e-162   
ref|XP_011048796.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    493   8e-162   
ref|XP_010414025.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    486   8e-162   
ref|XP_011048797.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    493   1e-161   
ref|XP_006473545.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    491   2e-161   
ref|XP_006473544.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    491   2e-161   
ref|XP_011028883.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    490   5e-161   
ref|XP_009378653.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    486   2e-160   
gb|KHN45872.1|  Sec14 cytosolic factor                                  487   4e-160   
gb|AFW70031.1|  putative CRAL/TRIO domain containing, Sec14p-like...    480   5e-160   
ref|XP_008385906.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    485   8e-160   
ref|XP_008385910.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    481   8e-160   
gb|EPS69446.1|  hypothetical protein M569_05317                         487   9e-160   
ref|XP_008377266.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    484   1e-159   
ref|XP_010234177.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    485   2e-159   
gb|AAD23696.1|  putative phosphatidylinositol/phosphatidylcholine...    482   5e-159   
ref|XP_010536337.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    485   6e-159   
ref|XP_011028880.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    484   1e-158   
ref|XP_006379255.1|  hypothetical protein POPTR_0009s12230g             481   2e-158   
ref|XP_004289635.1|  PREDICTED: SEC14 cytosolic factor-like             481   2e-158   
gb|KGN48869.1|  hypothetical protein Csa_6G504500                       481   2e-158   
ref|XP_008377267.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    480   2e-158   
ref|XP_006304805.1|  hypothetical protein CARUB_v10012422mg             481   1e-157   
ref|XP_002451489.1|  hypothetical protein SORBIDRAFT_04g002750          478   2e-157   
ref|XP_003523568.2|  PREDICTED: phosphatidylinositol/phosphatidyl...    479   4e-157   
gb|KCW67883.1|  hypothetical protein EUGRSUZ_F01595                     473   2e-156   
ref|XP_006577990.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    476   3e-156   
ref|XP_010459636.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    477   7e-156   
ref|XP_010477185.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    477   7e-156   
gb|AAL07100.1|  putative sec14 cytosolic factor                         476   1e-155   
gb|KHG13032.1|  SEC14 cytosolic factor                                  473   1e-155   
ref|XP_008359764.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    476   3e-155   
ref|XP_006409442.1|  hypothetical protein EUTSA_v10022634mg             473   3e-155   
ref|XP_009136302.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    473   3e-155   
gb|KHG03196.1|  Sec14 cytosolic factor                                  476   4e-155   
ref|XP_008237009.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    469   5e-155   
ref|XP_009348625.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    469   7e-155   
gb|KCW63963.1|  hypothetical protein EUGRSUZ_G01643                     471   8e-155   
ref|XP_006654736.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    474   1e-154   
gb|EPS72283.1|  hypothetical protein M569_02474                         472   3e-154   
ref|XP_006654735.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    473   3e-154   
ref|NP_564092.1|  Sec14p-like phosphatidylinositol transfer famil...    471   7e-154   
ref|XP_009335946.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    472   8e-154   
ref|XP_006654737.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    470   3e-153   
ref|XP_002893058.1|  hypothetical protein ARALYDRAFT_472189             470   3e-153   
ref|XP_008377243.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    468   5e-153   
ref|XP_004961332.1|  PREDICTED: uncharacterized protein LOC101785...    469   5e-153   
gb|KHG12222.1|  Sec14 cytosolic factor                                  469   5e-153   
ref|XP_004961331.1|  PREDICTED: uncharacterized protein LOC101785...    469   7e-153   
ref|XP_007017606.1|  Sec14p-like phosphatidylinositol transfer fa...    469   1e-152   
ref|XP_007017604.1|  Sec14p-like phosphatidylinositol transfer fa...    468   2e-152   
ref|XP_010061285.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    465   7e-152   
ref|XP_010498386.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    466   8e-152   
ref|XP_004500992.1|  PREDICTED: uncharacterized protein LOC101496...    464   3e-151   
gb|KDO47896.1|  hypothetical protein CISIN_1g006449mg                   462   4e-151   
ref|XP_008347363.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    465   4e-151   
emb|CAN76215.1|  hypothetical protein VITISV_009514                     474   1e-150   
ref|XP_010913311.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    463   1e-150   
ref|XP_003567967.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    463   2e-150   
ref|XP_010231072.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    463   2e-150   
ref|XP_009149448.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    462   5e-150   
gb|KCW68217.1|  hypothetical protein EUGRSUZ_F01871                     457   6e-150   
emb|CDY29415.1|  BnaA06g13810D                                          461   6e-150   
ref|XP_004500993.1|  PREDICTED: uncharacterized protein LOC101496...    459   8e-150   
ref|XP_009365514.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    462   9e-150   
emb|CDY39363.1|  BnaC05g15240D                                          460   1e-149   
ref|XP_010428554.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    460   2e-149   
ref|XP_010428555.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    460   2e-149   
gb|KEH40181.1|  Sec14p-like phosphatidylinositol transfer family ...    456   5e-149   
ref|NP_001056209.1|  Os05g0545000                                       459   5e-149   



>emb|CDP20067.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/601 (67%), Positives = 483/601 (80%), Gaps = 32/601 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDA--DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV  1882
             MSG +ERP RPS EK+DL+   D+R+TRLGSL+KAAI+AS KFRHS   + RR+SRVMSV
Sbjct  5     MSGPIERPYRPSMEKIDLENADDERKTRLGSLKKAAISASTKFRHSLTKKGRRNSRVMSV  64

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE+K+VDA RQALIL+ELLP+KHDDYHM+LRFL+ARKF+I+K+KQMWADM+Q
Sbjct  65    VFEDEHDAEELKAVDALRQALILEELLPSKHDDYHMLLRFLRARKFDIEKTKQMWADMIQ  124

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRK+FGADTI++DF+FKE+ EVLKYYP GHHGVDKDGRP+YIERLG VDA KLMQVTTMD
Sbjct  125   WRKDFGADTIMEDFEFKEKSEVLKYYPHGHHGVDKDGRPVYIERLGQVDAVKLMQVTTMD  184

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY+KYHVQEFERT  DK  +CSIAAKKHIDQSTTILDVQGVGLKNF K ARELIQ LQKI
Sbjct  185   RYVKYHVQEFERTFADKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKSARELIQRLQKI  244

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETLCRMYI+NAGSGFRLLWNTVKSFLDPKTTAKI+VLGNK+QSKLLE+IDASEL
Sbjct  245   DGDNYPETLCRMYIVNAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKFQSKLLEVIDASEL  304

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE-EEKTIPEDGGV  985
             P+FLGGTCTCADKGGCM SDKGPWND ++MKMV  G HKCS+++     +EKTI ED   
Sbjct  305   PEFLGGTCTCADKGGCMLSDKGPWNDADVMKMVRNGEHKCSNKIIIPNVDEKTISEDENA  364

Query  984   NvsvsmsaksvkkpaSFKIESTK------KLFPIQEE-------TRQPDMYVPMVDKTVD  844
             N          KK  SFK+ES +      +L  +QEE         + +  +P+++KTVD
Sbjct  365   N---------SKKNHSFKLESPRVQRTRSQLSAVQEEVASKCRPVTERERCIPVMEKTVD  415

Query  843   LPNWHVVNNDNCKFVVPKGADLYQI--QEAYKGQELASNQLLTGVMTFVMGIVTMVRMTK  670
                WH ++  +  F + K AD Y +   +A KG +  SNQ+ TGVMTFVMGIVTMVRMT+
Sbjct  416   -TTWHKISKID-DFALSKAADYYPVHHHDACKGNDGFSNQVFTGVMTFVMGIVTMVRMTR  473

Query  669   NMPRKLTESTLYSN-SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
             NMPRK+T++T YSN SM+  +  +KGH AY+ P PA+++A++  MMKRMA LE+K   L 
Sbjct  474   NMPRKMTDATFYSNGSMYGVEAMVKGH-AYELPAPAISSADYFTMMKRMAELEDKMSVLG  532

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFG  313
             N+  TMPPEKEE L+NA+SR+DALEQELA AKKAL+E+   Q EL+AYIEKKKKKK  FG
Sbjct  533   NKSQTMPPEKEEELNNALSRVDALEQELASAKKALDEALLQQQELLAYIEKKKKKKKFFG  592

Query  312   F  310
             F
Sbjct  593   F  593



>ref|XP_006343504.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Solanum tuberosum]
Length=604

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 464/605 (77%), Gaps = 23/605 (4%)
 Frame = -2

Query  2061  AGNMS-GAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk--frhsfksrrrss  1897
             +G MS G +ERPLRPS EK+D++   +D++ RLGS +K A+NASNK         RR SS
Sbjct  2     SGKMSTGPLERPLRPSMEKIDIENTEEDKKPRLGSFKKKALNASNKFRQSLKKTGRRNSS  61

Query  1896  RVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             RVMSVV +DEHDAEE KSVDAFRQALILDELLP +HDDYHMMLRFLKARKFE++KSKQMW
Sbjct  62    RVMSVVFEDEHDAEESKSVDAFRQALILDELLPAQHDDYHMMLRFLKARKFELEKSKQMW  121

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DM+ WRKEFGADTI+ DF+FKE++EV+KYYPQGHHGVDK+GRP+YIER+G VD+TKL+Q
Sbjct  122   SDMINWRKEFGADTIMQDFEFKEKEEVVKYYPQGHHGVDKEGRPVYIERIGQVDSTKLLQ  181

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AREL+Q
Sbjct  182   VTTMDRYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARELLQ  241

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQ +DG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEII
Sbjct  242   CLQGVDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEII  301

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPE  997
             DASELP+FLGGTCTC DKGGCM SDKGPWNDPEIMKMVH G HKC+ + +   +EKTI E
Sbjct  302   DASELPEFLGGTCTCEDKGGCMLSDKGPWNDPEIMKMVHSGMHKCTKKTSIPVDEKTISE  361

Query  996   DGGVN-vsvsmsaksvkkpaSFKIE----STKKLFPIQEE----TRQP-----DMYVPMV  859
             DG         S     + AS KI+    S  +L  + EE     + P     D Y+P+V
Sbjct  362   DGNAKPKDAKKSNSINMRTASSKIQRDHVSPTQLSTVHEEDGINKKHPSAYDRDKYIPVV  421

Query  858   DKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVR  679
             DK +D         DN  + + K +D   + +  K  +  SN L TGVMTFVMG+VTMVR
Sbjct  422   DKVIDPTIPKATKADN--YAIAKASDFLPMHDISKSPDGFSNHLFTGVMTFVMGVVTMVR  479

Query  678   MTKNMPRKLTESTLYSNSMHLND-HAMKGHGA-YKPPEPAVTAAEFMAMMKRMASLEEKF  505
             MT+NMPRKLT+STL S S+   D H    HG  Y+   PA++  E+ +MMKRM  LEEK 
Sbjct  480   MTRNMPRKLTDSTLLSGSLKGVDMHVKPVHGQEYRLSGPAISNNEYFSMMKRMGELEEKV  539

Query  504   ITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkK  325
             I+LSN+P ++PPEKEEML+N MS +D LEQEL   K ALE + S Q EL+AYIEKKKKKK
Sbjct  540   ISLSNKPSSLPPEKEEMLNNVMSHVDKLEQELCATKMALETALSRQEELLAYIEKKKKKK  599

Query  324   NIFGF  310
             N FGF
Sbjct  600   NFFGF  604



>ref|XP_010313144.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Solanum lycopersicum]
Length=581

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/582 (66%), Positives = 449/582 (77%), Gaps = 16/582 (3%)
 Frame = -2

Query  2013  EKMDLD-ADDRQTRLGSLRKAAINAsnk--frhsfksrrrssRVMSVVLDDEHDAEEVKS  1843
             EK+D++  +D++ RLGS +K A+NASNK         RR SSRVMSVV +DEHDAEE K 
Sbjct  2     EKIDVENTEDKKPRLGSFKKKALNASNKFRQSLKKTGRRSSSRVMSVVFEDEHDAEEAKL  61

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALILDELLP +HDDYHMMLRFLKARKFE+DKSKQMW+DM+ WRKEFGADTI+ D
Sbjct  62    VDAFRQALILDELLPAQHDDYHMMLRFLKARKFELDKSKQMWSDMINWRKEFGADTIMQD  121

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVTTMDRYLKYHVQEFERT
Sbjct  122   FEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVTTMDRYLKYHVQEFERT  181

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
              N+K+ +CSIAAKKHID STTILDVQGVGLKNF K AREL+Q LQ IDG+NYPE+LCRMY
Sbjct  182   FNEKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARELLQCLQGIDGNNYPESLCRMY  241

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADK  1123
             IINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+FLGGTCTC DK
Sbjct  242   IINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPEFLGGTCTCEDK  301

Query  1122  GGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVN-vsvsmsaksvkk  946
             GGCM SDKGPWNDPEIMKMVH G HKC+ R +   +EKTI EDG         S     +
Sbjct  302   GGCMLSDKGPWNDPEIMKMVHSGMHKCTKRTSIPVDEKTISEDGNAKPKDAKKSNSINLR  361

Query  945   paSFKIE----STKKLFPIQEE----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPK  790
              AS KI+    S  +L  + EE     +QP  Y P+VDK ++         DN  + + K
Sbjct  362   TASSKIQRDHVSPTQLSTVHEEDDIIKKQPSAYTPVVDKVIEPTIPKATKADN--YAIAK  419

Query  789   GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND  610
              +D   + +  K  +  SN L TGVMTFVMG+VTMVRMT+NMPRKLT+STL S S+   D
Sbjct  420   ASDFLPMHDISKSPDGFSNHLFTGVMTFVMGVVTMVRMTRNMPRKLTDSTLLSGSLKGVD  479

Query  609   HAMKG-HGA-YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMS  436
               +K  HG  Y+   PA++  E+ +MMKRM  LEEK I+LSN P ++PPEKEEML+N MS
Sbjct  480   MQVKPVHGQEYRLSGPAISNNEYFSMMKRMGELEEKVISLSNTPSSLPPEKEEMLNNVMS  539

Query  435   RIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              +D LEQEL   K ALE + S Q EL+AYIEKKKKKKN FGF
Sbjct  540   HVDKLEQELCATKMALETALSRQEELLAYIEKKKKKKNFFGF  581



>ref|XP_009595101.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595102.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Nicotiana tomentosiformis]
Length=601

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/602 (65%), Positives = 463/602 (77%), Gaps = 20/602 (3%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             +G MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRV
Sbjct  2     SGKMSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKFE++K+KQMW+D
Sbjct  62    MSVVFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFELEKAKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVT
Sbjct  122   MLNWRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +
Sbjct  182   TMDRYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIIDA
Sbjct  242   QGIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPED  994
             SELP+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI ED
Sbjct  302   SELPEFLGGTCTCAEKGGCMVSDKGPWNDPEIMKMVHSGMHKCSKKSASPAVDEKTISED  361

Query  993   G-GVNvsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVD  856
             G  +      S     + AS K++    S  +L  + EE             D  +P+VD
Sbjct  362   GNAIPKEAKKSNSIKMRTASSKVQRDHVSHMQLSTVHEEVEVKKNLPSAYDSDKCIPVVD  421

Query  855   KTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRM  676
             K +D         DN  + + K +D   + +  K  E  SN L TGVMTFVMG+VTMVRM
Sbjct  422   KVIDSTMPKATKADN--YAIAKASDFLPMHDISKSPEGFSNHLFTGVMTFVMGVVTMVRM  479

Query  675   TKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITL  496
             T+NMPRKLT+STL S S+   D        Y+   PA++  E+ +MMKRM  LEEK ITL
Sbjct  480   TRNMPRKLTDSTLLSGSLKGVDMVKPQAQEYRLNGPAISNNEYFSMMKRMGELEEKVITL  539

Query  495   SNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIF  316
             SN+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN F
Sbjct  540   SNKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFF  599

Query  315   GF  310
             GF
Sbjct  600   GF  601



>ref|XP_009786697.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009786698.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Nicotiana sylvestris]
Length=597

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/601 (64%), Positives = 463/601 (77%), Gaps = 24/601 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRVMSV
Sbjct  1     MSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+++K+KQMW+DML 
Sbjct  61    VFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDLEKTKQMWSDMLN  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVTTMD
Sbjct  121   WRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +Q +
Sbjct  181   RYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCIQGV  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIID SEL
Sbjct  241   DGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDGSEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPEDGGV  985
             P+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI EDG  
Sbjct  301   PEFLGGTCTCAEKGGCMLSDKGPWNDPEIMKMVHSGMHKCSKKSASPTVDEKTISEDGNA  360

Query  984   N-vsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVDKTV  847
             N      S     + AS K++    S  +L  + EE             D Y+P+VDK +
Sbjct  361   NPKEAKKSNSIKMRTASSKVQREHASHMQLSTVHEEVEVKKNLPSAYDSDKYIPVVDKVI  420

Query  846   D--LPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
             D  +PN    +N    + + K +D   + +  K  E  SN L TGVMTFVMG+VTMVRMT
Sbjct  421   DSTMPNATKADN----YAIAKASDFLPMHDISKSPEGFSNHLFTGVMTFVMGVVTMVRMT  476

Query  672   KNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
             +NMPRKLT+STL S S+   D        Y+    A++  E+ +MMKRM  LEEK ITLS
Sbjct  477   RNMPRKLTDSTLLSGSLKAVDMVKPQAQEYRLNGSAISNNEYFSMMKRMGELEEKVITLS  536

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFG  313
             N+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN FG
Sbjct  537   NKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFFG  596

Query  312   F  310
             F
Sbjct  597   F  597



>ref|XP_009595104.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009595105.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X3 [Nicotiana tomentosiformis]
Length=597

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/599 (65%), Positives = 461/599 (77%), Gaps = 20/599 (3%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRVMSV
Sbjct  1     MSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKFE++K+KQMW+DML 
Sbjct  61    VFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFELEKAKQMWSDMLN  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVTTMD
Sbjct  121   WRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +Q I
Sbjct  181   RYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCIQGI  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL
Sbjct  241   DGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPEDG-G  988
             P+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI EDG  
Sbjct  301   PEFLGGTCTCAEKGGCMVSDKGPWNDPEIMKMVHSGMHKCSKKSASPAVDEKTISEDGNA  360

Query  987   VNvsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVDKTV  847
             +      S     + AS K++    S  +L  + EE             D  +P+VDK +
Sbjct  361   IPKEAKKSNSIKMRTASSKVQRDHVSHMQLSTVHEEVEVKKNLPSAYDSDKCIPVVDKVI  420

Query  846   DLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKN  667
             D         DN  + + K +D   + +  K  E  SN L TGVMTFVMG+VTMVRMT+N
Sbjct  421   DSTMPKATKADN--YAIAKASDFLPMHDISKSPEGFSNHLFTGVMTFVMGVVTMVRMTRN  478

Query  666   MPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQ  487
             MPRKLT+STL S S+   D        Y+   PA++  E+ +MMKRM  LEEK ITLSN+
Sbjct  479   MPRKLTDSTLLSGSLKGVDMVKPQAQEYRLNGPAISNNEYFSMMKRMGELEEKVITLSNK  538

Query  486   PPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN FGF
Sbjct  539   PSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFFGF  597



>ref|XP_009595103.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Nicotiana tomentosiformis]
Length=599

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/602 (65%), Positives = 462/602 (77%), Gaps = 22/602 (4%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             +G MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRV
Sbjct  2     SGKMSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKFE++K+KQMW+D
Sbjct  62    MSVVFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFELEKAKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVT
Sbjct  122   MLNWRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +
Sbjct  182   TMDRYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIIDA
Sbjct  242   QGIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPED  994
             SELP+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI ED
Sbjct  302   SELPEFLGGTCTCAEKGGCMVSDKGPWNDPEIMKMVHSGMHKCSKKSASPAVDEKTISED  361

Query  993   G-GVNvsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVD  856
             G  +      S     + AS K++    S  +L  + EE             D  +P+VD
Sbjct  362   GNAIPKEAKKSNSIKMRTASSKVQRDHVSHMQLSTVHEEVEVKKNLPSAYDSDKCIPVVD  421

Query  855   KTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRM  676
             K +D         DN  + + K  D   + +  K  E  SN L TGVMTFVMG+VTMVRM
Sbjct  422   KVIDSTMPKATKADN--YAIAK--DFLPMHDISKSPEGFSNHLFTGVMTFVMGVVTMVRM  477

Query  675   TKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITL  496
             T+NMPRKLT+STL S S+   D        Y+   PA++  E+ +MMKRM  LEEK ITL
Sbjct  478   TRNMPRKLTDSTLLSGSLKGVDMVKPQAQEYRLNGPAISNNEYFSMMKRMGELEEKVITL  537

Query  495   SNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIF  316
             SN+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN F
Sbjct  538   SNKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFF  597

Query  315   GF  310
             GF
Sbjct  598   GF  599



>gb|EYU37816.1| hypothetical protein MIMGU_mgv1a003774mg [Erythranthe guttata]
Length=564

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/587 (65%), Positives = 458/587 (78%), Gaps = 29/587 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV  1882
             MS +VERP RPS EK+D++   D+R+TRLGSL++ AINASNKFR+S   R RR+SRVMSV
Sbjct  1     MSESVERPSRPSMEKIDMENSEDERKTRLGSLKQKAINASNKFRNSLNKRGRRNSRVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE+++VD+FRQ LIL+ELLP+KHDDYHM+LRFLKARKF+I+K+KQMW DMLQ
Sbjct  61    VFEDEHDAEELQAVDSFRQVLILEELLPSKHDDYHMLLRFLKARKFDIEKTKQMWGDMLQ  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRK+FG+DTI++DF+FKER+EVLKYYPQGHHGVDK+GRP+YIERLGLVD TKLMQVTT+D
Sbjct  121   WRKDFGSDTIMEDFEFKEREEVLKYYPQGHHGVDKEGRPVYIERLGLVDPTKLMQVTTLD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY+ YHVQEFERT  DK  +CSIAAKKHIDQSTTILDVQGVGLKNF K ARELIQ LQK+
Sbjct  181   RYINYHVQEFERTFIDKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARELIQRLQKV  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETL +MYIINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASEL
Sbjct  241   DGDNYPETLFQMYIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE-EEKTIPEDGGV  985
             P+FLGGTCTC +KGGCM SDKGPWND EIMKMV  G HKCS++M     +EKTI ED   
Sbjct  301   PEFLGGTCTCEEKGGCMLSDKGPWNDTEIMKMVRNGEHKCSNKMVISSVDEKTISEDET-  359

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCK  805
                                 +  K+        + + YV MVDKTV          DN  
Sbjct  360   --------------------TVTKVTRNSATAFESEQYVCMVDKTVAAKWKKAAQCDN--  397

Query  804   FVVPKGADLYQIQE-AYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
             + + +  D + +   A K  +  SN L TGV+TFVMG++TMVRMT+NMP+KLT++TLYS+
Sbjct  398   YALSRATDFFPVHNTACKNSDGLSNHLFTGVLTFVMGVMTMVRMTRNMPKKLTDATLYSS  457

Query  627   SMHLNDHAMKGH-GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             SM   D  +K    AY  PE A++ A+++ MMKRM  +EEK   L  +P TMPPEKEEML
Sbjct  458   SMRGVDEMIKPRPHAYDLPEAAISRADYLIMMKRMNEMEEKMSILCQKPVTMPPEKEEML  517

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             ++A++R+DALEQEL+ A+KALE++ S Q EL+AYIEKKKKKK  F F
Sbjct  518   NSALNRVDALEQELSSARKALEQALSQQEELLAYIEKKKKKKKFFAF  564



>ref|XP_009786699.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Nicotiana sylvestris]
Length=595

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/601 (64%), Positives = 462/601 (77%), Gaps = 26/601 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRVMSV
Sbjct  1     MSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+++K+KQMW+DML 
Sbjct  61    VFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDLEKTKQMWSDMLN  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVTTMD
Sbjct  121   WRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +Q +
Sbjct  181   RYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCIQGV  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIID SEL
Sbjct  241   DGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDGSEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPEDGGV  985
             P+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI EDG  
Sbjct  301   PEFLGGTCTCAEKGGCMLSDKGPWNDPEIMKMVHSGMHKCSKKSASPTVDEKTISEDGNA  360

Query  984   N-vsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVDKTV  847
             N      S     + AS K++    S  +L  + EE             D Y+P+VDK +
Sbjct  361   NPKEAKKSNSIKMRTASSKVQREHASHMQLSTVHEEVEVKKNLPSAYDSDKYIPVVDKVI  420

Query  846   D--LPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
             D  +PN    +N    + + K  D   + +  K  E  SN L TGVMTFVMG+VTMVRMT
Sbjct  421   DSTMPNATKADN----YAIAK--DFLPMHDISKSPEGFSNHLFTGVMTFVMGVVTMVRMT  474

Query  672   KNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
             +NMPRKLT+STL S S+   D        Y+    A++  E+ +MMKRM  LEEK ITLS
Sbjct  475   RNMPRKLTDSTLLSGSLKAVDMVKPQAQEYRLNGSAISNNEYFSMMKRMGELEEKVITLS  534

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFG  313
             N+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN FG
Sbjct  535   NKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFFG  594

Query  312   F  310
             F
Sbjct  595   F  595



>ref|XP_009600124.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Nicotiana tomentosiformis]
Length=580

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/597 (64%), Positives = 462/597 (77%), Gaps = 31/597 (5%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMS  1885
             + N SG +ERP RPS EK+D+D D+R+TRLGS++KAAINAS K      K  RR SRVMS
Sbjct  2     SDNKSGPLERPHRPSLEKIDMDEDERKTRLGSIKKAAINASAKFRNSLTKRGRRHSRVMS  61

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V  +DEHDAEE+K+VDAFRQALILDELLP KHDDYH+MLRFLKARKF+I+K+KQMW+DML
Sbjct  62    VGFEDEHDAEELKAVDAFRQALILDELLPAKHDDYHLMLRFLKARKFDIEKTKQMWSDML  121

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
             QWR+EFGADTI++DFDFKE+++VLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+Q TTM
Sbjct  122   QWRREFGADTIMEDFDFKEKEQVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQATTM  181

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             +RYLKYHVQEFERT N+KM +CS+AAK+HID STTILDVQGVGLKNF K AR+LIQ LQ 
Sbjct  182   ERYLKYHVQEFERTINEKMPACSLAAKRHIDTSTTILDVQGVGLKNFNKSARDLIQRLQA  241

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTT KI+VLGNKYQSKLLE+IDASE
Sbjct  242   IDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTQKIHVLGNKYQSKLLEVIDASE  301

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHK-CSHRMARVEEEKTIPEDGG  988
             LP+FLGGTCTCADKGGCM SDKGPWNDPEIMKMV  G HK CSH++    +EKTIPED  
Sbjct  302   LPEFLGGTCTCADKGGCMLSDKGPWNDPEIMKMVRNGEHKCCSHKIVVSFDEKTIPEDDN  361

Query  987   VNvsvsmsaksvkkpaSFKIESTK-----------KLFPIQEETRQPDMYVPMVDKTVDL  841
              N       K+VKK  SFK  +             +L P++EE       +P+VDK VD 
Sbjct  362   AN------TKNVKKNTSFKKGTDSPNVQRDNMAYGQLSPVREE-----FDIPIVDKAVD-  409

Query  840   PNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMP  661
               WH V   N  F   K  D + + +  K  E  SN + +GVMT VMGIVT+VRMTKNMP
Sbjct  410   ATWHKVVKAN-NFANSK--DFFPVHDNCKSPEGFSNPVFSGVMTLVMGIVTLVRMTKNMP  466

Query  660   RKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             RKLT++TL + S+  +   +KG          ++  ++++MMKRM  LE+K ITLS++P 
Sbjct  467   RKLTDATLLAGSL-CSAEIIKGQPQLNG--HVISTKDYISMMKRMEDLEDKVITLSHKPS  523

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             ++PPEKEEML+NAM+R+D LEQEL+  KKALEE+   Q ELI+ +EKKKKKK  F F
Sbjct  524   SLPPEKEEMLNNAMNRVDTLEQELSATKKALEEALVRQQELISALEKKKKKKKFFVF  580



>ref|XP_009765680.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Nicotiana sylvestris]
Length=581

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/582 (65%), Positives = 456/582 (78%), Gaps = 31/582 (5%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLD  1873
             SG +ERP RPS EK+D+D D+R+TRLGS++KAAINAS KFR+S   R RR SRVMSV  +
Sbjct  6     SGPIERPHRPSLEKIDMDEDERKTRLGSIKKAAINASAKFRNSLTKRGRRHSRVMSVGFE  65

Query  1872  DEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRK  1693
             DEHDAEE+K+VDAFRQALILDELLP KHDDYH+MLRFLKARKF+I+K+KQMWADMLQWR+
Sbjct  66    DEHDAEELKAVDAFRQALILDELLPAKHDDYHLMLRFLKARKFDIEKTKQMWADMLQWRR  125

Query  1692  EFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYL  1513
             EFGADTI++DFDFKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+Q TTMDRYL
Sbjct  126   EFGADTIMEDFDFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQATTMDRYL  185

Query  1512  KYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGD  1333
             KYHVQEFERT N+KM +CS+AAK+HID STTILDVQGVGLKNF K AR+LIQ LQ IDG+
Sbjct  186   KYHVQEFERTINEKMPACSLAAKRHIDTSTTILDVQGVGLKNFNKSARDLIQRLQAIDGN  245

Query  1332  NYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDF  1153
             NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTT KI+VLGNKYQSKLLE+IDASELP+F
Sbjct  246   NYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTQKIHVLGNKYQSKLLEVIDASELPEF  305

Query  1152  LGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHK-CSHRMARVEEEKTIPEDGGVNvs  976
             LGGTCTCADKGGCM SDKGPWNDPEIMKMV  G HK CSH+M    +EKTIPED   N  
Sbjct  306   LGGTCTCADKGGCMLSDKGPWNDPEIMKMVRNGEHKCCSHKMVVSFDEKTIPEDDNAN--  363

Query  975   vsmsaksvkkpaSFKIESTK-----------KLFPIQEETRQPDMYVPMVDKTVDLPNWH  829
                 AK+VKK  SFK  +             +L P++EE       +P+VDK VD   WH
Sbjct  364   ----AKNVKKNTSFKKGTDSPNVQRDNVAYGQLSPVREE-----FDIPIVDKAVD-ATWH  413

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
                  N  F   K  D + + +  K  E  SN + +GVMT VMGIVT+VRMTKNMPRKLT
Sbjct  414   KAVKAN-NFANSK--DFFPVHDTCKSPEGFSNPVFSGVMTLVMGIVTLVRMTKNMPRKLT  470

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             ++TL + S+  +   +KG          ++  ++++MMKRM  LE+K ITLS++P ++PP
Sbjct  471   DATLLAGSL-CSAEIIKGQPQLNG--HVISTKDYISMMKRMEELEDKVITLSHKPSSLPP  527

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EKEEML++A++R++ LEQEL+  KKALEE+   Q EL++ +E
Sbjct  528   EKEEMLNSAINRVETLEQELSATKKALEEALVRQQELLSALE  569



>ref|XP_006365289.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Solanum tuberosum]
Length=557

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/597 (64%), Positives = 461/597 (77%), Gaps = 55/597 (9%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             +GNMSG +++P RPS EK+D++    +R+TRLGSL+K A+NAS KFRHSF  + RR+SRV
Sbjct  2     SGNMSGPLDQPFRPSLEKIDMENHEHERKTRLGSLKKKAVNASTKFRHSFTKKGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSV+++DEHDAEE+K+VDAFRQALILDELLP KHDDYH +LRFLKARKF+IDKSKQMWAD
Sbjct  62    MSVIVEDEHDAEEIKAVDAFRQALILDELLPGKHDDYHKLLRFLKARKFDIDKSKQMWAD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M++WR EFGADTI++DF+FKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+QVT
Sbjct  122   MIKWRSEFGADTIVEDFEFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDKM +CSIA+K+HID STTILDVQGVGLKNF K ARELIQ L
Sbjct  182   TMDRYLKYHVQEFERTLNDKMPACSIASKRHIDTSTTILDVQGVGLKNFNKSARELIQCL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKI+VLGNKYQSKLLE+IDA
Sbjct  242   QSIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKIHVLGNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPED  994
             SELP+FLGGTCTCADKGGCM SDKGPWNDPEIMKMVH G HKCS+R      +EKTI ED
Sbjct  302   SELPEFLGGTCTCADKGGCMLSDKGPWNDPEIMKMVHNGEHKCSNRNFISTIDEKTISED  361

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEET---------RQPDMYVPMVDKTVDL  841
               V V                  +  +L P+ EE            P+ Y+P+VDK VD+
Sbjct  362   ANVYV------------------AHTQLSPLHEEVDMNKNYHRAYDPEDYMPIVDKAVDV  403

Query  840   PNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMP  661
               W   N          G D + I +A K  E  SN L TGVMT VMGIVT+V+MT+NMP
Sbjct  404   -TWSKAN----------GRDFFPIHDASKSPEGFSNHLFTGVMTLVMGIVTLVKMTRNMP  452

Query  660   RKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             RKL ++TL            + HG Y+  E  ++++E+ +M+KRM  LEEK ITL+N+P 
Sbjct  453   RKLADATL------------QAHG-YQLSELTISSSEYFSMIKRMEELEEKVITLTNKPA  499

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             ++PPEKEE+L+NAM RID LEQ+L+   K+LE + ++Q EL+AYIEKK++KK   G 
Sbjct  500   SLPPEKEELLNNAMKRIDTLEQDLSATHKSLELALAHQAELLAYIEKKRRKKKFLGI  556



>ref|XP_009781458.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X1 [Nicotiana sylvestris]
Length=564

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/589 (65%), Positives = 459/589 (78%), Gaps = 32/589 (5%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             +GNMSG ++RP RPS EK+DL+    +R+TRLGSL+K A+NAS+KFRHSF  + RR+SRV
Sbjct  2     SGNMSGPLDRPFRPSLEKIDLENPEHERKTRLGSLKKKAVNASSKFRHSFTKKGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE+K+VDAFRQALIL+ELLP KHDDYH MLRFLKARKF+I+KSKQMWAD
Sbjct  62    MSVVFEDEHDAEEIKAVDAFRQALILEELLPAKHDDYHKMLRFLKARKFDIEKSKQMWAD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WR EFGADTII+DF+FKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+QVT
Sbjct  122   MLKWRSEFGADTIIEDFEFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDKM +CSIAAKKHID STTILDVQGVGLK+F K ARELIQ L
Sbjct  182   TMDRYLKYHVQEFERTLNDKMPACSIAAKKHIDTSTTILDVQGVGLKSFNKSARELIQCL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKI+VLGNKYQSKLLE+IDA
Sbjct  242   QTIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKIHVLGNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPED  994
             SELP+FLGGTCTCADKGGCM SDKGPWND +IMKMV  G HKCS+R+     EEKTI ED
Sbjct  302   SELPEFLGGTCTCADKGGCMLSDKGPWNDQDIMKMVRNGEHKCSNRIFIPTVEEKTISED  361

Query  993   GGVNvsvsmsaksvkkpaSFKIE-STKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNN  817
                N +V  +  +  + +    E    K +P      +P+ ++P+VDK VD+  W     
Sbjct  362   ANANPNVQRNYVAHTQVSPVHEEVGMNKNYP---SAYEPEDFMPIVDKAVDV-TW-----  412

Query  816   DNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTL  637
                     K  D + I +A K  +  SNQL TGV+T VMGIVT+V+MT+NMPRKL ++TL
Sbjct  413   -----TKAKRGDFFPIHDASKSPQGFSNQLFTGVLTLVMGIVTLVKMTRNMPRKLADATL  467

Query  636   YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
              ++   LN             EP ++A E+ +MMKRM  LEEK ITLSN+P  +PPEKEE
Sbjct  468   QAHGYQLN-------------EPTISANEYFSMMKRMEELEEKVITLSNKPNALPPEKEE  514

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +L+NAM RID LEQ+L    KALE++   Q EL+AY+EKK+KKK   G 
Sbjct  515   LLNNAMKRIDTLEQDLCATHKALEQALVRQAELLAYVEKKRKKKKFLGL  563



>ref|XP_010327557.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Solanum lycopersicum]
Length=554

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/588 (63%), Positives = 455/588 (77%), Gaps = 40/588 (7%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             +GNMSG +++P R S EK+D++    +R+TRLGSL+K A+NAS KFRHSF  + RR+SRV
Sbjct  2     SGNMSGPLDQPFRSSLEKIDMENHEHERKTRLGSLKKKAVNASTKFRHSFTKKGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSV+ +DEHDAEE+K+VDAFRQALILDELLP KHDDYH +LRFLKARKF+IDKSKQMW+D
Sbjct  62    MSVIFEDEHDAEEIKAVDAFRQALILDELLPGKHDDYHKLLRFLKARKFDIDKSKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M++WR EFGADTI++DF+FKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+QVT
Sbjct  122   MIKWRSEFGADTIMEDFEFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDKM +CSIA+K+HID STTILDVQGVGLKNF K ARELIQ L
Sbjct  182   TMDRYLKYHVQEFERTLNDKMPACSIASKRHIDTSTTILDVQGVGLKNFNKSARELIQCL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKI+VL NKYQSKLLE+IDA
Sbjct  242   QNIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKIHVLSNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPED  994
             SELP+FLGGTCTCADKGGCM SDKGPWNDPEIMKMVH G HKCS+R      +EKTI ED
Sbjct  302   SELPEFLGGTCTCADKGGCMLSDKGPWNDPEIMKMVHNGEHKCSNRNFISTIDEKTISED  361

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNND  814
               +   ++ +                           P+ Y+P+VDK VD+  W   N  
Sbjct  362   ANIYADMNKNY---------------------SRAYDPEDYMPIVDKAVDV-TWKKANGT  399

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
               K++V K  D + I +A K  E   N L TGVMT VMGIVT+VRMT+NMPRKL ++TL 
Sbjct  400   R-KYIVTKCRDFFPIHDASKSPEGFRNHLFTGVMTLVMGIVTLVRMTRNMPRKLADATLQ  458

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
             ++S  L+D             P ++++E+ +M+KRM  LEEK ITL+N+P ++PPEKEE+
Sbjct  459   AHSYQLSD-------------PTISSSEYFSMIKRMEELEEKAITLTNKPASLPPEKEEL  505

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             L+NAM RID LEQEL+   K+LE + + Q EL+ YIEKK++KK   G 
Sbjct  506   LNNAMKRIDTLEQELSATHKSLELALTRQAELLEYIEKKRRKKKFLGI  553



>ref|XP_006365127.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X1 [Solanum tuberosum]
 ref|XP_006365128.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X2 [Solanum tuberosum]
Length=574

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/575 (63%), Positives = 447/575 (78%), Gaps = 24/575 (4%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADD-RQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV-V  1879
             SG +ERP+RPS EK D+DA+D R+TRLGS++KAAINAS KFR+S   R RR+SRVMSV V
Sbjct  6     SGPLERPVRPSLEKFDMDAEDERKTRLGSIKKAAINASTKFRNSLTKRGRRNSRVMSVLV  65

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             L+DEHDAEE+K+VDAFRQALIL+ELLP KHDDYH+MLRFLKARKF+I+K+KQMW+DMLQW
Sbjct  66    LEDEHDAEELKAVDAFRQALILEELLPAKHDDYHLMLRFLKARKFDIEKTKQMWSDMLQW  125

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             R+EFGADTI +DFDFKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+Q TTMDR
Sbjct  126   RREFGADTITEDFDFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQATTMDR  185

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             YLKYHVQEFERT N+KM +CS+AAK+HID STTILDVQGVGLKNF K AR+LIQ LQ ID
Sbjct  186   YLKYHVQEFERTINEKMPACSLAAKRHIDTSTTILDVQGVGLKNFNKSARDLIQRLQAID  245

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             G+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTT KI+VLGNKY SKLLEIIDASELP
Sbjct  246   GNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTQKIHVLGNKYHSKLLEIIDASELP  305

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNv  979
             +FLGGTCTCADKGGCM SDKGPWNDPEIM+MV  G HKCSH++    +EKTIPED   N 
Sbjct  306   EFLGGTCTCADKGGCMVSDKGPWNDPEIMRMVRNGEHKCSHKIVISIDEKTIPEDDNANT  365

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
               S S +     +  + ++  +L P++EE       +P+VDK V       V   N    
Sbjct  366   KKSTSFRKETDSSKVQRDNG-QLSPVREE-----FDIPIVDKAVYATWPKQVKAGN----  415

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
             +    D + + +A K  E   N + +GVMT VMGIVT+VRMTKNMPRKLT++TL + S++
Sbjct  416   LANSKDFFPVHDACKSSEGFGNPVFSGVMTLVMGIVTLVRMTKNMPRKLTDATLLAGSLY  475

Query  618   LND---HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
               D       GH         ++  ++++MMKRM  LE+K ITLS +P +MPPEKE ML+
Sbjct  476   SADMIKEETHGH--------VISTKDYISMMKRMEELEDKVITLSQKPSSMPPEKENMLN  527

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              A++R+  LE+EL   KKAL+E+   Q EL++ +E
Sbjct  528   AAINRVGTLEEELLATKKALDEALVRQQELLSVLE  562



>ref|XP_004230875.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Solanum lycopersicum]
 ref|XP_010315312.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Solanum lycopersicum]
Length=574

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/585 (64%), Positives = 453/585 (77%), Gaps = 21/585 (4%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADD-RQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVV-  1879
             SG +ERP+RPS EK D+DA+D R+TRLGS++KAAINAS KFR+S   R RR+SRVMSVV 
Sbjct  6     SGPLERPVRPSLEKFDMDAEDERKTRLGSIKKAAINASTKFRNSLTKRGRRNSRVMSVVV  65

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             L+DEHDAEE+K+VDA RQALIL+ELLP KHDDYH+MLRFLKARKF+I+K+KQMWADMLQW
Sbjct  66    LEDEHDAEELKAVDALRQALILEELLPAKHDDYHLMLRFLKARKFDIEKTKQMWADMLQW  125

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             R+EFGADTI +DFDFKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+Q TTMDR
Sbjct  126   RREFGADTITEDFDFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQATTMDR  185

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             YLKYHVQEFERT NDKM +CS+AAK+HID STTILDVQGVGLKNF K AR+LIQ LQ ID
Sbjct  186   YLKYHVQEFERTINDKMPACSLAAKRHIDTSTTILDVQGVGLKNFNKSARDLIQRLQAID  245

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             G+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTT KI+VLGNKY SKLLEIIDASELP
Sbjct  246   GNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTQKIHVLGNKYHSKLLEIIDASELP  305

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNv  979
             +FLGGTCTCADKGGCM SDKGPWNDPEIM+MV  G HKCSH+     +EKTIPED   N 
Sbjct  306   EFLGGTCTCADKGGCMVSDKGPWNDPEIMRMVRNGEHKCSHKFVISMDEKTIPEDDNANT  365

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
               S S +     +  + ++  +L P++EE       +P+VDK V    W           
Sbjct  366   KKSTSFRKETDSSKVQRDNG-QLSPVREE-----FDIPIVDKAV-YATWPKQVKAGP---  415

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
             +    D + + +A K  E   N + +GVMT VMGIVT+VRMTKNMPRKLT++TL + S++
Sbjct  416   LANSKDFFPVHDACKSSEGFGNPVFSGVMTLVMGIVTLVRMTKNMPRKLTDATLLAGSLY  475

Query  618   LND--HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSN  445
               D     + HG        ++  ++++MMKRM  LE+K ITLS +P +MPPEKE ML+ 
Sbjct  476   SADMIKEQQTHGH------VISTKDYISMMKRMEELEDKVITLSQKPSSMPPEKENMLNA  529

Query  444   AMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             A++R+  LE+EL   KKAL+E+   Q EL++ +EKKKKKK  F F
Sbjct  530   AINRVGTLEEELLATKKALDEALVRQQELLSVLEKKKKKKKFFVF  574



>ref|XP_009589910.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Nicotiana tomentosiformis]
 ref|XP_009589911.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Nicotiana tomentosiformis]
Length=565

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/597 (64%), Positives = 458/597 (77%), Gaps = 47/597 (8%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             +GNMSG ++RP RPS EK+DL+    +R+TRLGSL+K A+NAS+KFRHSF  + RR+SRV
Sbjct  2     SGNMSGPLDRPFRPSLEKIDLENPEHERKTRLGSLKKKAVNASSKFRHSFTKKGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE+K+VDAFRQ LIL+ELLP KHDDYH MLRFLKARKF+I+KSKQMWAD
Sbjct  62    MSVVFEDEHDAEEIKAVDAFRQVLILEELLPAKHDDYHKMLRFLKARKFDIEKSKQMWAD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WR EFGADTI++DF+FKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+QVT
Sbjct  122   MLKWRSEFGADTIMEDFEFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSIKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFER+ NDKM +C+IAAKKHID STTILDVQGVGLK F K ARELIQ L
Sbjct  182   TMDRYLKYHVQEFERSLNDKMPACAIAAKKHIDTSTTILDVQGVGLKRFNKSARELIQCL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKI+VLGNKYQSKLLE+IDA
Sbjct  242   QTIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKIHVLGNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPED  994
             SELP+FLGGTCTCADKGGCM SDKGPWNDP+IMKMV  G HKCS+R+     +EKTI ED
Sbjct  302   SELPEFLGGTCTCADKGGCMHSDKGPWNDPDIMKMVRNGEHKCSNRIFIPSVDEKTISED  361

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEET---------RQPDMYVPMVDKTVDL  841
                N +V                +   L P+ EE           +P+ ++P+VDK VD+
Sbjct  362   ANANPNVQRDYV-----------AHTHLSPVHEEVGMNKNHTSAYEPEDFMPIVDKAVDV  410

Query  840   PNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMP  661
               W             KG DL+ I +A K  +  SNQL TGVMT VMGIVT+V+MT+NMP
Sbjct  411   -TW----------TKAKGGDLFPIHDASKSAQGFSNQLFTGVMTLVMGIVTLVKMTRNMP  459

Query  660   RKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             RKL ++T+           ++ HG Y+  EP ++A ++ +M+KRM  LEEK I LSN+P 
Sbjct  460   RKLADATM-----------LQAHG-YELNEPTISANDYFSMIKRMEELEEKVIILSNKPN  507

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              +PPEKEE+L+NAM RID LEQ L    KALE++   Q EL+AY+EKK+KKK   G 
Sbjct  508   ALPPEKEELLNNAMKRIDTLEQHLCATHKALEQALVRQAELLAYVEKKRKKKKFLGI  564



>ref|XP_011092810.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Sesamum indicum]
 ref|XP_011092811.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Sesamum indicum]
 ref|XP_011092812.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Sesamum indicum]
 ref|XP_011092813.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Sesamum indicum]
Length=567

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/593 (63%), Positives = 449/593 (76%), Gaps = 36/593 (6%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMS  1885
             + N S ++ERP RPS E +D+  D+R+TRLGSL+K AI+AS+KFRHS   + RR+SRVMS
Sbjct  2     SDNRSASLERPYRPSLENIDISEDERKTRLGSLKKVAISASSKFRHSLTKKGRRNSRVMS  61

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             VV +DEHDAEE+++VDA RQ LIL+ELLP KHDDYHM+LRFL+ARKF+I+K+KQMWADM+
Sbjct  62    VVFEDEHDAEEIQAVDALRQVLILEELLPAKHDDYHMLLRFLRARKFDIEKTKQMWADMI  121

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRK+FG+DTI++DF+FKE++EVLKYYPQGHHGVDKDGRP+YIE+LG VD TKL+QVTTM
Sbjct  122   HWRKDFGSDTIMEDFEFKEKEEVLKYYPQGHHGVDKDGRPVYIEKLGQVDPTKLLQVTTM  181

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+KYHVQEFERT  DK  +CSI+AKKHIDQSTTILDVQGVGLKNF K AR+LIQ LQK
Sbjct  182   DRYVKYHVQEFERTFIDKFPACSISAKKHIDQSTTILDVQGVGLKNFNKAARDLIQRLQK  241

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASE
Sbjct  242   IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASE  301

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGG  988
             LP+FLGGTCTCADKGGCM SDKGPWNDPEIMKMV  G HKCS+++     +EK   +   
Sbjct  302   LPEFLGGTCTCADKGGCMLSDKGPWNDPEIMKMVRNGEHKCSNKIVISTSDEKADSQ---  358

Query  987   VNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ-------PDMYVPMVDKTVDLPNWH  829
                                  +  +L  ++EE          P  Y P VDK V      
Sbjct  359   -------------------TVARSQLTSVREEANNNCPSPDAPAKYQPTVDKAVTASWPK  399

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
                 DN  + V K  D Y    A K  +  SN L TGVMTFVMG+VTM+RMT+NMP+KLT
Sbjct  400   AAKGDN--YAVSKATDYYPRHNACKTSDGLSNHLFTGVMTFVMGVVTMIRMTRNMPKKLT  457

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             ++TLYS+SM+ +D   + HG      P +++ ++  MMKR+  LEEK   L N+P +MPP
Sbjct  458   DATLYSSSMYSDDIKGQSHGYNM---PTISSEDYFIMMKRVNELEEKVSVLVNKPASMPP  514

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             EKEEML+ A+ R+D LEQEL + KK+LE++   Q EL+AY+EKKKKKK  F F
Sbjct  515   EKEEMLNTALKRVDTLEQELLKTKKSLEDALVRQEELLAYVEKKKKKKKFFAF  567



>gb|KDO47897.1| hypothetical protein CISIN_1g008520mg [Citrus sinensis]
Length=563

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/579 (62%), Positives = 432/579 (75%), Gaps = 40/579 (7%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             M+  ++R  +   EK D +   D+R+TRLGSL+K AINAS K      K  RR+S+VMSV
Sbjct  1     MAAPLDRHNKAGLEKSDHENSEDERKTRLGSLKKKAINASTKFRHSLTKRGRRNSKVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
              ++D  +AEE+++VDAFRQAL+LDELLP KHDD+HMMLRFLKARKF+I+K+KQMW DMLQ
Sbjct  61    SIEDCLNAEEMQAVDAFRQALVLDELLPAKHDDHHMMLRFLKARKFDIEKTKQMWGDMLQ  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE DEVLKYYPQGHHGVDKDG+P+YIE LG VD+ KLMQVTTMD
Sbjct  121   WRKEFGADTIMEDFEFKEIDEVLKYYPQGHHGVDKDGQPVYIEWLGQVDSNKLMQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+Q +QKI
Sbjct  181   RYLKYHVKEFERTFISKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVQRIQKI  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETL RM+I+NAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+EL
Sbjct  241   DGDNYPETLNRMFIVNAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVN  982
             PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV  G  KC  R     EEKTI ED    
Sbjct  301   PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVQNGYAKCLRRTLSGIEEKTISED----  356

Query  981   vsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVD------LPNWHVVN  820
                        + +  K  ++KKL    E  +     +P+VDKTVD      +PN    N
Sbjct  357   -----------ENSLSKSFASKKLNNAYEFGKS----IPVVDKTVDESWLKSMPNKKFAN  401

Query  819   NDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
             + +C          +  Q   K  E  SN +  GV+ FVMGIVTMVRMT NMPR++TE+ 
Sbjct  402   SKDC----------FTAQHPCKSPEGISNHIFGGVLAFVMGIVTMVRMTTNMPRRITEAA  451

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             LY + ++  D  MKGH  +K   P+++ A++MAM KRMA LE+K   L+ +P TMPPEKE
Sbjct  452   LYGSQVYYTDSMMKGH--HKLTAPSISGADYMAMAKRMAELEDKVKMLTMKPSTMPPEKE  509

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EML+ A++R+  LEQEL+  KKALE S + Q EL+AYIE
Sbjct  510   EMLNAAVNRVSTLEQELSATKKALENSLARQEELVAYIE  548



>ref|XP_011088434.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Sesamum indicum]
 ref|XP_011088435.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Sesamum indicum]
 ref|XP_011088436.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Sesamum indicum]
 ref|XP_011088438.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Sesamum indicum]
Length=589

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/603 (64%), Positives = 468/603 (78%), Gaps = 36/603 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             MS  VER   PS EK+D++   D+R+TRLGSL+K AI+ASNK      +  RR+SRVMS+
Sbjct  1     MSEPVERSAMPSMEKIDVENSEDERKTRLGSLKKVAISASNKFRNSLTRKSRRNSRVMSI  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             VL+DEHDAEE++SVDAFRQALIL+ELLP KHDDYHM+LRFLKARKF+I+K+KQMWADMLQ
Sbjct  61    VLEDEHDAEELQSVDAFRQALILEELLPAKHDDYHMLLRFLKARKFDIEKTKQMWADMLQ  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRK++G+DTI++DF+FKE++EV+KYYP GHHGVDK+GRPIYIERLG+VD TKL+QVTTM+
Sbjct  121   WRKDYGSDTIMEDFEFKEKEEVVKYYPHGHHGVDKEGRPIYIERLGMVDPTKLLQVTTME  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHV+EFERT  DK  +CSIAAK+HIDQSTTILDVQGVGLKNF K ARELIQ+LQKI
Sbjct  181   RYLKYHVKEFERTFVDKFPACSIAAKRHIDQSTTILDVQGVGLKNFNKAARELIQSLQKI  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETLC+M+IINAGSGFRLLWNTVKSFLDPKTTAKI+VL NKYQSKLLE+ID SEL
Sbjct  241   DGDNYPETLCQMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLSNKYQSKLLEVIDESEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE-EEKTIPEDGGV  985
             P+FLGGTCTCADKGGCM SDKGPWND EIMK+V  GAHKCS + +    +EKTI ED   
Sbjct  301   PEFLGGTCTCADKGGCMVSDKGPWNDEEIMKLVRMGAHKCSKKASSSSVDEKTISED---  357

Query  984   NvsvsmsaksvkkpaSFKIESTK---------KLFPIQEE-TR------QPDMYVPMVDK  853
                 S  +KSVKK +SF + S           +L P+QEE TR      +P  YVP++DK
Sbjct  358   ---ESSISKSVKKTSSFNLMSNSPGGDPVAIPQLTPVQEEATRNPPDAGEPQEYVPVIDK  414

Query  852   TVDLPNWHV-VNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRM  676
              +  P   + V  DN          L ++ +  K  E  SN + TGV+TFVMG+VTMVRM
Sbjct  415   AITAPRAQIAVKIDNLA--------LAKMTDYGKAPEGLSNHIFTGVLTFVMGVVTMVRM  466

Query  675   TKNMPRKLTESTLYSNSMHLNDHAMKGHG-AYKPPEPAVTAAEFMAMMKRMASLEEKFIT  499
             T+NMPRKLT++ LYSNS+H  D  +K     Y  PE  ++ A+++ MMKRM  LEEK  +
Sbjct  467   TRNMPRKLTDANLYSNSVHSPDDMIKSRAHTYDSPEAGISRADYLIMMKRMNELEEKLSS  526

Query  498   LSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNI  319
             L N+P  MPPE EEML +A++R+D LEQEL+E KKALE+S S Q EL++YI+KKKKKK  
Sbjct  527   LCNKPADMPPENEEMLQSALNRVDKLEQELSETKKALEQSLSQQEELLSYIDKKKKKKKF  586

Query  318   FGF  310
             F F
Sbjct  587   FAF  589



>ref|XP_004289637.1| PREDICTED: uncharacterized protein LOC101312296 [Fragaria vesca 
subsp. vesca]
Length=585

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/579 (62%), Positives = 438/579 (76%), Gaps = 22/579 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MSG ++R L+P  E  +   ++R+TRLG+L++ AINAS KFRHSF  + RR+S+VMSV +
Sbjct  5     MSGPLDRHLKPVPE--ETSEEERKTRLGALKQKAINASTKFRHSFTKKGRRNSKVMSVPI  62

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D  +AEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DMLQWR
Sbjct  63    EDNINAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKAKQMWTDMLQWR  122

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI+++F++KE DEVL YYPQGHHGVDKDGRP+YIERLG VD+TK+MQVTTMDRY
Sbjct  123   KEFGADTIMEEFEYKEIDEVLNYYPQGHHGVDKDGRPVYIERLGQVDSTKMMQVTTMDRY  182

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +K+HV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K ARELIQ LQKIDG
Sbjct  183   VKFHVREFERTFAHKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKSARELIQCLQKIDG  242

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFRLLW+TVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  243   DNYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  302

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED------  994
             FLGGTCTCADKGGCMRSDKGPWNDP+IMKMVH G  KC+ +     EEK I ED      
Sbjct  303   FLGGTCTCADKGGCMRSDKGPWNDPDIMKMVHNGEGKCTRQTLSGIEEKIISEDEMSYSK  362

Query  993   --GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVN  820
                  N        +       ++  TKK      +  + D  +PMVDK VD       +
Sbjct  363   RCDSFNSKTVQMEHTKLSHVPKQVSFTKK----SSKDYEYDNLMPMVDKIVDATWTKSAH  418

Query  819   NDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
              D  KF      D +      K  E  SN LL+G+M F+MGIVTM+R+T+NMPRKLTE+ 
Sbjct  419   YD--KFA--HSQDCFPSHNVGKSSEGLSNYLLSGIMAFIMGIVTMIRLTRNMPRKLTEAA  474

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             LY +  + N   MK   A + P P++++  +M MMKRMA LEEK   LS +P  MPPEKE
Sbjct  475   LYGSPAYCNGMGMK---AKQLPAPSISSDTYMNMMKRMAELEEKVKVLSKKPTVMPPEKE  531

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EML+NA++R  ALEQEL+  KKAL+++   QNELIAY++
Sbjct  532   EMLNNALNRAAALEQELSSTKKALDDALVRQNELIAYLD  570



>ref|XP_008236928.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Prunus mume]
 ref|XP_008236929.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Prunus mume]
Length=595

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/582 (62%), Positives = 446/582 (77%), Gaps = 21/582 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             M G+++R L+P  E  +   D+R+TRLGSL++ AINAS+KFRHSF  + RR+SRVMSV +
Sbjct  6     MPGSLDRHLKPVHE--ETSEDERKTRLGSLKQKAINASSKFRHSFTKKGRRNSRVMSVPI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D  DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WR
Sbjct  64    EDNIDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLLWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             K+FGADTI++DFDFKE DEVLKYYPQGHHGVDK+GRPIYIERLG VD+TKLMQVTTMDRY
Sbjct  124   KDFGADTIMEDFDFKEIDEVLKYYPQGHHGVDKEGRPIYIERLGQVDSTKLMQVTTMDRY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVG K+F K ARELIQ L KIDG
Sbjct  184   VKYHVREFERTFVCKFPACSIAAKKHIDQSTTILDVQGVGFKHFNKSARELIQTLNKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPETLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED------  994
             FLGGTCTCADKGGCMRSDKGPWNDP+I+KMVH G  KC  +     +EK I ED      
Sbjct  304   FLGGTCTCADKGGCMRSDKGPWNDPDIIKMVHNGEGKCPRKSLSGIDEKIISEDENAYSK  363

Query  993   --GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP---DMYVPMVDKTVDLPNWH  829
                 +            +    ++    +  P+ ++  +    D + PMV KTVD     
Sbjct  364   RYDSLKSKTVQEVDVHCQVEHQRLSHVPREVPMAKKGNRGYKHDNFRPMVSKTVDSTWPK  423

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
              V+ D  K+ +  G D + + +A K  E  +NQLL+ +M F+MGIV MVR+ ++MPRKLT
Sbjct  424   SVHYD--KYAL--GGDCFSVHDACKVPEGLTNQLLSAIMAFIMGIVAMVRLARSMPRKLT  479

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             E+TLY N ++ N   +KG    + P PA+++ ++M MMKRMA LEEK   LS++P  MPP
Sbjct  480   EATLYGNPVYYNGMVVKGQ---QLPAPAISSNDYMNMMKRMAELEEKVNALSSKPAVMPP  536

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EKE++L+ A++R++ALEQEL+  KKALE++   Q+ELIA +E
Sbjct  537   EKEDLLNVALNRVNALEQELSATKKALEDTLVRQDELIALLE  578



>ref|XP_010097032.1| Sec14 cytosolic factor [Morus notabilis]
 gb|EXB66716.1| Sec14 cytosolic factor [Morus notabilis]
Length=609

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/563 (64%), Positives = 440/563 (78%), Gaps = 20/563 (4%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVV-LDDEHDAEEVKSVDAFRQAL  1819
             D+R+TR+GSL+K AINAS+KFRHS   + RRSS+VMSV+ ++D HDAEEV++VDAFRQAL
Sbjct  25    DERKTRIGSLKKKAINASSKFRHSLTIKGRRSSKVMSVIEIEDVHDAEEVQAVDAFRQAL  84

Query  1818  ILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDE  1639
             IL+ELLP KHDDYHMMLRFLKARKF+IDK+KQMW DML+WRKEFGADTI++DF+FKE  E
Sbjct  85    ILEELLPAKHDDYHMMLRFLKARKFDIDKAKQMWTDMLEWRKEFGADTIMEDFEFKELSE  144

Query  1638  VLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSC  1459
             VL+YYPQG+HGVDKDG+P+YIERLG VD  KLMQVTTMDRY+KYHV+EFERT   K  +C
Sbjct  145   VLEYYPQGYHGVDKDGKPVYIERLGKVDPNKLMQVTTMDRYVKYHVREFERTFGVKFPAC  204

Query  1458  SIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGF  1279
             SIAAKKHIDQSTTILDVQGVGLKNFTK ARELI  LQKIDGDNYPETL RM+IINAGSGF
Sbjct  205   SIAAKKHIDQSTTILDVQGVGLKNFTKSARELISCLQKIDGDNYPETLNRMFIINAGSGF  264

Query  1278  RLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDK  1099
             R+LWNTVKSFLDPKT AKI+VLGNKYQSKLLEIIDA+ELPDFLGGTCTCA+ GGCMRSDK
Sbjct  265   RMLWNTVKSFLDPKTAAKIHVLGNKYQSKLLEIIDANELPDFLGGTCTCAEHGGCMRSDK  324

Query  1098  GPWNDPEIMKMVHQGAHKCSHRMA--RVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIE  925
             GPW DPEI+KMV  G HKC  +    +V +EKTI ED            S    A+  ++
Sbjct  325   GPWKDPEILKMVQNGDHKCKGKPGSIQVADEKTISEDE--MSYSKGYCDSHNVEATPDVD  382

Query  924   STKKLFPIQEET---------RQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQ  772
              T +L PI+EE           + D YVPMVDK+VD      V ++N  F +PK  D Y 
Sbjct  383   GTTQLSPIREENPVLKRSKKFYKYDDYVPMVDKSVDATWQKAVESNN--FALPK--DCYT  438

Query  771   IQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGH  592
             + +  K  +  S+Q+ TGVMT VMGIVTMVR+T+N+P+KLT+ST YS+  + +D +M G 
Sbjct  439   MHDGCKMSDGFSSQIFTGVMTVVMGIVTMVRLTRNIPKKLTDSTFYSSPTYCDDDSMSG-  497

Query  591   GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqe  412
                +    A+++A+ M++MKRMA LEE+   +S +  TMP EKE ML++A+SR+DALE+E
Sbjct  498   AKVQLQGAAMSSADLMSVMKRMAELEERVTVMSMKQVTMPLEKEAMLNSALSRVDALEKE  557

Query  411   laeakkaleesqSNQNELIAYIE  343
             L E KKALEES S Q EL+AY++
Sbjct  558   LMETKKALEESLSRQEELVAYLD  580



>ref|XP_008377269.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Malus domestica]
 ref|XP_008377270.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Malus domestica]
Length=590

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/583 (62%), Positives = 442/583 (76%), Gaps = 25/583 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             M  +V+R L+P  E  +   D+R+TRLG+L+K AINAS KF+HSF  + RRSSRVMSV +
Sbjct  5     MPASVDRHLKPVHE--ETSEDERKTRLGTLKKKAINASTKFKHSFTKKGRRSSRVMSVPI  62

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D  DAEE+++VDAFRQALIL+ELLP KHDD+HMMLRFL+ARKF+I+K+KQMW DMLQWR
Sbjct  63    EDNIDAEELQAVDAFRQALILEELLPAKHDDHHMMLRFLRARKFDIEKAKQMWTDMLQWR  122

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DFDFKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+ KLMQVTTM+RY
Sbjct  123   KEFGADTIMEDFDFKEIDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSNKLMQVTTMERY  182

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LIQ LQ IDG
Sbjct  183   LKYHVREFERTFVCKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKSARDLIQTLQNIDG  242

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
              NYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  243   GNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  302

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCMRSDKGPWNDP+IMKMVH GA KC  +     EEK I ED   +  
Sbjct  303   FLGGTCTCADKGGCMRSDKGPWNDPDIMKMVHDGAAKCPRKSLSGIEEKIISEDENASSK  362

Query  975   vsmsaksvk---kpaSFKIESTK-----KLFPIQEETRQP---DMYVPMVDKTVDLPNW-  832
                S KS         F++E  +     K   I ++  Q    D + PMVDKTVD  NW 
Sbjct  363   RYDSFKSKTVPDVDVHFQVEYRRPSHLLKKVSIADKGNQAYEYDNFAPMVDKTVD-ANWP  421

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               V+ D          + + + +  K  +  +NQLL+G+M F+MGIV M++ T++MPRKL
Sbjct  422   KSVHYDEFP------TEGFPVHDTRKVPDGLTNQLLSGLMAFIMGIVAMIQFTRSMPRKL  475

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             T++  Y + ++ N   +KG      P PA+++ ++M MMKRMA LEEK   LS++P  MP
Sbjct  476   TDAARYGSPVYYNGVVVKGQPL---PAPAISSTDYMNMMKRMAELEEKLYALSSKPAVMP  532

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             P+KEEML+ A++R++ LEQEL+  KKALE++   Q+ELIA +E
Sbjct  533   PDKEEMLNAALNRVNTLEQELSSTKKALEDTLVRQDELIANLE  575



>ref|XP_009781459.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X2 [Nicotiana sylvestris]
Length=515

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/587 (63%), Positives = 438/587 (75%), Gaps = 77/587 (13%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             +GNMSG ++RP RPS EK+DL+    +R+TRLGSL+K A+NAS+KFRHSF  + RR+SRV
Sbjct  2     SGNMSGPLDRPFRPSLEKIDLENPEHERKTRLGSLKKKAVNASSKFRHSFTKKGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE+K+VDAFRQALIL+ELLP KHDDYH MLRFLKARKF+I+KSKQMWAD
Sbjct  62    MSVVFEDEHDAEEIKAVDAFRQALILEELLPAKHDDYHKMLRFLKARKFDIEKSKQMWAD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WR EFGADTII+DF+FKE++EVLKYYPQGHHGVDK+GRP+YIER+G VD+ KL+QVT
Sbjct  122   MLKWRSEFGADTIIEDFEFKEKEEVLKYYPQGHHGVDKEGRPVYIERIGQVDSVKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDKM +CSIAAKKHID STTILDVQGVGLK+F K ARELIQ L
Sbjct  182   TMDRYLKYHVQEFERTLNDKMPACSIAAKKHIDTSTTILDVQGVGLKSFNKSARELIQCL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKI+VLGNKYQSKLLE+IDA
Sbjct  242   QTIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKIHVLGNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+FLGGTCTCADKGGCM SDKGPWND +IMK+                         
Sbjct  302   SELPEFLGGTCTCADKGGCMLSDKGPWNDQDIMKV-------------------------  336

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
             G+N                      K +P      +P+ ++P+VDK VD+  W       
Sbjct  337   GMN----------------------KNYP---SAYEPEDFMPIVDKAVDV-TW-------  363

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
                   K  D + I +A K  +  SNQL TGV+T VMGIVT+V+MT+NMPRKL ++TL +
Sbjct  364   ---TKAKRGDFFPIHDASKSPQGFSNQLFTGVLTLVMGIVTLVKMTRNMPRKLADATLQA  420

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             +   LN             EP ++A E+ +MMKRM  LEEK ITLSN+P  +PPEKEE+L
Sbjct  421   HGYQLN-------------EPTISANEYFSMMKRMEELEEKVITLSNKPNALPPEKEELL  467

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +NAM RID LEQ+L    KALE++   Q EL+AY+EKK+KKK   G 
Sbjct  468   NNAMKRIDTLEQDLCATHKALEQALVRQAELLAYVEKKRKKKKFLGL  514



>ref|XP_010526772.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Tarenaya hassleriana]
Length=570

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/575 (63%), Positives = 434/575 (75%), Gaps = 40/575 (7%)
 Frame = -2

Query  2010  KMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLD--DEHDAEEVKSVD  1837
             K+D +    +  +GSL+K    AS+KFR S   RRRSS+VMSV  D  D HDAEE+K+VD
Sbjct  4     KLDAEVLGEKPNMGSLKK---RASSKFRSSLTKRRRSSKVMSVDFDIEDVHDAEELKAVD  60

Query  1836  AFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFD  1657
             AFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW+DM++WRKEFGAD+I++DFD
Sbjct  61    AFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMWSDMVRWRKEFGADSIVEDFD  120

Query  1656  FKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNN  1477
             FKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+TKLMQVTTMDRY+KYHV EFERT N
Sbjct  121   FKEIDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSTKLMQVTTMDRYVKYHVMEFERTFN  180

Query  1476  DKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYII  1297
              K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+II
Sbjct  181   VKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFII  240

Query  1296  NAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGG  1117
             NAGSGFR+LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+FLGG+CTC+DKGG
Sbjct  241   NAGSGFRMLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPEFLGGSCTCSDKGG  300

Query  1116  CMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             CMRSDKGPWNDP+IMK V  G HKCS R+ A    EKTI ED   +   +          
Sbjct  301   CMRSDKGPWNDPDIMKGVQNGHHKCSKRVQAENATEKTISEDEIFHSKEN----------  350

Query  939   SFKIESTKKLFPIQEETRQ---------PDMYVPM----VDKTVDLPNWHVVNNDNCKFV  799
                 +ST +L P +E+  +         PD   P+     DKTVD   W+   +D  KF 
Sbjct  351   ----KSTAELSPKEEKVSRDNIEHPQSSPDQNGPVSASGFDKTVD-SVWNT--SDGQKFE  403

Query  798   VPKGADLYQIQEAYKGQE-LASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
             + KG D+  IQEA KG    A + +  GV+ FVMG+ TM+R+T+N+P+KLTE T+YS+ +
Sbjct  404   LSKG-DVCAIQEACKGTTGEAGSPIFNGVVAFVMGVATMIRVTRNIPKKLTEGTIYSSPV  462

Query  621   HLNDHAMKGHG--AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
             + +D +M      + K   P ++  EFMA+MKRMA LE+K  +LS QP  MPPEKEEML+
Sbjct  463   YCDDESMNKSAMQSQKLDMPPISGEEFMAVMKRMAELEQKVTSLSMQPTAMPPEKEEMLN  522

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              A++R D LEQELA  KKALE+S S Q EL+AYIE
Sbjct  523   AAITRADVLEQELASTKKALEDSLSQQEELMAYIE  557



>ref|XP_010548310.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548312.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Tarenaya hassleriana]
Length=570

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/573 (63%), Positives = 435/573 (76%), Gaps = 12/573 (2%)
 Frame = -2

Query  2010  KMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSV--VLDDEHDAEEVKSVD  1837
             K+D +    ++++GSL+K    AS+KFR S   RRRSS+VMSV   ++D HD EE+K+VD
Sbjct  4     KLDAEIPGEKSKMGSLKK---RASSKFRCSLTKRRRSSKVMSVDFEIEDVHDVEELKAVD  60

Query  1836  AFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFD  1657
             AFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW DML+WRKEFGAD+I++DFD
Sbjct  61    AFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMWTDMLRWRKEFGADSIVEDFD  120

Query  1656  FKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNN  1477
             FKE DEVL YYPQGHHGVDKDGRP+YIERLG VD+TKLMQVTTMDRY+KYH+ EFERT N
Sbjct  121   FKEIDEVLTYYPQGHHGVDKDGRPVYIERLGQVDSTKLMQVTTMDRYVKYHIMEFERTFN  180

Query  1476  DKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYII  1297
              K  +CSI+AKKHIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+II
Sbjct  181   VKFPACSISAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFII  240

Query  1296  NAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGG  1117
             NAGSGFR+LWNTVKSFLDPKTTAKINVLGNKYQSKLLEII+ASELP+FLGGTCTCADKGG
Sbjct  241   NAGSGFRMLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIEASELPEFLGGTCTCADKGG  300

Query  1116  CMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGV-Nvsvsmsaksvkkp  943
             CMRSDKGPWNDPEIMK V  G HKCS R  A    EKTI ED  + + S    + +   P
Sbjct  301   CMRSDKGPWNDPEIMKNVQDGHHKCSKRSQAENATEKTISEDEILYSNSKENKSTANLAP  360

Query  942   aSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQE  763
                K+       P+    +   +  P  DKTVD   W+    D  KF + K  D+Y IQE
Sbjct  361   EEEKVSRDNISHPLSSPHQNGPVSSPGFDKTVD-SAWNT--PDAQKFELLKAEDVYAIQE  417

Query  762   AYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--  589
             A K      + +  GVM  VMG+ TM+R+T+N+P++LTE T+YS+ ++ +D +M      
Sbjct  418   ACKDTTGGKSPIFNGVMALVMGVATMIRVTRNVPKRLTEGTIYSSPVYCDDESMNKSAMQ  477

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             + K   P ++  EFM +MKRMA LE+K  +LS QP TMPPEKEEML++A+SR + LEQEL
Sbjct  478   SQKLAMPPISGEEFMTVMKRMAELEQKVTSLSMQPTTMPPEKEEMLNSAISRANVLEQEL  537

Query  408   aeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             A  KKALE++ S Q E +AYIEKKKKKK +F +
Sbjct  538   AATKKALEDTLSRQEEFVAYIEKKKKKKKLFNW  570



>ref|XP_006383162.1| hypothetical protein POPTR_0005s12160g [Populus trichocarpa]
 gb|ERP60959.1| hypothetical protein POPTR_0005s12160g [Populus trichocarpa]
Length=573

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/577 (61%), Positives = 446/577 (77%), Gaps = 22/577 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPS-AEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVV  1879
             M+ AV  PL P+    M+   D+R+ R+ SL+K AI+ASNK      +  RRSS+VMSV 
Sbjct  1     MAAAVCAPLTPNPVPDMEHSGDERKNRIESLKKKAISASNKFRHSLTRKSRRSSKVMSVE  60

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             ++D HDAEE+K+VDAFRQ LIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQW
Sbjct  61    IEDVHDAEELKAVDAFRQVLILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQW  120

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             RKEFGADT++++F+F+E +EVL+YYPQGHHGVDK+GRP+YIE LG  D  KLMQVT MDR
Sbjct  121   RKEFGADTVLEEFEFQELNEVLEYYPQGHHGVDKEGRPVYIESLGKADPAKLMQVTNMDR  180

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             Y+KYHV+EFERT + K  +CS+AAK+HIDQSTTILDVQGVGLK+FTK AR+LI  LQKID
Sbjct  181   YVKYHVREFERTFDVKFPACSLAAKRHIDQSTTILDVQGVGLKSFTKAARDLITRLQKID  240

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             GDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP
Sbjct  241   GDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELP  300

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVN  982
             +FLGGTCTCADKGGC+RSDKGPWNDPEI+KMV  G HKC+ +   +  +EKTI ED    
Sbjct  301   EFLGGTCTCADKGGCVRSDKGPWNDPEILKMVQNGDHKCAKKFGTQYPDEKTICEDD---  357

Query  981   vsvsmsaksvkkpaSFKIEST---KKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
                       K+  S K+ES     +  P+ E+  + + Y  +VDK++D+ +W  V  DN
Sbjct  358   ------LSCSKRLDSSKVESAPEHPQSSPVPEKAYKFEDYDLVVDKSMDI-SWKKV--DN  408

Query  810   CKFVVPKG-ADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
               F + K  AD Y   +A K  +  S+ L TGVM  V GIVTM+R+T+N+PRK+T++T+Y
Sbjct  409   GMFALSKAKADCYTQYDACKAPQAISSPLFTGVMALVTGIVTMIRVTRNVPRKMTDATIY  468

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
             S+ ++ +D A+K   + +   PA+++A++M ++KRMA LE+K   LS +P +MPPEKEEM
Sbjct  469   SSPVYCDDTAVK---SLEHQSPAISSADYMTVLKRMAELEDKVSVLSAKPVSMPPEKEEM  525

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             LS A+SR+D LEQEL   KKALEES + Q EL+AY++
Sbjct  526   LSAALSRVDGLEQELMATKKALEESLAQQAELVAYLD  562



>ref|XP_009378652.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Pyrus x bretschneideri]
Length=589

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/583 (61%), Positives = 440/583 (75%), Gaps = 25/583 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             M  +V+R L+P  E  +   D+R+TRLG+L+K AINAS KFRHSF  + RRSSRVMSV +
Sbjct  5     MPASVDRHLKPVHE--ETSEDERKTRLGTLKKKAINASTKFRHSFTKKGRRSSRVMSVPI  62

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D  DAEE+++VDAFRQALIL+ELLP KHDD+HMMLRFL+ARKF+I+K+KQMW DMLQWR
Sbjct  63    EDNIDAEELQAVDAFRQALILEELLPAKHDDHHMMLRFLRARKFDIEKAKQMWTDMLQWR  122

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DFDFKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+ KLMQVTTM+RY
Sbjct  123   KEFGADTIMEDFDFKEIDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSNKLMQVTTMERY  182

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LIQ LQ IDG
Sbjct  183   LKYHVREFERTFVCKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKSARDLIQTLQNIDG  242

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
              NYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  243   GNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  302

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCMRSDKGPWNDP+IMKMVH G  KC  +     EEK I ED   +  
Sbjct  303   FLGGTCTCADKGGCMRSDKGPWNDPDIMKMVHDGEAKCPRKSLSGIEEKIISEDENASSK  362

Query  975   vsmsaksvk---kpaSFKIESTKKLFPIQE--------ETRQPDMYVPMVDKTVDLPNW-  832
                S KS         F++E  +   P+++        +  + D + PMVDKTVD  NW 
Sbjct  363   RYDSFKSKTVPDVDVHFQVEHRRPSHPLKKVSIADKGNQAYEYDNFAPMVDKTVDA-NWP  421

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               V+ D          + + + +  K  +  +NQLL+G+M F+MGIV M++ T++MPRKL
Sbjct  422   KSVHYDEFP------TEGFPVHDTRKVPDGLTNQLLSGLMAFIMGIVAMIQFTRSMPRKL  475

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             T++  Y   ++ N   +KG      P PA+++ ++  +MKRMA LEEK   LS++P  MP
Sbjct  476   TDAARYGTPVYYNGVVVKGQPL---PAPAISSTDYKNLMKRMAELEEKLYALSSKPAVMP  532

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             P+KEE+L+ A++R++ LEQEL+  KKALE++   Q+ELIA +E
Sbjct  533   PDKEEILNAALNRVNTLEQELSSTKKALEDTLVRQDELIANLE  575



>gb|EPS64124.1| hypothetical protein M569_10657 [Genlisea aurea]
Length=559

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/588 (64%), Positives = 449/588 (76%), Gaps = 36/588 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV  1882
             MS   ERP RPS EK+DL+   D+R+TRLGSL+K AINASNKFR+S   + RR+SRVMSV
Sbjct  1     MSEENERPWRPSLEKIDLENSEDERRTRLGSLKKKAINASNKFRNSLGKKGRRNSRVMSV  60

Query  1881  VL-DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             VL +DEHDAEE+++VDAFRQALIL+ELLP+KHDDYHM+LRFLKARKF+I+K+KQMW+DML
Sbjct  61    VLLEDEHDAEELQAVDAFRQALILEELLPSKHDDYHMLLRFLKARKFDIEKTKQMWSDML  120

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
             QWRK+F ADTI +DF+FKE++EV+KYYP GHHGVDK GRP+YIE+LG VD+ KL+QVTT+
Sbjct  121   QWRKDFAADTITEDFEFKEKEEVIKYYPHGHHGVDKVGRPVYIEQLGQVDSVKLLQVTTL  180

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRYLKYHVQEFERT NDK+ +CSIAAKKHIDQSTTILDVQGVGLKNF K ARELIQ LQK
Sbjct  181   DRYLKYHVQEFERTFNDKLPACSIAAKKHIDQSTTILDVQGVGLKNFNKSARELIQRLQK  240

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             IDGDNYPE+L +MYIINAGSGFRLLWNTVKSFLDPKTTAKI+VL NKYQSKLLE+I+ASE
Sbjct  241   IDGDNYPESLFQMYIINAGSGFRLLWNTVKSFLDPKTTAKIHVLSNKYQSKLLEVIEASE  300

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGGTC C DKGGCM SDKGPWND EIMKMV  G HKC+HR + + EEKTI ED   
Sbjct  301   LPEFLGGTCNCKDKGGCMVSDKGPWNDMEIMKMVRSGMHKCAHRGSTL-EEKTISEDDN-  358

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCK  805
                                      F + +     +  +   +K V             +
Sbjct  359   -------------------------FKMHDNLTHDEYGLVTANKAVAGHWAKAAAKAAKR  393

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNS  625
                   AD ++    +K  E  SN L TGV+TFVMG+VTMVRMT+NMP++LT+STLYS+S
Sbjct  394   DDYTLSADFFR-GPHHKKSEGVSNHLFTGVLTFVMGVVTMVRMTRNMPKRLTDSTLYSSS  452

Query  624   MHLNDHAMKG---HGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
             +   D  +K    HG Y+ PE A++ A+ + MMKRM  LEEK   L +QP  MPPEKEE+
Sbjct  453   ITGGDEMVKTRHIHG-YESPETAISRADHLIMMKRMNELEEKVGILCSQPVGMPPEKEEL  511

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             L NA++R+DALEQEL++AKKALE++ S Q EL+AYIEKKKKKK  F F
Sbjct  512   LKNALNRVDALEQELSDAKKALEKALSQQEELLAYIEKKKKKKKFFAF  559



>ref|XP_010548313.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Tarenaya hassleriana]
Length=569

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/573 (63%), Positives = 435/573 (76%), Gaps = 13/573 (2%)
 Frame = -2

Query  2010  KMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSV--VLDDEHDAEEVKSVD  1837
             K+D +    ++++GSL+K    AS+KFR S   RRRSS+VMSV   ++D HD EE+K+VD
Sbjct  4     KLDAEIPGEKSKMGSLKK---RASSKFRCSLTKRRRSSKVMSVDFEIEDVHDVEELKAVD  60

Query  1836  AFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFD  1657
             AFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW DML+WRKEFGAD+I++DFD
Sbjct  61    AFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMWTDMLRWRKEFGADSIVEDFD  120

Query  1656  FKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNN  1477
             FKE DEVL YYPQGHHGVDKDGRP+YIERLG VD+TKLMQVTTMDRY+KYH+ EFERT N
Sbjct  121   FKEIDEVLTYYPQGHHGVDKDGRPVYIERLGQVDSTKLMQVTTMDRYVKYHIMEFERTFN  180

Query  1476  DKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYII  1297
              K  +CSI+AKKHIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+II
Sbjct  181   VKFPACSISAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFII  240

Query  1296  NAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGG  1117
             NAGSGFR+LWNTVKSFLDPKTTAKINVLGNKYQSKLLEII+ASELP+FLGGTCTCADKGG
Sbjct  241   NAGSGFRMLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIEASELPEFLGGTCTCADKGG  300

Query  1116  CMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGV-Nvsvsmsaksvkkp  943
             CMRSDKGPWNDPEIMK V  G HKCS R  A    EKTI ED  + + S    + +   P
Sbjct  301   CMRSDKGPWNDPEIMKNVQDGHHKCSKRSQAENATEKTISEDEILYSNSKENKSTANLAP  360

Query  942   aSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQE  763
                K+       P+    +   +  P  DKTVD   W+    D  KF + K  D+Y IQE
Sbjct  361   EEEKVSRDNISHPLSSPHQNGPVSSPGFDKTVD-SAWNT--PDAQKFELLK-EDVYAIQE  416

Query  762   AYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--  589
             A K      + +  GVM  VMG+ TM+R+T+N+P++LTE T+YS+ ++ +D +M      
Sbjct  417   ACKDTTGGKSPIFNGVMALVMGVATMIRVTRNVPKRLTEGTIYSSPVYCDDESMNKSAMQ  476

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             + K   P ++  EFM +MKRMA LE+K  +LS QP TMPPEKEEML++A+SR + LEQEL
Sbjct  477   SQKLAMPPISGEEFMTVMKRMAELEQKVTSLSMQPTTMPPEKEEMLNSAISRANVLEQEL  536

Query  408   aeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             A  KKALE++ S Q E +AYIEKKKKKK +F +
Sbjct  537   AATKKALEDTLSRQEEFVAYIEKKKKKKKLFNW  569



>ref|XP_003548870.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Glycine max]
Length=555

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/591 (61%), Positives = 425/591 (72%), Gaps = 46/591 (8%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLD  1873
             MSG    PL P   K  L+  DR   +GSL+K   N+  + +    S+     VMSV ++
Sbjct  1     MSG----PLSP---KTSLEKSDR---VGSLKKMLRNSLTRSKRRSSSK-----VMSVEIE  45

Query  1872  DEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRK  1693
             D  DAEE K+VD FRQAL+LDELLP KHDDYHM+LRFLKARKF+++KSKQMW+DMLQWRK
Sbjct  46    DIRDAEESKAVDEFRQALVLDELLPEKHDDYHMLLRFLKARKFDLEKSKQMWSDMLQWRK  105

Query  1692  EFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYL  1513
             EFGADTI +DF+FKE DEVL+YYPQGHHGVDKDGRPIYIERLG VDATKLMQVTTMDRY+
Sbjct  106   EFGADTITEDFEFKELDEVLQYYPQGHHGVDKDGRPIYIERLGQVDATKLMQVTTMDRYI  165

Query  1512  KYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGD  1333
             KYHV+EFERT + K ++C+IAAKKHIDQSTTILDVQGVGLKNF K ARELI  LQKIDGD
Sbjct  166   KYHVKEFERTFDVKFAACTIAAKKHIDQSTTILDVQGVGLKNFNKHARELITRLQKIDGD  225

Query  1332  NYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDF  1153
             NYPETL RM+IINAGSGFR+LWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIID SELP+F
Sbjct  226   NYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDESELPEF  285

Query  1152  LGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNvs  976
             LGG CTCAD+GGCMRSDKGPW D +IMKMV  G HKCS +    V EEKT  E+      
Sbjct  286   LGGACTCADQGGCMRSDKGPWKDADIMKMVQNGEHKCSRKCEVPVMEEKTTSEEHETPKL  345

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVV  796
              +  A         ++ S     P  +     D +VP  DKT     W+    +N KF V
Sbjct  346   EANLAA--------QLSSVFAEVPASKAYNYED-FVPEADKTA----WNKKMEENEKFAV  392

Query  795   PKGA--DLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              K    D Y + +++K  E  ++Q+ TGVM FVMGIVTMVRMTKNMP+KLT++  YSN  
Sbjct  393   SKAGAVDAYAMVDSFKIHEKVNSQIFTGVMAFVMGIVTMVRMTKNMPKKLTDANFYSN--  450

Query  621   HLNDHAMKGHGAYKPPE-------PAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEK  463
                     G    + P        P ++A EFM +MKRMA LE++ + ++NQ   MPPEK
Sbjct  451   ------FGGEYKGQAPNTEEMTTMPNISAQEFMTVMKRMAELEDRMVNMNNQTTCMPPEK  504

Query  462   EEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             EEML+ A+SR DALEQEL   KKALE+S S Q EL AYIEKKKKKK +F +
Sbjct  505   EEMLNAAISRADALEQELLATKKALEDSLSKQEELSAYIEKKKKKKKLFAW  555



>ref|XP_009353404.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Pyrus x bretschneideri]
Length=589

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/583 (62%), Positives = 439/583 (75%), Gaps = 25/583 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             M  +V+R L+ S E  +   D+R+TRLG+L+K AINAS KFRHSF  + RR+S+VMSV +
Sbjct  5     MPASVDRHLKSSQE--ETSEDERKTRLGTLKKKAINASTKFRHSFTKKGRRNSKVMSVPI  62

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D  DAEE+K+VDAFRQALIL+ELLP KHDD+HMMLRFLKARKF+I+K+KQMW DMLQWR
Sbjct  63    EDNIDAEELKAVDAFRQALILEELLPAKHDDHHMMLRFLKARKFDIEKAKQMWTDMLQWR  122

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DFDFKE +EVLKYYPQGHHGVDKDGRP+YIERLG VD  KLMQVTTM+RY
Sbjct  123   KEFGADTIMEDFDFKEIEEVLKYYPQGHHGVDKDGRPVYIERLGQVDCNKLMQVTTMERY  182

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVG KNF K AR+LIQ LQ IDG
Sbjct  183   VKYHVREFERTFVSKFPACSIAAKKHIDQSTTILDVQGVGFKNFNKSARDLIQTLQNIDG  242

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
              +YPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID SELP+
Sbjct  243   GSYPETLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDGSELPE  302

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCMRSDKGPWNDP+ MKMVH G  KCS +     EEK I E+   +  
Sbjct  303   FLGGTCTCADKGGCMRSDKGPWNDPDTMKMVHNGEAKCSRKSLSGIEEKIISEEENASSK  362

Query  975   vsmsaksvkkpaS---FKIESTKKLFPIQ--------EETRQPDMYVPMVDKTVDLPNW-  832
                S KS         F +E  +   P++         +  + D + PMVDKTVD  NW 
Sbjct  363   RYDSFKSKTVAEVDMHFPVEHRRLSRPLKRVSIADKSSQAYEYDNFAPMVDKTVD-ANWP  421

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               V+ D  KF      + + + +  K     +NQLL+G+MTF+MGIV MV+ T+ MPRKL
Sbjct  422   KSVHYD--KF----PTEGFPVHDTCKAPGGLTNQLLSGLMTFIMGIVAMVQFTRTMPRKL  475

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             T++ LY + ++ N   +KG      P PA+++ ++M MMKRMA LEEK   LS++P  MP
Sbjct  476   TDAALYGSPVYYNGVVVKGQPL---PVPAISSTDYMNMMKRMAELEEKLNALSSKPAVMP  532

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             P+KEEML+ A++R++ LEQEL+  KKALE++   Q+ELIA +E
Sbjct  533   PDKEEMLNAALNRVNTLEQELSSTKKALEDTLVRQDELIAQLE  575



>ref|XP_011025853.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 isoform X1 [Populus euphratica]
Length=567

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/576 (61%), Positives = 443/576 (77%), Gaps = 28/576 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPS-AEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVV  1879
             M+ AV  PL P+   +M+   D+R+ R+ SL+K AI+ASNKFRHS   + RRSS+VMSV 
Sbjct  1     MATAVCVPLSPNPVPEMEHSGDERKKRIESLKKKAISASNKFRHSLTRKGRRSSKVMSVE  60

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             ++D HD EE+K VDAFRQ LIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQW
Sbjct  61    IEDVHDIEELKVVDAFRQVLILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQW  120

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             RKEFGADT++++F+F+E  EVL++YPQGHHGVDK+GRP+YIE LG  D  KLMQVT MDR
Sbjct  121   RKEFGADTVLEEFEFQELSEVLEHYPQGHHGVDKEGRPVYIESLGKADPAKLMQVTNMDR  180

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             Y+KYHV+EFERT + K  +CS+AAK+HIDQSTTILDVQGVGLK+ TK AR+LI  LQKID
Sbjct  181   YVKYHVREFERTFDAKFPACSLAAKRHIDQSTTILDVQGVGLKSLTKAARDLISRLQKID  240

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             GDNYPETL RM+IINAGSGFR+LWNT+KSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP
Sbjct  241   GDNYPETLNRMFIINAGSGFRMLWNTIKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELP  300

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVN  982
             +FLGGTCTCADKGGCMRSDKGPWNDPEIMKMV  G HKC+ +      +EKTI ED   N
Sbjct  301   EFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVQDGHHKCAKKCGTHYPDEKTICEDDLSN  360

Query  981   vsvsmsaksvkkpaSFKIESTKKLFP---IQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
               +  +          K+E+  +L     + E+  + + Y  +VDK+VD+    VVNN  
Sbjct  361   SKLHEAP---------KVETAPQLPQPSFVPEKAYKLEEYQLVVDKSVDMSWKKVVNN--  409

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
                     AD Y   +A K  +  ++ L TGVM  V GIVTM+++T+N+PRKLT++T+YS
Sbjct  410   --------ADCYTQYDACKAPQAINSPLFTGVMALVTGIVTMIKVTRNVPRKLTDATIYS  461

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             N  + +D ++KG    +   PA+++A++M ++KRMA LE+K   LS++P +MPPEKEEML
Sbjct  462   NPDYCDDTSVKGR---EQQSPAISSADYMTVLKRMAELEDKVSVLSSKPVSMPPEKEEML  518

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + A+SR++ALEQEL   KKALE+S + Q EL+AY+E
Sbjct  519   NAAISRVEALEQELMATKKALEDSLAQQAELVAYLE  554



>ref|XP_006423352.1| hypothetical protein CICLE_v10030083mg, partial [Citrus clementina]
 gb|ESR36592.1| hypothetical protein CICLE_v10030083mg, partial [Citrus clementina]
Length=613

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/609 (59%), Positives = 429/609 (70%), Gaps = 79/609 (13%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+TRLGSL+K AINAS KFRHS   R RR+S+VMSV ++D  +AEE+++VDAFRQAL+
Sbjct  17    DERKTRLGSLKKKAINASTKFRHSLTKRGRRNSKVMSVSIEDCLNAEEMQAVDAFRQALV  76

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP KHDD+HMMLRFLKARKF+I+K+KQMW DMLQWRKEFGADTI++DF+FKE DEV
Sbjct  77    LDELLPAKHDDHHMMLRFLKARKFDIEKTKQMWGDMLQWRKEFGADTIMEDFEFKEIDEV  136

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             LKYYPQGHHGVDKDG+P+YIE LG VD+ KLMQVTTMDRYLKYHV+EFERT   K  +CS
Sbjct  137   LKYYPQGHHGVDKDGQPVYIEWLGQVDSNKLMQVTTMDRYLKYHVKEFERTFISKFPACS  196

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLKNF K AR+L+Q +QKIDGDNYPETL RM+I+NAGSGFR
Sbjct  197   IAAKKHIDQSTTILDVQGVGLKNFNKAARDLVQRIQKIDGDNYPETLNRMFIVNAGSGFR  256

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGGTCTCADKGGCMRSDKG
Sbjct  257   LLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGTCTCADKGGCMRSDKG  316

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEIMKMV  G  KCS R     EEKTI ED              K+   F  E+T 
Sbjct  317   PWNDPEIMKMVQNGYAKCSRRTLSGIEEKTISED---------ENSLSKRYDPFNAEAT-  366

Query  915   KLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDN-CKFVVPKGADLYQIQ----EAYKG  751
                 +  +   P  + P+    V  PN+H+V+ D   +F       LYQ+Q      +K 
Sbjct  367   ----VARDHMHP-TFAPV---RVSFPNFHLVSIDRISQFCFCLFLTLYQLQCMIPVVFKL  418

Query  750   QELAS-----------------------------------------------------NQ  730
             Q  AS                                                     N 
Sbjct  419   QSFASKKLNNAYEFGKSIPVVDKTVDESWLKSMPNKKFANSKDCFTAQHPCKSPEGISNH  478

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAE  550
             +  GV+ FVMGIVTMVRMT NMPR++TE+ LY + ++  D  MKGH  +K   P+++ A+
Sbjct  479   IFGGVLAFVMGIVTMVRMTTNMPRRITEAALYGSQVYYTDSMMKGH--HKLTAPSISGAD  536

Query  549   FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSN  370
             +MAM KRMA LE+K   L+ +P TMPPEKEEML+ A++R+  LEQEL+  KKALE S + 
Sbjct  537   YMAMAKRMAELEDKVKMLTVKPSTMPPEKEEMLNTAVNRVSTLEQELSATKKALENSLAR  596

Query  369   QNELIAYIE  343
             Q EL+AYIE
Sbjct  597   QEELVAYIE  605



>ref|XP_006487242.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Citrus sinensis]
Length=633

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/636 (57%), Positives = 435/636 (68%), Gaps = 85/636 (13%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             A  M+  ++R  +   EK D +   D+R+TRLGSL+K AINAS KFRHS   R RR+S+V
Sbjct  2     ADTMAAPLDRHNKAGLEKSDHENSEDERKTRLGSLKKKAINASTKFRHSLTKRGRRNSKV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSV ++D  +AEE+++VDAFRQAL+LDELLP KHDD+HMMLRFLKARKF+I+K+KQMW D
Sbjct  62    MSVSIEDCLNAEEMQAVDAFRQALVLDELLPAKHDDHHMMLRFLKARKFDIEKTKQMWGD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             MLQWRKEFGADTI++DF+FKE DEVLKYYPQGHHGVDKDG+P+YIE LG VD+ KLMQVT
Sbjct  122   MLQWRKEFGADTIMEDFEFKEIDEVLKYYPQGHHGVDKDGQPVYIECLGQVDSNKLMQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+Q +
Sbjct  182   TMDRYLKYHVKEFERTFISKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVQRI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETL RM+I+NAGSGFRLLWNTVKSFLDPKTTAKI+VL NKYQSKLLEIIDA
Sbjct  242   QKIDGDNYPETLNRMFIVNAGSGFRLLWNTVKSFLDPKTTAKIHVLSNKYQSKLLEIIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             +ELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV  G  KC  R     EEKTI ED 
Sbjct  302   NELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVQNGYAKCLRRTLSGIEEKTISEDE  361

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR--QPDMYVPMVDKTVDLPNWHVVNN  817
                                    +K+  P   E    +  M+       V  PN+H+V+ 
Sbjct  362   N--------------------SLSKRYDPFNAEATVARGHMHPTFAPVRVSFPNFHLVSI  401

Query  816   DN-CKFVVPKGADLYQIQ----EAYKGQELAS----------------------------  736
             D   +F       LYQ+Q      +K Q  AS                            
Sbjct  402   DRISRFCFCLFLTLYQLQCMIPVVFKLQSFASKKLNNAYEFGKSIPVVDKTVDESWLKSM  461

Query  735   -------------------------NQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
                                      N +  GV+ FVMGIVTMVRMT NMPR++TE+ LYS
Sbjct  462   PNQKFANSKDCFTTQHPCKSPEGISNHIFGGVLAFVMGIVTMVRMTTNMPRRITEAALYS  521

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             + ++  D  MKGH  +K   P+++ A++MAM KRMA LE+K   L+ +P TMPPEKEEML
Sbjct  522   SQVYYTDSMMKGH--HKLTAPSISGADYMAMAKRMAELEDKVKMLTMKPSTMPPEKEEML  579

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + A++R+  LEQEL+  KKALE S + Q EL+AYIE
Sbjct  580   NAAVNRVSTLEQELSATKKALENSLARQEELVAYIE  615



>ref|XP_006467150.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Citrus sinensis]
Length=575

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/575 (62%), Positives = 442/575 (77%), Gaps = 28/575 (5%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVV-LDDEHDAEEVKSVDAFRQALI  1816
             D+++TR+GSL+K AI+ASNKFRHS K  RRSS+VMSVV ++D HDAEE+K+VDA RQALI
Sbjct  15    DEKKTRIGSLKKVAISASNKFRHSLKRGRRSSKVMSVVEIEDVHDAEEIKAVDALRQALI  74

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFG D I+ DF+FKE  +V
Sbjct  75    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWSDMLQWRKEFGTDDIMQDFEFKELSQV  134

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+ YP GHHGVDK+G+P+YIERLGLVDATKLMQVT M+RYL YHV+EFERT + K  +CS
Sbjct  135   LECYPHGHHGVDKEGQPVYIERLGLVDATKLMQVTNMERYLNYHVREFERTFDIKFPACS  194

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLK+F K ARELI  +QKIDGDNYPETL RM+IINAGSGFR
Sbjct  195   IAAKKHIDQSTTILDVQGVGLKSFNKAARELITQIQKIDGDNYPETLNRMFIINAGSGFR  254

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             +LWNT+KSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGG+CTCAD+GGCMRSDKG
Sbjct  255   MLWNTIKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTCADQGGCMRSDKG  314

Query  1095  PWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIEST  919
             PW DP+I+KMV  G HKC +   A+  EEKTI ED  ++     ++ +         E  
Sbjct  315   PWKDPDILKMVQNGDHKCKNMGGAQKPEEKTISEDETISFKKIETSNAESPK-----EQC  369

Query  918   KKLFPIQEE-----------TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQ  772
              +L PIQEE            +  D +VPMVDK VD     VV N+  KF +  GA+ Y 
Sbjct  370   PRLSPIQEEFNIMKQNFHKSFKYDDRFVPMVDKPVDASWQKVVENE--KFYLKVGAEDYN  427

Query  771   IQ-EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKG  595
             ++ E  +G    S+QL TGVM FVMGIVTM+R+TKNMP+KLT++T+YSN  +  D   + 
Sbjct  428   MRHEVPEGN--ISSQLFTGVMAFVMGIVTMIRVTKNMPKKLTDATIYSNPGYNVDEVDRH  485

Query  594   HGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                     P +  AE++A+MKRMA LE+    LS +P  M  EKEEML+ A+SR+DALEQ
Sbjct  486   KST-----PGIYGAEYIAVMKRMAELEDAVTILSAKPAAMLAEKEEMLNAAVSRVDALEQ  540

Query  414   elaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             EL   ++ALE+S + Q EL+A+I+KKKKKK +F +
Sbjct  541   ELMSTRRALEDSLARQEELLAFIDKKKKKKKLFNW  575



>ref|XP_011025854.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 isoform X2 [Populus euphratica]
Length=566

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/576 (60%), Positives = 444/576 (77%), Gaps = 29/576 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPS-AEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVV  1879
             M+ AV  PL P+   +M+   D+R+ R+ SL+K AI+ASNKFRHS   + RRSS+VMSV 
Sbjct  1     MATAVCVPLSPNPVPEMEHSGDERKKRIESLKKKAISASNKFRHSLTRKGRRSSKVMSVE  60

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             ++D HD EE+K VDAFRQ LIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQW
Sbjct  61    IEDVHDIEELKVVDAFRQVLILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQW  120

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             RKEFGADT++++F+F+E  EVL++YPQGHHGVDK+GRP+YIE LG  D  KLMQVT MDR
Sbjct  121   RKEFGADTVLEEFEFQELSEVLEHYPQGHHGVDKEGRPVYIESLGKADPAKLMQVTNMDR  180

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             Y+KYHV+EFERT + K  +CS+AAK+HIDQSTTILDVQGVGLK+ TK AR+LI  LQKID
Sbjct  181   YVKYHVREFERTFDAKFPACSLAAKRHIDQSTTILDVQGVGLKSLTKAARDLISRLQKID  240

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             GDNYPETL RM+IINAGSGFR+LWNT+KSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP
Sbjct  241   GDNYPETLNRMFIINAGSGFRMLWNTIKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELP  300

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVN  982
             +FLGGTCTCADKGGCMRSDKGPWNDPEIMKMV  G HKC+ +      +EKTI ED   N
Sbjct  301   EFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVQDGHHKCAKKCGTHYPDEKTICEDDLSN  360

Query  981   vsvsmsaksvkkpaSFKIESTKKLFP---IQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
               +  +          K+E+  +L     + E+  + + Y  +VDK+VD+ +W  V N++
Sbjct  361   SKLHEAP---------KVETAPQLPQPSFVPEKAYKLEEYQLVVDKSVDM-SWKKVVNND  410

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
             C          Y   +A K  +  ++ L TGVM  V GIVTM+++T+N+PRKLT++T+YS
Sbjct  411   C----------YTQYDACKAPQAINSPLFTGVMALVTGIVTMIKVTRNVPRKLTDATIYS  460

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             N  + +D ++KG    +   PA+++A++M ++KRMA LE+K   LS++P +MPPEKEEML
Sbjct  461   NPDYCDDTSVKGR---EQQSPAISSADYMTVLKRMAELEDKVSVLSSKPVSMPPEKEEML  517

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + A+SR++ALEQEL   KKALE+S + Q EL+AY+E
Sbjct  518   NAAISRVEALEQELMATKKALEDSLAQQAELVAYLE  553



>gb|KGN61818.1| hypothetical protein Csa_2G248750 [Cucumis sativus]
Length=603

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/592 (61%), Positives = 447/592 (76%), Gaps = 32/592 (5%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVL  1876
             SG+++RP +  A + ++  ++R+TRL SL++ AINASNKFRHS K R  R SSRVMS+ +
Sbjct  7     SGSLDRPNK-GANEAEMSEEERKTRLASLKQRAINASNKFRHSMKKRGRRNSSRVMSISI  65

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF++DKSKQMW+DMLQWR
Sbjct  66    EDDIDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDVDKSKQMWSDMLQWR  125

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             K+FG+DT++++F+FKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+TKL++VTTMDRY
Sbjct  126   KDFGSDTVMEEFEFKEVDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSTKLLEVTTMDRY  185

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             + YHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELIQ LQKIDG
Sbjct  186   VNYHVREFERTFALKFPACSIAAKKHIDQSTTILDVQGVGLKHFNKSARELIQRLQKIDG  245

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  246   DNYPETLKRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  305

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED------  994
             FLGG+CTCAD+GGCMRSDKGPW DPEI+KMV  G  +C  R     EE+TI ED      
Sbjct  306   FLGGSCTCADQGGCMRSDKGPWKDPEIVKMVQNGEGRCRRRSLSNVEERTISEDDNTTST  365

Query  993   ---GGVNvsvsmsaksvkkpaSFKIESTK--KLFPIQEETR----------QPDMYVPMV  859
                G  N   +  A +    A+    S K  KL P+ EE R          Q + ++P+V
Sbjct  366   KRSGSFNSEAAPDATAAAAAATESCMSPKQAKLTPVLEEIRMSQKLGGCEYQYEKFIPVV  425

Query  858   DKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVR  679
             DK VD  NW +      K+   K  D + + E YK  E  SNQ++ G+M  VMGIVTMVR
Sbjct  426   DKAVD-SNWALSTE---KYTFSK--DPFAVHENYKVPEGFSNQIVGGIMALVMGIVTMVR  479

Query  678   MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFIT  499
             +T+ MP+KLTE+ +YS++++  D +M  H    PP  AV  +++M MMKRMA LEE+   
Sbjct  480   LTRTMPKKLTEAAIYSSTVYY-DGSMAKH-PALPPPAAVPLSDYMTMMKRMAELEERVNV  537

Query  498   LSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             L+ +P  MP +KEEML+ A+ +++ LEQEL   KKALEES S + EL  YIE
Sbjct  538   LNMKPAAMPADKEEMLNIALGKVETLEQELEATKKALEESLSREAELTDYIE  589



>ref|XP_010028612.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Eucalyptus grandis]
 ref|XP_010028613.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Eucalyptus grandis]
Length=579

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/580 (61%), Positives = 436/580 (75%), Gaps = 24/580 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSV  1882
             M+G ++   +P  EK DL+   D+R+TRLGSL+K AINAS KFRHS  K  RRSS+VMSV
Sbjct  1     MTGPLDLAAKPVLEKPDLENSEDERKTRLGSLKKKAINASTKFRHSWTKRGRRSSKVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
               DD+ D+EE+++VDAFRQALILDELLP++HDD HMMLRFL+ARKF+I+K+KQMWADMLQ
Sbjct  61    SFDDDFDSEELQAVDAFRQALILDELLPSRHDDPHMMLRFLRARKFDIEKTKQMWADMLQ  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DFDFKE D+VL+YYPQGHHGVDK+GRPIYIERLG VD  KLMQVTTMD
Sbjct  121   WRKEFGADTIMEDFDFKEIDDVLEYYPQGHHGVDKEGRPIYIERLGKVDPNKLMQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY+KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGL+NF K AR+L+  LQKI
Sbjct  181   RYVKYHVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLRNFNKAARDLVACLQKI  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASEL
Sbjct  241   DGDNYPETLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVN  982
             P+FLGG+CTCADKGGCMRSDKGPWN+P+ +KMVH G  KC  +++ ++E KTI ++    
Sbjct  301   PEFLGGSCTCADKGGCMRSDKGPWNNPDTLKMVHNGESKCERKLSDIDE-KTISQEKECV  359

Query  981   vsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP-DMYVPMVDKTVD------LPNWHVV  823
              S   +   V       +   K     + +T    D +V ++DK VD      LP     
Sbjct  360   SSNLTAVPDVSNLEPPCVTKDKIFLAKKCDTDNAYDHFVTIIDKAVDNDWIKTLPTSKSG  419

Query  822   NNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTES  643
                 C FV P         +  K  +  S+ +L GV+ F+MGI T+VRMT+++PRKLT+ 
Sbjct  420   LKKGC-FVPP---------DHCKPHDAISSHILNGVLAFIMGIFTVVRMTRDIPRKLTDG  469

Query  642   TLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEK  463
              LYS   +  D   KGH   + PEP+++  +++ MMKRMA LEEK I L  +  +MPPEK
Sbjct  470   NLYSTPTYYVDTMKKGH---QLPEPSISRDDYLNMMKRMAELEEKVIVLGTKQASMPPEK  526

Query  462   EEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EEML  A+SR++ALEQEL+  KKALEES + Q EL+A+IE
Sbjct  527   EEMLIAAVSRVEALEQELSSTKKALEESIARQEELLAFIE  566



>ref|XP_006285310.1| hypothetical protein CARUB_v10006692mg [Capsella rubella]
 gb|EOA18208.1| hypothetical protein CARUB_v10006692mg [Capsella rubella]
Length=543

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/562 (63%), Positives = 426/562 (76%), Gaps = 37/562 (7%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   RRRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  12    RMGSFKKRS--SSKNLRYSMTKRRRSSKVMSVDIIEDVHDAEELKAVDAFRQSLILDELL  69

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  70    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYYP  129

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLGLVD+TKLMQVTTMDRY+ YHV+EFERT N K+ +C+IAAKK
Sbjct  130   QGHHGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVNYHVREFERTFNVKLPACTIAAKK  189

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  190   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  249

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD+GGCMRSDKGPW +P
Sbjct  250   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADEGGCMRSDKGPWKNP  309

Query  1080  EIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIMK VH G HKCS R  A    E TIPE                       +ST +  P
Sbjct  310   EIMKKVHNGDHKCSKRSQAENIAENTIPEGD---------------------DSTTEPAP  348

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E++      VP        P W+    +  KF + K  ++Y I+EA      E   + 
Sbjct  349   EEEKSSTGAEIVP-----AGHPAWN--KPEAQKFSLSK-KEVYAIKEACSNATTEGGRSP  400

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ M+ ND +M      + K   PA++ 
Sbjct  401   IFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPMYCNDASMNKSAMQSEKMTVPAISG  460

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  461   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNVLEQELAATKKALDDSL  520

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q EL+AYIEKKKKKK +F +
Sbjct  521   GRQEELVAYIEKKKKKKKLFNY  542



>gb|KHN27029.1| Sec14 cytosolic factor, partial [Glycine soja]
Length=590

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/557 (62%), Positives = 408/557 (73%), Gaps = 35/557 (6%)
 Frame = -2

Query  1989  DRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILD  1810
             ++  R+GSL+K   N+  + +    S+     VMSV ++D  DAEE K+VD FRQAL+LD
Sbjct  1     EKSDRVGSLKKMLRNSLTRSKRRSSSK-----VMSVEIEDIRDAEESKAVDEFRQALVLD  55

Query  1809  ELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLK  1630
             ELLP KHDDYHM+LRFLKARKF+++KSKQMW+DMLQWRKEFGADTI +DF+FKE DEVL+
Sbjct  56    ELLPEKHDDYHMLLRFLKARKFDLEKSKQMWSDMLQWRKEFGADTITEDFEFKELDEVLQ  115

Query  1629  YYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIA  1450
             YYPQGHHGVDKDGRPIYIERLG VDATKLMQVTTMDRY+KYHV+EFERT + K ++C+IA
Sbjct  116   YYPQGHHGVDKDGRPIYIERLGQVDATKLMQVTTMDRYIKYHVKEFERTFDVKFAACTIA  175

Query  1449  AKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLL  1270
             AKKHIDQSTTILDVQGVGLKNF K ARELI  LQKIDGDNYPETL RM+IINAGSGFR+L
Sbjct  176   AKKHIDQSTTILDVQGVGLKNFNKHARELITRLQKIDGDNYPETLNRMFIINAGSGFRML  235

Query  1269  WNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPW  1090
             WNTVKSFLDPKTT+KI+VLGNKYQSKLLEIID SELP+FLGG CTCAD+GGCMRSDKGPW
Sbjct  236   WNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDESELPEFLGGACTCADQGGCMRSDKGPW  295

Query  1089  NDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKK  913
              D +IMKMV  G HKCS +    V EEKT  E+       +  A         ++ S   
Sbjct  296   KDADIMKMVQNGEHKCSRKCEVPVMEEKTTSEEHETPKLEANLAA--------QLSSVFA  347

Query  912   LFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
               P  +     D +VP  DKT     W+    +N KF V K  D Y + +++K  E  ++
Sbjct  348   EVPASKAYNYED-FVPEADKTA----WNKKMEENEKFAVSK-VDAYAMVDSFKIHEKVNS  401

Query  732   QLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE------  571
             Q+ TGVM FVMGIVTMVRMTKNMP+KLT++  YSN          G    + P       
Sbjct  402   QIFTGVMAFVMGIVTMVRMTKNMPKKLTDANFYSN--------FGGEYKGQAPNTEEMTT  453

Query  570   -PAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
              P ++A EFM +MKRMA LE++ + ++NQ   MPPEKEEML+ A+SR DALEQEL   KK
Sbjct  454   MPNISAQEFMTVMKRMAELEDRMVNMNNQTTCMPPEKEEMLNAAISRADALEQELLATKK  513

Query  393   aleesqSNQNELIAYIE  343
             ALE+S S Q EL AYIE
Sbjct  514   ALEDSLSKQEELSAYIE  530



>ref|XP_006425618.1| hypothetical protein CICLE_v10025176mg [Citrus clementina]
 gb|ESR38858.1| hypothetical protein CICLE_v10025176mg [Citrus clementina]
Length=620

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/564 (62%), Positives = 433/564 (77%), Gaps = 28/564 (5%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVV-LDDEHDAEEVKSVDAFRQALI  1816
             D+++TR+GSL+K AI+ASNKFRHS K  RRSS+VMSVV ++D HDAEE+K+VDA RQALI
Sbjct  15    DEKKTRIGSLKKVAISASNKFRHSLKRGRRSSKVMSVVEIEDVHDAEEIKAVDALRQALI  74

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFG D I+ DF+FKE  +V
Sbjct  75    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWSDMLQWRKEFGTDDIMQDFEFKELSQV  134

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+ YP GHHGVDK+G+P+YIERLGLVDATKLMQVT M+RYL YHV+EFERT + K  +CS
Sbjct  135   LECYPHGHHGVDKEGQPVYIERLGLVDATKLMQVTNMERYLNYHVREFERTFDIKFPACS  194

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLK+F K ARELI  +QKIDGDNYPETL RM+IINAGSGFR
Sbjct  195   IAAKKHIDQSTTILDVQGVGLKSFNKAARELITQIQKIDGDNYPETLNRMFIINAGSGFR  254

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             +LWNT+KSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGG+CTCAD+GGCMRSDKG
Sbjct  255   MLWNTIKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTCADQGGCMRSDKG  314

Query  1095  PWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIEST  919
             PW DP+I+KMV  G HKC +   A+  EEKTI ED  ++     ++ +         E  
Sbjct  315   PWKDPDILKMVQNGDHKCKNMGGAQKPEEKTISEDETISFKKIETSNAESPK-----EQC  369

Query  918   KKLFPIQEE-----------TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQ  772
              +L PIQEE            +  D +VPMVDK VD     VV N+  KF +  GA+ Y 
Sbjct  370   PRLSPIQEEFNIMKQNFHKSFKYDDRFVPMVDKPVDASWQKVVENE--KFYLKVGAEDYN  427

Query  771   IQ-EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKG  595
             ++ E  +G    S+QL TGVM FVMGIVTM+R+TKNMP+KLT++T+YSN  +  D   + 
Sbjct  428   MRHEVPEGN--ISSQLFTGVMAFVMGIVTMIRVTKNMPKKLTDATIYSNPGYNVDEVDRH  485

Query  594   HGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                     P +  AE++A+MKRMA LE+    LS +P  M  EKEEML+ A+SR+DALEQ
Sbjct  486   KST-----PGIYGAEYIAVMKRMAELEDAVTILSAKPAAMLAEKEEMLNAAVSRVDALEQ  540

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   ++ALE+S + Q EL+A+I+
Sbjct  541   ELMSTRRALEDSLARQEELLAFID  564



>ref|XP_004169148.1| PREDICTED: uncharacterized LOC101214906, partial [Cucumis sativus]
Length=572

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/564 (60%), Positives = 424/564 (75%), Gaps = 32/564 (6%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk--frhsfksrrrssRVMSVVL  1876
             SG+++RP +  A + ++  ++R+TRL SL++ AINASNK       + RR SSRVMS+ +
Sbjct  7     SGSLDRPNK-GANEAEMSEEERKTRLASLKQRAINASNKFRHSMKKRGRRNSSRVMSISI  65

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF++DKSKQMW+DMLQWR
Sbjct  66    EDDIDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDVDKSKQMWSDMLQWR  125

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             K+FG+DT++++F+FKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+TKL++VTTMDRY
Sbjct  126   KDFGSDTVMEEFEFKEVDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSTKLLEVTTMDRY  185

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             + YHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELIQ LQKIDG
Sbjct  186   VNYHVREFERTFALKFPACSIAAKKHIDQSTTILDVQGVGLKHFNKSARELIQRLQKIDG  245

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  246   DNYPETLKRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  305

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED------  994
             FLGG+CTCAD+GGCMRSDKGPW DPEI+KMV  G  +C  R     EE+TI ED      
Sbjct  306   FLGGSCTCADQGGCMRSDKGPWKDPEIVKMVQNGEGRCRRRSLSNVEERTISEDDNTTST  365

Query  993   ---GGVNvsvsmsaksvkkpaSFKIESTK--KLFPIQEETR----------QPDMYVPMV  859
                G  N   +  A +    A+    S K  KL P+ EE R          Q + ++P+V
Sbjct  366   KRSGSFNSEAAPDATAAAAAATESCMSPKQAKLTPVLEEIRMSQKLGGCEYQYEKFIPVV  425

Query  858   DKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVR  679
             DK VD  NW +      K+   K  D + + E YK  E  SNQ++ G+M  VMGIVTMVR
Sbjct  426   DKAVD-SNWALSTE---KYTFSK--DPFAVHENYKVPEGFSNQIVGGIMALVMGIVTMVR  479

Query  678   MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFIT  499
             +T+ MP+KLTE+ +YS++++  D +M  H    PP  AV  +++M MMKRMA LEE+   
Sbjct  480   LTRTMPKKLTEAAIYSSTVYY-DGSMAKH-PALPPPAAVPLSDYMTMMKRMAELEERVNV  537

Query  498   LSNQPPTMPPEKEEMLSNAMSRID  427
             L+ +P  MP +KEEML+ A+ +++
Sbjct  538   LNMKPAAMPADKEEMLNIALGKVE  561



>ref|XP_002867013.1| hypothetical protein ARALYDRAFT_912720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43272.1| hypothetical protein ARALYDRAFT_912720 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/562 (62%), Positives = 420/562 (75%), Gaps = 37/562 (7%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   RRRSS+VMS  +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  12    RMGSFKKRS--SSKNLRYSMTKRRRSSKVMSAEIIEDVHDAEELKAVDAFRQSLILDELL  69

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  70    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYYP  129

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLGLVD+TKLMQVTTMDRY+ YHV EFERT N K  +CSIAAKK
Sbjct  130   QGHHGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKK  189

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  190   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  249

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGCMRSDKGPW +P
Sbjct  250   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDDSELPEFLGGSCTCADNGGCMRSDKGPWKNP  309

Query  1080  EIMKMVHQGAHKCSH-RMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIMK VH G HKCS    A    EKTIPE+                       ST +   
Sbjct  310   EIMKRVHNGDHKCSKGSKAENSAEKTIPEENA---------------------STTEPAS  348

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E+       VP      ++P  H       KF + K  ++Y IQEA      E   + 
Sbjct  349   EEEKASTEVEIVPAAHPAWNMPEAH-------KFSLSK-KEVYAIQEACNNATTEGGRSP  400

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ ++ +D +M      + K   PA++ 
Sbjct  401   IFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQSEKMTVPAISG  460

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  461   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNVLEQELAATKKALDDSL  520

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q EL+AYIEKKKKKK +F +
Sbjct  521   GRQEELVAYIEKKKKKKKLFNY  542



>ref|NP_568006.1| protein SEC14-like 12 [Arabidopsis thaliana]
 sp|Q94A34.1|SFH12_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
12; Short=AtSFH12 [Arabidopsis thaliana]
 gb|AAK91435.1| C7A10_870/C7A10_870 [Arabidopsis thaliana]
 gb|AAN33209.1| At4g36490/C7A10_870 [Arabidopsis thaliana]
 gb|AEE86662.1| protein SEC14-like 12 [Arabidopsis thaliana]
Length=543

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/562 (62%), Positives = 423/562 (75%), Gaps = 37/562 (7%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   RRRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  12    RMGSFKKRS--SSKNLRYSMTKRRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELL  69

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  70    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYYP  129

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLGLVD+TKLMQVTTMDRY+ YHV EFERT N K  +CSIAAKK
Sbjct  130   QGHHGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKK  189

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  190   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  249

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGCMRSDKGPW +P
Sbjct  250   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMRSDKGPWKNP  309

Query  1080  EIMKMVHQGAHKCSH-RMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIMK VH G HKCS    A    EKTIPE+                      +ST +   
Sbjct  310   EIMKRVHNGDHKCSKGSQAENSGEKTIPEED---------------------DSTTEPAS  348

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E+  +    VP      ++P  H       KF + K  ++Y IQEA      E   + 
Sbjct  349   EEEKASKEVEIVPAAHPAWNMPEAH-------KFSLSK-KEVYAIQEACNNATTEGGRSP  400

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+++TKN+PRKLTESTLYS+ ++ +D +M      + K   PA++ 
Sbjct  401   IFTGVMALVMGVVTMIKVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQSEKMTVPAISG  460

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  461   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNVLEQELAATKKALDDSL  520

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q EL+AYIEKKKKKK +F +
Sbjct  521   GRQEELVAYIEKKKKKKKLFNY  542



>ref|XP_002521526.1| Sec14 cytosolic factor, putative [Ricinus communis]
 gb|EEF40797.1| Sec14 cytosolic factor, putative [Ricinus communis]
Length=547

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/583 (62%), Positives = 445/583 (76%), Gaps = 41/583 (7%)
 Frame = -2

Query  2046  GAVERPL--RPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
              AV  PL   P  E MD   D+R+TR+ SL+K AINASNKFR+SF  + RRSS+VMS+ +
Sbjct  2     AAVSGPLSLNPVPE-MDHLGDERKTRIESLKKKAINASNKFRNSFTRKGRRSSKVMSIEI  60

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D HDAEE+K+VDAFRQ LIL+ELLP+KHDDYH+MLRFLKARKF+++K+KQMW+DMLQWR
Sbjct  61    EDVHDAEELKAVDAFRQVLILEELLPSKHDDYHVMLRFLKARKFDLEKTKQMWSDMLQWR  120

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DF+F E DEVL+YYPQGHHGVDKDGRP+YIERLG VDA KLMQVT +DRY
Sbjct  121   KEFGADTIMEDFEFNEIDEVLQYYPQGHHGVDKDGRPVYIERLGQVDANKLMQVTNLDRY  180

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +KYHVQEFERT   K  +CS+AAK+HIDQSTTILDVQGVGLKNF K AR+LI  LQKIDG
Sbjct  181   VKYHVQEFERTFAVKFPACSLAAKRHIDQSTTILDVQGVGLKNFNKAARDLITRLQKIDG  240

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFR+LWNT+KSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+
Sbjct  241   DNYPETLNRMFIINAGSGFRMLWNTIKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPE  300

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNv  979
             FLGGTCTCAD+GGCMRSDKGPW D EI+KMV  G HKC+ +  +++ +EKT  +D  V  
Sbjct  301   FLGGTCTCADQGGCMRSDKGPWKDQEILKMVQNGDHKCTKKCESQIPDEKTASDDDTV--  358

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
                           F   S+K            + Y P+++KTVD+  W  +  D  K+ 
Sbjct  359   --------------FSKVSSK-----------FEDYGPIIEKTVDM-TWKQLAEDE-KYT  391

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
             + K AD Y   +  K  E  S  + TGVM FVMGIVTM+++T+NMPRKLT +T+YS+S++
Sbjct  392   LTK-ADCYANYDGSKVSEGGS-PIFTGVMAFVMGIVTMIKVTRNMPRKLTNATIYSSSVY  449

Query  618   LNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAM  439
              ++  +K     +  EPA++ A++M ++KRMA LEEK   LS + P M P+KEEM + AM
Sbjct  450   CDEAEVKS----RAHEPAISTADYMTVIKRMAELEEKVNVLSMK-PAMTPKKEEMYNAAM  504

Query  438   SRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             SR+D LEQEL   +KALE+S + Q ELIAY++KKKKKK +F +
Sbjct  505   SRVDTLEQELMATRKALEDSLARQEELIAYLDKKKKKKKLFNW  547



>gb|KFK30270.1| hypothetical protein AALP_AA7G239600 [Arabis alpina]
Length=542

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/571 (62%), Positives = 423/571 (74%), Gaps = 38/571 (7%)
 Frame = -2

Query  2007  MDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFR  1828
             M L  D  + R+GS +K +  +S   R+S   RRRSS+VMSV ++D HDAEE+K+VDAFR
Sbjct  1     MSLTHDAVKPRMGSFKKRS--SSKNLRYSISKRRRSSKVMSVEIEDVHDAEELKAVDAFR  58

Query  1827  QALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKE  1648
             Q LILDELLP KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT+++DF+FKE
Sbjct  59    QLLILDELLPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVVEDFEFKE  118

Query  1647  RDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKM  1468
              D+VLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV EFERT N K 
Sbjct  119   IDDVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVMEFERTFNVKF  178

Query  1467  SSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAG  1288
              +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI  LQ +DG+NYPETL RM+IINAG
Sbjct  179   PACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQNVDGNNYPETLNRMFIINAG  238

Query  1287  SGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMR  1108
             SGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGCMR
Sbjct  239   SGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMR  298

Query  1107  SDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFK  931
             SDKGPW +PE+MKMVH G HKC+ R  A    EKTI E+                     
Sbjct  299   SDKGPWKNPEVMKMVHNGDHKCTKRSQAENSVEKTISEED--------------------  338

Query  930   IESTKKLFPIQEETR---QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
              +S  +  P +E+      P   VP+     + P  H       KF + K  ++Y IQEA
Sbjct  339   -DSPTEQAPEEEKASTEASPSEVVPVAHPAWNRPEAH-------KFSLSK-KEVYAIQEA  389

Query  759   YKGQEL--ASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAM-KGHG  589
                       + + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ ++ +D +M K   
Sbjct  390   CNNATTDGGRSPIFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPVYCDDESMNKSSM  449

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
               +   PA++  +FMA+MKRMA LE+K   LS QP TMPPEKEEML+ A+SR + LEQEL
Sbjct  450   QSEKMIPAISGEDFMAIMKRMAELEQKVTVLSAQPTTMPPEKEEMLNAAISRSNILEQEL  509

Query  408   aeakkaleesqSNQNELIAYIEkkkkkKNIF  316
             A  KKALE+S   Q EL+AYIEKKKKKK +F
Sbjct  510   AATKKALEDSLGRQEELVAYIEKKKKKKKLF  540



>ref|XP_004500796.1| PREDICTED: uncharacterized protein LOC101489636 isoform X1 [Cicer 
arietinum]
 ref|XP_004500797.1| PREDICTED: uncharacterized protein LOC101489636 isoform X2 [Cicer 
arietinum]
Length=577

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/544 (60%), Positives = 411/544 (76%), Gaps = 15/544 (3%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  ++RP++    +M+   D+++ R+GS++K AI+AS+KF+HSF  + RR SRVMSV  
Sbjct  5     MSATLDRPVKLGGHEMEHSEDEKKKRVGSIKKVAISASSKFKHSFTKKGRRHSRVMSVSF  64

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQ LIL+ELLP+KHDD HMMLRFL+ARK++I+K+KQMW+DML+WR
Sbjct  65    EDDFDAEELQAVDAFRQTLILEELLPSKHDDPHMMLRFLRARKYDIEKTKQMWSDMLKWR  124

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DF+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD  KL+QVT+++RY
Sbjct  125   KEFGADTIMEDFEFKELDEVLKYYPQGHHGVDKEGRPVYIERLGQVDCNKLLQVTSVERY  184

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  185   LKYHVREFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLLQRLQKIDG  244

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+
Sbjct  245   DNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPE  304

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDPEI+KM   G  KC+       EEKTI +D      
Sbjct  305   FLGGTCTCADKGGCMLSDKGPWNDPEILKMAQNGVGKCTRNALSGIEEKTIRQDETAYQK  364

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEE--TRQPDMYVPMVDKTVDLPNWHVVNNDNCKF  802
                 +           +   K + + ++    Q D YVP++DK+VD       +ND  KF
Sbjct  365   GFRDSFPETHDVHCLSQEQPKSYGVAKQCGVYQYDSYVPVLDKSVDSSWKKTTHND--KF  422

Query  801   VVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              + K AD +          + S Q + G+M  VMGIVTM+RMT +MPRKLTE+ LY NS 
Sbjct  423   ALSKAADCFPNNNEKNSGRIGS-QFVGGIMALVMGIVTMIRMTSSMPRKLTEAALYGNSE  481

Query  621   HLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
             + +   MK         PA+++ E+MAMMKRMA LEEK   LS + P+MPPEKEEML+NA
Sbjct  482   YYDGTMMKA--------PAISSNEYMAMMKRMADLEEKVTILSVR-PSMPPEKEEMLNNA  532

Query  441   MSRI  430
             ++R+
Sbjct  533   LTRV  536



>gb|KFK30271.1| hypothetical protein AALP_AA7G239600 [Arabis alpina]
Length=544

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/562 (61%), Positives = 415/562 (74%), Gaps = 38/562 (7%)
 Frame = -2

Query  2007  MDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFR  1828
             M L  D  + R+GS +K +  +S   R+S   RRRSS+VMSV ++D HDAEE+K+VDAFR
Sbjct  1     MSLTHDAVKPRMGSFKKRS--SSKNLRYSISKRRRSSKVMSVEIEDVHDAEELKAVDAFR  58

Query  1827  QALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKE  1648
             Q LILDELLP KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT+++DF+FKE
Sbjct  59    QLLILDELLPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVVEDFEFKE  118

Query  1647  RDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKM  1468
              D+VLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV EFERT N K 
Sbjct  119   IDDVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVMEFERTFNVKF  178

Query  1467  SSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAG  1288
              +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI  LQ +DG+NYPETL RM+IINAG
Sbjct  179   PACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQNVDGNNYPETLNRMFIINAG  238

Query  1287  SGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMR  1108
             SGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGCMR
Sbjct  239   SGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMR  298

Query  1107  SDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFK  931
             SDKGPW +PE+MKMVH G HKC+ R  A    EKTI E+                     
Sbjct  299   SDKGPWKNPEVMKMVHNGDHKCTKRSQAENSVEKTISEED--------------------  338

Query  930   IESTKKLFPIQEETR---QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
              +S  +  P +E+      P   VP+     + P  H       KF + K  ++Y IQEA
Sbjct  339   -DSPTEQAPEEEKASTEASPSEVVPVAHPAWNRPEAH-------KFSLSK-KEVYAIQEA  389

Query  759   YKGQEL--ASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAM-KGHG  589
                       + + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ ++ +D +M K   
Sbjct  390   CNNATTDGGRSPIFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPVYCDDESMNKSSM  449

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
               +   PA++  +FMA+MKRMA LE+K   LS QP TMPPEKEEML+ A+SR + LEQEL
Sbjct  450   QSEKMIPAISGEDFMAIMKRMAELEQKVTVLSAQPTTMPPEKEEMLNAAISRSNILEQEL  509

Query  408   aeakkaleesqSNQNELIAYIE  343
             A  KKALE+S   Q EL+AYIE
Sbjct  510   AATKKALEDSLGRQEELVAYIE  531



>ref|XP_006411998.1| hypothetical protein EUTSA_v10024850mg [Eutrema salsugineum]
 gb|ESQ53451.1| hypothetical protein EUTSA_v10024850mg [Eutrema salsugineum]
Length=545

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/572 (62%), Positives = 426/572 (74%), Gaps = 34/572 (6%)
 Frame = -2

Query  2007  MDLDADDRQT-RLGSLRKAAINAsnkfrhsfksrrrssRVMSVV-LDDEHDAEEVKSVDA  1834
             M L  D R+  R+GS ++ +  +S   R+S   RRRSS+VMSV  ++D HDAEE+K+VDA
Sbjct  1     MSLIQDAREKPRMGSFKRRS--SSKNLRYSMTKRRRSSKVMSVEEIEDVHDAEELKAVDA  58

Query  1833  FRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDF  1654
             FRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++F+F
Sbjct  59    FRQALILDELLPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFEF  118

Query  1653  KERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNND  1474
             KE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV EFERT N 
Sbjct  119   KEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVMEFERTFNV  178

Query  1473  KMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIIN  1294
             K  +CSIAAKKH+DQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IIN
Sbjct  179   KFPACSIAAKKHVDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIIN  238

Query  1293  AGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGC  1114
             AGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGC
Sbjct  239   AGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGC  298

Query  1113  MRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaS  937
             MRSDKGPWN+PEIMK V+ G HKCS R  A    +KTI E                    
Sbjct  299   MRSDKGPWNNPEIMKRVNNGDHKCSKRSQAENCAQKTISEGN------------------  340

Query  936   FKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAY  757
                E T +  P  EE +      P     V  P W++   +  KF + K  ++Y IQEA 
Sbjct  341   ---EPTTE--PAPEEEKASSQLSPCEIAPVAHPAWNM--PEAHKFSLSK-KEVYAIQEAC  392

Query  756   KGQEL--ASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAM-KGHGA  586
                      + + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ ++ +D +M K    
Sbjct  393   NNATTDGGRSPIFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQ  452

Query  585   YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqela  406
              +   PA++  +FMA+MKRMA LE+K   LS QP TMPPEKEEML+ A+SR + LEQELA
Sbjct  453   SEKMTPAISGEDFMAIMKRMAELEQKVTVLSAQPTTMPPEKEEMLNAAISRSNVLEQELA  512

Query  405   eakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
               KKAL +S S Q EL+AYIEKKKKKK IF +
Sbjct  513   ATKKALNDSLSRQEELVAYIEKKKKKKKIFNY  544



>ref|XP_010489517.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10-like [Camelina sativa]
Length=549

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/531 (63%), Positives = 404/531 (76%), Gaps = 25/531 (5%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV +++DEHDAEE+K+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIIEDEHDAEELKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIP  1000
             DA+ELP+ LGG+C CAD GGCMRSDKGPWN+P+IMK V+ G HKCS R  A    E T  
Sbjct  281   DATELPECLGGSCICADNGGCMRSDKGPWNNPDIMKRVNNGDHKCSKRSQAENAAENTTF  340

Query  999   EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVN  820
             E+  V+   + SA                      ET Q  +  P  +  V  P W++  
Sbjct  341   EEDIVHSKGNDSAAEEAL-----------------ETDQSQLSSPCQNVVVAHPAWNIPE  383

Query  819   NDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTES  643
                 KF + KG D+Y IQEA K   E+  + + TGVM F+MG+ TM+R+TKN+PRKLTES
Sbjct  384   AH--KFSISKG-DVYAIQEACKATNEIGRSPVFTGVMAFMMGVFTMIRVTKNVPRKLTES  440

Query  642   TLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEK  463
             TLYS  ++ ND +M  + +       ++  +FMA MKR+A LE K   LS QP TMPPEK
Sbjct  441   TLYSTPVYCNDKSM--NKSSMQSTATISGEDFMAFMKRLAELEHKVTILSAQPATMPPEK  498

Query  462   EEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             EEML+ A+S++D LEQEL+  KKAL++S   Q +L+AYIE+KKKKK +F +
Sbjct  499   EEMLNAAISQVDVLEQELSATKKALDDSLGRQEDLVAYIERKKKKKKLFTW  549



>ref|XP_011028447.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Populus euphratica]
Length=554

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/560 (61%), Positives = 436/560 (78%), Gaps = 22/560 (4%)
 Frame = -2

Query  2007  MDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEEVKSVDAF  1831
             M+   D+R+ R+ S++K AI+ASNK      +  RRSS+VMSV ++D HD+EE+K+VDAF
Sbjct  1     MEHTGDERKNRIESIKKKAISASNKFRHSLTRKSRRSSKVMSVEIEDVHDSEELKAVDAF  60

Query  1830  RQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFK  1651
             RQ LIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFGADT++++F+F+
Sbjct  61    RQVLILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQWRKEFGADTVLEEFEFQ  120

Query  1650  ERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDK  1471
             E +EVL+YYPQGHHGVDK+GRP+YIE LG  D  KLMQVT MDRY+KYHV+EFERT + K
Sbjct  121   ELNEVLEYYPQGHHGVDKEGRPVYIESLGKADPAKLMQVTNMDRYVKYHVREFERTFDAK  180

Query  1470  MSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINA  1291
               +CS+AAK+HIDQSTTILDVQGVGLK+FTK AR+LI  LQKIDGDNYPETL RM+IINA
Sbjct  181   FPACSLAAKRHIDQSTTILDVQGVGLKSFTKAARDLITRLQKIDGDNYPETLNRMFIINA  240

Query  1290  GSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCM  1111
             GSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTCADKGGC+
Sbjct  241   GSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADKGGCV  300

Query  1110  RSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVNvsvsmsaksvkkpaSF  934
             RSDKGPWNDPEI+KMV  G HKC+ +   +  +EKTI ED           +  K+  S 
Sbjct  301   RSDKGPWNDPEILKMVQNGDHKCAKKCGTQYPDEKTICEDD---------LRCSKRLDSS  351

Query  933   KIEST---KKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQE  763
             K+ES     +  P+ E   + + Y  +VDK++D+ +W  V  DN  F + K  D Y   +
Sbjct  352   KVESAPEHPQSSPVPERAYKFEDYDLLVDKSMDM-SWKKV--DNGMFDLSK--DCYTQYD  406

Query  762   AYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAY  583
             A K  +  ++ L TGVM  V GIVTM+R+T+N+PRK+T++T+YS+ ++ +D A+K   + 
Sbjct  407   ACKAPQAINSPLFTGVMALVTGIVTMIRVTRNVPRKMTDATIYSSPVYCDDTAVK---SL  463

Query  582   KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
             +   PA+++ ++M ++KRMA LE+K   LS +P +MPPEKEEML+ A+SR+D LEQEL  
Sbjct  464   EHQSPALSSEDYMTVLKRMAELEDKVSVLSAKPVSMPPEKEEMLNAALSRVDGLEQELMA  523

Query  402   akkaleesqSNQNELIAYIE  343
              KKALEES + Q EL+AY++
Sbjct  524   TKKALEESLAQQAELVAYLD  543



>ref|XP_002886154.1| hypothetical protein ARALYDRAFT_900189 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62413.1| hypothetical protein ARALYDRAFT_900189 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/525 (63%), Positives = 400/525 (76%), Gaps = 36/525 (7%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV + +DEHDAEEVK+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIFEDEHDAEEVKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML+WRKEFGADT+++DF+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLRWRKEFGADTVMEDFEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR--MARVEEEKTI  1003
             DASELP+FLGG+CTCAD GGCMRSDKGPWN+ +IMK V+ G HKCS R     V +  T 
Sbjct  281   DASELPEFLGGSCTCADNGGCMRSDKGPWNNLDIMKRVNNGDHKCSKRSQAENVADNTTS  340

Query  1002  PEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPD--MYVPMVDKTVDLPNWH  829
              E+ G + +V                         EE  + D  +  P  +  V  P W+
Sbjct  341   EENIGNDSAV-------------------------EEAPETDQSLLSPCQNVVVAHPAWN  375

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
             +   +  KF + K  D+Y IQEA K   E   + + TGVM FVMG+VTM+R+TKN+PRKL
Sbjct  376   I--PEAHKFSLSK-RDVYAIQEACKATNESGRSPIFTGVMAFVMGVVTMIRVTKNVPRKL  432

Query  651   TESTLYSNSMHLNDHAMKGHGAY--KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPT  478
             TEST+YS+ ++ ++++M     +  K     ++   FMA+MKRMA LE+K   LS QP T
Sbjct  433   TESTIYSSPVYCDENSMNKSSMHEGKMATTTISGDNFMAVMKRMAELEQKVTILSAQPIT  492

Query  477   MPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             MPPEKEEML++A+SR D LEQELA  KKAL++S   Q +L+AY+E
Sbjct  493   MPPEKEEMLNDAISRADFLEQELAATKKALDDSLGRQEDLVAYVE  537



>ref|XP_010467629.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10 isoform X2 [Camelina sativa]
Length=548

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/534 (63%), Positives = 400/534 (75%), Gaps = 32/534 (6%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV +++DEHDAEE+K+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIIEDEHDAEELKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR--MARVEEEKTI  1003
             DASELP+FLGG+CTCAD GGCMRSDKGPWN+P+IMK V+ G HKCS R       E  T 
Sbjct  281   DASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNGDHKCSKRSQAENAAENTTF  340

Query  1002  PEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPD--MYVPMVDKTVDLPNWH  829
              ED                     I  +K      EE  + D     P  +  V  P W+
Sbjct  341   EED---------------------IVHSKGNDSTAEEALETDHSQLSPCQNVVVAHPAWN  379

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
             +      KF + +G D+Y IQEA K   E+  + + TGVM FVMG+ TM+R+TKN+PRKL
Sbjct  380   IPEAH--KFSISQG-DVYAIQEACKATNEIGRSPVFTGVMAFVMGVFTMIRVTKNVPRKL  436

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             TESTLYS  ++ +D +      +      ++  +FMA MKR+A LE K   LS QP TMP
Sbjct  437   TESTLYSTPVYCDDKSTNKSSMHST--ATISGEDFMAFMKRLAELEHKVTILSAQPATMP  494

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             PEKEEML+ A+S+ D LEQEL+  KKAL++S   Q +L+AYIE+KKKKK +F +
Sbjct  495   PEKEEMLNAAISQFDVLEQELSATKKALDDSLGRQEDLVAYIERKKKKKKLFTW  548



>ref|XP_006574696.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Glycine max]
Length=555

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/587 (60%), Positives = 423/587 (72%), Gaps = 38/587 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLD  1873
             MSG    PL P   K  L+  DR   +GSL+K   N+  + R    S+     VMSV ++
Sbjct  1     MSG----PLSP---KTSLEKSDR---VGSLKKMLRNSLTRSRRRSSSK-----VMSVEIE  45

Query  1872  DEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRK  1693
             D  DAEE K+VD FRQAL+LDELLP KHDDYHM+LRFLKARKFE++KSKQMW+DMLQWRK
Sbjct  46    DIRDAEESKAVDEFRQALVLDELLPEKHDDYHMLLRFLKARKFELEKSKQMWSDMLQWRK  105

Query  1692  EFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYL  1513
             EFGADTI +DF+FKE +EVL+YYP GHHGVDKDGRP+YIER+G VDATKLMQVTTMDRY+
Sbjct  106   EFGADTISEDFEFKELEEVLQYYPHGHHGVDKDGRPVYIERIGQVDATKLMQVTTMDRYI  165

Query  1512  KYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGD  1333
             KYHV+EFERT + K ++CSI+AKKHIDQSTTILDVQGVGLK+F K ARELI  LQKIDGD
Sbjct  166   KYHVKEFERTFDVKFAACSISAKKHIDQSTTILDVQGVGLKSFNKHARELITRLQKIDGD  225

Query  1332  NYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDF  1153
             NYPETL RM+IINAGSGFR+LWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIID SELP+F
Sbjct  226   NYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDESELPEF  285

Query  1152  LGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNvs  976
             LGGTCTCAD+GGCM SDKGPW D +IMKMV  G HKCS +    V EEKT  E+   +  
Sbjct  286   LGGTCTCADQGGCMHSDKGPWKDADIMKMVQNGDHKCSRKCEVPVMEEKTASEEHETSKL  345

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVV  796
              +            ++ S     P  +     D +VP  DKT     W+   ++N KF +
Sbjct  346   EANLTA--------QLSSVFAGVPASKAYNYED-FVPEADKTA----WNKKMDENEKFAL  392

Query  795   PK--GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              K    D Y + +++   E  ++Q+ TGVM FVMGIVTMVRMTKNMP+KLT++  YSN  
Sbjct  393   SKVGAVDAYAMVDSFNIHEKMNSQIFTGVMAFVMGIVTMVRMTKNMPKKLTDANFYSNF-  451

Query  621   HLNDHAMKGHGAYK---PPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
                    KG           P ++A EFM +MKRMA LE+K + ++NQ   MPPEKEEML
Sbjct  452   ---GSEYKGQATNSEEMTTMPNISAKEFMTVMKRMAELEDKMVKMNNQTICMPPEKEEML  508

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             + A++R DALEQEL   KKALE+S S Q EL AYIEKKKKKK +F +
Sbjct  509   NAAITRADALEQELLATKKALEDSLSKQEELSAYIEKKKKKKKLFAW  555



>ref|XP_010414002.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10-like isoform X1 [Camelina sativa]
 ref|XP_010414010.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10-like isoform X1 [Camelina sativa]
Length=557

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/523 (63%), Positives = 396/523 (76%), Gaps = 32/523 (6%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV +++DEHDAEE+K+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIIEDEHDAEELKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR--MARVEEEKTI  1003
             DA+ELP+FLGG+CTCA+ GGCMRSDKGPWN+P+IMK V+ G HKCS R       E  T 
Sbjct  281   DATELPEFLGGSCTCAENGGCMRSDKGPWNNPDIMKRVNNGDHKCSKRSQAENAAENTTF  340

Query  1002  PEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPD--MYVPMVDKTVDLPNWH  829
              ED                     I  +K      EE  + D     P  +  V  P W+
Sbjct  341   EED---------------------IVHSKGNDSAAEEALETDHSQLSPCQNVVVAHPAWN  379

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
             +   +  KF + KG D+Y IQEA K   E+  + + TGVM FVMG+ TM+R+TKN+PRKL
Sbjct  380   I--PEAHKFSISKG-DVYAIQEACKATNEIGRSPVFTGVMAFVMGVFTMIRVTKNVPRKL  436

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             TESTLYS  ++ ++++M  + +       ++  +FMA MKRMA LE K   LS QP TMP
Sbjct  437   TESTLYSTPVYCDNNSM--NKSLMQSTSTISGEDFMAFMKRMAELEHKVNILSAQPATMP  494

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             PEKEEML+ A+S++D LEQELA  KKAL++S   Q +L+AYIE
Sbjct  495   PEKEEMLNAAISQVDVLEQELAATKKALDDSLGRQKDLVAYIE  537



>ref|XP_010467626.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10 isoform X1 [Camelina sativa]
 ref|XP_010467627.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10 isoform X1 [Camelina sativa]
Length=557

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 392/523 (75%), Gaps = 32/523 (6%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV +++DEHDAEE+K+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIIEDEHDAEELKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR--MARVEEEKTI  1003
             DASELP+FLGG+CTCAD GGCMRSDKGPWN+P+IMK V+ G HKCS R       E  T 
Sbjct  281   DASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNGDHKCSKRSQAENAAENTTF  340

Query  1002  PEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPD--MYVPMVDKTVDLPNWH  829
              ED                     I  +K      EE  + D     P  +  V  P W+
Sbjct  341   EED---------------------IVHSKGNDSTAEEALETDHSQLSPCQNVVVAHPAWN  379

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
             +   +  KF + +G D+Y IQEA K   E+  + + TGVM FVMG+ TM+R+TKN+PRKL
Sbjct  380   I--PEAHKFSISQG-DVYAIQEACKATNEIGRSPVFTGVMAFVMGVFTMIRVTKNVPRKL  436

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             TESTLYS  ++ +D +      +      ++  +FMA MKR+A LE K   LS QP TMP
Sbjct  437   TESTLYSTPVYCDDKSTNKSSMHST--ATISGEDFMAFMKRLAELEHKVTILSAQPATMP  494

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             PEKEEML+ A+S+ D LEQEL+  KKAL++S   Q +L+AYIE
Sbjct  495   PEKEEMLNAAISQFDVLEQELSATKKALDDSLGRQEDLVAYIE  537



>ref|XP_008460963.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X1 [Cucumis melo]
 ref|XP_008460964.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X1 [Cucumis melo]
Length=600

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/582 (60%), Positives = 433/582 (74%), Gaps = 32/582 (5%)
 Frame = -2

Query  2016  AEKMDLDADDRQTRLGSLRKAAINAsnk--frhsfksrrrssRVMSVVLDDEHDAEEVKS  1843
             A ++++  ++R+TRL SL++ AINASNK       +SRR SSRVMS+ ++D+ DAEE+++
Sbjct  13    ANEVEMSEEERKTRLASLKQRAINASNKFRHSMKKRSRRNSSRVMSISIEDDIDAEELQA  72

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+IDKSKQMW+DMLQWRK+FG+DTI+++
Sbjct  73    VDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIDKSKQMWSDMLQWRKDFGSDTIMEE  132

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKL++VTTMDRY+ YHV+EFERT
Sbjct  133   FEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLLEVTTMDRYVNYHVREFERT  192

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
                K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELIQ LQKIDGDNYPETL RM+
Sbjct  193   FALKFPACSIAAKKHIDQSTTILDVQGVGLKHFNKSARELIQRLQKIDGDNYPETLKRMF  252

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADK  1123
             IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+FLGG+CTCAD+
Sbjct  253   IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPEFLGGSCTCADQ  312

Query  1122  GGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkp  943
             GGCMRSDKGPW DPEI+KMV  G  KC  R     EE+TI ED     +    + + +  
Sbjct  313   GGCMRSDKGPWKDPEIVKMVQNGEGKCRRRSLSNVEERTISEDDNTTSTKRSGSFNSEAA  372

Query  942   aSFKIESTK------------KLFPIQEETR----------QPDMYVPMVDKTVDLPNWH  829
                                  KL P+ EE            Q + ++P+VDK VD P+W 
Sbjct  373   PEAAAAGAAAATESCMSPKQTKLTPVMEEIHMAQKFGGCEYQYEKFIPVVDKAVD-PSWA  431

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
             +      K+ + K  D + + E YK  E  SNQ++ G+M  VMGIVTMVR+T+ MP+KLT
Sbjct  432   LSTE---KYTLSK--DPFAVHENYKVPEGFSNQIVGGIMALVMGIVTMVRLTRTMPKKLT  486

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             E+ +YS++++  D +M  H    PP  AV  +++M MMKRMA LEE+   L+ +P  MP 
Sbjct  487   EAAIYSSTVYY-DGSMAKH-PALPPPAAVPLSDYMTMMKRMAELEERVNVLNMKPAAMPA  544

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +KEEML+ A+ +++ LEQEL   KKALEES S + EL  YIE
Sbjct  545   DKEEMLNIALGKVETLEQELEATKKALEESLSREAELTDYIE  586



>gb|AAK64378.1|AF366901_1 phosphatidylinositol transfer-like protein II [Lotus japonicus]
Length=550

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/586 (60%), Positives = 425/586 (73%), Gaps = 42/586 (7%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLD  1873
             MSG    PL P        A D+  R GSL+K A++  +      +       VMSV ++
Sbjct  1     MSG----PLSPKT------ALDKSDRAGSLKKKAMSLRSSLSRKSRRSSSK--VMSVEIE  48

Query  1872  DEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRK  1693
             D  DAE++K+VD FRQALILDELLP KHDDYH +LRFLKARKF+I+KSKQMW+DMLQWRK
Sbjct  49    DVRDAEDLKAVDEFRQALILDELLPEKHDDYHQLLRFLKARKFDIEKSKQMWSDMLQWRK  108

Query  1692  EFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYL  1513
             EFGADTI++DFDFKE DEV+KYYP GHHGVDKDGRP+YIE +G VDATKLMQVTTMDRY+
Sbjct  109   EFGADTIVEDFDFKEIDEVVKYYPHGHHGVDKDGRPVYIENIGQVDATKLMQVTTMDRYI  168

Query  1512  KYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGD  1333
             KYHV+EFERT + K ++CSIAAKKHIDQSTTILDVQGVGLKNF K ARELI  LQKIDGD
Sbjct  169   KYHVKEFERTFDLKFAACSIAAKKHIDQSTTILDVQGVGLKNFNKHARELITRLQKIDGD  228

Query  1332  NYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDF  1153
             NYPETL RM+IINAGSGFR+LW+TVKSFLDPKTT+KI+VLGNKYQSKLLE+IDAS+LP+F
Sbjct  229   NYPETLNRMFIINAGSGFRMLWSTVKSFLDPKTTSKIHVLGNKYQSKLLEVIDASQLPEF  288

Query  1152  LGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDG---GV  985
             LGGTCTCAD+GGCMRSDKGPW DPE+++MV  G HKCS +  + V EEK I E+    G 
Sbjct  289   LGGTCTCADQGGCMRSDKGPWKDPELVRMVQNGEHKCSRKCESPVVEEKKISEETTKMGA  348

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCK  805
             N +              ++ S     P  +     D +VP  D+TV    W  V  +N +
Sbjct  349   NFTS-------------QLSSVFGEVPATKVCNYED-FVPAADETV----WKKV-EENEQ  389

Query  804   FVVPKG-ADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
             F + K   + + + ++ K  E  ++Q+ TGVM FVMGIVTMVRMT+NMP+KLT++  YSN
Sbjct  390   FQMSKAVVETFSMVDSCKIHEKVNSQIFTGVMAFVMGIVTMVRMTRNMPKKLTDANFYSN  449

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
             S++       G        P+++A EFM +MKRMA LEEK   + N    MPPEKEEML+
Sbjct  450   SVYSG-----GQNPSDQTNPSISAQEFMTVMKRMAELEEKMGNM-NYNTCMPPEKEEMLN  503

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              A+SR DALEQEL   KKALE+S + Q EL AYIEKKKKKK +F +
Sbjct  504   AAISRADALEQELMSTKKALEDSLAKQEELSAYIEKKKKKKKLFAW  549



>emb|CAB16843.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80315.1| hypothetical protein [Arabidopsis thaliana]
Length=558

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/562 (62%), Positives = 422/562 (75%), Gaps = 38/562 (7%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   RRRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  28    RMGSFKKRS--SSKNLRYSMTKRRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELL  85

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT+++ FDFKE DEVLKYYP
Sbjct  86    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVME-FDFKEIDEVLKYYP  144

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLGLVD+TKLMQVTTMDRY+ YHV EFERT N K  +CSIAAKK
Sbjct  145   QGHHGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKK  204

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  205   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  264

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD GGCMRSDKGPW +P
Sbjct  265   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMRSDKGPWKNP  324

Query  1080  EIMKMVHQGAHKCSH-RMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIMK VH G HKCS    A    EKTIPE+                      +ST +   
Sbjct  325   EIMKRVHNGDHKCSKGSQAENSGEKTIPEED---------------------DSTTEPAS  363

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E+  +    VP      ++P  H       KF + K  ++Y IQEA      E   + 
Sbjct  364   EEEKASKEVEIVPAAHPAWNMPEAH-------KFSLSK-KEVYAIQEACNNATTEGGRSP  415

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+++TKN+PRKLTESTLYS+ ++ +D +M      + K   PA++ 
Sbjct  416   IFTGVMALVMGVVTMIKVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQSEKMTVPAISG  475

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  476   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNVLEQELAATKKALDDSL  535

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q EL+AYIEKKKKKK +F +
Sbjct  536   GRQEELVAYIEKKKKKKKLFNY  557



>ref|XP_006296648.1| hypothetical protein CARUB_v10015446mg [Capsella rubella]
 gb|EOA29546.1| hypothetical protein CARUB_v10015446mg [Capsella rubella]
Length=545

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/520 (63%), Positives = 393/520 (76%), Gaps = 33/520 (6%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV +++D HDAEE+K+VDAFRQALILDELLP KHDDYHMMLRFLKARKF+++K+KQMW
Sbjct  41    VMSVEIIEDVHDAEELKAVDAFRQALILDELLPDKHDDYHMMLRFLKARKFDLEKTKQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DMLQWRKEFGADT+++DF+FKE DEVLKYYP GHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLQWRKEFGADTVMEDFEFKEIDEVLKYYPHGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKK IDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKQIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPE  997
             DASELP+FLGG+CTCAD GGCMRSDKGPWN+P+IMK V+ G HKCS R ++ E       
Sbjct  281   DASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNGDHKCSKRSSQAEN------  334

Query  996   DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR-QPDMYVPMVDKTVDLPNWHVVN  820
                             +  +F++  + +  P    ++  P   V +     ++P  H   
Sbjct  335   --------------AAENTTFEVNDSAEEAPENVNSQLSPSKNVVVAHPAWNMPEAH---  377

Query  819   NDNCKFVVPKGADLYQIQEAYK-GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTES  643
                 KF + KG D+Y IQEA K   E   + + TGVM FVMG+VTM+R++KN+PRKLTES
Sbjct  378   ----KFSISKG-DVYAIQEACKVTNENGRSPIFTGVMAFVMGVVTMIRVSKNVPRKLTES  432

Query  642   TLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEK  463
             T+YS   + +D +M         +  ++  + MA+MKRMA LE K   LS QP TMPPEK
Sbjct  433   TIYSTPAYCDDSSMNKSSMQSTAK--ISGEDLMAVMKRMAELEHKVNILSAQPATMPPEK  490

Query  462   EEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EEML++A+SR D  EQELA  KKAL++S S Q +L+AYIE
Sbjct  491   EEMLNDAISRADVFEQELAATKKALDDSLSRQEDLVAYIE  530



>ref|XP_008460965.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X2 [Cucumis melo]
Length=596

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 431/582 (74%), Gaps = 36/582 (6%)
 Frame = -2

Query  2016  AEKMDLDADDRQTRLGSLRKAAINAsnk--frhsfksrrrssRVMSVVLDDEHDAEEVKS  1843
             A ++++  ++R+TRL SL++ AINASNK       +SRR SSRVMS+ ++D+ DAEE+++
Sbjct  13    ANEVEMSEEERKTRLASLKQRAINASNKFRHSMKKRSRRNSSRVMSISIEDDIDAEELQA  72

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+IDKSKQMW+DMLQWRK+FG+DTI+++
Sbjct  73    VDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIDKSKQMWSDMLQWRKDFGSDTIMEE  132

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKL++VTTMDRY+ YHV+EFERT
Sbjct  133   FEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLLEVTTMDRYVNYHVREFERT  192

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
                K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELIQ LQKIDGDNYPETL RM+
Sbjct  193   FALKFPACSIAAKKHIDQSTTILDVQGVGLKHFNKSARELIQRLQKIDGDNYPETLKRMF  252

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADK  1123
             IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+FLGG+CTCAD+
Sbjct  253   IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPEFLGGSCTCADQ  312

Query  1122  GGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkp  943
             GGCMRSDKGPW DPEI+KMV  G  KC  R     EE+TI ED     +    + + +  
Sbjct  313   GGCMRSDKGPWKDPEIVKMVQNGEGKCRRRSLSNVEERTISEDDNTTSTKRSGSFNSEAA  372

Query  942   aSFKIESTK------------KLFPIQEETR----------QPDMYVPMVDKTVDLPNWH  829
                                  KL P+ EE            Q + ++P+VDK VD P+W 
Sbjct  373   PEAAAAGAAAATESCMSPKQTKLTPVMEEIHMAQKFGGCEYQYEKFIPVVDKAVD-PSWA  431

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
             +      K+ + K      + E YK  E  SNQ++ G+M  VMGIVTMVR+T+ MP+KLT
Sbjct  432   LSTE---KYTLSK------VHENYKVPEGFSNQIVGGIMALVMGIVTMVRLTRTMPKKLT  482

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             E+ +YS++++  D +M  H    PP  AV  +++M MMKRMA LEE+   L+ +P  MP 
Sbjct  483   EAAIYSSTVYY-DGSMAKH-PALPPPAAVPLSDYMTMMKRMAELEERVNVLNMKPAAMPA  540

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +KEEML+ A+ +++ LEQEL   KKALEES S + EL  YIE
Sbjct  541   DKEEMLNIALGKVETLEQELEATKKALEESLSREAELTDYIE  582



>ref|XP_004500798.1| PREDICTED: uncharacterized protein LOC101489636 isoform X3 [Cicer 
arietinum]
Length=575

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/544 (60%), Positives = 410/544 (75%), Gaps = 17/544 (3%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  ++RP++    +M+   D+++ R+GS++K AI+AS+KF+HSF  + RR SRVMSV  
Sbjct  5     MSATLDRPVKLGGHEMEHSEDEKKKRVGSIKKVAISASSKFKHSFTKKGRRHSRVMSVSF  64

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQ LIL+ELLP+KHDD HMMLRFL+ARK++I+K+KQMW+DML+WR
Sbjct  65    EDDFDAEELQAVDAFRQTLILEELLPSKHDDPHMMLRFLRARKYDIEKTKQMWSDMLKWR  124

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DF+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD  KL+QVT+++RY
Sbjct  125   KEFGADTIMEDFEFKELDEVLKYYPQGHHGVDKEGRPVYIERLGQVDCNKLLQVTSVERY  184

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  185   LKYHVREFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLLQRLQKIDG  244

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+
Sbjct  245   DNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPE  304

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDPEI+KM   G  KC+       EEKTI +D      
Sbjct  305   FLGGTCTCADKGGCMLSDKGPWNDPEILKMAQNGVGKCTRNALSGIEEKTIRQDETAYQK  364

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEE--TRQPDMYVPMVDKTVDLPNWHVVNNDNCKF  802
                 +           +   K + + ++    Q D YVP++DK+VD       +ND  KF
Sbjct  365   GFRDSFPETHDVHCLSQEQPKSYGVAKQCGVYQYDSYVPVLDKSVDSSWKKTTHND--KF  422

Query  801   VVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              + K  D +          + S Q + G+M  VMGIVTM+RMT +MPRKLTE+ LY NS 
Sbjct  423   ALSK--DCFPNNNEKNSGRIGS-QFVGGIMALVMGIVTMIRMTSSMPRKLTEAALYGNSE  479

Query  621   HLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
             + +   MK         PA+++ E+MAMMKRMA LEEK   LS + P+MPPEKEEML+NA
Sbjct  480   YYDGTMMKA--------PAISSNEYMAMMKRMADLEEKVTILSVR-PSMPPEKEEMLNNA  530

Query  441   MSRI  430
             ++R+
Sbjct  531   LTRV  534



>ref|NP_179410.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|Q9SI13.1|SFH10_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
10; Short=AtSFH10 [Arabidopsis thaliana]
 gb|AAD31348.1| putative phosphatidylinositol/phophatidylcholine transfer protein 
[Arabidopsis thaliana]
 gb|AEC06735.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=558

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/522 (63%), Positives = 395/522 (76%), Gaps = 33/522 (6%)
 Frame = -2

Query  1893  VMSV-VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             VMSV + +DEHDAEE+K VDAFRQ LILDELLP KHDDYHMMLRFLKARKF+++K+ QMW
Sbjct  41    VMSVEIFEDEHDAEELKVVDAFRQVLILDELLPDKHDDYHMMLRFLKARKFDLEKTNQMW  100

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DML+WRKEFGADT+++DF+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQ
Sbjct  101   SDMLRWRKEFGADTVMEDFEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQ  160

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI 
Sbjct  161   VTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIT  220

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  221   RLQKVDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEII  280

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPE  997
             DASELP+FLGG+CTCAD GGCMRSDKGPWN+P+IMK V+ G H CS R       + I  
Sbjct  281   DASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNGDHICSKRSQADNAGENIIS  340

Query  996   DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNN  817
              G                      S  +  P  +++ QP    P  +  V  P W++   
Sbjct  341   QGN--------------------NSAVEEAPETDQS-QPS---PCQNVVVAHPAWNIPEA  376

Query  816   DNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
                KF + K  D+Y IQEA K   E   + + TGVM FVMG+VTM+R+TKN+PRKLTEST
Sbjct  377   H--KFSLSK-RDVYAIQEACKATNESGRSPIFTGVMAFVMGVVTMIRVTKNVPRKLTEST  433

Query  639   LYSNSMHLNDHAMKG---HGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             +YS+ ++ ++++M     HG  K     ++  +FMA+MKRMA LE+K   LS QP TMPP
Sbjct  434   IYSSPVYCDENSMNKSSMHGK-KMATTTISGEDFMAVMKRMAELEQKVTNLSAQPATMPP  492

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EKEEML+ A+SR D LEQELA  KKAL++S + Q +L+AY+E
Sbjct  493   EKEEMLNAAISRADFLEQELAATKKALDDSLTRQEDLVAYVE  534



>ref|XP_010690841.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Beta vulgaris subsp. vulgaris]
Length=579

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/584 (61%), Positives = 431/584 (74%), Gaps = 41/584 (7%)
 Frame = -2

Query  2013  EKMDLD--ADDRQTRLGSLRKAAIN-AsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKS  1843
             EK D+D   D+++T+LGS +KAA N +S       K  RR+SRVMSV  +DEHDAEE+ +
Sbjct  21    EKPDIDYYEDEKKTKLGSFKKAAFNVSSRFRNSLTKKGRRNSRVMSVSFEDEHDAEEMLA  80

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALIL+ELLP+KHDDYHM+LRFLKARKF+I+KSKQMW DMLQWRK+FGAD+I++D
Sbjct  81    VDAFRQALILEELLPSKHDDYHMLLRFLKARKFDIEKSKQMWTDMLQWRKDFGADSIMED  140

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+FKE +EV +YYPQGHHGVDK+GRP+YIE+LG VD  KLMQVT+MDRYLKYHVQEFERT
Sbjct  141   FEFKEVEEVKQYYPQGHHGVDKEGRPVYIEKLGQVDPNKLMQVTSMDRYLKYHVQEFERT  200

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
               DK  +CSIAAK+HIDQSTTILDVQGVGLKNF K ARELIQ LQKIDGDNYPETLCRMY
Sbjct  201   FIDKFPACSIAAKRHIDQSTTILDVQGVGLKNFNKAARELIQRLQKIDGDNYPETLCRMY  260

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTC-TCAD  1126
             IINAGSGFRLLW+TVKSFLDPKTT KI+VLGNKYQSKLLE+IDASELP+FLGGTC +CAD
Sbjct  261   IINAGSGFRLLWSTVKSFLDPKTTQKIHVLGNKYQSKLLEVIDASELPEFLGGTCNSCAD  320

Query  1125  KGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPED----------GGVNv  979
             KGGC+ SDKGPWNDP+IMKMV  G  KC+ R    V +EKTI ED               
Sbjct  321   KGGCLNSDKGPWNDPDIMKMVRNGEAKCASRGPFPVIDEKTIAEDEMAKPKGCEWDDFQS  380

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
                        P+SF+ ES K                 +VDK ++      V N+N   V
Sbjct  381   CGLKENYCKDAPSSFQYESFK-----------------IVDKDMEKIWMKAVANNN--MV  421

Query  798   VPKGADLYQIQEAYK-GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
             + KG   +Q + + K   + +SN L+TG+M  VMG VTM+R+++NMP+K  ++TLYS   
Sbjct  422   MSKGC--FQSKNSSKCSNQKSSNHLMTGIMAVVMGFVTMIRLSRNMPKKFNDATLYSTLT  479

Query  621   HLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
             + +D       ++K PE  ++  E+ AMMKR+  LE K I+L  +P TMPPEKEEML+NA
Sbjct  480   YGDDKV----NSHKLPENEISEEEYFAMMKRVGVLEGKVISLIAKPTTMPPEKEEMLNNA  535

Query  441   MSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +SR++ LEQELA  KK LEES   Q E++A+IEKKKKKK +F F
Sbjct  536   LSRVEVLEQELASTKKLLEESLQRQEEIMAFIEKKKKKKKMFLF  579



>ref|XP_007042121.1| SEC14-like 3 [Theobroma cacao]
 gb|EOX97952.1| SEC14-like 3 [Theobroma cacao]
Length=586

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/579 (59%), Positives = 426/579 (74%), Gaps = 14/579 (2%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             A  +S  +ER  R   EK D++   D+R+TRLGSL+K AI+AS+K      K  RR SRV
Sbjct  2     ADTLSLPLERQARTGLEKSDVENSEDERKTRLGSLKKKAISASSKFRHSLKKKTRRHSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS  ++D  DAEE+++VDAFRQALILDELLP KHDD+HMMLRFL+ARKF++DK+KQMWAD
Sbjct  62    MSAAIEDNLDAEELQAVDAFRQALILDELLPAKHDDHHMMLRFLRARKFDLDKAKQMWAD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             MLQWRK+FGADTI++DFDFKE  EV+KYYPQG+HGVDKDGRP+YIER+G VDA KL QVT
Sbjct  122   MLQWRKDFGADTIMEDFDFKEYSEVVKYYPQGYHGVDKDGRPVYIERVGQVDANKLTQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T+DRYLKYHV+EFE+T   K  + SIAAKKHI QSTTILDV+GVGLK+F K AREL+Q L
Sbjct  182   TIDRYLKYHVKEFEKTFAIKFPAASIAAKKHISQSTTILDVEGVGLKSFNKAARELLQRL  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETL RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDA
Sbjct  242   QKIDGDNYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             +ELP+FLGGTC CADKGGCM SDKGPW DPEI+KMV  G  KC+ R     EEK   E  
Sbjct  302   NELPEFLGGTCNCADKGGCMTSDKGPWKDPEILKMVQNGEAKCTRRNISGVEEKACRERR  361

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP---DMYVPMVDKTVDLPNWHVVN  820
                 +      +     +  +    +  PI+++ +     + ++PMVDK VD  +W    
Sbjct  362   HSFDAEPAMDTAEWHAENPPLSPVPE-SPIKKKCQNSYAYEKFIPMVDKGVD-ASWPKSV  419

Query  819   NDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
              DN KF   +  D Y +++  +  E  S  +  G+M FVMG+VTMVR+++NMPRKL+E+ 
Sbjct  420   GDN-KFATSE--DCYPVKDDSRVTEAMSTNIFGGIMAFVMGVVTMVRLSRNMPRKLSEAA  476

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             LY   ++  +  + GH    PP   +T+A++ +MMKRMA LEEK   L  +P  MPPEKE
Sbjct  477   LYGGQVYYANPMIAGHTRQLPP---ITSADYFSMMKRMAELEEKVSVLIRKPAVMPPEKE  533

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             EML+ A+SR+  LE+EL+ AKKALEE+ S Q EL  YI+
Sbjct  534   EMLNAALSRVCTLEEELSAAKKALEEALSKQQELQTYID  572



>ref|XP_004500799.1| PREDICTED: uncharacterized protein LOC101489636 isoform X4 [Cicer 
arietinum]
Length=574

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/544 (60%), Positives = 410/544 (75%), Gaps = 18/544 (3%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  ++RP++   E M+   D+++ R+GS++K AI+AS+KF+HSF  + RR SRVMSV  
Sbjct  5     MSATLDRPVKLGHE-MEHSEDEKKKRVGSIKKVAISASSKFKHSFTKKGRRHSRVMSVSF  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQ LIL+ELLP+KHDD HMMLRFL+ARK++I+K+KQMW+DML+WR
Sbjct  64    EDDFDAEELQAVDAFRQTLILEELLPSKHDDPHMMLRFLRARKYDIEKTKQMWSDMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             KEFGADTI++DF+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD  KL+QVT+++RY
Sbjct  124   KEFGADTIMEDFEFKELDEVLKYYPQGHHGVDKEGRPVYIERLGQVDCNKLLQVTSVERY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVREFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDPEI+KM   G  KC+       EEKTI +D      
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPEILKMAQNGVGKCTRNALSGIEEKTIRQDETAYQK  363

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEE--TRQPDMYVPMVDKTVDLPNWHVVNNDNCKF  802
                 +           +   K + + ++    Q D YVP++DK+VD       +ND  KF
Sbjct  364   GFRDSFPETHDVHCLSQEQPKSYGVAKQCGVYQYDSYVPVLDKSVDSSWKKTTHND--KF  421

Query  801   VVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              + K  D +          + S Q + G+M  VMGIVTM+RMT +MPRKLTE+ LY NS 
Sbjct  422   ALSK--DCFPNNNEKNSGRIGS-QFVGGIMALVMGIVTMIRMTSSMPRKLTEAALYGNSE  478

Query  621   HLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
             + +   MK         PA+++ E+MAMMKRMA LEEK   LS + P+MPPEKEEML+NA
Sbjct  479   YYDGTMMKA--------PAISSNEYMAMMKRMADLEEKVTILSVR-PSMPPEKEEMLNNA  529

Query  441   MSRI  430
             ++R+
Sbjct  530   LTRV  533



>ref|XP_007156083.1| hypothetical protein PHAVU_003G257000g [Phaseolus vulgaris]
 gb|ESW28077.1| hypothetical protein PHAVU_003G257000g [Phaseolus vulgaris]
Length=550

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/582 (60%), Positives = 420/582 (72%), Gaps = 33/582 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLD  1873
             MSG    PL P   K  L+  DR   +GSL+K   N+  + R    S+     VMSV ++
Sbjct  1     MSG----PLTP---KTSLEKGDR---VGSLKKKLRNSLTRSRRRSSSK-----VMSVEIE  45

Query  1872  DEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRK  1693
             D  DAEE K+VD FRQALILDELLP KHDDYHM+LRFLKARKF+++KSKQMW DMLQWRK
Sbjct  46    DIRDAEESKAVDEFRQALILDELLPEKHDDYHMLLRFLKARKFDLEKSKQMWTDMLQWRK  105

Query  1692  EFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYL  1513
             EFGADTI +DF+FKE DEVL+YYP GHHGVDKDGRP+YIERLG VDATKLMQVTTMDRY+
Sbjct  106   EFGADTITEDFEFKELDEVLQYYPHGHHGVDKDGRPVYIERLGQVDATKLMQVTTMDRYV  165

Query  1512  KYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGD  1333
             KYHV+EFERT + K ++CS+AAKKHIDQSTTILDVQGVGLKNF K ARELI ALQKIDGD
Sbjct  166   KYHVKEFERTFDVKFAACSLAAKKHIDQSTTILDVQGVGLKNFNKHARELITALQKIDGD  225

Query  1332  NYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDF  1153
             NYPETL RM+IINAGSGFR+LW TVKSFLDPKTT+KI+VLGNKYQSKLLE+ID SELP+F
Sbjct  226   NYPETLNRMFIINAGSGFRMLWGTVKSFLDPKTTSKIHVLGNKYQSKLLEMIDESELPEF  285

Query  1152  LGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsv  973
             LGG CTCAD+GGCMRSDKGPW D EIMKMV  G HKCS +      E  + E+   +   
Sbjct  286   LGGKCTCADQGGCMRSDKGPWKDEEIMKMVQNGEHKCSRKC-----EAPVMEEKTTSEEP  340

Query  972   smsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVP  793
               +           +   +    +  ++   + +V   +KT     W  V  DN K+ V 
Sbjct  341   ETTTSEANLTTQLSVVLGE---AVSAKSYNYEDFVSSAEKTA----WKKVE-DNDKYAVS  392

Query  792   K-GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHL  616
             K GAD Y + +++K  E  ++Q+ TGVM FVMGIVTMVRMT+NMP+KLT++  YSN    
Sbjct  393   KDGADAYAM-DSFKIHEKVNSQIFTGVMAFVMGIVTMVRMTRNMPKKLTDANFYSN---F  448

Query  615   NDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMS  436
                  KG G  +   PA++  EFM +MKRMA LEEK   ++N    MPPEKEEML+ A++
Sbjct  449   GGEYNKGQGNDQMTIPAISPQEFMTVMKRMAELEEKMTNMNNFTICMPPEKEEMLNAAIT  508

Query  435   RIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             R DALEQEL   KKALE+S + Q EL AY+EKKKKKK +F +
Sbjct  509   RADALEQELMATKKALEDSLTKQEELSAYVEKKKKKKKLFAW  550



>ref|XP_009786700.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X3 [Nicotiana sylvestris]
Length=544

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/601 (60%), Positives = 431/601 (72%), Gaps = 77/601 (13%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSV  1882
             MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRVMSV
Sbjct  1     MSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+++K+KQMW+DML 
Sbjct  61    VFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDLEKTKQMWSDMLN  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVTTMD
Sbjct  121   WRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +Q +
Sbjct  181   RYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCIQGV  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIID SEL
Sbjct  241   DGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDGSEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPEDGGV  985
             P+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI EDG  
Sbjct  301   PEFLGGTCTCAEKGGCMLSDKGPWNDPEIMKMVHSGMHKCSKKSASPTVDEKTISEDGNA  360

Query  984   N-vsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVDKTV  847
             N      S     + AS K++    S  +L  + EE             D Y+P+VDK +
Sbjct  361   NPKEAKKSNSIKMRTASSKVQREHASHMQLSTVHEEVEVKKNLPSAYDSDKYIPVVDKVI  420

Query  846   D--LPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
             D  +PN    +N    + + KG+                           +  V MV+  
Sbjct  421   DSTMPNATKADN----YAIAKGS---------------------------LKAVDMVK--  447

Query  672   KNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
                P+        +    LN  A             ++  E+ +MMKRM  LEEK ITLS
Sbjct  448   ---PQ--------AQEYRLNGSA-------------ISNNEYFSMMKRMGELEEKVITLS  483

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFG  313
             N+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN FG
Sbjct  484   NKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFFG  543

Query  312   F  310
             F
Sbjct  544   F  544



>ref|XP_010444947.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12, partial [Camelina sativa]
Length=512

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/521 (62%), Positives = 390/521 (75%), Gaps = 36/521 (7%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   +RRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  12    RMGSFKKRS--SSKNLRYSMTKKRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELL  69

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  70    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLKWRKEFGADTVMEEFDFKEIDEVLKYYP  129

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV+EFERT N K+ +C+IAAKK
Sbjct  130   QGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVREFERTFNVKLPACTIAAKK  189

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  190   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  249

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD+GGCMRSDKGPW +P
Sbjct  250   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADEGGCMRSDKGPWKNP  309

Query  1080  EIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIM+ V  G HKCS R  A    E TIPE                       E T +   
Sbjct  310   EIMQKVQNGDHKCSKRSQAENIAEDTIPEGND--------------------ECTTEPTS  349

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E+       VP      ++P  H       KF + K  ++Y IQEA      +   + 
Sbjct  350   EEEKASTGVEIVPAAHPAWNVPEAH-------KFSLSK-KEVYAIQEACSNATNDGGRSP  401

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ M+ +D +M      + K   PA++ 
Sbjct  402   IFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPMYCDDASMNKSAMQSEKMTVPAISG  461

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSR  433
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR
Sbjct  462   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISR  502



>emb|CBI17459.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/574 (58%), Positives = 429/574 (75%), Gaps = 19/574 (3%)
 Frame = -2

Query  2016  AEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrss-RVMSVVLDDEHDAEEVKSV  1840
             + ++D    +R+ R+GSL+K A NAS+KFRHS   R R S +VMSV ++D HDAEE+++V
Sbjct  5     STEVDHSVCERENRIGSLKKKANNASSKFRHSLTKRGRRSGKVMSVDIEDVHDAEELQAV  64

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DA RQALI ++ LP++HDDYHM+LRFLKARKF+++K+KQMW DMLQWRK+FGADTI++DF
Sbjct  65    DALRQALISEDRLPSRHDDYHMLLRFLKARKFDLEKTKQMWIDMLQWRKDFGADTIMEDF  124

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +FKE +EV+++YPQGHHGVDK+GRP+YIERLG VDA KLMQ TTMDRY+KYHVQEFERT 
Sbjct  125   EFKELNEVIEHYPQGHHGVDKEGRPVYIERLGKVDANKLMQATTMDRYVKYHVQEFERTF  184

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCSI+A+K IDQSTTILDVQGVGLK+FTK ARELI  LQK+DGDNYPETL RM+I
Sbjct  185   VIKFPSCSISARKQIDQSTTILDVQGVGLKHFTKSARELIVNLQKVDGDNYPETLNRMFI  244

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLWNTVKSFLDPKTT+KI+VLGNK+QSKLLEII+ASELP+FLGGTCTCAD+G
Sbjct  245   INAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKFQSKLLEIIEASELPEFLGGTCTCADQG  304

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDG----GVNvsvsmsaks  955
             GCMRSDKGPW DPEI++MV  G   C  +  ++   EKTI ED      V+  V      
Sbjct  305   GCMRSDKGPWKDPEILRMVQNGYAICRTKCESQSTAEKTISEDEIVYPKVSREVEDIQSL  364

Query  954   vkkpaSFKIESTKKLFPIQEETR---------QPDMYVPMVDKTVDLPNWHVVNNDNCKF  802
               +     IE    L P+ EE R           + ++P++DK+++ P  +V+ ND  ++
Sbjct  365   SPEVPRSYIEHP-NLSPVHEEVRINQNFHKSYNYEDFIPIIDKSMNAPWQNVMEND--RY  421

Query  801   VVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
              + K AD + I +AYK  +  S Q+ TGVM  VMGIVTM+R+T+ MP+K T++ LY   +
Sbjct  422   ALSKAADCFTIHDAYKAPDGFSTQIFTGVMALVMGIVTMIRLTRTMPKKFTDANLYPGPI  481

Query  621   HLNDHAMKGHG-AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSN  445
             +  D  +K H  A++   P +T  EF+A MKRMA +E++   LS +P  MP +KE++L+ 
Sbjct  482   YCVDAMIKSHPYAHQLSAPVITGTEFLAFMKRMAEMEDRVSVLSVKPTAMPADKEDLLNA  541

Query  444   AMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             A+ RID LE+ELA  KK LEE+ + Q E++AYIE
Sbjct  542   ALIRIDTLERELAATKKTLEEAMAQQEEVLAYIE  575



>ref|XP_009595106.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X4 [Nicotiana tomentosiformis]
Length=548

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/602 (59%), Positives = 428/602 (71%), Gaps = 73/602 (12%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             +G MSG +ERP+RPS E +D++   ++R+ RLGS +K A+NASNK  +   K+ RR+SRV
Sbjct  2     SGKMSGPLERPVRPSMENIDIENTEEERKPRLGSFKKKALNASNKFRQSLKKTGRRNSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV +DEHDAEE K+VDAFRQALIL+ELLP KHDDYHMMLRFLKARKFE++K+KQMW+D
Sbjct  62    MSVVFEDEHDAEESKAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFELEKAKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML WRKEFGADTI++DF+FKE++EV+KYYPQGHHGVDKDGRP+YIER+G VD+TKL+QVT
Sbjct  122   MLNWRKEFGADTIMEDFEFKEKEEVVKYYPQGHHGVDKDGRPVYIERIGQVDSTKLLQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TMDRYLKYHVQEFERT NDK+ +CSIAAKKHID STTILDVQGVGLKNF K AR+L+Q +
Sbjct  182   TMDRYLKYHVQEFERTFNDKLPACSIAAKKHIDTSTTILDVQGVGLKNFNKSARDLLQCI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             Q IDG+NYPE+LCRMYIINAGSGFRLLWN+VKSFLDPKTTAKINVLGNKYQSKLLEIIDA
Sbjct  242   QGIDGNNYPESLCRMYIINAGSGFRLLWNSVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR-VEEEKTIPED  994
             SELP+FLGGTCTCA+KGGCM SDKGPWNDPEIMKMVH G HKCS + A    +EKTI ED
Sbjct  302   SELPEFLGGTCTCAEKGGCMVSDKGPWNDPEIMKMVHSGMHKCSKKSASPAVDEKTISED  361

Query  993   G-GVNvsvsmsaksvkkpaSFKIE----STKKLFPIQEETR---------QPDMYVPMVD  856
             G  +      S     + AS K++    S  +L  + EE             D  +P+VD
Sbjct  362   GNAIPKEAKKSNSIKMRTASSKVQRDHVSHMQLSTVHEEVEVKKNLPSAYDSDKCIPVVD  421

Query  855   KTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRM  676
             K +D         DN  + + KG        + KG ++   Q                  
Sbjct  422   KVIDSTMPKATKADN--YAIAKG--------SLKGVDMVKPQ------------------  453

Query  675   TKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITL  496
                           +    LN  A             ++  E+ +MMKRM  LEEK ITL
Sbjct  454   --------------AQEYRLNGPA-------------ISNNEYFSMMKRMGELEEKVITL  486

Query  495   SNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIF  316
             SN+P  +PPEKEEML+N MS +D LEQEL   K ALE++ + Q EL+AYIEKKKKKKN F
Sbjct  487   SNKPSALPPEKEEMLNNVMSHVDKLEQELCATKMALEKALARQEELLAYIEKKKKKKNFF  546

Query  315   GF  310
             GF
Sbjct  547   GF  548



>ref|XP_008241728.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Prunus mume]
Length=609

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/590 (58%), Positives = 436/590 (74%), Gaps = 25/590 (4%)
 Frame = -2

Query  2076  YPACSAGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrs  1900
             +  C A ++S +  RP+  S   +++  ++ +TR+ SLRK A+NAS +  +   K  RRS
Sbjct  16    FLTCDAMSVSLSA-RPV--SVSDVEISEEEGKTRVASLRKKAMNASARFRKSLSKRGRRS  72

Query  1899  sRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQM  1720
             S+V+SV ++D HD+ E+++VD+ RQALIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQM
Sbjct  73    SKVLSVEIEDVHDSVELQAVDSLRQALILEELLPSKHDDYHMMLRFLKARKFDIEKTKQM  132

Query  1719  WADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLM  1540
             W+DML+WRKEFGADTI++DF+FKE  EVL++YPQGHHGVDKDG+P+YIER+G VD TKLM
Sbjct  133   WSDMLEWRKEFGADTIMEDFEFKEHSEVLQHYPQGHHGVDKDGQPVYIERIGQVDVTKLM  192

Query  1539  QVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELI  1360
             Q TTMDRY+KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI
Sbjct  193   QATTMDRYVKYHVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLI  252

Query  1359  QALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEI  1180
               LQKIDGDNYPETL RM+IINAG GFR+LWNTVKSF+DPKTTAKINVLGNKYQSKL+EI
Sbjct  253   ARLQKIDGDNYPETLNRMFIINAGPGFRMLWNTVKSFIDPKTTAKINVLGNKYQSKLIEI  312

Query  1179  IDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIP  1000
             IDASELP+FLGGTCTCAD+GGCMRSDKGPW  PEIM+MV  G HKCS R + ++E  T P
Sbjct  313   IDASELPEFLGGTCTCADQGGCMRSDKGPWKKPEIMQMVQNGDHKCS-RKSGIQERDTAP  371

Query  999   ---EDGGVNvsvsmsaksvkkpaSFKIE-STKKLFPIQEETRQPDMYVPMVDKTVDLPNW  832
                +    +   +M        + F+ E S  K F    E+ +   +V MV KTVD  +W
Sbjct  372   TLADKRPFSPRFTMEHIEYPGLSRFQEEASIAKNF---HESYKCKEHVSMVGKTVD-SSW  427

Query  831   HVVNNDNCKFVVPKGA-------DLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
              +  + N  F + KG+       D +   +A K  +   +Q+L  VM FVMGIVTMVR+T
Sbjct  428   QMAGSSN--FALSKGSSSKNIAGDCFSRDDACKVPDGFGSQILAAVMAFVMGIVTMVRLT  485

Query  672   KNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
             +NMP+KLT+ST YS+++   D  +K  G   P  PA++  + M++MKRMA LEE+   LS
Sbjct  486   RNMPKKLTDSTFYSSTVCDGDTMIKTQG---PSYPAISGTDLMSVMKRMAELEERMSMLS  542

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              +P T+P EK+ ML  A+ R+DALEQEL   K+ALEES + Q+EL+  ++
Sbjct  543   VKPATVPAEKDRMLKTALGRVDALEQELMATKQALEESLTRQDELLGSLD  592



>ref|XP_010649108.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Vitis vinifera]
Length=591

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/578 (58%), Positives = 431/578 (75%), Gaps = 21/578 (4%)
 Frame = -2

Query  2022  PSAEKMDLDAD--DRQTRLGSLRKAAINAsnkfrhsfksrrrss-RVMSVVLDDEHDAEE  1852
             P +  +++D    +R+ R+GSL+K A NAS+KFRHS   R R S +VMSV ++D HDAEE
Sbjct  4     PPSRNIEVDHSVCERENRIGSLKKKANNASSKFRHSLTKRGRRSGKVMSVDIEDVHDAEE  63

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             +++VDA RQALI ++ LP++HDDYHM+LRFLKARKF+++K+KQMW DMLQWRK+FGADTI
Sbjct  64    LQAVDALRQALISEDRLPSRHDDYHMLLRFLKARKFDLEKTKQMWIDMLQWRKDFGADTI  123

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE +EV+++YPQGHHGVDK+GRP+YIERLG VDA KLMQ TTMDRY+KYHVQEF
Sbjct  124   MEDFEFKELNEVIEHYPQGHHGVDKEGRPVYIERLGKVDANKLMQATTMDRYVKYHVQEF  183

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  SCSI+A+K IDQSTTILDVQGVGLK+FTK ARELI  LQK+DGDNYPETL 
Sbjct  184   ERTFVIKFPSCSISARKQIDQSTTILDVQGVGLKHFTKSARELIVNLQKVDGDNYPETLN  243

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNK+QSKLLEII+ASELP+FLGGTCTC
Sbjct  244   RMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKFQSKLLEIIEASELPEFLGGTCTC  303

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPED----GGVNvsvsm  967
             AD+GGCMRSDKGPW DPEI++MV  G   C  +  ++   EKTI ED      V+  V  
Sbjct  304   ADQGGCMRSDKGPWKDPEILRMVQNGYAICRTKCESQSTAEKTISEDEIVYPKVSREVED  363

Query  966   saksvkkpaSFKIESTKKLFPIQEETR---------QPDMYVPMVDKTVDLPNWHVVNND  814
                   +     IE    L P+ EE R           + ++P++DK+++ P  +V+ ND
Sbjct  364   IQSLSPEVPRSYIEHP-NLSPVHEEVRINQNFHKSYNYEDFIPIIDKSMNAPWQNVMEND  422

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
               ++ + K AD + I +AYK  +  S Q+ TGVM  VMGIVTM+R+T+ MP+K T++ LY
Sbjct  423   --RYALSKAADCFTIHDAYKAPDGFSTQIFTGVMALVMGIVTMIRLTRTMPKKFTDANLY  480

Query  633   SNSMHLNDHAMKGHG-AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
                ++  D  +K H  A++   P +T  EF+A MKRMA +E++   LS +P  MP +KE+
Sbjct  481   PGPIYCVDAMIKSHPYAHQLSAPVITGTEFLAFMKRMAEMEDRVSVLSVKPTAMPADKED  540

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +L+ A+ RID LE+ELA  KK LEE+ + Q E++AYIE
Sbjct  541   LLNAALIRIDTLERELAATKKTLEEAMAQQEEVLAYIE  578



>ref|XP_010436238.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Camelina sativa]
Length=803

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/562 (62%), Positives = 422/562 (75%), Gaps = 36/562 (6%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   +RRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  271   RMGSFKKRS--SSKNLRYSMTKKRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELL  328

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  329   PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLKWRKEFGADTVMEEFDFKEIDEVLKYYP  388

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV+EFERT N K+ +C+IAAKK
Sbjct  389   QGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVREFERTFNVKLPACTIAAKK  448

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  449   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  508

Query  1260  VKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDP  1081
             VKSFLDPKTTAKI+VLGNKYQSKLLEIID SELP+FLGG+CTCAD+GGCMRSDKGPW +P
Sbjct  509   VKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADEGGCMRSDKGPWKNP  568

Query  1080  EIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFP  904
             EIM+ V  G HKCS R  A    E TIPE                       EST +   
Sbjct  569   EIMQKVQNGDHKCSKRSQADNIAEDTIPEGND--------------------ESTTEPAS  608

Query  903   IQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQ  730
              +E+       VP      ++P  H       KF + K  ++Y IQEA      +   + 
Sbjct  609   EEEKASTGVEIVPAAHPAWNVPEAH-------KFSLSK-KEVYAIQEACSNATNDGGRSP  660

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ ++ +D +M      + K   PA++ 
Sbjct  661   IFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQSEKMTVPAISG  720

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP  MPP+KEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  721   EDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNILEQELAATKKALDDSL  780

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q EL+AYIEKKKKKK IF +
Sbjct  781   GRQEELVAYIEKKKKKKKIFNY  802


 Score =   397 bits (1021),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 229/255 (90%), Gaps = 3/255 (1%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VLDDEHDAEEVKSVDAFRQALILDELL  1801
             R+GS +K +  +S   R+S   +RRSS+VMSV +++D HDAEE+K+VDAFRQ+LILDELL
Sbjct  12    RMGSFKKRS--SSKNLRYSMTKKRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELL  69

Query  1800  PTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYP  1621
             P KHDDYHMMLRFLKARKF+++K+KQMW +ML+WRKEFGADT++++FDFKE DEVLKYYP
Sbjct  70    PEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLKWRKEFGADTVMEEFDFKEIDEVLKYYP  129

Query  1620  QGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKK  1441
             QGHHGVDK+GRP+YIERLG VD+TKLMQVTTMDRY+ YHV+EFERT N K+ +C+IAAKK
Sbjct  130   QGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYHVREFERTFNVKLPACTIAAKK  189

Query  1440  HIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNT  1261
             HIDQSTTILDVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LWNT
Sbjct  190   HIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNT  249

Query  1260  VKSFLDPKTTAKINV  1216
             VKSFLDPKTTAKI+ 
Sbjct  250   VKSFLDPKTTAKIHA  264



>ref|XP_004509308.1| PREDICTED: SEC14 cytosolic factor-like isoform X1 [Cicer arietinum]
 ref|XP_004509309.1| PREDICTED: SEC14 cytosolic factor-like isoform X2 [Cicer arietinum]
Length=556

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/581 (59%), Positives = 422/581 (73%), Gaps = 43/581 (7%)
 Frame = -2

Query  2025  RPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVK  1846
             RP+ +K+D        R+GSL+K   ++  +      S+     VMSV ++D  DA+++K
Sbjct  10    RPALDKID--------RVGSLKKKLRDSLTRRSRRSSSK-----VMSVEIEDVRDADDLK  56

Query  1845  SVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIID  1666
             +VD FRQAL+LDELLP KHDDYHM+LRFL+ARKF+I+KSKQMW+DMLQWRKEFGADTI++
Sbjct  57    AVDEFRQALVLDELLPEKHDDYHMLLRFLRARKFDIEKSKQMWSDMLQWRKEFGADTIVE  116

Query  1665  DFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFER  1486
             DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG VDATKLMQVTTMDRY+KYHV+EFE+
Sbjct  117   DFEFKELEEVLQYYPHGHHGVDKEGRPVYIERLGQVDATKLMQVTTMDRYIKYHVKEFEK  176

Query  1485  TNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRM  1306
             T + K ++CSIAAKKHIDQSTTILDVQGVGLK+F KQARELI  LQKIDGDNYPETL RM
Sbjct  177   TFDLKFAACSIAAKKHIDQSTTILDVQGVGLKSFNKQARELIMRLQKIDGDNYPETLNRM  236

Query  1305  YIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCAD  1126
             +IINAGSGFR+LWNTVKSFLDPKTTAKI+VL NKY+SKLLEIIDASELP+FLGGTCTCA+
Sbjct  237   FIINAGSGFRMLWNTVKSFLDPKTTAKIHVLSNKYESKLLEIIDASELPEFLGGTCTCAE  296

Query  1125  KGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVNvsvsmsaksvk  949
              GGCMRSDKGPW D EI +MV  G HKCS +    V EEKT   +   +  +     +  
Sbjct  297   HGGCMRSDKGPWKDQEIYRMVQNGEHKCSSKYEPPVVEEKTTTSEVSESSKMEAMLTAQF  356

Query  948   kpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKG-ADLYQ  772
                  + +S+K            + +VPM DKT     W  V  +N  F V K     + 
Sbjct  357   SKVFAEADSSKAC--------NYEDFVPMADKTA----WKKV-EENETFAVSKAEVQNFT  403

Query  771   IQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGH  592
             + +++K  E  ++Q+ TGVM FVMGIVTMVRMT+NMP+KLT++  YSNS +         
Sbjct  404   MPDSFKIHEKVNSQIFTGVMAFVMGIVTMVRMTRNMPKKLTDANFYSNSAY-------SC  456

Query  591   GAYKPPEPA-------VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSR  433
             G YK  +P        ++A EFM +MKRMA LE+K + + NQ   MPPEKEEML+ A+SR
Sbjct  457   GDYKGQDPCDQMTNPTISAQEFMTVMKRMAELEDKMVNM-NQITCMPPEKEEMLNAAISR  515

Query  432   IDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              DALEQEL   KKALE+S + Q EL  YIEKKKKKK +F +
Sbjct  516   ADALEQELMATKKALEDSLARQEELSDYIEKKKKKKKLFAW  556



>ref|NP_001242548.1| uncharacterized protein LOC100798374 [Glycine max]
 gb|ACU17783.1| unknown [Glycine max]
Length=573

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/543 (60%), Positives = 413/543 (76%), Gaps = 22/543 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  V+ P++   E ++   D+R+ +LGS +K AI+AS+KF+HSF  R R+ SRV S+ +
Sbjct  5     MSAPVDPPMKLGHE-IEYSEDERKKKLGSFKKVAISASSKFKHSFAKRGRKHSRVTSLSI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DML+WR
Sbjct  64    EDDLDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKTKQMWTDMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFGADTI++DF+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+TKLMQVTTM+RY
Sbjct  124   QEFGADTIMEDFEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSTKLMQVTTMERY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVKEFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSLNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWNT+KSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWNTIKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDP+I+KMVH G  KC  +     EEK I EDG  N +
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKRIIEDGTANQN  363

Query  975   vsmsaks-vkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
             +        +     +  S KK    Q    + D +VP++ K VD P+W+ +   + K  
Sbjct  364   LGNKESFPERYDVDVQCLSPKK----QCTAYKYDAFVPVLGKPVD-PSWNTLTQKD-KDA  417

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
             + KGAD +      K  +  SN  + G+M  VMGIVTM+RMT+NMPRK+TE+ LY +S +
Sbjct  418   LSKGADCF----PSKTCDGYSNHFVGGIMAIVMGIVTMIRMTRNMPRKITEAALYGSSGY  473

Query  618   LNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAM  439
              +   MK            +  ++MAMMKRMA LEEK +T+ +  P +PPEKEE+L+NA+
Sbjct  474   YDGTMMKA--------ATFSCNDYMAMMKRMAELEEK-VTILSMKPVIPPEKEEVLNNAL  524

Query  438   SRI  430
              R+
Sbjct  525   GRV  527



>ref|XP_004509310.1| PREDICTED: SEC14 cytosolic factor-like isoform X3 [Cicer arietinum]
Length=553

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/584 (59%), Positives = 423/584 (72%), Gaps = 52/584 (9%)
 Frame = -2

Query  2025  RPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVK  1846
             RP+ +K+D        R+GSL+K   ++  +      S+     VMSV ++D  DA+++K
Sbjct  10    RPALDKID--------RVGSLKKKLRDSLTRRSRRSSSK-----VMSVEIEDVRDADDLK  56

Query  1845  SVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIID  1666
             +VD FRQAL+LDELLP KHDDYHM+LRFL+ARKF+I+KSKQMW+DMLQWRKEFGADTI++
Sbjct  57    AVDEFRQALVLDELLPEKHDDYHMLLRFLRARKFDIEKSKQMWSDMLQWRKEFGADTIVE  116

Query  1665  DFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFER  1486
             DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG VDATKLMQVTTMDRY+KYHV+EFE+
Sbjct  117   DFEFKELEEVLQYYPHGHHGVDKEGRPVYIERLGQVDATKLMQVTTMDRYIKYHVKEFEK  176

Query  1485  TNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRM  1306
             T + K ++CSIAAKKHIDQSTTILDVQGVGLK+F KQARELI  LQKIDGDNYPETL RM
Sbjct  177   TFDLKFAACSIAAKKHIDQSTTILDVQGVGLKSFNKQARELIMRLQKIDGDNYPETLNRM  236

Query  1305  YIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCAD  1126
             +IINAGSGFR+LWNTVKSFLDPKTTAKI+VL NKY+SKLLEIIDASELP+FLGGTCTCA+
Sbjct  237   FIINAGSGFRMLWNTVKSFLDPKTTAKIHVLSNKYESKLLEIIDASELPEFLGGTCTCAE  296

Query  1125  KGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA--RVEEEKTIPEDGGVNvsvsmsaksv  952
              GGCMRSDKGPW D EI +MV  G HKCS +     VEE+ T  E   +   ++      
Sbjct  297   HGGCMRSDKGPWKDQEIYRMVQNGEHKCSSKYEPPVVEEKTTTSESSKMEAMLTAQFS--  354

Query  951   kkpaSFKIESTKKLFPIQEETRQPDM--YVPMVDKTVDLPNWHVVNNDNCKFVVPKG-AD  781
                         K+F   + ++  +   +VPM DKT     W  V  +N  F V K    
Sbjct  355   ------------KVFAEADSSKACNYEDFVPMADKTA----WKKVE-ENETFAVSKAEVQ  397

Query  780   LYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAM  601
              + + +++K  E  ++Q+ TGVM FVMGIVTMVRMT+NMP+KLT++  YSNS +      
Sbjct  398   NFTMPDSFKIHEKVNSQIFTGVMAFVMGIVTMVRMTRNMPKKLTDANFYSNSAY------  451

Query  600   KGHGAYKPPEPA-------VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
                G YK  +P        ++A EFM +MKRMA LE+K + + NQ   MPPEKEEML+ A
Sbjct  452   -SCGDYKGQDPCDQMTNPTISAQEFMTVMKRMAELEDKMVNM-NQITCMPPEKEEMLNAA  509

Query  441   MSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +SR DALEQEL   KKALE+S + Q EL  YIEKKKKKK +F +
Sbjct  510   ISRADALEQELMATKKALEDSLARQEELSDYIEKKKKKKKLFAW  553



>ref|XP_009144505.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Brassica rapa]
Length=547

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/562 (61%), Positives = 416/562 (74%), Gaps = 33/562 (6%)
 Frame = -2

Query  1977  RLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLP  1798
             R+GS +K    +S+K       RR SS+V  V ++D HDAEE+KSVDAFRQALILDELLP
Sbjct  12    RMGSFKK---RSSSKNLRYSMKRRTSSKVTPVEIEDVHDAEELKSVDAFRQALILDELLP  68

Query  1797  TKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQ  1618
              KHDDYHMMLRFLKARKF++DK+K MW +ML+WRKEFGADT++++F+FKE DEVLKYYPQ
Sbjct  69    EKHDDYHMMLRFLKARKFDLDKTKLMWTEMLRWRKEFGADTVMEEFEFKEIDEVLKYYPQ  128

Query  1617  GHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKH  1438
             GHHGVDK+GRP+YIERLG VD+TKLMQVTT+DRY+ YHV EFERT N K  +CSIAAKK 
Sbjct  129   GHHGVDKEGRPVYIERLGQVDSTKLMQVTTLDRYVNYHVMEFERTFNVKFPACSIAAKKQ  188

Query  1437  IDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTV  1258
             IDQSTTILDVQGVGLKNF K AR+L+  LQ +DG+NYPE+L RM+IINAGSGFR+LW+TV
Sbjct  189   IDQSTTILDVQGVGLKNFNKAARDLVTRLQAVDGNNYPESLNRMFIINAGSGFRMLWSTV  248

Query  1257  KSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPE  1078
             KSFLDPKTTAKINVLGNKYQSKLLEIID SELPDFLGGTCTCAD GGCMRSDKGPWN+PE
Sbjct  249   KSFLDPKTTAKINVLGNKYQSKLLEIIDESELPDFLGGTCTCADSGGCMRSDKGPWNNPE  308

Query  1077  IMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPI  901
             IM+ V  G HKC+ R  A    E+TI E                       EST +  P 
Sbjct  309   IMQRVKNGDHKCTKRSQAENGAEETIFEGS---------------------ESTAEQAPE  347

Query  900   Q-EETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA--YKGQELASNQ  730
             + +++ QP      +      P W++   +  KF + K  ++Y IQEA      +   + 
Sbjct  348   EKKDSAQPSSSSSDIVPVAAHPAWNM--PEAHKFSLSK-KEVYAIQEACNTATSDGGRSP  404

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTA  556
             + TGVM  VMG+VTM+R+TKN+PRKLTESTLYS+ M+ +D +M      + K   PA++ 
Sbjct  405   IFTGVMALVMGVVTMIRVTKNVPRKLTESTLYSSPMYCDDASMNKSAMQSEKMMVPAISG  464

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              +FMA+MKRMA LE+K   LS QP TMPPEKEEML+ A+SR + LEQELA  KKAL++S 
Sbjct  465   EDFMAIMKRMAELEQKVTVLSAQPTTMPPEKEEMLNAAISRSNVLEQELAATKKALDDSL  524

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
               Q +L+AYIEKKKKKK +F +
Sbjct  525   GRQEDLVAYIEKKKKKKKLFNY  546



>ref|XP_002512942.1| Sec14 cytosolic factor, putative [Ricinus communis]
 gb|EEF49445.1| Sec14 cytosolic factor, putative [Ricinus communis]
Length=555

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/576 (57%), Positives = 416/576 (72%), Gaps = 40/576 (7%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             A   SG ++R ++   EK D D   D+R+TRL +L+K AINASNK      K  RR SRV
Sbjct  4     ADTQSGPLDRHIKAGPEKSDTDNVEDERKTRLAALKKKAINASNKFRNSLTKKGRRHSRV  63

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSV ++D+ +AEE+++VDAFRQ LILDELLP+KHDD+H+MLRFLKARKF+ +K+KQMW+D
Sbjct  64    MSVAIEDDINAEELQAVDAFRQVLILDELLPSKHDDHHLMLRFLKARKFDAEKAKQMWSD  123

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             MLQWRKEFG DTII+DF+F+E DEV+KYYPQG+HG+DK+GRP+YIE+LG VDA KL+QVT
Sbjct  124   MLQWRKEFGTDTIIEDFEFQELDEVVKYYPQGYHGIDKEGRPVYIEKLGDVDANKLLQVT  183

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T++RY+KYHV+EFE+T   K  +CS+AAKKHIDQSTTILDVQGVGLK FTK ARELI  +
Sbjct  184   TLERYVKYHVREFEKTFAYKFPACSVAAKKHIDQSTTILDVQGVGLKQFTKTARELISRI  243

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETL RM+IIN G+GFRLLWNTVK FLDPKT AKI+VLG+KYQSKLLE+IDA
Sbjct  244   QKIDGDNYPETLNRMFIINGGAGFRLLWNTVKQFLDPKTAAKIHVLGSKYQSKLLEVIDA  303

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+FLGGTC CADKGGCMRSDKGPW+DPEIMK+V  G   C  R     EEK I ED 
Sbjct  304   SELPEFLGGTCNCADKGGCMRSDKGPWHDPEIMKVVQNGGATCRRRTLSGIEEKKISEDE  363

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
               N+                                 D  +PMVDK+VD   WH    DN
Sbjct  364   KTNI-----------------------------VNNFDKLIPMVDKSVD-SAWH-TPMDN  392

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
               F V +  D + +    +   + +N +++GVM  VMGIVTMVRMT+NMPR+LTE+ +Y 
Sbjct  393   NGFDVSR--DQFPLHGGCRADSI-NNPIISGVMALVMGIVTMVRMTRNMPRRLTEAAIYG  449

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             N ++ +D  +KG      P  ++  A++  MM RMA++EEK   L+ +P  MPPEKEE+L
Sbjct  450   NQVYYDDAMVKGRAL---PPASIPTADYKNMMIRMAAMEEKLNVLATKPQVMPPEKEELL  506

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + A+ R D LEQELA  KKAL+++ +   EL+ Y+E
Sbjct  507   NAAIRRADVLEQELAATKKALDDAVAKHQELMEYVE  542



>ref|XP_008241729.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Prunus mume]
Length=607

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/579 (58%), Positives = 431/579 (74%), Gaps = 23/579 (4%)
 Frame = -2

Query  2043  AVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDE  1867
             +V    RP ++ +++  ++ +TR+ SLRK A+NAS +  +   K  RRSS+V+SV ++D 
Sbjct  23    SVSLSARPVSD-VEISEEEGKTRVASLRKKAMNASARFRKSLSKRGRRSSKVLSVEIEDV  81

Query  1866  HDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEF  1687
             HD+ E+++VD+ RQALIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DML+WRKEF
Sbjct  82    HDSVELQAVDSLRQALILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLEWRKEF  141

Query  1686  GADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKY  1507
             GADTI++DF+FKE  EVL++YPQGHHGVDKDG+P+YIER+G VD TKLMQ TTMDRY+KY
Sbjct  142   GADTIMEDFEFKEHSEVLQHYPQGHHGVDKDGQPVYIERIGQVDVTKLMQATTMDRYVKY  201

Query  1506  HVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNY  1327
             HV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI  LQKIDGDNY
Sbjct  202   HVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIARLQKIDGDNY  261

Query  1326  PETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLG  1147
             PETL RM+IINAG GFR+LWNTVKSF+DPKTTAKINVLGNKYQSKL+EIIDASELP+FLG
Sbjct  262   PETLNRMFIINAGPGFRMLWNTVKSFIDPKTTAKINVLGNKYQSKLIEIIDASELPEFLG  321

Query  1146  GTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIP---EDGGVNvs  976
             GTCTCAD+GGCMRSDKGPW  PEIM+MV  G HKCS R + ++E  T P   +    +  
Sbjct  322   GTCTCADQGGCMRSDKGPWKKPEIMQMVQNGDHKCS-RKSGIQERDTAPTLADKRPFSPR  380

Query  975   vsmsaksvkkpaSFKIE-STKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
              +M        + F+ E S  K F    E+ +   +V MV KTVD  +W +  + N  F 
Sbjct  381   FTMEHIEYPGLSRFQEEASIAKNF---HESYKCKEHVSMVGKTVD-SSWQMAGSSN--FA  434

Query  798   VPKGA-------DLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
             + KG+       D +   +A K  +   +Q+L  VM FVMGIVTMVR+T+NMP+KLT+ST
Sbjct  435   LSKGSSSKNIAGDCFSRDDACKVPDGFGSQILAAVMAFVMGIVTMVRLTRNMPKKLTDST  494

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
              YS+++   D  +K  G   P  PA++  + M++MKRMA LEE+   LS +P T+P EK+
Sbjct  495   FYSSTVCDGDTMIKTQG---PSYPAISGTDLMSVMKRMAELEERMSMLSVKPATVPAEKD  551

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              ML  A+ R+DALEQEL   K+ALEES + Q+EL+  ++
Sbjct  552   RMLKTALGRVDALEQELMATKQALEESLTRQDELLGSLD  590



>ref|XP_004148858.1| PREDICTED: uncharacterized protein LOC101214906 [Cucumis sativus]
Length=568

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/581 (60%), Positives = 433/581 (75%), Gaps = 45/581 (8%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVL  1876
             SG+++RP +  A + ++  ++R+TRL SL++ AINASNKFRHS K R  R SSRVMS+ +
Sbjct  7     SGSLDRPNK-GANEAEMSEEERKTRLASLKQRAINASNKFRHSMKKRGRRNSSRVMSISI  65

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF++DKSKQMW+DMLQWR
Sbjct  66    EDDIDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDVDKSKQMWSDMLQWR  125

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             K+FG+DT++++F+FKE DEVLKYYPQGHHGVDKDGRP+YIERLG VD+TKL++VTTMDRY
Sbjct  126   KDFGSDTVMEEFEFKEVDEVLKYYPQGHHGVDKDGRPVYIERLGQVDSTKLLEVTTMDRY  185

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             + YHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELIQ LQKIDG
Sbjct  186   VNYHVREFERTFALKFPACSIAAKKHIDQSTTILDVQGVGLKHFNKSARELIQRLQKIDG  245

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP+
Sbjct  246   DNYPETLKRMFIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPE  305

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGG+CTCAD+GGCMRSDKGPW DPEI+K++ Q A   +   A    E  +         
Sbjct  306   FLGGSCTCADQGGCMRSDKGPWKDPEIVKVIIQKAAPDATAAAAAATESCMSPKQA----  361

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEETR----------QPDMYVPMVDKTVDLPNWHV  826
                                 KL P+ EE R          Q + ++P+VDK VD  NW +
Sbjct  362   --------------------KLTPVLEEIRMSQKLGGCEYQYEKFIPVVDKAVD-SNWAL  400

Query  825   VNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTE  646
                   K+   K  D + + E YK  E  SNQ++ G+M  VMGIVTMVR+T+ MP+KLTE
Sbjct  401   STE---KYTFSK--DPFAVHENYKVPEGFSNQIVGGIMALVMGIVTMVRLTRTMPKKLTE  455

Query  645   STLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPE  466
             + +YS++++  D +M  H A   P  AV  +++M MMKRMA LEE+   L+ +P  MP +
Sbjct  456   AAIYSSTVYY-DGSMAKHPALP-PPAAVPLSDYMTMMKRMAELEERVNVLNMKPAAMPAD  513

Query  465   KEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             KEEML+ A+ +++ LEQEL   KKALEES S + EL  YIE
Sbjct  514   KEEMLNIALGKVETLEQELEATKKALEESLSREAELTDYIE  554



>ref|XP_006581016.1| PREDICTED: uncharacterized protein LOC100798374 isoform X2 [Glycine 
max]
Length=561

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/532 (60%), Positives = 407/532 (77%), Gaps = 21/532 (4%)
 Frame = -2

Query  2019  SAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKS  1843
             +  +++   D+R+ +LGS +K AI+AS+KF+HSF  R R+ SRVMS+ ++D+ DAEE+++
Sbjct  3     TGHEIEYSEDERKKKLGSFKKVAISASSKFKHSFAKRGRKHSRVMSLSIEDDLDAEELQA  62

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DML+WR+EFGADTI++D
Sbjct  63    VDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKTKQMWTDMLKWRQEFGADTIMED  122

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+TKLMQVTTM+RYLKYHV+EFERT
Sbjct  123   FEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSTKLMQVTTMERYLKYHVKEFERT  182

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
                K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDGDNYPE+L RM+
Sbjct  183   FAVKLPACSIAAKKHIDQSTTILDVQGVGLKSLNKAARDLLQRLQKIDGDNYPESLNRMF  242

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADK  1123
             IINAGSGFRLLWNT+KSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+FLGGTCTCADK
Sbjct  243   IINAGSGFRLLWNTIKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADK  302

Query  1122  GGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaks-vkk  946
             GGCM SDKGPWNDP+I+KMVH G  KC  +     EEK I EDG  N ++        + 
Sbjct  303   GGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKRIIEDGTANQNLGNKESFPERY  362

Query  945   paSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQ  766
                 +  S KK    Q    + D +VP++ K VD  +W+ +   + K  + KGAD +   
Sbjct  363   DVDVQCLSPKK----QCTVYKYDAFVPVLGKPVD-SSWNTLTQKD-KDALSKGADCF---  413

Query  765   EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
                K  +  SN  + G+M  VMGIVTM+RMT+NMPRK+TE+ LY +S + +   MK    
Sbjct  414   -PSKTCDGYSNHFVGGIMAIVMGIVTMIRMTRNMPRKITEAALYGSSGYYDGTMMKA---  469

Query  585   YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
                     +  ++MAMMKRMA LEEK +T+ +  P +PPEKEE+L+NA+ R+
Sbjct  470   -----ATFSCNDYMAMMKRMAELEEK-VTILSMKPVIPPEKEEVLNNALGRV  515



>ref|NP_565514.1| SEC14-like 3 protein [Arabidopsis thaliana]
 ref|NP_001031389.1| SEC14-like 3 protein [Arabidopsis thaliana]
 sp|Q93ZE9.1|SFH3_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
3; Short=AtSFH3 [Arabidopsis thaliana]
 gb|AAL14382.1| At2g21540/F2G1.19 [Arabidopsis thaliana]
 gb|AAM15309.1| putative phosphatidylinositol phophatidylcholine transfer protein 
[Arabidopsis thaliana]
 dbj|BAD44183.1| putative phosphatidylinositol/ phophatidylcholine transfer protein 
[Arabidopsis thaliana]
 gb|AEC07192.1| SEC14-like 3 protein [Arabidopsis thaliana]
 gb|AEC07193.1| SEC14-like 3 protein [Arabidopsis thaliana]
Length=548

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/574 (60%), Positives = 422/574 (74%), Gaps = 46/574 (8%)
 Frame = -2

Query  2010  KMDLDA--DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSV  1840
             K+D D   D+++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++V
Sbjct  14    KLDYDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDLEELQAV  73

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW DM+ WRKEFG DTI++DF
Sbjct  74    DAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDF  133

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DFKE DEVLKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T 
Sbjct  134   DFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTF  193

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
             N K+ +CSIAAKKHIDQSTTILDVQGVGLK+F+K AR+L+Q +QKID DNYPETL RM+I
Sbjct  194   NIKLPACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFI  253

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKG
Sbjct  254   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKG  313

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI  D                  
Sbjct  314   GCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVDENTT-----MKSDSFAKN  368

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQ  772
              F  E+TK              ++PM+DKTV+   W    H  N        P+  DLY 
Sbjct  369   KFDAENTK--------------FIPMIDKTVNASTWPTNLHKSN-------YPEPEDLYS  407

Query  771   IQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGH  592
               +  + +      L  GVM+ VMG++T+VR+TKNMPRKLTE+ +Y            G 
Sbjct  408   AVKPSQ-RRGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAAIY------------GG  454

Query  591   GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqe  412
                K     V+  E+M+M+KRMA LEEK  +L NQP    PEKE++L+ A+SR+D LE +
Sbjct  455   EVDKAETTMVSNQEYMSMVKRMAELEEKCRSLDNQPAAFSPEKEQILTAALSRVDELELQ  514

Query  411   laeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             LA+ KK LEE+ + Q+ ++AYI+KKKKKK  FGF
Sbjct  515   LAQTKKTLEETMATQHVIMAYIDKKKKKKKFFGF  548



>ref|NP_001189571.1| SEC14-like 3 protein [Arabidopsis thaliana]
 gb|AEC07194.1| SEC14-like 3 protein [Arabidopsis thaliana]
Length=542

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/570 (60%), Positives = 422/570 (74%), Gaps = 44/570 (8%)
 Frame = -2

Query  2010  KMDLDA--DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSV  1840
             K+D D   D+++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++V
Sbjct  14    KLDYDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDLEELQAV  73

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW DM+ WRKEFG DTI++DF
Sbjct  74    DAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDF  133

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DFKE DEVLKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T 
Sbjct  134   DFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTF  193

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
             N K+ +CSIAAKKHIDQSTTILDVQGVGLK+F+K AR+L+Q +QKID DNYPETL RM+I
Sbjct  194   NIKLPACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFI  253

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKG
Sbjct  254   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKG  313

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI  D                  
Sbjct  314   GCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVDENTT-----------MKN  362

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
              F  E+TK              ++PM+DKTV+   W     +  K   P+  DLY   + 
Sbjct  363   KFDAENTK--------------FIPMIDKTVNASTWPT---NLHKSNYPEPEDLYSAVKP  405

Query  759   YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK  580
              + +      L  GVM+ VMG++T+VR+TKNMPRKLTE+ +Y            G    K
Sbjct  406   SQ-RRGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAAIY------------GGEVDK  452

Query  579   PPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
                  V+  E+M+M+KRMA LEEK  +L NQP    PEKE++L+ A+SR+D LE +LA+ 
Sbjct  453   AETTMVSNQEYMSMVKRMAELEEKCRSLDNQPAAFSPEKEQILTAALSRVDELELQLAQT  512

Query  399   kkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             KK LEE+ + Q+ ++AYI+KKKKKK  FGF
Sbjct  513   KKTLEETMATQHVIMAYIDKKKKKKKFFGF  542



>ref|XP_002880389.1| hypothetical protein ARALYDRAFT_481021 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56648.1| hypothetical protein ARALYDRAFT_481021 [Arabidopsis lyrata subsp. 
lyrata]
Length=548

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/574 (60%), Positives = 424/574 (74%), Gaps = 46/574 (8%)
 Frame = -2

Query  2010  KMDLDA--DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSV  1840
             K+D D   D+++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++V
Sbjct  14    KLDYDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDLEELQAV  73

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW DM+ WRKEFG DTI++DF
Sbjct  74    DAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDF  133

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DFKE DEVLKYYPQG+HGVDK+GRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T 
Sbjct  134   DFKEIDEVLKYYPQGYHGVDKEGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTF  193

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
             N K+ +CSIAAKKHIDQSTTILDVQGVGLKNF+K AR+L+Q +QKID DNYPETL RM+I
Sbjct  194   NIKLPACSIAAKKHIDQSTTILDVQGVGLKNFSKAARDLLQRIQKIDSDNYPETLNRMFI  253

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKG
Sbjct  254   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKG  313

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI  D                  
Sbjct  314   GCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVDENTT-----MKCDSFAKN  368

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQ  772
             +F  E+ K              ++PM+DKTV+   W    H  N        P+  DLY 
Sbjct  369   NFDAENAK--------------FIPMIDKTVNATTWPTNLHKSN-------YPEPEDLYS  407

Query  771   IQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGH  592
               +  + +      L  GVM+ +MG++T+VR+TKNMPRKLT++ +Y            G 
Sbjct  408   AVKPSQ-RRGGEGYLFGGVMSLMMGLMTVVRLTKNMPRKLTDAAIY------------GG  454

Query  591   GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqe  412
              A K     V+  E+M+M+KRMA LEEK  +L NQP    PEKE++L+ A+SR+D LE +
Sbjct  455   EAEKAETTMVSNQEYMSMVKRMAELEEKCRSLDNQPAAFSPEKEQILTAALSRVDELELQ  514

Query  411   laeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             LA+ KK LEE+ + Q+E++AYI+KKKKKK  FGF
Sbjct  515   LAQTKKTLEETMATQHEIMAYIDKKKKKKKFFGF  548



>ref|XP_007203119.1| hypothetical protein PRUPE_ppa023962mg, partial [Prunus persica]
 gb|EMJ04318.1| hypothetical protein PRUPE_ppa023962mg, partial [Prunus persica]
Length=549

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/569 (58%), Positives = 419/569 (74%), Gaps = 49/569 (9%)
 Frame = -2

Query  2025  RPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEEV  1849
             RP ++ +++  ++ +TR+ SLRK A+NAS +  +   K  RRSS+V+SV ++D HD+ E+
Sbjct  8     RPVSD-VEISEEEGKTRVASLRKKAMNASARFRKSLSKRGRRSSKVLSVEIEDVHDSVEL  66

Query  1848  KSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTII  1669
             ++VD+ RQALIL+ELLP+KHDDYHMMLRFLKARKF+I+K+KQMW+DML+WRKEFGADTI+
Sbjct  67    QAVDSLRQALILEELLPSKHDDYHMMLRFLKARKFDIEKTKQMWSDMLEWRKEFGADTIM  126

Query  1668  DDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFE  1489
             +DF+FKE  EVL++YPQGHHGVDKDG+P+YIER+G VD TKLMQ TTMDRY+KYHV+EFE
Sbjct  127   EDFEFKEHSEVLQHYPQGHHGVDKDGQPVYIERIGQVDVTKLMQATTMDRYVKYHVREFE  186

Query  1488  RTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCR  1309
             RT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+LI  LQKIDGDNYPETL R
Sbjct  187   RTFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLIARLQKIDGDNYPETLNR  246

Query  1308  MYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCA  1129
             M+IINAG GFR+LWNTVKSF+DPKTTAKINVLGNKYQSKLLEIIDASELP+FLGGTCTCA
Sbjct  247   MFIINAGPGFRMLWNTVKSFIDPKTTAKINVLGNKYQSKLLEIIDASELPEFLGGTCTCA  306

Query  1128  DKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvk  949
             D+GGCMRSDKGPW  PEIM+MV  G HKCS +              G+  S++ +     
Sbjct  307   DQGGCMRSDKGPWKKPEIMQMVQNGDHKCSTK-------------SGIQASIAKN-----  348

Query  948   kpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGA-----  784
                            IQE  +  D +V MV KTVD  +W +  + N  F + KG+     
Sbjct  349   ---------------IQESYKCKD-HVSMVGKTVD-SSWQMAGSSN--FALSKGSSSNNI  389

Query  783   --DLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND  610
               D +   +A K  +   +Q+L  VM FVMGIVTMVR+T+NMP+KLT+ST YS+++   D
Sbjct  390   AGDCFSRDDACKVPDGFGSQILAAVMAFVMGIVTMVRLTRNMPKKLTDSTFYSSTVCDGD  449

Query  609   HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
               +K  G   P   A++  + M++MKRMA LEE+   LS +P T+P EK+ ML  A+ R+
Sbjct  450   TMIKPQG---PSYAAISGTDLMSVMKRMAELEERMSMLSVKPATVPAEKDRMLKTALGRV  506

Query  429   DaleqelaeakkaleesqSNQNELIAYIE  343
             DALEQEL   K+ALEES + Q+EL+  ++
Sbjct  507   DALEQELMATKQALEESLTRQDELLGSLD  535



>ref|XP_010416906.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 [Camelina sativa]
Length=548

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/562 (60%), Positives = 422/562 (75%), Gaps = 36/562 (6%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+++T+L SL+K AINASNKF+HS  K  RR+SRVMS+ + D+ D EE+++VDAFRQALI
Sbjct  22    DEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSLSIVDDIDLEELQAVDAFRQALI  81

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW+DM+ WRKEFG DTI++DFDFKE DEV
Sbjct  82    LDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWSDMIHWRKEFGVDTIMEDFDFKEIDEV  141

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             LKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T N K+ +CS
Sbjct  142   LKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACS  201

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLKNF+K AR+L+Q +QKID DNYPETL RM+IINAGSGFR
Sbjct  202   IAAKKHIDQSTTILDVQGVGLKNFSKAARDLLQRIQKIDSDNYPETLNRMFIINAGSGFR  261

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKGGCMRSDKG
Sbjct  262   LLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKGGCMRSDKG  321

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDP+I KMV  G  KC  +     EEKTI  D    +     AK+     + K+    
Sbjct  322   PWNDPDIFKMVQNGGGKCPRKTLSNIEEKTISVDENTTMKSDSVAKNKVDVENAKL----  377

Query  915   KLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                            +P+V+K V+   W   N     F  P+  D+Y   +  + +    
Sbjct  378   ---------------IPIVEKAVNATTWP-ANLHKSNF--PEPEDIYSAVKPSQ-RRGGE  418

Query  735   NQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTA  556
               L  GVM+ +MG++T+VR+TKNMPRKLTE+ +Y            G    K     V++
Sbjct  419   GYLFGGVMSLMMGLMTVVRLTKNMPRKLTEAAIY------------GGNGEKTETTMVSS  466

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              E+M+M+KRMA LEEK  +L NQP +  PEKE++L+ A+SR+D LE +LA+ KK L+E+ 
Sbjct  467   QEYMSMVKRMAELEEKCRSLDNQPASFSPEKEQILTAALSRVDELEVQLAQTKKTLDEAM  526

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
             + Q+E++AYIEKKKKKK  FGF
Sbjct  527   ATQHEIMAYIEKKKKKKKFFGF  548



>ref|XP_010649109.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Vitis vinifera]
Length=590

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/578 (58%), Positives = 431/578 (75%), Gaps = 22/578 (4%)
 Frame = -2

Query  2022  PSAEKMDLDAD--DRQTRLGSLRKAAINAsnkfrhsfksrrrss-RVMSVVLDDEHDAEE  1852
             P +  +++D    +R+ R+GSL+K A NAS+KFRHS   R R S +VMSV ++D HDAEE
Sbjct  4     PPSRNIEVDHSVCERENRIGSLKKKANNASSKFRHSLTKRGRRSGKVMSVDIEDVHDAEE  63

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             +++VDA RQALI ++ LP++HDDYHM+LRFLKARKF+++K+KQMW DMLQWRK+FGADTI
Sbjct  64    LQAVDALRQALISEDRLPSRHDDYHMLLRFLKARKFDLEKTKQMWIDMLQWRKDFGADTI  123

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE +EV+++YPQGHHGVDK+GRP+YIERLG VDA KLMQ TTMDRY+KYHVQEF
Sbjct  124   MEDFEFKELNEVIEHYPQGHHGVDKEGRPVYIERLGKVDANKLMQATTMDRYVKYHVQEF  183

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  SCSI+A+K IDQSTTILDVQGVGLK+FTK ARELI  LQK+DGDNYPETL 
Sbjct  184   ERTFVIKFPSCSISARKQIDQSTTILDVQGVGLKHFTKSARELIVNLQKVDGDNYPETLN  243

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNK+QSKLLEII+ASELP+FLGGTCTC
Sbjct  244   RMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKFQSKLLEIIEASELPEFLGGTCTC  303

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPED----GGVNvsvsm  967
             AD+GGCMRSDKGPW DPEI++MV  G   C  +  ++   EKTI ED      V+  V  
Sbjct  304   ADQGGCMRSDKGPWKDPEILRMVQNGYAICRTKCESQSTAEKTISEDEIVYPKVSREVED  363

Query  966   saksvkkpaSFKIESTKKLFPIQEETR---------QPDMYVPMVDKTVDLPNWHVVNND  814
                   +     IE    L P+ EE R           + ++P++DK+++ P  +V+ ND
Sbjct  364   IQSLSPEVPRSYIEHP-NLSPVHEEVRINQNFHKSYNYEDFIPIIDKSMNAPWQNVMEND  422

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
               ++ + K AD + I +AYK  +  S Q+ TGVM  VMGIVTM+R+T+ MP+K T++ LY
Sbjct  423   --RYALSK-ADCFTIHDAYKAPDGFSTQIFTGVMALVMGIVTMIRLTRTMPKKFTDANLY  479

Query  633   SNSMHLNDHAMKGHG-AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
                ++  D  +K H  A++   P +T  EF+A MKRMA +E++   LS +P  MP +KE+
Sbjct  480   PGPIYCVDAMIKSHPYAHQLSAPVITGTEFLAFMKRMAEMEDRVSVLSVKPTAMPADKED  539

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +L+ A+ RID LE+ELA  KK LEE+ + Q E++AYIE
Sbjct  540   LLNAALIRIDTLERELAATKKTLEEAMAQQEEVLAYIE  577



>ref|XP_006404605.1| hypothetical protein EUTSA_v10000115mg [Eutrema salsugineum]
 gb|ESQ46058.1| hypothetical protein EUTSA_v10000115mg [Eutrema salsugineum]
Length=535

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/567 (61%), Positives = 419/567 (74%), Gaps = 59/567 (10%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             DD++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++VDAFRQALI
Sbjct  22    DDKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDVEELQAVDAFRQALI  81

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DM+ WRKEFGADTI++DFDFKE DEV
Sbjct  82    LDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWNDMINWRKEFGADTIMEDFDFKEIDEV  141

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             LKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T N K+ +CS
Sbjct  142   LKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACS  201

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLKNF+K AR+L+Q +QKID DN+PETL RM+IINAGSGFR
Sbjct  202   IAAKKHIDQSTTILDVQGVGLKNFSKAARDLLQRIQKIDSDNFPETLNRMFIINAGSGFR  261

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKGGCMRSDKG
Sbjct  262   LLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKGGCMRSDKG  321

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDP+I KMV  G  KC  R     EEKTI                         E+T 
Sbjct  322   PWNDPDIFKMVQNGEGKCPRRTLSNIEEKTIS----------------------VCENTT  359

Query  915   KLFPIQEETRQPDMYVPMVDKTVDL---PNWHVVNNDNCKFVVPKGADLYQIQEAYKGQE  745
             K      E  +   + PM+DK+VD     N H  N        P+  DLY    A K  E
Sbjct  360   KKNKFDSENAK---FTPMIDKSVDTTWPTNLHKKN-------FPEPEDLYS---AVKPTE  406

Query  744   LASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
                 +  L  GVM+ VMG++T+VR+TKNMPRKLTE+            A KG        
Sbjct  407   RRGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEA------------AEKGQTTM----  450

Query  570   PAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakka  391
               +++ E+M+M+KRMA LEEK  +L NQPP   PEKE++L+ A+SR+D LE +L+E KK 
Sbjct  451   --ISSQEYMSMVKRMAELEEKCRSLDNQPPAFSPEKEQILTAALSRVDELELQLSETKKT  508

Query  390   leesqSNQNELIAYIEkkkkkKNIFGF  310
             L+E+ + Q E++ YIEKKKKKK  FGF
Sbjct  509   LDEAMARQQEIVDYIEKKKKKKKFFGF  535



>ref|XP_002313782.2| hypothetical protein POPTR_0009s12220g, partial [Populus trichocarpa]
 gb|EEE87737.2| hypothetical protein POPTR_0009s12220g, partial [Populus trichocarpa]
Length=551

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/576 (57%), Positives = 422/576 (73%), Gaps = 36/576 (6%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             A  +SG ++ P++   EK D +   D+R+T+LGSL+K AI+ASNK      K  RR SRV
Sbjct  2     ADTLSGPLDPPIKGGHEKSDTEHSEDERKTKLGSLKKKAISASNKFRNSLTKKGRRHSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS+ ++D+ DAEE+++VDAFRQALILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW+D
Sbjct  62    MSISIEDDLDAEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDVEKAKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WRKEFGADTI+++F+FKE DEVLKYYPQG+HGVDK+GRP+YIERLG VDA KL+QVT
Sbjct  122   MLKWRKEFGADTIMEEFEFKEIDEVLKYYPQGYHGVDKEGRPVYIERLGEVDANKLVQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T+DRY+KYHVQEFE+T N K  +CSIAAKKHIDQSTTILDVQGVGLK FTK ARELI  +
Sbjct  182   TLDRYMKYHVQEFEKTFNIKFPACSIAAKKHIDQSTTILDVQGVGLKQFTKTARELISHI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
              KIDGDNYPETL RM+IIN G GFRLLW+TVK F+DPKT  KI+ LGNKYQSKLLE IDA
Sbjct  242   SKIDGDNYPETLNRMFIINGGPGFRLLWSTVKQFIDPKTAQKIHFLGNKYQSKLLEAIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+  GGTCTCA+KGGCMRSDKGPWND +I+KMV  G  KC  R      EK I ED 
Sbjct  302   SELPEIFGGTCTCANKGGCMRSDKGPWNDTDILKMVQNGEAKCHRRTFSGIHEKAISEDN  361

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDN  811
                                +  +   L    +  ++ D  +PMV+KT+D   W    N+ 
Sbjct  362   -------------------QPCTKSPLSKGYKSDQEYDYSIPMVEKTIDAA-WPTRQNN-  400

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
              ++ + K  D+Y+ Q         S Q++ G+M  VMGIVTMVR+++NMPRKL E+ +Y 
Sbjct  401   -RYDLSKEHDVYKAQR-------RSGQIVNGIMAVVMGIVTMVRISRNMPRKLAEAAVYG  452

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
             + ++ N+ A K H     P P+++ +E+  MM RMA +EEK   LS++P  M PEKEEML
Sbjct  453   SQVYANEMA-KSHAL---PAPSISTSEYKNMMSRMAEMEEKLNVLSSKPQVMLPEKEEML  508

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + ++ R D+LEQEL+ AKKALE++ + Q EL+AYI+
Sbjct  509   NASIRRADSLEQELSIAKKALEDALAKQQELLAYID  544



>ref|XP_002305440.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
 gb|EEE85951.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
Length=597

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/588 (58%), Positives = 422/588 (72%), Gaps = 33/588 (6%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             A  MSG ++R ++   EK D +   DDR+T+LGSL+K AI+ASNK      K  RR SRV
Sbjct  39    ADTMSGPLDRDIKGGLEKSDAEYSEDDRKTKLGSLKKKAISASNKFRNSLTKRGRRHSRV  98

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS+ ++D  +AEE+++VDAFRQALILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW+D
Sbjct  99    MSIAIEDNLNAEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWSD  158

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML WRKEFGADTI++DF+FKE DEVLK+YPQG+HG+DK+GRP+YIERLG +DA KL+QVT
Sbjct  159   MLSWRKEFGADTIMEDFEFKEIDEVLKHYPQGYHGIDKEGRPVYIERLGEIDANKLIQVT  218

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T+DRY+KYHVQEFE+T N K  +CSIAAKKHIDQSTTILDVQGVGLK FTK ARELI  +
Sbjct  219   TLDRYMKYHVQEFEKTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKQFTKTARELIGRI  278

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
              KIDGDNYPETL RM+IIN G GFRLLW+TVK F+DPKT  KI+ LGNKYQSKLLE IDA
Sbjct  279   SKIDGDNYPETLNRMFIINGGPGFRLLWSTVKQFIDPKTAQKIHFLGNKYQSKLLEAIDA  338

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+  GGTCTCADKGGCMRSDKGPWNDP+I+KMVH G  KC  +      EK I ED 
Sbjct  339   SELPEIFGGTCTCADKGGCMRSDKGPWNDPDILKMVHNGEAKCHRKTFSGIHEKGISED-  397

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNN-D  814
                                K   +K+    Q+        +PMV +T+D      +NN D
Sbjct  398   --------------DQPCIKSPLSKRCSSDQDYENS----IPMVKRTIDTAWPTPLNNRD  439

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
                   P       +  A K Q   S Q+L G++T VMGIVTMVR+++NMPRKL E   Y
Sbjct  440   GLSKECPP------VHGACKAQG-GSTQILNGILTVVMGIVTMVRISRNMPRKLAEVAAY  492

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
              + ++  D   K H       P+++ +E+  +M RMA +EEK   LS++P  MP EKEEM
Sbjct  493   GSQVYYADEMAKSHVL---AAPSISTSEYKNIMLRMAEMEEKLCVLSSKPQAMPAEKEEM  549

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             L+ A+ R D+LEQEL+  K ALE++ + Q EL+AYIEKKKKKK+IFGF
Sbjct  550   LNAAIKRADSLEQELSMVKTALEDAVAKQQELLAYIEKKKKKKSIFGF  597



>ref|XP_006404606.1| hypothetical protein EUTSA_v10000115mg [Eutrema salsugineum]
 gb|ESQ46059.1| hypothetical protein EUTSA_v10000115mg [Eutrema salsugineum]
Length=541

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/567 (62%), Positives = 423/567 (75%), Gaps = 53/567 (9%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             DD++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++VDAFRQALI
Sbjct  22    DDKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDVEELQAVDAFRQALI  81

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DM+ WRKEFGADTI++DFDFKE DEV
Sbjct  82    LDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWNDMINWRKEFGADTIMEDFDFKEIDEV  141

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             LKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T N K+ +CS
Sbjct  142   LKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACS  201

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLKNF+K AR+L+Q +QKID DN+PETL RM+IINAGSGFR
Sbjct  202   IAAKKHIDQSTTILDVQGVGLKNFSKAARDLLQRIQKIDSDNFPETLNRMFIINAGSGFR  261

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKGGCMRSDKG
Sbjct  262   LLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKGGCMRSDKG  321

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDP+I KMV  G  KC  R     EEKTI               SV +  + K ES  
Sbjct  322   PWNDPDIFKMVQNGEGKCPRRTLSNIEEKTI---------------SVCENTTKKCES--  364

Query  915   KLFPIQEETRQPDMYVPMVDKTVDL---PNWHVVNNDNCKFVVPKGADLYQIQEAYKGQE  745
               F   +   +   + PM+DK+VD     N H  N        P+  DLY    A K  E
Sbjct  365   --FAKNKFDSENAKFTPMIDKSVDTTWPTNLHKKN-------FPEPEDLYS---AVKPTE  412

Query  744   LASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
                 +  L  GVM+ VMG++T+VR+TKNMPRKLTE+            A KG        
Sbjct  413   RRGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEA------------AEKGQTTM----  456

Query  570   PAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakka  391
               +++ E+M+M+KRMA LEEK  +L NQPP   PEKE++L+ A+SR+D LE +L+E KK 
Sbjct  457   --ISSQEYMSMVKRMAELEEKCRSLDNQPPAFSPEKEQILTAALSRVDELELQLSETKKT  514

Query  390   leesqSNQNELIAYIEkkkkkKNIFGF  310
             L+E+ + Q E++ YIEKKKKKK  FGF
Sbjct  515   LDEAMARQQEIVDYIEKKKKKKKFFGF  541



>ref|XP_011048002.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Populus euphratica]
 ref|XP_011048011.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Populus euphratica]
 ref|XP_011048016.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Populus euphratica]
Length=599

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/601 (57%), Positives = 438/601 (73%), Gaps = 27/601 (4%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRV  1891
             A  +SG ++ P++   EK D +   D+R+T+LGSL+K AI+ASNK      K  RR SRV
Sbjct  2     ADTLSGPLDPPIKGGHEKSDTEHSEDERKTKLGSLKKKAISASNKFTNSLTKKGRRHSRV  61

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS+ ++D+ DAEE+++VDAFRQALILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW+D
Sbjct  62    MSISIEDDLDAEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDVEKAKQMWSD  121

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WRKEFGADTI+++F+FKE DEVLKYYPQG+HGVDK+GRP+YIERLG VDA KL+QVT
Sbjct  122   MLKWRKEFGADTIMEEFEFKEIDEVLKYYPQGYHGVDKEGRPVYIERLGEVDANKLVQVT  181

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T+DRY+KYHVQEFE+T N K  +CSIAAKKHIDQSTTILDVQGVGLK FTK ARELI  +
Sbjct  182   TLDRYMKYHVQEFEKTFNIKFPACSIAAKKHIDQSTTILDVQGVGLKQFTKTARELISHI  241

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
              KIDGDNYPETL RM+IIN G GFRLLW+TVK F+DPKT  KI+ LGNKYQSKLLE IDA
Sbjct  242   SKIDGDNYPETLNRMFIINGGPGFRLLWSTVKQFIDPKTAQKIHFLGNKYQSKLLEAIDA  301

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+  GGTCTCA+KGGCMRSDKGPWND +I+KMV  G  KC  R      EK I ED 
Sbjct  302   SELPEIFGGTCTCANKGGCMRSDKGPWNDTDIIKMVQNGEAKCHRRTFSGIHEKAISEDD  361

Query  990   GVNvsvsmsaksvkkpaSFKIESTKK------LFPIQE--------ETRQPDMYVPMVDK  853
                +  + S        +      +       L P+ E          ++ D  +PMV+K
Sbjct  362   QPCIKTNASFSKETAADATDYGHPRNHGEHQILSPVPESPLSKGNKSDQEYDYSIPMVEK  421

Query  852   TVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
             T+D   W    N+  ++ + K + L    + YK Q  +S Q++ G+M  +MGIVTMVR++
Sbjct  422   TIDAA-WPTRQNN--RYDLSKESRLE--HDVYKAQRRSS-QIVNGIMAVMMGIVTMVRIS  475

Query  672   KNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLS  493
             +NMPRKL E+ +Y + ++ N+ A K H     P P+++ +E+  MM RMA +EEK   LS
Sbjct  476   RNMPRKLAEAAVYGSQVYANEMA-KSHAL---PAPSISTSEYKNMMSRMAEMEEKLNVLS  531

Query  492   NQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFG  313
             ++P  M PEKEEML+ ++ R D LEQEL+ AKKALE++ + Q EL+AYI+KKKKKK IFG
Sbjct  532   SKPQVMLPEKEEMLNASIRRADCLEQELSIAKKALEDALAKQQELLAYIDKKKKKKKIFG  591

Query  312   F  310
             F
Sbjct  592   F  592



>ref|XP_006581015.1| PREDICTED: uncharacterized protein LOC100798374 isoform X1 [Glycine 
max]
Length=571

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/543 (59%), Positives = 410/543 (76%), Gaps = 24/543 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  V+ P++   E ++   D+R+ +LGS +K AI+AS+KF+HSF  R R+ SRVMS+ +
Sbjct  5     MSAPVDPPMKLGHE-IEYSEDERKKKLGSFKKVAISASSKFKHSFAKRGRKHSRVMSLSI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW DML+WR
Sbjct  64    EDDLDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKTKQMWTDMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFGADTI++DF+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+TKLMQVTTM+RY
Sbjct  124   QEFGADTIMEDFEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSTKLMQVTTMERY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVKEFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSLNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWNT+KSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWNTIKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDP+I+KMVH G  KC  +     EEK I EDG  N +
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKRIIEDGTANQN  363

Query  975   vsmsaks-vkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
             +        +     +  S KK    Q    + D +VP++ K VD  +W+ +   + K  
Sbjct  364   LGNKESFPERYDVDVQCLSPKK----QCTVYKYDAFVPVLGKPVD-SSWNTLTQKD-KDA  417

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
             + K     +  + Y      SN  + G+M  VMGIVTM+RMT+NMPRK+TE+ LY +S +
Sbjct  418   LSKDCFPSKTCDGY------SNHFVGGIMAIVMGIVTMIRMTRNMPRKITEAALYGSSGY  471

Query  618   LNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAM  439
              +   MK            +  ++MAMMKRMA LEEK +T+ +  P +PPEKEE+L+NA+
Sbjct  472   YDGTMMKA--------ATFSCNDYMAMMKRMAELEEK-VTILSMKPVIPPEKEEVLNNAL  522

Query  438   SRI  430
              R+
Sbjct  523   GRV  525



>ref|XP_008795962.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Phoenix dactylifera]
Length=629

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/586 (58%), Positives = 420/586 (72%), Gaps = 47/586 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+TR+GSL+K AINAS KFR+S   R RRSSRVMSV ++D  DAEE+++VDAFRQ LI
Sbjct  38    DERKTRIGSLKKKAINASTKFRNSLTKRGRRSSRVMSVCIEDVRDAEEMQAVDAFRQTLI  97

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMWADMLQWRKEFGA+TI +DFDFKE D+V
Sbjct  98    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWADMLQWRKEFGANTIAEDFDFKELDQV  157

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+YYPQGHHGVDK+GRP+YIE+LG +D  KLMQVT MDRY+KYHV+EFERT N K  +CS
Sbjct  158   LEYYPQGHHGVDKEGRPVYIEKLGQIDTNKLMQVTNMDRYIKYHVKEFERTFNIKFPACS  217

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IA K+HIDQSTTILDVQGVG+K F K AR+LI  LQKIDGDNYPETLCRM+IINAG GFR
Sbjct  218   IATKRHIDQSTTILDVQGVGMKQFNKVARDLISRLQKIDGDNYPETLCRMFIINAGQGFR  277

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGGTC C  KGGC+RSDKG
Sbjct  278   LLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGTCNC--KGGCLRSDKG  335

Query  1095  PWNDPEIMKMVHQGAHKCSHRMA-RVEEEKTIPEDGGVNvsvsms---------------  964
             PW DPEI+KMV  G  +     A    +EKTI ED  V +    S               
Sbjct  336   PWKDPEIIKMVQSGMARYGRCQAPSGTDEKTISEDEIVYLKRQDSFCGETILAADDVRPP  395

Query  963   ---------------aksvkkpaSFKIESTKKLFPIQEETRQPDM---YVPMVDKTVDLP  838
                             +      S+ ++S KK FP       PD    Y+PMVDK VD  
Sbjct  396   SPRMSRLIEHPHLSPVREEVVSPSYLVQSAKKCFPT------PDADVDYIPMVDKAVD-A  448

Query  837   NWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPR  658
             +W     D  +  + KG  +Y + + YKG +  SN +L GVM FVMGIVTM+R+T+ +P+
Sbjct  449   SWSKEVMDEKQLALSKG--VYSLSDVYKGPDGFSNHILAGVMAFVMGIVTMLRVTRVVPK  506

Query  657   KLTESTL-YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             K+ ++ + Y++ ++  +  +KG      P   V+AAE+ ++MKR+  LEE    LS +P 
Sbjct  507   KIVDAAIDYASPVYCGETMVKGQMQQTLPASTVSAAEYSSVMKRLMKLEENVNILSMKPA  566

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              MP EKEE L  A+SR+DALE ELA  KKALE++   Q EL+AY+E
Sbjct  567   EMPIEKEEQLKAAVSRVDALEAELAATKKALEDAFVRQEELLAYVE  612



>ref|XP_006296006.1| hypothetical protein CARUB_v10025149mg [Capsella rubella]
 gb|EOA28904.1| hypothetical protein CARUB_v10025149mg [Capsella rubella]
Length=564

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/561 (60%), Positives = 422/561 (75%), Gaps = 48/561 (9%)
 Frame = -2

Query  2010  KMDLDA--DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSV  1840
             K+D D   D+++T+L SL+K AINASNKF+HS  K  RR+SRVMSV + D+ D EE+++V
Sbjct  14    KLDCDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVSIVDDIDLEELQAV  73

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDE+LP+KHDD+HMMLRFL+ARKF+I+K+KQMW DM+ WRKEFGADTI++DF
Sbjct  74    DAFRQALILDEILPSKHDDHHMMLRFLRARKFDIEKAKQMWTDMIHWRKEFGADTIMEDF  133

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DFKE DEVLKYYPQG+HGVDK+GRP+YIERLG VDATKLMQVTT+DRY++YHV+EFE+T 
Sbjct  134   DFKEIDEVLKYYPQGYHGVDKEGRPVYIERLGQVDATKLMQVTTIDRYVQYHVREFEKTF  193

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
             N K+ +CSIAAKKHIDQSTTILDVQGVGLK+F+K AR+L+Q +QKID DNYPETL RM+I
Sbjct  194   NIKLPACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFI  253

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTCADKG
Sbjct  254   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKG  313

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI  D                  
Sbjct  314   GCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVD------------------  355

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQE-  763
                 E+T K   +  E   P+ ++P+V+KTV+   W   N     F  P+  D+Y   + 
Sbjct  356   ----ENTTKKNKLDAE--NPN-FMPLVEKTVNASTW-PANLPKSNF--PEPEDIYSAVKP  405

Query  762   -AYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
                KG E     L  GVM+ +MG++T+VR+TKNMPR+LTE+ +Y            G  A
Sbjct  406   SQRKGGE---GYLFGGVMSLMMGLMTVVRLTKNMPRRLTEAAIY------------GGEA  450

Query  585   YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqela  406
              K     V++ E+M+M+KRMA LEEK  +L NQP +  PEKE++L+ A+SR+D LE +LA
Sbjct  451   EKAETTMVSSQEYMSMVKRMAELEEKCRSLDNQPASFSPEKEQILTAALSRVDELELQLA  510

Query  405   eakkaleesqSNQNELIAYIE  343
             + KK L+E+ + Q+E++AYIE
Sbjct  511   QTKKTLDEAMATQHEIMAYIE  531



>ref|XP_009140284.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brassica rapa]
 ref|XP_009140285.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brassica rapa]
 ref|XP_009140286.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brassica rapa]
 ref|XP_009140287.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brassica rapa]
Length=550

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/587 (58%), Positives = 426/587 (73%), Gaps = 41/587 (7%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMS  1885
             A  MS  ++R  +P  E      DD++T+L S +K AINASNKF+HS  K  RR+SRVMS
Sbjct  2     ADTMSAHMDRHNKPDHE---CSEDDKKTKLCSFKKKAINASNKFKHSFTKKTRRNSRVMS  58

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V + D+ D EE+++VDAFRQALILDELLP++HDD+HMMLRFL+ARKF+I+K+KQMW DM+
Sbjct  59    VSIVDDIDVEELQAVDAFRQALILDELLPSRHDDHHMMLRFLRARKFDIEKAKQMWCDMI  118

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKEFG D I++DFDFKE DEV+KYYPQG+HGVDK+GRPIYIERLG VDATKLMQVTT+
Sbjct  119   NWRKEFGTDAIMEDFDFKEIDEVIKYYPQGYHGVDKEGRPIYIERLGQVDATKLMQVTTI  178

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+ YHV+EFE+  N K+ +CSIAAK+HIDQSTTILDVQGVGLKNF+K AR+L+Q +QK
Sbjct  179   DRYVSYHVREFEKAFNIKLPACSIAAKRHIDQSTTILDVQGVGLKNFSKAARDLLQRIQK  238

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             ID DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++E
Sbjct  239   IDSDNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNE  298

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGG CTCADKGGCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI     V
Sbjct  299   LPEFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTI----SV  354

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCK  805
               S +       +  +F  E+ K              + P+VDKTVD  +          
Sbjct  355   YESTTEKKCETFEKNTFNAENEK--------------FTPIVDKTVDASSTWPTTLHKAT  400

Query  804   FVVPKGADLYQIQEAYKGQELASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
             F  P+  DLY    A K  E    +  L  GVM+ VMG++T+VR+TKNMPRKLTE+ +Y 
Sbjct  401   FTEPE--DLYS---AVKPSERKGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAAIYG  455

Query  630   NSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEML  451
              +    + AM            V+  E+M+M+KRMA LEEK  +L NQP     EKE++L
Sbjct  456   GAAEKGETAM------------VSTQEYMSMVKRMAELEEKCRSLDNQPAPFSAEKEQIL  503

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             + A++R+D LE +L+E KK L+E+ + Q E++AYIEKKKKKK  FGF
Sbjct  504   NAALTRVDQLEFQLSETKKTLDEAMAKQLEIVAYIEKKKKKKKFFGF  550



>ref|XP_009388836.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Musa acuminata subsp. malaccensis]
Length=629

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/585 (58%), Positives = 416/585 (71%), Gaps = 45/585 (8%)
 Frame = -2

Query  2004  DLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFR  1828
             ++  D+R+TR+ SL+K AINAS K      K  RRSS+VMSV ++D  DAEE+++VDAFR
Sbjct  32    EISEDERRTRIESLKKKAINASTKFRHSLIKRGRRSSKVMSVAIEDVRDAEEMQAVDAFR  91

Query  1827  QALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKE  1648
             Q LIL+ELLP++HDDYH MLRFLKARKF+I+K+KQMWADMLQWRKEFGADTI+DDFDFKE
Sbjct  92    QILILEELLPSRHDDYHTMLRFLKARKFDIEKTKQMWADMLQWRKEFGADTILDDFDFKE  151

Query  1647  RDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKM  1468
              ++V++YYPQGHHGVDK+GRP+YIERLG VDA KLMQVTTMDRY+KYHV+EFER+   K 
Sbjct  152   LNDVMEYYPQGHHGVDKEGRPVYIERLGQVDANKLMQVTTMDRYVKYHVKEFERSFVVKF  211

Query  1467  SSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAG  1288
              +CSIAAK+HIDQSTTI+DVQGVG K FTK ARELI  +QKIDGDNYPETLCRM+IINAG
Sbjct  212   PACSIAAKRHIDQSTTIIDVQGVGCKQFTKAARELISRIQKIDGDNYPETLCRMFIINAG  271

Query  1287  SGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMR  1108
             SGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGGTC C  +GGC+ 
Sbjct  272   SGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGTCNC--EGGCLH  329

Query  1107  SDKGPWNDPEIMKMVHQGAHKC-SHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFK  931
             SDKGPW DPEI+KMV  G   C S  +A   EEKTI ED  V      S       A   
Sbjct  330   SDKGPWKDPEILKMVQSGVGSCGSQHLATGTEEKTISEDEVVYPKKQDSFCKETILAVDD  389

Query  930   IESTK-----------KLFPIQEETRQPDM---------------YVPMVDKTVDLPNWH  829
             + S              + P++EE    D+               YVP+VDK VD  +  
Sbjct  390   MYSVSPNILRSVIEHPHMSPVREEEDSSDLQTAPEKFPTPYSNDDYVPIVDKAVDASSNK  449

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
             V +    K  +P G+  Y +   Y G +  SNQ+++GVM FVMGIVTM+R+ +  PRK+ 
Sbjct  450   VPDE---KLAIPNGS--YALSGTYNGPDGFSNQIVSGVMAFVMGIVTMMRVGRATPRKIA  504

Query  648   ESTLYSNSMHLNDHA--MKGH-GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPT  478
              +        +ND    +KG     + P P V+AAEF +++KR+  LEEK   LS +P  
Sbjct  505   NA-------DINDAIPMLKGQMHQSQLPAPTVSAAEFSSVLKRLGELEEKVSVLSTKPAE  557

Query  477   MPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             M PEKEEML+ A+ R+DALE ELA  KKALE++   Q E++AYI+
Sbjct  558   MAPEKEEMLNAAVMRVDALEAELAATKKALEDALVQQQEILAYID  602



>dbj|BAF98224.1| CM0216.420.nc [Lotus japonicus]
Length=580

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 393/529 (74%), Gaps = 26/529 (5%)
 Frame = -2

Query  2010  KMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDA  1834
             +M+   D+++TRLGSL+K AI+AS+KF++S   + R+  RVMS+ ++DE D EE+++VDA
Sbjct  18    EMEYLEDEKKTRLGSLKKVAISASSKFKNSLTKKGRKHCRVMSIAIEDELDLEELQAVDA  77

Query  1833  FRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDF  1654
             FRQAL L+ELLP+KHDD HMMLRFL+ARKF+I+K+KQMWADMLQWR+EFGADTI++DF+F
Sbjct  78    FRQALTLEELLPSKHDDDHMMLRFLRARKFDIEKAKQMWADMLQWRREFGADTIMEDFEF  137

Query  1653  KERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNND  1474
             +E DEV+KYYPQGHHG DKDGRP+YIERLG VD+ KLMQVTTMDRYLKYHV+EFERT   
Sbjct  138   QEIDEVIKYYPQGHHGTDKDGRPVYIERLGQVDSHKLMQVTTMDRYLKYHVREFERTFAV  197

Query  1473  KMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIIN  1294
             K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQK+DGDNYPE+L RM+IIN
Sbjct  198   KLPACSIAAKKHIDQSTTILDVQGVGLKSLNKAARDLIQMLQKVDGDNYPESLNRMFIIN  257

Query  1293  AGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGC  1114
             AGSGFRLLWNT+KSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+FLGGTCTCADKGGC
Sbjct  258   AGSGFRLLWNTIKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADKGGC  317

Query  1113  MRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSF  934
             M SDKGPWNDPEI KMV  G  KC  +     EEKT+ ED      V    K        
Sbjct  318   MLSDKGPWNDPEIFKMVQNGQGKCKRKTLSGIEEKTMIEDDTTYEKVECMPKVEHPECYA  377

Query  933   KIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNW-HVVNNDNCKFVVPKGADLYQIQEAY  757
               E  K     Q    Q D +VP++  +V   +W   V ND          D +  ++  
Sbjct  378   VPEVAK-----QCNVYQCDAFVPVIGNSV---SWKKAVQNDKLAL----SQDCFPNKDCK  425

Query  756   KGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKP  577
              G    + Q   G+M  VMG +T +R+T+NMPRK+TE  LY +S++ + + MK       
Sbjct  426   TG---LTTQFAGGIMAVVMGFITFIRLTRNMPRKITEVALYGSSVYYDGNMMKA------  476

Query  576   PEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
               PA++  E MA+MKRMA LEEK   LS + P+MPPEKEEML+NA+SR+
Sbjct  477   --PAISIDEHMALMKRMAELEEKVNALSMR-PSMPPEKEEMLNNALSRV  522



>emb|CDX99586.1| BnaC04g33430D [Brassica napus]
Length=550

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/590 (58%), Positives = 425/590 (72%), Gaps = 47/590 (8%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMS  1885
             A  MS  ++R  +P  E      DD++T+L S +K AINASNKF+HS  K  RR+SRVMS
Sbjct  2     ADTMSAHMDRHNKPDHE---CSEDDKKTKLCSFKKKAINASNKFKHSFTKKTRRNSRVMS  58

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V + D+ D EE+++VDAFRQALILDELLP++HDD+HMMLRFL+ARKF+I+K+KQMW DM+
Sbjct  59    VSIVDDIDVEELQAVDAFRQALILDELLPSRHDDHHMMLRFLRARKFDIEKAKQMWCDMI  118

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKEFG D I++DFDFKE DEV+KYYPQG+HGVDK+GRPIYIERLG VDATKLMQVTT+
Sbjct  119   NWRKEFGTDAIMEDFDFKEIDEVIKYYPQGYHGVDKEGRPIYIERLGQVDATKLMQVTTI  178

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+ YHV+EFE+  N K+ +CSIAAK+HIDQSTTILDVQGVGLKNF+K AR+L+Q +QK
Sbjct  179   DRYVNYHVREFEKAFNIKLPACSIAAKRHIDQSTTILDVQGVGLKNFSKAARDLLQRIQK  238

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             ID DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++E
Sbjct  239   IDSDNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNE  298

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGG CTCADKGGCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI      
Sbjct  299   LPEFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTIS-----  353

Query  984   NvsvsmsaksvkkpaSFKIESTK---KLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNND  814
                                EST    + F       + + + P+VDKTVD  +    +  
Sbjct  354   -----------------VYESTTEKCETFEKNSFNAENEKFTPIVDKTVDASSTWPTSLH  396

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
                F  P+ AD+Y    A K  E    +  L  GVM+ VMG++T+VR+TKNMPRKLTE+ 
Sbjct  397   KTTFTEPE-ADVYS---AVKPSERKGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAA  452

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             +Y            G  A K     V+  E+M+M+KRMA LEEK  +L NQP     EKE
Sbjct  453   IY------------GGAAEKGETAMVSTQEYMSMVKRMAELEEKCRSLDNQPAPFSAEKE  500

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             ++L+ A++R+D LE +L+E KK L+E+ + Q E++AYIEKKKKKK  FGF
Sbjct  501   QILNAALTRVDQLEFQLSETKKTLDEAMAKQLEIVAYIEKKKKKKKFFGF  550



>emb|CDY15887.1| BnaA04g12240D [Brassica napus]
Length=549

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/589 (58%), Positives = 427/589 (72%), Gaps = 46/589 (8%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMS  1885
             A  MS  ++R  +P  E      DD++T+L S +K AINASNKF+HS  K  RR+SRVMS
Sbjct  2     ADTMSAHMDRHSKPDHE---CSEDDKKTKLCSFKKKAINASNKFKHSFTKKTRRNSRVMS  58

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V + D+ D EE+++VDAFRQALILDELLP++HDD+HMMLRFL+ARKF+I+K+KQMW DM+
Sbjct  59    VSIVDDIDVEELQAVDAFRQALILDELLPSRHDDHHMMLRFLRARKFDIEKAKQMWCDMI  118

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKEFG D I++DFDFKE DEV+KYYPQG+HGVDK+GRPIYIERLG VDATKLMQVTT+
Sbjct  119   NWRKEFGTDAIMEDFDFKEIDEVIKYYPQGYHGVDKEGRPIYIERLGQVDATKLMQVTTI  178

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+ YHV+EFE+  N K+ +CSIAAK+HIDQSTTILDVQGVGLKNF+K AR+L+Q +QK
Sbjct  179   DRYVNYHVREFEKAFNIKLPACSIAAKRHIDQSTTILDVQGVGLKNFSKAARDLLQRIQK  238

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             ID DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++E
Sbjct  239   IDSDNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNE  298

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGG CTCADKGGCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI      
Sbjct  299   LPEFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTI------  352

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEET--RQPDMYVPMVDKTVDLPNWHVVNNDN  811
                            S    +T+K    ++ T   + + + P+VDKTVD  +        
Sbjct  353   ---------------SVYESTTEKCETFEKNTFNAENEKFTPIVDKTVDASSTWPTTLHK  397

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTESTL  637
               F  P+  DLY    A K  E    +  L  GVM+ VMG++T+VR+TKNMPRKLTE+ +
Sbjct  398   ATFTEPE--DLYS---AVKPSERKGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAAI  452

Query  636   YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
             Y  +    + AM            V+  E+M+M+KRMA LEEK  +L NQP     EKE+
Sbjct  453   YGGAAEKGETAM------------VSTQEYMSMVKRMAELEEKCRSLDNQPAPFSAEKEQ  500

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +L+ A++R+D LE +L+E KK L+E+ + Q E++AYIEKKKKKK  FGF
Sbjct  501   ILNAALTRVDQLEFQLSETKKTLDEAMAKQLEIVAYIEKKKKKKKFFGF  549



>ref|XP_009140288.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X2 [Brassica rapa]
Length=549

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/589 (58%), Positives = 427/589 (72%), Gaps = 46/589 (8%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMS  1885
             A  MS  ++R  +P  E      DD++T+L S +K AINASNKF+HS  K  RR+SRVMS
Sbjct  2     ADTMSAHMDRHNKPDHE---CSEDDKKTKLCSFKKKAINASNKFKHSFTKKTRRNSRVMS  58

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V + D+ D EE+++VDAFRQALILDELLP++HDD+HMMLRFL+ARKF+I+K+KQMW DM+
Sbjct  59    VSIVDDIDVEELQAVDAFRQALILDELLPSRHDDHHMMLRFLRARKFDIEKAKQMWCDMI  118

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKEFG D I++DFDFKE DEV+KYYPQG+HGVDK+GRPIYIERLG VDATKLMQVTT+
Sbjct  119   NWRKEFGTDAIMEDFDFKEIDEVIKYYPQGYHGVDKEGRPIYIERLGQVDATKLMQVTTI  178

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+ YHV+EFE+  N K+ +CSIAAK+HIDQSTTILDVQGVGLKNF+K AR+L+Q +QK
Sbjct  179   DRYVSYHVREFEKAFNIKLPACSIAAKRHIDQSTTILDVQGVGLKNFSKAARDLLQRIQK  238

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             ID DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++E
Sbjct  239   IDSDNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNE  298

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGG CTCADKGGCMRSDKGPWNDP+I KMV  G  KC  +     EEKTI      
Sbjct  299   LPEFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTI------  352

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEET--RQPDMYVPMVDKTVDLPNWHVVNNDN  811
                            S    +T+K    ++ T   + + + P+VDKTVD  +        
Sbjct  353   ---------------SVYESTTEKCETFEKNTFNAENEKFTPIVDKTVDASSTWPTTLHK  397

Query  810   CKFVVPKGADLYQIQEAYKGQELASNQ--LLTGVMTFVMGIVTMVRMTKNMPRKLTESTL  637
               F  P+  DLY    A K  E    +  L  GVM+ VMG++T+VR+TKNMPRKLTE+ +
Sbjct  398   ATFTEPE--DLYS---AVKPSERKGGEGYLFGGVMSLVMGLMTVVRLTKNMPRKLTEAAI  452

Query  636   YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
             Y  +    + AM            V+  E+M+M+KRMA LEEK  +L NQP     EKE+
Sbjct  453   YGGAAEKGETAM------------VSTQEYMSMVKRMAELEEKCRSLDNQPAPFSAEKEQ  500

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +L+ A++R+D LE +L+E KK L+E+ + Q E++AYIEKKKKKK  FGF
Sbjct  501   ILNAALTRVDQLEFQLSETKKTLDEAMAKQLEIVAYIEKKKKKKKFFGF  549



>ref|XP_008784932.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Phoenix dactylifera]
Length=634

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/613 (56%), Positives = 433/613 (71%), Gaps = 49/613 (8%)
 Frame = -2

Query  2052  MSGAVER---------PLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnk-frhsfksr  1909
             MSG ++R         P      K D+D   D+R+TR+ SL+K AINAS K      K  
Sbjct  5     MSGPLDRHGKSGLDGAPEERRDRKSDVDNSEDERKTRIESLKKKAINASTKFRNSLSKRG  64

Query  1908  rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKS  1729
             RRSSRVMSV ++D  DAEE+++VDAFRQ LIL+ELLP++HDDYHMMLRFLKARKF+I+K+
Sbjct  65    RRSSRVMSVSIEDVRDAEEMQAVDAFRQILILEELLPSRHDDYHMMLRFLKARKFDIEKT  124

Query  1728  KQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDAT  1549
             KQMWADMLQWRKEFGADTI++DF+FKE D+VL+YYPQGHHGVDK+GRP+Y+E+LG +D  
Sbjct  125   KQMWADMLQWRKEFGADTIVEDFEFKELDQVLEYYPQGHHGVDKEGRPVYVEKLGQIDTN  184

Query  1548  KLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQAR  1369
             KLMQVT MDRY+KYHV+EFERT N K  +CS+AAK+HIDQSTTILDVQGVG+K+F K AR
Sbjct  185   KLMQVTNMDRYIKYHVKEFERTFNVKFPACSVAAKRHIDQSTTILDVQGVGMKHFNKVAR  244

Query  1368  ELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKL  1189
             +LI  LQKIDGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKL
Sbjct  245   DLIGRLQKIDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKL  304

Query  1188  LEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKC--SHRMARVEE  1015
             LE+IDASELP+FLGGTC C  +GGC+RSDKGPW DPEI+K+V  G  +C  S +     +
Sbjct  305   LEVIDASELPEFLGGTCNC--EGGCLRSDKGPWKDPEILKIVQSGMARCGRSCQATSGTD  362

Query  1014  EKTIPEDGGV----------NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP-----  880
             EKTI ED  V             ++        P   ++     L P++EE   P     
Sbjct  363   EKTISEDEVVYLKRQDSFCGETILAADDVRPPSPRMSRVIEHPHLSPVREEAVSPSYQVQ  422

Query  879   ------------DMYVPMVDKTVDLP-NWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
                         D Y+PMVDKTVD   N  V+N +  +  + KG   Y + + YKG +  
Sbjct  423   GAKESFPTPDADDDYIPMVDKTVDASWNKEVMNEE--QLALSKG--FYTLSDVYKGPDGF  478

Query  738   SNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTL-YSNSMHLNDHAMKGHGAYKPPEPAV  562
             SN +L GVM FVMGIVTM+R T+ +P+K+ ++ + Y++ ++  +  +KG    + P   V
Sbjct  479   SNHILAGVMVFVMGIVTMLRATRVIPKKIVDAAIDYASPVYCAETLVKGQMHQQLPASTV  538

Query  561   TAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkalee  382
             +AAE+ ++MKR+  LEEK   +  +P  MP EKEE L  A+SR++ALE ELA  KKALE+
Sbjct  539   SAAEYSSVMKRLRELEEKMSIVDMKPAEMPVEKEEELKAAVSRMNALEVELAATKKALED  598

Query  381   sqSNQNELIAYIE  343
             + + Q EL+AYI+
Sbjct  599   ALARQEELLAYID  611



>ref|XP_008795961.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Phoenix dactylifera]
Length=631

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/588 (58%), Positives = 420/588 (71%), Gaps = 49/588 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+TR+GSL+K AINAS KFR+S   R RRSSRVMSV ++D  DAEE+++VDAFRQ LI
Sbjct  38    DERKTRIGSLKKKAINASTKFRNSLTKRGRRSSRVMSVCIEDVRDAEEMQAVDAFRQTLI  97

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMWADMLQWRKEFGA+TI +DFDFKE D+V
Sbjct  98    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWADMLQWRKEFGANTIAEDFDFKELDQV  157

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+YYPQGHHGVDK+GRP+YIE+LG +D  KLMQVT MDRY+KYHV+EFERT N K  +CS
Sbjct  158   LEYYPQGHHGVDKEGRPVYIEKLGQIDTNKLMQVTNMDRYIKYHVKEFERTFNIKFPACS  217

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IA K+HIDQSTTILDVQGVG+K F K AR+LI  LQKIDGDNYPETLCRM+IINAG GFR
Sbjct  218   IATKRHIDQSTTILDVQGVGMKQFNKVARDLISRLQKIDGDNYPETLCRMFIINAGQGFR  277

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGGTC C  KGGC+RSDKG
Sbjct  278   LLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGTCNC--KGGCLRSDKG  335

Query  1095  PWNDPEIMK--MVHQGAHKCSHRMA-RVEEEKTIPEDGGVNvsvsms-------------  964
             PW DPEI+K  MV  G  +     A    +EKTI ED  V +    S             
Sbjct  336   PWKDPEIIKVQMVQSGMARYGRCQAPSGTDEKTISEDEIVYLKRQDSFCGETILAADDVR  395

Query  963   -----------------aksvkkpaSFKIESTKKLFPIQEETRQPDM---YVPMVDKTVD  844
                               +      S+ ++S KK FP       PD    Y+PMVDK VD
Sbjct  396   PPSPRMSRLIEHPHLSPVREEVVSPSYLVQSAKKCFPT------PDADVDYIPMVDKAVD  449

Query  843   LPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNM  664
               +W     D  +  + KG  +Y + + YKG +  SN +L GVM FVMGIVTM+R+T+ +
Sbjct  450   -ASWSKEVMDEKQLALSKG--VYSLSDVYKGPDGFSNHILAGVMAFVMGIVTMLRVTRVV  506

Query  663   PRKLTESTL-YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQ  487
             P+K+ ++ + Y++ ++  +  +KG      P   V+AAE+ ++MKR+  LEE    LS +
Sbjct  507   PKKIVDAAIDYASPVYCGETMVKGQMQQTLPASTVSAAEYSSVMKRLMKLEENVNILSMK  566

Query  486   PPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             P  MP EKEE L  A+SR+DALE ELA  KKALE++   Q EL+AY+E
Sbjct  567   PAEMPIEKEEQLKAAVSRVDALEAELAATKKALEDAFVRQEELLAYVE  614



>ref|XP_010429071.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Camelina sativa]
 ref|XP_010429072.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Camelina sativa]
Length=548

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/562 (60%), Positives = 420/562 (75%), Gaps = 36/562 (6%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+++T+L SL+K AINASNKF+HS  K  RR+SRVMS+ + D+ D EE+++VDAFRQALI
Sbjct  22    DEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSLSIVDDIDLEELQAVDAFRQALI  81

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARK +I+K+KQMW+DM+ WRKEFG DTI++DFDFKE DEV
Sbjct  82    LDELLPSKHDDHHMMLRFLRARKCDIEKAKQMWSDMIHWRKEFGVDTIMEDFDFKEIDEV  141

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             LKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DRY+KYHV+EFE+T N K+ +CS
Sbjct  142   LKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACS  201

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLK+F+K AR+L+Q +QKID DNYPETL RM+IINAGSGFR
Sbjct  202   IAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFIINAGSGFR  261

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIID++ELP+FLGG CTC DKGGCMRSDKG
Sbjct  262   LLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCTDKGGCMRSDKG  321

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDP+I KMV  G  KC  +     EEKTI  D                    K +S +
Sbjct  322   PWNDPDIFKMVQNGGGKCPRKTLANIEEKTISVDENTT---------------MKCDSVE  366

Query  915   KLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
             K     E  +     +P+V+K V+   W   N     F  P+  D+Y   +  + +    
Sbjct  367   KNKLDVENAK----LLPIVEKAVNATTWP-ANLHKSNF--PEPEDIYSAVKPSQ-RRGGE  418

Query  735   NQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTA  556
               L  GVM+ +MG++T+VR+TKNMPRKLTE+ +Y            G    K     +++
Sbjct  419   GYLFGGVMSLMMGLMTVVRLTKNMPRKLTEAAIY------------GGNGEKTETTMMSS  466

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              E+M+M+KRMA LEEK  +L NQP +  PEKE++L+ A+SR+D LE +LA+ KK L+E+ 
Sbjct  467   QEYMSMVKRMAELEEKCRSLDNQPASFSPEKEQILTAALSRVDELEVQLAQTKKTLDEAM  526

Query  375   SNQNELIAYIEkkkkkKNIFGF  310
             + Q+E++AYIEKKKKKK  FGF
Sbjct  527   ATQHEIMAYIEKKKKKKKFFGF  548



>ref|XP_010029748.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Eucalyptus grandis]
Length=583

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/594 (58%), Positives = 438/594 (74%), Gaps = 24/594 (4%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVL  1876
             MSG +  PL P       +  D + ++ S +K AINASNK      K  RRSS+VMS+ +
Sbjct  1     MSGTMSGPLSPKPAD---ERHDEKNKISSFKKKAINASNKFRHSLTKKGRRSSKVMSIDI  57

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +DEHDAEE+K+VDAFRQALIL+ELLP+KHDDYHMMLRFLKARKF+I+KSKQMWA+M+QWR
Sbjct  58    EDEHDAEELKAVDAFRQALILEELLPSKHDDYHMMLRFLKARKFDIEKSKQMWANMIQWR  117

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFG+DTI+++F+F+E +EVLKYYPQGHHGVDK+GRP+YIERLG VDATKLMQVTTM+RY
Sbjct  118   EEFGSDTILEEFEFEEINEVLKYYPQGHHGVDKEGRPVYIERLGQVDATKLMQVTTMERY  177

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +KYHV+EFER    K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+  LQKIDG
Sbjct  178   VKYHVREFERIFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVTRLQKIDG  237

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+
Sbjct  238   DNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPE  297

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGG CTC+D+GGCM SDKGPW D EIMKMV  G H C  +     + KT  ED   NV 
Sbjct  298   FLGGACTCSDQGGCMLSDKGPWKDQEIMKMVQNGDHMCRKKSTPGFDGKTTSEDEMANVK  357

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEET----------RQPDMYVPMVDKTVDLPNWHV  826
                   +    A         L PI EE           R+ D + P+VDK V +  W  
Sbjct  358   GCDHPNADALDAR---PQPPHLSPIVEEGYNSQNCKKSFRRED-FAPVVDKNVIMA-WEK  412

Query  825   VNNDNCKFVVPKGADLYQIQEAYKG--QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               +D+ K  +PKG + + + + +K    E  S+ L +G+MT VMG+ T++RMT+NMP+K+
Sbjct  413   FAHDD-KLALPKG-NHFAMADHHKAPQSEGFSSHLFSGLMTVVMGVATVIRMTRNMPKKV  470

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             T++TLYS+S + +D+ +K       P P ++++++  M+KRMA LEEK   L+ +P  MP
Sbjct  471   TDATLYSSSAYYSDNMVKSQMHEFAPAP-ISSSDYFMMLKRMAELEEKVTVLNMKPAAMP  529

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              EK+E+L  A+SR+  LEQEL   KKAL+++ S Q EL+ Y+EKKKKKK++FG+
Sbjct  530   VEKQELLDAAISRVSTLEQELTATKKALDDTISRQQELLDYMEKKKKKKSLFGW  583



>gb|KCW55375.1| hypothetical protein EUGRSUZ_I01285 [Eucalyptus grandis]
Length=520

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 393/551 (71%), Gaps = 72/551 (13%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhs-fksrrrssRVMSV  1882
             M+G ++   +P  EK DL+   D+R+TRLGSL+K AINAS KFRHS  K  RRSS+VMSV
Sbjct  1     MTGPLDLAAKPVLEKPDLENSEDERKTRLGSLKKKAINASTKFRHSWTKRGRRSSKVMSV  60

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
               DD+ D+EE+++VDAFRQALILDELLP++HDD HMMLRFL+ARKF+I+K+KQMWADMLQ
Sbjct  61    SFDDDFDSEELQAVDAFRQALILDELLPSRHDDPHMMLRFLRARKFDIEKTKQMWADMLQ  120

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DFDFKE D+VL+YYPQGHHGVDK+GRPIYIERLG VD  KLMQVTTMD
Sbjct  121   WRKEFGADTIMEDFDFKEIDDVLEYYPQGHHGVDKEGRPIYIERLGKVDPNKLMQVTTMD  180

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY+KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGL+NF K AR+L+  LQKI
Sbjct  181   RYVKYHVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLRNFNKAARDLVACLQKI  240

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DGDNYPETL RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASEL
Sbjct  241   DGDNYPETLNRMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASEL  300

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVN  982
             P+FLGG+CTCADKGGCMRSDKGPWN+P+ +K+    A KC    A               
Sbjct  301   PEFLGGSCTCADKGGCMRSDKGPWNNPDTLKIFL--AKKCDTDNAY--------------  344

Query  981   vsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVD------LPNWHVVN  820
                                               D +V ++DK VD      LP      
Sbjct  345   ----------------------------------DHFVTIIDKAVDNDWIKTLPTSKSGL  370

Query  819   NDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTEST  640
                C FV P         +  K  +  S+ +L GV+ F+MGI T+VRMT+++PRKLT+  
Sbjct  371   KKGC-FVPP---------DHCKPHDAISSHILNGVLAFIMGIFTVVRMTRDIPRKLTDGN  420

Query  639   LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             LYS   +  D   KGH   + PEP+++  +++ MMKRMA LEEK I L  +  +MPPEKE
Sbjct  421   LYSTPTYYVDTMKKGH---QLPEPSISRDDYLNMMKRMAELEEKVIVLGTKQASMPPEKE  477

Query  459   EMLSNAMSRID  427
             EML  A+SR++
Sbjct  478   EMLIAAVSRVE  488



>ref|XP_010263589.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Nelumbo nucifera]
Length=602

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/599 (55%), Positives = 432/599 (72%), Gaps = 35/599 (6%)
 Frame = -2

Query  2067  CSAGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             C   +     ERP+  S E      D+++ R+GSLR+ + N+S K R+S   + RRSS+V
Sbjct  2     CDVMSARPGDERPIVESLE------DEKKNRMGSLRQISANSSTKLRNSLSKKGRRSSKV  55

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             M V ++D HDAEE K+VDA RQALIL+ELLP++HDDYHMMLRFLKARKF+ +K+KQMW D
Sbjct  56    MDVSIEDVHDAEESKAVDALRQALILEELLPSRHDDYHMMLRFLKARKFDTEKTKQMWTD  115

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M++WRKEFGADTI++DF+F+E +EVL++YPQGHHGVDK+GRP+YIE+LG VD  KL+Q T
Sbjct  116   MIRWRKEFGADTIMEDFEFEELNEVLEHYPQGHHGVDKEGRPVYIEKLGQVDPIKLLQAT  175

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             +M+RY+KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+ AL
Sbjct  176   SMERYVKYHVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVVAL  235

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETLCRM+IINAGSGFRLLWNT+KSFLDPKTTAKI+VLGNK+QSKLLE+IDA
Sbjct  236   QKIDGDNYPETLCRMFIINAGSGFRLLWNTIKSFLDPKTTAKIHVLGNKFQSKLLEVIDA  295

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQG-AHKCSHRMARVEEEKTIPED  994
             SELPDFLGGTCTCA+ GGCMRSDKGPW DPEI+KM+  G     +       +EKTIPE+
Sbjct  296   SELPDFLGGTCTCAEHGGCMRSDKGPWKDPEILKMIQNGHVTCTTKTTTPGTDEKTIPEE  355

Query  993   GGV--NvsvsmsaksvkkpaSFKIESTK---------KLFPIQEETR---------QPDM  874
               V      S+ +         +  S+K         +L P++EE +         + D 
Sbjct  356   EIVYPKRCDSVQSDKGTDVEDMRSRSSKIPREDIRHPELSPVREEVKVSQNGPRNFEYDD  415

Query  873   YVPMVDKTVDLPNWH-VVNNDNCKFVVPKGADLYQIQEAY-KGQELASNQLLTGVMTFVM  700
              +P+VDK VD   WH +V +D+    + K +  + I +   K  E  SNQ+ TG+M FVM
Sbjct  416   LIPIVDKAVD-ATWHKIVQSDD--LALSKVSGYFPINDVCNKAPEGGSNQIFTGLMAFVM  472

Query  699   GIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMAS  520
             GIVTM+R+T+ MP+KLT++ LYS+ ++  D  +K         P+++  +++++MKRM  
Sbjct  473   GIVTMIRLTRTMPKKLTDANLYSSPIYYVDPMIKDQSQLSG--PSISETQYLSIMKRMDE  530

Query  519   LEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             LEEK   LS +P  M  EKEEML+ A+ RI+ALEQEL   KKALE++   Q +++AY++
Sbjct  531   LEEKVTVLSMKPAEMSAEKEEMLNAAVRRIEALEQELMATKKALEDALVRQEDIVAYLD  589



>ref|XP_007135958.1| hypothetical protein PHAVU_009G006100g [Phaseolus vulgaris]
 gb|ESW07952.1| hypothetical protein PHAVU_009G006100g [Phaseolus vulgaris]
Length=567

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/586 (58%), Positives = 428/586 (73%), Gaps = 33/586 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVL  1876
             M   V++P++   E    D D+R+ R+GS +K A++AS K      K  RR SRVMSV +
Sbjct  5     MPAPVDQPVKLGHESEHSD-DERKKRVGSFKKVAMSASFKFRSSLTKKGRRHSRVMSVSI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
              D+ DAEE+++VDAFRQALIL+ELLP++HDD+H+MLRFL+ARKF+I+K+KQMWADML+WR
Sbjct  64    ADDLDAEELQAVDAFRQALILEELLPSRHDDHHVMLRFLRARKFDIEKTKQMWADMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFGADTI +DF+F E+DEVLKYYPQGHHGVDKDGRP+YIE+LG VD+TKLMQVTTMDRY
Sbjct  124   QEFGADTISEDFEFTEQDEVLKYYPQGHHGVDKDGRPVYIEKLGQVDSTKLMQVTTMDRY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVKEFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED----GG  988
             FLGGTCTCADKGGCM SDKGPWNDP+I+KM+  G  KC  +      EKT+ ED      
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPDIIKMIQNGEGKCKRQTLSGIAEKTVIEDETAHQN  363

Query  987   VNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNC  808
             V    S+             +  K ++  +E       +VP++ K VD     ++ ND  
Sbjct  364   VGNKESVPETYNVDVPCLSPKVAKPVYKYEE-------FVPVLGKPVDSSWNKLIQND--  414

Query  807   KFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
                  KGAD +    A K  +L +N  + G+M F+MGIVTM+RMTKNMPRKL E+ LYS+
Sbjct  415   -----KGADCF----ASKTSDLNTNHFVGGIMAFIMGIVTMIRMTKNMPRKLNEAALYSS  465

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
             S +     MK            +  ++M+ +KRM  LEEK +T+ N+   MPPEKEE+L+
Sbjct  466   SGYYESSMMKA--------ATFSCNDYMSFVKRMGELEEK-VTVLNKRSVMPPEKEEVLN  516

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             NA++R+  LEQ+L   KKALE++ + Q +L A I+KK+KKK +F F
Sbjct  517   NALTRVTTLEQDLVATKKALEDALARQGQLQAQIDKKRKKKKLFRF  562



>ref|XP_010263590.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Nelumbo nucifera]
Length=600

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/599 (55%), Positives = 432/599 (72%), Gaps = 37/599 (6%)
 Frame = -2

Query  2067  CSAGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRV  1891
             C   +     ERP+  S E      D+++ R+GSLR+ + N+S K R+S   + RRSS+V
Sbjct  2     CDVMSARPGDERPIVESLE------DEKKNRMGSLRQISANSSTKLRNSLSKKGRRSSKV  55

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             M V ++D HDAEE K+VDA RQALIL+ELLP++HDDYHMMLRFLKARKF+ +K+KQMW D
Sbjct  56    MDVSIEDVHDAEESKAVDALRQALILEELLPSRHDDYHMMLRFLKARKFDTEKTKQMWTD  115

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M++WRKEFGADTI++DF+F+E +EVL++YPQGHHGVDK+GRP+YIE+LG VD  KL+Q T
Sbjct  116   MIRWRKEFGADTIMEDFEFEELNEVLEHYPQGHHGVDKEGRPVYIEKLGQVDPIKLLQAT  175

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             +M+RY+KYHV+EFERT   K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+ AL
Sbjct  176   SMERYVKYHVREFERTFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVVAL  235

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETLCRM+IINAGSGFRLLWNT+KSFLDPKTTAKI+VLGNK+QSKLLE+IDA
Sbjct  236   QKIDGDNYPETLCRMFIINAGSGFRLLWNTIKSFLDPKTTAKIHVLGNKFQSKLLEVIDA  295

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQG-AHKCSHRMARVEEEKTIPED  994
             SELPDFLGGTCTCA+ GGCMRSDKGPW DPEI+KM+  G     +       +EKTIPE+
Sbjct  296   SELPDFLGGTCTCAEHGGCMRSDKGPWKDPEILKMIQNGHVTCTTKTTTPGTDEKTIPEE  355

Query  993   GGV--NvsvsmsaksvkkpaSFKIESTK---------KLFPIQEETR---------QPDM  874
               V      S+ +         +  S+K         +L P++EE +         + D 
Sbjct  356   EIVYPKRCDSVQSDKGTDVEDMRSRSSKIPREDIRHPELSPVREEVKVSQNGPRNFEYDD  415

Query  873   YVPMVDKTVDLPNWH-VVNNDNCKFVVPKGADLYQIQEAY-KGQELASNQLLTGVMTFVM  700
              +P+VDK VD   WH +V +D+    + KG   + I +   K  E  SNQ+ TG+M FVM
Sbjct  416   LIPIVDKAVD-ATWHKIVQSDD--LALSKG--YFPINDVCNKAPEGGSNQIFTGLMAFVM  470

Query  699   GIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMAS  520
             GIVTM+R+T+ MP+KLT++ LYS+ ++  D  +K         P+++  +++++MKRM  
Sbjct  471   GIVTMIRLTRTMPKKLTDANLYSSPIYYVDPMIKDQSQLSG--PSISETQYLSIMKRMDE  528

Query  519   LEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             LEEK   LS +P  M  EKEEML+ A+ RI+ALEQEL   KKALE++   Q +++AY++
Sbjct  529   LEEKVTVLSMKPAEMSAEKEEMLNAAVRRIEALEQELMATKKALEDALVRQEDIVAYLD  587



>ref|XP_006577914.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X1 [Glycine max]
Length=572

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/551 (58%), Positives = 408/551 (74%), Gaps = 39/551 (7%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVL  1876
             MS  V+ P++   E ++   D+R+ +LGS +K AI+AS+KF+HSF  R RR SRVMSV +
Sbjct  5     MSAPVDLPMKLGHE-IEYSEDERKKKLGSFKKVAISASSKFKHSFAKRGRRHSRVMSVSI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
             +D+ DAEE+++VDAFRQALIL+ELLP KHDD+HMMLRFL+ARKF+I+K+KQMWADML+WR
Sbjct  64    EDDLDAEELQAVDAFRQALILEELLPAKHDDHHMMLRFLRARKFDIEKTKQMWADMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFGADTI++DF+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+ KLMQVTTM+RY
Sbjct  124   QEFGADTIMEDFEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSIKLMQVTTMERY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSI+AKKHIDQSTT+LDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVREFERTFAVKLPACSISAKKHIDQSTTLLDVQGVGLKSLNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLWN++KSFLDPKTT+KI+VLGNKYQ KLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWNSIKSFLDPKTTSKIHVLGNKYQRKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvs  976
             FLGGTCTCADKGGCM SDKGPWNDP+I+KMVH G  KC  +     EEKTI EDG  + +
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKTIIEDGTAHQN  363

Query  975   vsmsaksvkkpaSFKIESTKKLFPIQEETRQP---------DMYVPMVDKTVDLPNWHVV  823
             V               ES  + + + E+   P         D +VP++ K VD  +W+ +
Sbjct  364   VGNK------------ESFPETYDVDEQCLSPKKQCAVYKYDAFVPVLGKPVD-SSWNKL  410

Query  822   NNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTES  643
                + K  + K     +  + Y      SN  + G+M  VMGIVT++R+T+NMPRK+TE+
Sbjct  411   TQKD-KDALSKDCFPSKTCDGY------SNHFVGGIMAIVMGIVTVIRLTRNMPRKITEA  463

Query  642   TLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEK  463
              +Y +S    D  M          P ++  ++MA+MKRMA LEEK   LS + P +P EK
Sbjct  464   IVYGSSSGYYDGTMM-------KAPTISCNDYMAVMKRMAELEEKVTVLSMR-PVIPHEK  515

Query  462   EEMLSNAMSRI  430
             EE+L+NA+ R+
Sbjct  516   EEVLNNALCRV  526



>ref|XP_004288801.1| PREDICTED: uncharacterized protein LOC101297004 [Fragaria vesca 
subsp. vesca]
Length=557

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/546 (59%), Positives = 399/546 (73%), Gaps = 18/546 (3%)
 Frame = -2

Query  1971  GSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTK  1792
             GSL+K A +A          R     VMSV + D HD EE ++VD  RQALILDELLP+K
Sbjct  13    GSLKKKATHALRNSFTRKGRRSSK--VMSVEIADVHDVEEGQAVDKLRQALILDELLPSK  70

Query  1791  HDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGH  1612
             HDDYHMMLRFLKARKF+I+++K+MW+ ML+WRKEFGADTI DDF+FKE ++VL YYPQGH
Sbjct  71    HDDYHMMLRFLKARKFDIEQTKKMWSQMLEWRKEFGADTIRDDFEFKELNKVLDYYPQGH  130

Query  1611  HGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHID  1432
             HGVDK+GRP+YIERLGLVD+TKLMQVTTMDRY+KYHVQEFERT + K  +CSIAAKKHID
Sbjct  131   HGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVKYHVQEFERTFDVKFPACSIAAKKHID  190

Query  1431  QSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKS  1252
             QSTTILDVQGVGLKNF K ARELI +LQKIDGDNYPETL RM+IINAGSGFR+LW+TVKS
Sbjct  191   QSTTILDVQGVGLKNFNKAARELILSLQKIDGDNYPETLSRMFIINAGSGFRMLWSTVKS  250

Query  1251  FLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIM  1072
             FLDP+TTAKI+VLGNKYQS LLEIIDASELP+FLGG CTCAD+GGCMRSDKGPW +PEIM
Sbjct  251   FLDPRTTAKIHVLGNKYQSNLLEIIDASELPEFLGGKCTCADEGGCMRSDKGPWKNPEIM  310

Query  1071  KMVHQGAHKCSHRMARVEEEKTIPED-GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQE  895
              MV  G HKCS      E    + ED   V+VS      S    + +  ++ ++ F  +E
Sbjct  311   SMVQNGDHKCSK-----EPGTQVAEDKKSVHVSDDEFVYSTGNSSPYLPKNFQEYFKHEE  365

Query  894   ETRQPDMYVPMVDKTVDLPNWHVVNNDNC-KFVVPKGADLYQIQEAYKGQELASNQLLTG  718
                    Y+PMVDK +D  +  VV +     F   K  D + + EA K  +  S +    
Sbjct  366   -------YIPMVDKAMDTTSHIVVGSVKFDTFPTSKSVDCFDMPEACKPADGFSARFSGA  418

Query  717   VMTFVMGIVTMVR-MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMA  541
             +M F++ IV + R +T N+PRKL  ST YS+++  +D  +K   + K    A++ A+F +
Sbjct  419   IMAFILSIVAIFRLLTSNVPRKLANSTFYSSAVCHDDTMLKSRASSKSAN-AISEADFQS  477

Query  540   MMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNE  361
             ++ R+A LEE+ I LS +P TMPPEKE++LS A++R+DALE+EL    KAL+ES   Q+E
Sbjct  478   IITRIADLEERAIVLSTKPVTMPPEKEDLLSAALNRVDALERELMATTKALQESMCRQDE  537

Query  360   LIAYIE  343
             L+AYIE
Sbjct  538   LLAYIE  543



>ref|XP_006847541.1| hypothetical protein AMTR_s00014p00130910 [Amborella trichopoda]
 gb|ERN09122.1| hypothetical protein AMTR_s00014p00130910 [Amborella trichopoda]
Length=631

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/579 (58%), Positives = 415/579 (72%), Gaps = 33/579 (6%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnk---frhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D+R+TR+GSL+K AI+AS K          RR  SRV+SV ++D  DAEE+++VDAFRQA
Sbjct  44    DERRTRIGSLKKKAISASTKFRHSLTKRSRRRSESRVISVAIEDVRDAEELQAVDAFRQA  103

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LIL+ELLP++HDDYHMMLRFLKARKF+I+K+KQMWADMLQWRKEFGADTI++DF+FKE D
Sbjct  104   LILEELLPSRHDDYHMMLRFLKARKFDIEKAKQMWADMLQWRKEFGADTIMEDFEFKEID  163

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EVL++YPQGHHGVDKDGRP+YIERLG VD  KLM+ TT++RY+KYHVQEFE+T   K  +
Sbjct  164   EVLQHYPQGHHGVDKDGRPVYIERLGKVDPNKLMEATTLERYVKYHVQEFEKTFAIKFPA  223

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAKKHID STTILDVQGVGLKNF K AR+LI  LQKIDGDNYPETLCRM+IINAG+G
Sbjct  224   CSIAAKKHIDSSTTILDVQGVGLKNFNKAARDLIVRLQKIDGDNYPETLCRMFIINAGAG  283

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FRLLWNT+K+FLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGG+CTCAD GGC+RSD
Sbjct  284   FRLLWNTIKTFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGSCTCADHGGCLRSD  343

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVE--EEKTI-------PEDGGVNvsvsmsaksvk  949
             KGPW DPEI+KMVH G  KCS ++      EEKTI       P+ G V    S+      
Sbjct  344   KGPWQDPEILKMVHNGEAKCSRKIVTFSGTEEKTISHTDVEYPKGGDVCSPESVLEAEDM  403

Query  948   kpaSFKIESTK--KLFPIQEETR-------QP---DMYVPMVDKTVDLPNWHVVNNDNCK  805
             +P     +  +  +L P+ EE +        P   D Y+PMVDK VD    +V    + K
Sbjct  404   RPPINPRDFIEHPQLSPVHEEAQIGRGNFPSPYDYDDYIPMVDKAVDATWKNVALAQDEK  463

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY--S  631
              +V KG  +  +  AYK  E     + +G M  +MGIV + R+++NMP+K+ + +LY   
Sbjct  464   LLVSKG--ILSLTGAYKASE--GLGVFSGFMALLMGIVAIFRVSRNMPKKIMDPSLYFTD  519

Query  630   NSMHLNDHAMKG---HGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             + +H    AM     H             ++  + KR++ LEEK ITLS++P  MPPEKE
Sbjct  520   SPVHCIGSAMVKDPLHCGLPMAISTFEGGDYALVAKRLSDLEEKVITLSSKPLEMPPEKE  579

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             E L+ A+SR+DALE EL   KKAL +S   Q EL+AY+E
Sbjct  580   EQLNAAISRVDALEAELMATKKALHDSLVRQEELLAYLE  618



>ref|XP_006577915.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like isoform X2 [Glycine max]
Length=560

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/540 (58%), Positives = 402/540 (74%), Gaps = 38/540 (7%)
 Frame = -2

Query  2019  SAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKS  1843
             +  +++   D+R+ +LGS +K AI+AS+KF+HSF  R RR SRVMSV ++D+ DAEE+++
Sbjct  3     TGHEIEYSEDERKKKLGSFKKVAISASSKFKHSFAKRGRRHSRVMSVSIEDDLDAEELQA  62

Query  1842  VDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDD  1663
             VDAFRQALIL+ELLP KHDD+HMMLRFL+ARKF+I+K+KQMWADML+WR+EFGADTI++D
Sbjct  63    VDAFRQALILEELLPAKHDDHHMMLRFLRARKFDIEKTKQMWADMLKWRQEFGADTIMED  122

Query  1662  FDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERT  1483
             F+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+ KLMQVTTM+RYLKYHV+EFERT
Sbjct  123   FEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSIKLMQVTTMERYLKYHVREFERT  182

Query  1482  NNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMY  1303
                K+ +CSI+AKKHIDQSTT+LDVQGVGLK+  K AR+L+Q LQKIDGDNYPE+L RM+
Sbjct  183   FAVKLPACSISAKKHIDQSTTLLDVQGVGLKSLNKAARDLLQRLQKIDGDNYPESLNRMF  242

Query  1302  IINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADK  1123
             IINAGSGFRLLWN++KSFLDPKTT+KI+VLGNKYQ KLLEIIDASELP+FLGGTCTCADK
Sbjct  243   IINAGSGFRLLWNSIKSFLDPKTTSKIHVLGNKYQRKLLEIIDASELPEFLGGTCTCADK  302

Query  1122  GGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkp  943
             GGCM SDKGPWNDP+I+KMVH G  KC  +     EEKTI EDG  + +V          
Sbjct  303   GGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKTIIEDGTAHQNVGNK-------  355

Query  942   aSFKIESTKKLFPIQEETRQP---------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPK  790
                  ES  + + + E+   P         D +VP++ K VD  +W+ +   + K  + K
Sbjct  356   -----ESFPETYDVDEQCLSPKKQCAVYKYDAFVPVLGKPVD-SSWNKLTQKD-KDALSK  408

Query  789   GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND  610
                  +  + Y      SN  + G+M  VMGIVT++R+T+NMPRK+TE+ +Y +S    D
Sbjct  409   DCFPSKTCDGY------SNHFVGGIMAIVMGIVTVIRLTRNMPRKITEAIVYGSSSGYYD  462

Query  609   HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
               M          P ++  ++MA+MKRMA LEEK   LS + P +P EKEE+L+NA+ R+
Sbjct  463   GTMM-------KAPTISCNDYMAVMKRMAELEEKVTVLSMR-PVIPHEKEEVLNNALCRV  514



>ref|XP_010940109.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1-like [Elaeis guineensis]
Length=622

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/575 (58%), Positives = 416/575 (72%), Gaps = 30/575 (5%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+TR+GSL+K AINAS KFR+S   R RRSSRVMSV ++D  DAEE+++VDAFRQ LI
Sbjct  38    DERKTRIGSLKKKAINASAKFRNSLTKRGRRSSRVMSVCIEDVRDAEEMQAVDAFRQTLI  97

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMW DMLQWRKEFGADTI++DF+FKE DEV
Sbjct  98    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWTDMLQWRKEFGADTIVEDFEFKELDEV  157

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+YYPQGHHGVDK+GRP+YIE+LG +D  KLMQVT MDRY+KYHV+EFERT N K  +CS
Sbjct  158   LEYYPQGHHGVDKEGRPVYIEKLGQIDTNKLMQVTNMDRYIKYHVKEFERTFNTKFPACS  217

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTI+DVQGVG+K F K AR+LI  LQKIDGDNYPETLCRM+IINAG GFR
Sbjct  218   IAAKRHIDQSTTIIDVQGVGMKQFNKVARDLISRLQKIDGDNYPETLCRMFIINAGQGFR  277

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKINVLGNKYQSKLLE+IDASELP+FLGGTC C  KGGC+RSDKG
Sbjct  278   LLWSTVKSFLDPKTTAKINVLGNKYQSKLLEVIDASELPEFLGGTCNC--KGGCLRSDKG  335

Query  1095  PWNDPEIM--KMVHQGAHKCSHRMA-RVEEEKTIPEDGGV---NvsvsmsaksvkkpaSF  934
             PW DPEI+  +MV  G  +     A    +EKTI ED  V                P   
Sbjct  336   PWKDPEIIDVQMVQGGMARYGRCQAPSSTDEKTISEDEIVYHKRQDSFCDDVRPPSPGMS  395

Query  933   KIESTKKLFPIQEETRQP-----------------DMYVPMVDKTVDLPNWHVVNNDNCK  805
             ++     L P++EE   P                 D Y+PMVDKTVD  +W     D  +
Sbjct  396   RVIEHPHLSPVREEVVSPSYKAQRAMESFPTPDADDDYIPMVDKTVD-ASWIKEVMDEKQ  454

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTL-YSN  628
               + KGA  Y + + YKG +  SN +L GVM FVMGIVTM+R+T+ +P+K+ ++ + + +
Sbjct  455   LALSKGA--YTLADVYKGPDGFSNHILAGVMAFVMGIVTMLRVTRVVPKKIVDAAIDHVS  512

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
              ++     +K     + P   V+AAE+ ++MKR+  LEE    LS +P  M  EKEE L 
Sbjct  513   PVYCAQTMVKAQMHQQLPASTVSAAEYSSVMKRLIKLEETVNILSMKPAEMAIEKEEQLK  572

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              A+SR+DALE ELA  KKALE++   Q EL+AY++
Sbjct  573   AAVSRVDALEAELAATKKALEDALVRQEELLAYLD  607



>gb|KHN20050.1| Sec14 cytosolic factor [Glycine soja]
Length=513

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/488 (61%), Positives = 372/488 (76%), Gaps = 22/488 (5%)
 Frame = -2

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS+ ++D+ DAEE+++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMW D
Sbjct  1     MSLSIEDDLDAEELQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKTKQMWTD  60

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             ML+WR+EFGADTI++DF+F E +EVLKYYPQGHHG+DKDGRP+YIE+LG VD+TKLMQVT
Sbjct  61    MLKWRQEFGADTIMEDFEFNELEEVLKYYPQGHHGIDKDGRPVYIEKLGQVDSTKLMQVT  120

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TM+RYLKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q L
Sbjct  121   TMERYLKYHVKEFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSLNKAARDLLQRL  180

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPE+L RM+IINAGSGFRLLWNT+KSFLDPKTT+KI+VLGNKYQSKLLEIIDA
Sbjct  181   QKIDGDNYPESLNRMFIINAGSGFRLLWNTIKSFLDPKTTSKIHVLGNKYQSKLLEIIDA  240

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+FLGGTCTCADKGGCM SDKGPWNDP+I+KMVH G  KC  +     EEK I EDG
Sbjct  241   SELPEFLGGTCTCADKGGCMLSDKGPWNDPDILKMVHNGEGKCKRKTLSGIEEKRIIEDG  300

Query  990   GVNvsvsmsaks-vkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNND  814
               N ++        +     +  S KK    Q    + D +VP++ K VD  +W+ +   
Sbjct  301   TANQNLGNKESFPERYDVDVQCLSPKK----QCTVYKYDAFVPVLGKPVD-SSWNTLTQK  355

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
             + K  + K     +  + Y      SN  + G+M  VMGIVTM+RMT+NMPRK+TE+ LY
Sbjct  356   D-KDALSKDCFPSKTCDGY------SNHFVGGIMAIVMGIVTMIRMTRNMPRKITEAALY  408

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
              +S + +   MK            +  ++MAMMKRMA LEEK +T+ +  P +PPEKEE+
Sbjct  409   GSSGYYDGTMMKA--------ATFSCNDYMAMMKRMAELEEK-VTILSMKPVIPPEKEEV  459

Query  453   LSNAMSRI  430
             L+NA+ R+
Sbjct  460   LNNALGRV  467



>ref|XP_007135959.1| hypothetical protein PHAVU_009G006100g [Phaseolus vulgaris]
 gb|ESW07953.1| hypothetical protein PHAVU_009G006100g [Phaseolus vulgaris]
Length=565

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/586 (57%), Positives = 424/586 (72%), Gaps = 35/586 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVL  1876
             M   V++P++   E    D D+R+ R+GS +K A++AS K      K  RR SRVMSV +
Sbjct  5     MPAPVDQPVKLGHESEHSD-DERKKRVGSFKKVAMSASFKFRSSLTKKGRRHSRVMSVSI  63

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
              D+ DAEE+++VDAFRQALIL+ELLP++HDD+H+MLRFL+ARKF+I+K+KQMWADML+WR
Sbjct  64    ADDLDAEELQAVDAFRQALILEELLPSRHDDHHVMLRFLRARKFDIEKTKQMWADMLKWR  123

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             +EFGADTI +DF+F E+DEVLKYYPQGHHGVDKDGRP+YIE+LG VD+TKLMQVTTMDRY
Sbjct  124   QEFGADTISEDFEFTEQDEVLKYYPQGHHGVDKDGRPVYIEKLGQVDSTKLMQVTTMDRY  183

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             LKYHV+EFERT   K+ +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+L+Q LQKIDG
Sbjct  184   LKYHVKEFERTFAVKLPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLLQRLQKIDG  243

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPE+L RM+IINAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+
Sbjct  244   DNYPESLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPE  303

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED----GG  988
             FLGGTCTCADKGGCM SDKGPWNDP+I+KM+  G  KC  +      EKT+ ED      
Sbjct  304   FLGGTCTCADKGGCMLSDKGPWNDPDIIKMIQNGEGKCKRQTLSGIAEKTVIEDETAHQN  363

Query  987   VNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNC  808
             V    S+             +  K ++  +E       +VP++ K VD     ++ ND  
Sbjct  364   VGNKESVPETYNVDVPCLSPKVAKPVYKYEE-------FVPVLGKPVDSSWNKLIQNDKD  416

Query  807   KFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
              F             A K  +L +N  + G+M F+MGIVTM+RMTKNMPRKL E+ LYS+
Sbjct  417   CF-------------ASKTSDLNTNHFVGGIMAFIMGIVTMIRMTKNMPRKLNEAALYSS  463

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLS  448
             S +     MK            +  ++M+ +KRM  LEEK +T+ N+   MPPEKEE+L+
Sbjct  464   SGYYESSMMKA--------ATFSCNDYMSFVKRMGELEEK-VTVLNKRSVMPPEKEEVLN  514

Query  447   NAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             NA++R+  LEQ+L   KKALE++ + Q +L A I+KK+KKK +F F
Sbjct  515   NALTRVTTLEQDLVATKKALEDALARQGQLQAQIDKKRKKKKLFRF  560



>ref|XP_009403235.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Musa acuminata subsp. malaccensis]
Length=614

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/586 (57%), Positives = 420/586 (72%), Gaps = 42/586 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+ ++ SL K A+NAS K+R+S   R RRSS+VMSV ++D  DAEE+++VDAFRQ LI
Sbjct  22    DERRNKIESLTKKAMNASTKYRNSLNRRGRRSSKVMSVSIEDVRDAEEMQAVDAFRQILI  81

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+E+LP++HDDYH MLRFLKARKF+I+K+KQMW DMLQWRKEFGADTI+DDF+FKE  EV
Sbjct  82    LEEMLPSRHDDYHTMLRFLKARKFDIEKTKQMWTDMLQWRKEFGADTILDDFEFKELGEV  141

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+YYPQGHHGVDK+GRP+YIERLGLVDA K+MQVT MDRY+KYHV+EFERT   K  +CS
Sbjct  142   LEYYPQGHHGVDKEGRPVYIERLGLVDANKMMQVTNMDRYVKYHVKEFERTFVVKFPACS  201

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTI+DVQGVG+K F K ARELI  +QKIDGDNYPETLCRM+I+NAG GFR
Sbjct  202   IAAKRHIDQSTTIIDVQGVGMKQFNKTARELISRIQKIDGDNYPETLCRMFIVNAGQGFR  261

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGGTC C  +GGC+RSDKG
Sbjct  262   LLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGTCNC--EGGCLRSDKG  319

Query  1095  PWNDPEIMKMVHQGAHKCS-HRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIEST  919
             PW DPEI+KMV  G  +C   +M    EEKTI ED  V      S +     A+ ++ S 
Sbjct  320   PWKDPEILKMVQSGMGQCGRQQMTPAVEEKTISEDDIVYSKRHESFRGPSAFAADEMSSA  379

Query  918   K-----------KLFPIQEETRQPDM--------------------YVPMVDKTVDLPNW  832
                         +L P+ EE    +                      +P+VDK +D   W
Sbjct  380   SPKMSRSQIEHPQLSPLHEEVSNTEAEKNLDVEAALKEFPTYSYNDLIPIVDKAMD-ATW  438

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKN-MPRK  655
                   + KF + KGA  Y + E Y+G +  SN +L GVM FVMG+VTM+R+  N +P+K
Sbjct  439   K-KQMLSQKFAMSKGA--YNLSEIYRGPDGVSNHVLAGVMAFVMGLVTMIRVGGNTVPKK  495

Query  654   LTESTL-YSNSMHLNDHAMKGH-GAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             ++ + + Y+ S+ L    +KG     +   PAV+AAEF  ++KR++ LEEK   LS +P 
Sbjct  496   MSNADIDYARSLELAGTMLKGQMQQSEQSAPAVSAAEFSGVVKRLSELEEKVAELSAKPV  555

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              +P EKEE+L  A+ R+DALE+ELA  KKALEES + Q E +AY+E
Sbjct  556   ELPAEKEEILHAAVKRVDALEEELAATKKALEESLARQEEFVAYLE  601



>ref|XP_009402009.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/578 (57%), Positives = 417/578 (72%), Gaps = 49/578 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             DDR+TR+GS++K AI+AS K R+S   R RRSS+VMSV ++D  DAEE+++VDAFRQ LI
Sbjct  32    DDRKTRIGSIKKKAIDASAKLRNSLNKRGRRSSKVMSVSIEDVRDAEEMQAVDAFRQILI  91

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMWADMLQWRK+FGADTI+++F+FKE D+V
Sbjct  92    LEELLPSRHDDYHMMLRFLKARKFDIEKAKQMWADMLQWRKDFGADTILEEFEFKELDQV  151

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             ++YYPQGHHGVDK+GRP+YIERLG VDA K+MQVTTMDRY+KYHV+EFER+ + K  +CS
Sbjct  152   MEYYPQGHHGVDKEGRPVYIERLGQVDANKMMQVTTMDRYIKYHVKEFERSFDVKFPACS  211

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTI+DVQGVG K F K AR+LI  +QK+DGDNYPETLCRM+IINAG GFR
Sbjct  212   IAAKRHIDQSTTIIDVQGVGCKQFNKVARDLISRIQKVDGDNYPETLCRMFIINAGQGFR  271

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKINVLGNKYQSKLLE+IDASELP+FLGGTC C  +GGC+RSDKG
Sbjct  272   LLWSTVKSFLDPKTTAKINVLGNKYQSKLLEVIDASELPEFLGGTCNC--EGGCLRSDKG  329

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVE-EEKTIPEDGGVNvsvsmsaksvkkpaSFKIEST  919
             PW DPEIMKMV  GA  C  +    + EEKTI ED  V      S   V+  A+  + S 
Sbjct  330   PWKDPEIMKMVQNGAGSCGRQQPTTDAEEKTISEDEIVYPKRQESYCGVRVFAADNVSSK  389

Query  918   --------KKLFPIQEETRQPDM---------------YVPMVDKTVDLPNWHVVNNDNC  808
                      +  P+ EE   PD                Y+P+VDK VD   W+    D  
Sbjct  390   ISRSHIVHPQPSPVHEELDIPDCKAADKKFPTPYSYGDYLPIVDKAVD-SCWNKEIPDE-  447

Query  807   KFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
             K  + KGA      E Y+G +  +N +  GV+ FVMG+ T++R+++ MP+K+ ++ +   
Sbjct  448   KLAISKGA--CNPSEIYRGPDGFNNNIFGGVVAFVMGVFTVLRVSRGMPKKVADADI---  502

Query  627   SMHLNDHAMKGHGAYKPPEPA---VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
                         G  KP EPA   + AAEF + +KR+ +LEEK   LS +PP MP EKEE
Sbjct  503   ------------GCAKPVEPAAPTLPAAEFSSALKRLGNLEEKVSILSKKPPQMPSEKEE  550

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +L+ A+ R+DALE ELA  KKALE++   Q E +AYIE
Sbjct  551   ILNAAVKRVDALETELAATKKALEDALVRQGEFLAYIE  588



>ref|XP_003629395.1| Phosphatidylinositol transfer-like protein II [Medicago truncatula]
 gb|AET03871.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=555

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/552 (59%), Positives = 409/552 (74%), Gaps = 23/552 (4%)
 Frame = -2

Query  1995  ADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             A D+  R+GSL+K   ++  +      S+     VMSV ++D  DA+++K+VD FRQALI
Sbjct  11    AVDKIDRVGSLKKILRDSLTRRSRRSSSK-----VMSVEIEDIRDADDLKAVDEFRQALI  65

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP KHDDYHM+LRFL+ARKFEI+KSKQMW+DMLQWRKEFG DT+++DF+F+E +EV
Sbjct  66    LDELLPEKHDDYHMLLRFLRARKFEIEKSKQMWSDMLQWRKEFGTDTVVEDFEFEELEEV  125

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             ++YYP G+HGVDK+GRPIYIERLG VDATKL+QVTTMDRY+KYHV+EFERT + K  +C+
Sbjct  126   VQYYPHGNHGVDKEGRPIYIERLGQVDATKLLQVTTMDRYVKYHVKEFERTFDLKFPACT  185

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAKKHIDQSTTILDVQGVGLKNF KQAR+LI  LQKIDGDNYPETL RM+IINAGSGFR
Sbjct  186   IAAKKHIDQSTTILDVQGVGLKNFNKQARDLITRLQKIDGDNYPETLNRMFIINAGSGFR  245

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             +LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTCAD+GGCMRSDKG
Sbjct  246   MLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADQGGCMRSDKG  305

Query  1095  PWNDPEIMKMVHQGAHKCSHRM-ARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIEST  919
             PW DPEI++MV  G HK S ++ A + EEKT PE+   +   ++           ++ + 
Sbjct  306   PWKDPEIIRMVQNGEHKTSRKIEAPIVEEKT-PEESQASKMEAVFTA--------QLSTV  356

Query  918   KKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKG-ADLYQIQEAYKGQEL  742
                 P  +     D+ VPM DKT     W +V      F VPK   +   + ++ K  E 
Sbjct  357   YAKAPSSKACNYEDL-VPMADKTA----WQMVEKTKS-FAVPKAEVEALTVPDSCKIHEK  410

Query  741   ASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAV  562
              ++Q+ TG+M FVMG++TMVRMT+NMP++LT++  YSNS++            +   P +
Sbjct  411   VNSQIFTGMMAFVMGLITMVRMTRNMPKRLTDANFYSNSVYSGGDFKTEDSNDQLTNPTI  470

Query  561   TAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkalee  382
             +A EFM +MKRMA LE+K   + N    MPPEKEEML+ A+SR DALEQEL   KKALE+
Sbjct  471   SAQEFMTVMKRMAELEDKMGNM-NTTTCMPPEKEEMLNAAISRADALEQELMATKKALED  529

Query  381   sqSNQNELIAYI  346
             S + Q EL AYI
Sbjct  530   SLAKQEELSAYI  541



>ref|XP_010555282.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Tarenaya hassleriana]
 ref|XP_010555283.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Tarenaya hassleriana]
Length=535

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/573 (58%), Positives = 421/573 (73%), Gaps = 57/573 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfr-hsfksrrrssRVMSV-V  1879
             M+G ++R  +   E   L  DD++T+LGSL+K AINASNKF+    K  RR+SRV SV +
Sbjct  5     MTGHLDRHNKLEFE---LSEDDKRTKLGSLKKKAINASNKFKPSFTKKGRRNSRVTSVSI  61

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
             ++D+ DAEE++++DAFRQ+LILDELLP+KHDD+H MLRFL+ARKF+++K+KQMW+DML W
Sbjct  62    IEDDIDAEELQALDAFRQSLILDELLPSKHDDHHTMLRFLRARKFDMEKAKQMWSDMLNW  121

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             RKEFGADTI+++F+FKE DEVLKYYPQG+HGVDKDGRP+YIERLG VDATKLMQVTT+DR
Sbjct  122   RKEFGADTIMEEFEFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDR  181

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             Y+KYHV+EFE+T N K  +CSIAAKKHIDQSTTILDVQGVGLKNF+K AR+L+Q +QKID
Sbjct  182   YVKYHVREFEKTFNIKFPACSIAAKKHIDQSTTILDVQGVGLKNFSKAARDLLQRIQKID  241

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
              DNYPETL RM+IINAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP
Sbjct  242   SDNYPETLNRMFIINAGHGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELP  301

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNv  979
             +FLGG+CTCAD GGCMRSDKGPWNDPEI KMV  G  KC+ ++    EEKT+ E      
Sbjct  302   EFLGGSCTCADNGGCMRSDKGPWNDPEIFKMVQNGEGKCTRKILSDIEEKTVSE------  355

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFV  799
                              E T+      +     + ++PMV+KT+D+     +++ +    
Sbjct  356   ----------------YEMTESKVKKNKFADLNERFIPMVEKTMDVTWPTSLHHKD----  395

Query  798   VPKGADLYQIQEAYK-GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM  622
                 AD Y ++ + K G E     L  GVMT VMGIV ++R+TKNMPRKLTE+T Y   +
Sbjct  396   ---PADCYTMKPSEKRGGE---GYLFGGVMTLVMGIVAVMRLTKNMPRKLTEATTYGGKV  449

Query  621   HLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
                                V++ ++M M+KRMA LE K   L +Q P   PEKE++L++A
Sbjct  450   E------------------VSSEDYMKMVKRMAELEGKCKFLDSQ-PVFSPEKEQLLNSA  490

Query  441   MSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +SR+D LE +L+E KKAL+E+ S Q E++AYIE
Sbjct  491   LSRVDDLELQLSETKKALDEALSRQQEILAYIE  523



>gb|KCW56705.1| hypothetical protein EUGRSUZ_I02398 [Eucalyptus grandis]
Length=531

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/539 (60%), Positives = 409/539 (76%), Gaps = 20/539 (4%)
 Frame = -2

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MS+ ++DEHDAEE+K+VDAFRQALIL+ELLP+KHDDYHMMLRFLKARKF+I+KSKQMWA+
Sbjct  1     MSIDIEDEHDAEELKAVDAFRQALILEELLPSKHDDYHMMLRFLKARKFDIEKSKQMWAN  60

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M+QWR+EFG+DTI+++F+F+E +EVLKYYPQGHHGVDK+GRP+YIERLG VDATKLMQVT
Sbjct  61    MIQWREEFGSDTILEEFEFEEINEVLKYYPQGHHGVDKEGRPVYIERLGQVDATKLMQVT  120

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             TM+RY+KYHV+EFER    K  +CSIAAKKHIDQSTTILDVQGVGLKNF K AR+L+  L
Sbjct  121   TMERYVKYHVREFERIFAVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLVTRL  180

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA
Sbjct  181   QKIDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDA  240

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDG  991
             SELP+FLGG CTC+D+GGCM SDKGPW D EIMKMV  G H C  +     + KT  ED 
Sbjct  241   SELPEFLGGACTCSDQGGCMLSDKGPWKDQEIMKMVQNGDHMCRKKSTPGFDGKTTSEDE  300

Query  990   GVNvsvsmsaksvkkpaSFKIESTKKLFPIQEET----------RQPDMYVPMVDKTVDL  841
               NV       +    A         L PI EE           R+ D + P+VDK V +
Sbjct  301   MANVKGCDHPNADALDAR---PQPPHLSPIVEEGYNSQNCKKSFRRED-FAPVVDKNVIM  356

Query  840   PNWHVVNNDNCKFVVPKGADLYQIQEAYKG--QELASNQLLTGVMTFVMGIVTMVRMTKN  667
               W    +D+ K  +PKG + + + + +K    E  S+ L +G+MT VMG+ T++RMT+N
Sbjct  357   A-WEKFAHDD-KLALPKG-NHFAMADHHKAPQSEGFSSHLFSGLMTVVMGVATVIRMTRN  413

Query  666   MPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQ  487
             MP+K+T++TLYS+S + +D+ +K       P P ++++++  M+KRMA LEEK   L+ +
Sbjct  414   MPKKVTDATLYSSSAYYSDNMVKSQMHEFAPAP-ISSSDYFMMLKRMAELEEKVTVLNMK  472

Query  486   PPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             P  MP EK+E+L  A+SR+  LEQEL   KKAL+++ S Q EL+ Y+EKKKKKK++FG+
Sbjct  473   PAAMPVEKQELLDAAISRVSTLEQELTATKKALDDTISRQQELLDYMEKKKKKKSLFGW  531



>ref|XP_007199958.1| hypothetical protein PRUPE_ppa026305mg [Prunus persica]
 gb|EMJ01157.1| hypothetical protein PRUPE_ppa026305mg [Prunus persica]
Length=614

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 380/517 (74%), Gaps = 26/517 (5%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VM V ++D  DAE++++VDAFRQALIL+ELLP+ HDD+HMMLRFL+ARKF+I+++K+MWA
Sbjct  21    VMPVPIEDNIDAEDLQAVDAFRQALILEELLPSNHDDHHMMLRFLRARKFDIEQTKKMWA  80

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFGADTI++DF+FKE DEV+KYYPQGHHGVDKDGRP+YIERLG VD+TKL+QV
Sbjct  81    DMLQWRKEFGADTIMEDFEFKEIDEVVKYYPQGHHGVDKDGRPVYIERLGQVDSTKLLQV  140

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TTMDRY+KYH++EFERT   K  +CSIAAKKHIDQSTTILDVQGVGL +  K ARELIQ 
Sbjct  141   TTMDRYVKYHIREFERTFVCKFPACSIAAKKHIDQSTTILDVQGVGLTSLNKSARELIQC  200

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETL RMYIINAGSGFRLLWNTVKSFLDP+TT KI+VLGNKYQSKLLEIID
Sbjct  201   LQKVDGDNYPETLNRMYIINAGSGFRLLWNTVKSFLDPRTTGKIHVLGNKYQSKLLEIID  260

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             +SELP+FLGG CTCADKGGCMRSDKGPWNDP I+K       +C          KT+PE 
Sbjct  261   SSELPEFLGGKCTCADKGGCMRSDKGPWNDPVILK-------RCDSL-----NSKTVPEA  308

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNND  814
                +     +   + +      E  +        T + + ++PMVDK +D        + 
Sbjct  309   DMKSQVKQQNLCPLPEDVVITKECNR--------TYEHEDFMPMVDKAMDTT---FTKSF  357

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
              C+    +  D + +  A +  +  SNQ ++G+M FVMGI TMVR+ +NMP+KL E   Y
Sbjct  358   QCEISPSQATDSFPVHYACRDLDRLSNQFVSGMMAFVMGIFTMVRLARNMPKKLAEVAHY  417

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
              + ++      KGH   + P PA+++  +M MMKRM+ LEEK   LS +P  MPPEKEEM
Sbjct  418   GSPVYSTGMVNKGH---QLPAPAISSNAYMTMMKRMSELEEKVSVLSTKPALMPPEKEEM  474

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             L+  ++RI+ LE +L+  KKALE++   Q EL+AY++
Sbjct  475   LNITLNRINVLEPDLSATKKALEDALVRQEELVAYLD  511



>ref|XP_010645212.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Vitis vinifera]
 ref|XP_010645218.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Vitis vinifera]
 ref|XP_010645224.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Vitis vinifera]
Length=616

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/599 (56%), Positives = 440/599 (73%), Gaps = 34/599 (6%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV  1882
              SG +ER  +P  EK D++   D+R+ ++G+ +K AI AS+KFR+S   + RR+S+VM++
Sbjct  5     FSGPLERSNKPVNEKSDIENSEDERKKKMGTFKKKAITASSKFRNSLTKKGRRNSKVMNI  64

Query  1881  -VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
              V +D+ DAEE+++VDAFRQALIL+ELLP+KHDD  +MLRFLKARKF+I+K+KQMWADM+
Sbjct  65    AVEEDDLDAEELQAVDAFRQALILEELLPSKHDDSRVMLRFLKARKFDIEKTKQMWADMI  124

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKEFGADTI++DF+FKE D+VL+YYPQGHHGVDKDGRP+YIERLG VD  KLMQVTT+
Sbjct  125   NWRKEFGADTIMEDFEFKEIDDVLEYYPQGHHGVDKDGRPVYIERLGKVDPVKLMQVTTL  184

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             +RY+KYHV+EFERT   K  +CSIAAK+HIDQSTTILDVQGVGLKNF K ARELI  LQK
Sbjct  185   ERYVKYHVREFERTFKVKFPACSIAAKRHIDQSTTILDVQGVGLKNFNKSARELIMQLQK  244

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             IDG+NYPETLCRM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLE+IDASE
Sbjct  245   IDGENYPETLCRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEVIDASE  304

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPE---  997
             LP+FLGGTCTCADKGGCMRSDKGPWNDPEI+KM      K   + +  V +E T+     
Sbjct  305   LPEFLGGTCTCADKGGCMRSDKGPWNDPEILKMAQNYDAKSFKKILIPVIDENTVSGEEM  364

Query  996   --------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDM----------Y  871
                     D  ++           + A   +E  + L P+QEE + P+           +
Sbjct  365   AHKKCDSFDSDISFDSGDKWSHSSRLAKEHVEH-QPLSPVQEE-KYPNTKDYGGYEYEGF  422

Query  870   VPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQ-EAYKGQELASNQLLTGVMTFVMGI  694
             + +VDK VD   W    N+N +F + +  D +    +  + Q   ++Q+ +G+M+FV+GI
Sbjct  423   IQVVDKAVD-ATWPKAVNNNPQFALSR--DCFPTHGDPCRPQGRVTDQIFSGLMSFVVGI  479

Query  693   VTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAY--KPPEPAVTAAEFMAMMKRMAS  520
             +TM+R+TKNMP++LT++TLYS   +  D  +K H  +  K P P V++ ++M+++KR+A 
Sbjct  480   ITMIRLTKNMPKRLTDATLYSTPDYCVDTIVKSHAQHPQKSPAPEVSSVDYMSIIKRVAE  539

Query  519   LEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +EEK   LS +   M  EKEEM++ A++R +ALEQELA  +KALEE+   Q EL+ YIE
Sbjct  540   VEEKMSVLSIKSMAMLAEKEEMMNAAINRANALEQELAANRKALEEALIRQGELMTYIE  598



>ref|XP_010531443.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Tarenaya hassleriana]
Length=570

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/589 (56%), Positives = 421/589 (71%), Gaps = 31/589 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSV-VL  1876
             MSG ++R  +   E      DD++T+L + +  +           K  R++SRVMSV ++
Sbjct  5     MSGHLDRHNKLDGE---FSEDDKKTKLANAKLRSQPCQRPRDSFTKKSRKNSRVMSVPII  61

Query  1875  DDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWR  1696
              D+ DAE++++VDAFRQALILDELLP+KHDD HMMLRFL+ARKF+I+K+KQMW+DML WR
Sbjct  62    YDDIDAEDLQAVDAFRQALILDELLPSKHDDLHMMLRFLRARKFDIEKAKQMWSDMLNWR  121

Query  1695  KEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRY  1516
             K+FGADTI++DFDFKE DEVLKYYPQG+HGVDK+GRP+YIERLG VDATKLMQVTT++RY
Sbjct  122   KDFGADTIMEDFDFKEIDEVLKYYPQGYHGVDKEGRPVYIERLGQVDATKLMQVTTIERY  181

Query  1515  LKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDG  1336
             +KYHV+EFE+T   K  +CSIA+K+HIDQSTT+LDVQGVGLKNF K AR+L+Q +QKID 
Sbjct  182   VKYHVREFEKTFRIKFPACSIASKRHIDQSTTVLDVQGVGLKNFNKAARDLLQHIQKIDN  241

Query  1335  DNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPD  1156
             DNYPETL RM+IINAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+
Sbjct  242   DNYPETLNRMFIINAGHGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPE  301

Query  1155  FLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPE------D  994
             FLGG+CTC DKGGCMRSDKGPWNDPEI KMV  G  +C+  +    EEKTI E       
Sbjct  302   FLGGSCTCEDKGGCMRSDKGPWNDPEIFKMVQNGEGRCTRNVLSGIEEKTISEYETYTPK  361

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNND  814
             G  +       K     A F +  +KK   + E+       +PMVDKT+D   W    N 
Sbjct  362   GRGSFEAEEKLKLSAAEAMFILAKSKKFNELNEK------LIPMVDKTMD-ATWPTTRNK  414

Query  813   NCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLY  634
                F         +  E   G+      LL GVMT +MGI+T++++TKNMPRK+TE+ +Y
Sbjct  415   ANTFANTAECCPVKPSEKRAGE----GYLLGGVMTVLMGIMTVMKLTKNMPRKITEAAIY  470

Query  633   SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
                        +G G       AV+++E+M M+KRMA LE+K   L +Q P   PEKE+M
Sbjct  471   GGG----SCYYEGEGG----NVAVSSSEYMGMVKRMAELEDKCKFLDSQ-PIFSPEKEQM  521

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEk-kkkkKNIFGF  310
             L++A+SR++ LE +L+E KKAL+E+ S Q E++AYIE+ KKKKK  FGF
Sbjct  522   LNSALSRVNDLELQLSETKKALDEALSKQQEILAYIEEKKKKKKKFFGF  570



>ref|XP_010679780.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010679781.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/583 (58%), Positives = 416/583 (71%), Gaps = 27/583 (5%)
 Frame = -2

Query  2031  PLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEE  1852
             P    A  MD   D+++   GS +K A++ASNKF+ SF  RRRSS+VMSV   D HDAEE
Sbjct  5     PAVDRAVDMDNLDDEKKNAAGSFKKKAMSASNKFKSSFSRRRRSSKVMSVEFVDIHDAEE  64

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
              ++VD  RQ L+ ++LLP K DDYH+MLRFL+ARKF+ +K+KQMW+DMLQWRKEFGADTI
Sbjct  65    SQAVDTLRQTLMSEDLLPPKFDDYHIMLRFLRARKFDPEKTKQMWSDMLQWRKEFGADTI  124

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             +++FDFKE +EVL+YYPQGHHGVDKDG+P+YIE LG VDATKLMQ TT+DRY+ YHV EF
Sbjct  125   MEEFDFKEVNEVLEYYPQGHHGVDKDGQPVYIELLGKVDATKLMQATTIDRYISYHVMEF  184

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  +CS+AAKKHIDQSTTILDV GVGLK F K AR+LI  LQKIDGDNYPETL 
Sbjct  185   ERTFVVKFPACSLAAKKHIDQSTTILDVSGVGLKQFNKAARDLIGRLQKIDGDNYPETLN  244

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTTAKI VLGNKYQSKLLEIIDASELP+F GGTCTC
Sbjct  245   RMFIINAGSGFRLLWNTVKSFLDPKTTAKITVLGNKYQSKLLEIIDASELPEFFGGTCTC  304

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKC-----SHRMARVEEEKTIPEDGGVNvsvsm  967
              DKGGCMRSDKGPW DP+I+  V  G   C     SHR     +EKTI ED         
Sbjct  305   DDKGGCMRSDKGPWKDPDILMRVQNGGAICKQLGNSHRC----DEKTITEDEASKKVQKD  360

Query  966   saksvkkpaSFKIESTKKLFPIQEETRQ---PDMYVPMVDKTVDLPNWH-VVNNDNCKFV  799
                        ++ S       +EE+ +   P+  VP+  K  D  +WH +VN+D    V
Sbjct  361   EEAPKTNVEHQQLPSIS-----EEESNKAVSPNSLVPVATKKPD-NSWHKMVNSDKYALV  414

Query  798   VPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMH  619
                 AD Y +   +K  E  SNQ++ G+M F+MGIVTMVR+T+ MP+K+T++ LYS  M+
Sbjct  415   ---KADCYGLNSGFKPPEGISNQIVAGLMAFIMGIVTMVRLTRTMPKKMTDANLYSTPMY  471

Query  618   LNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAM  439
               D   K  G     E A++ AEFM +MKRMA++EEK + ++ +P  +  EKEEML  A 
Sbjct  472   CFDSMGKAQGQ----ELAISNAEFMTVMKRMAAMEEKLLAMAVKPDAI-TEKEEMLEVAS  526

Query  438   SRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +R+DALE EL   KKALE++ S Q EL+A++EKKKKKK +F +
Sbjct  527   NRVDALEHELTATKKALEDALSKQEELLAFMEKKKKKKKLFAW  569



>gb|EYU42604.1| hypothetical protein MIMGU_mgv1a005833mg [Erythranthe guttata]
Length=468

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/532 (60%), Positives = 377/532 (71%), Gaps = 69/532 (13%)
 Frame = -2

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSVV DDEHDA+E+++VDA RQALIL+ELLPTKHDDYHM+LRFLKARKF+I+K+KQMWAD
Sbjct  1     MSVVFDDEHDADEIQAVDALRQALILEELLPTKHDDYHMLLRFLKARKFDIEKTKQMWAD  60

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             M+ WRKEFGAD I+++FDFKER+EVLKYYPQGHHGVDKDGRP+YIERLG VD+TKLMQVT
Sbjct  61    MIHWRKEFGADNIMEEFDFKEREEVLKYYPQGHHGVDKDGRPVYIERLGQVDSTKLMQVT  120

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             T+DRYLKYHVQEFERT  DK  +CSIAAKKHIDQSTTILDVQGVGLK+F K AREL+Q L
Sbjct  121   TLDRYLKYHVQEFERTFIDKFPACSIAAKKHIDQSTTILDVQGVGLKSFNKAARELVQRL  180

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QKIDGDNYPE                                  VLGNKYQSKLLE+IDA
Sbjct  181   QKIDGDNYPE----------------------------------VLGNKYQSKLLEVIDA  206

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRM--ARVEEEKTIPE  997
             SELP+FLGGTCTCADKGGCM SDKGPWND EIMKMV  G HKCS+++  + ++E+   PE
Sbjct  207   SELPEFLGGTCTCADKGGCMFSDKGPWNDTEIMKMVRNGEHKCSNKIIVSLLDEKMDYPE  266

Query  996   DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ--PDMYVPMVDKTVDLPNWHVV  823
                                   I  T +L P+ EE     P  Y PMVDK+V        
Sbjct  267   -----------------VTKEHIPRT-QLSPVHEEVNNYSPSAYEPMVDKSVTTTWPKAA  308

Query  822   NNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTE  646
             + DN  F  PK  D +   Q+A    E  SN L  GVMTFVMG+VTMVRMT+NMP+KLT+
Sbjct  309   SYDN--FAPPK--DYFPSHQKACTKSEGLSNHLFAGVMTFVMGVVTMVRMTRNMPKKLTD  364

Query  645   STLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPE  466
             +TLYS+SM+  D   K         PA+++ ++  MMKRM  LEEK   L+N+P TMPPE
Sbjct  365   ATLYSSSMYGVDAMFKA--------PAISSEDYFIMMKRMNELEEKVSVLANKPATMPPE  416

Query  465   KEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             KEEML+NA++R+D LE EL   KK L+++   Q+EL+AY+EKKKKKK  F F
Sbjct  417   KEEMLNNALNRVDMLEHELLATKKRLDDALVRQDELLAYMEKKKKKKRFFAF  468



>ref|XP_003606968.1| Sec14 cytosolic factor [Medicago truncatula]
 gb|AES89165.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=565

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/585 (58%), Positives = 436/585 (75%), Gaps = 28/585 (5%)
 Frame = -2

Query  2052  MSG--AVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVV  1879
             MSG   ++RP++    +++   D+++TRLGSL+K AI+AS+KF+HSFK  RR +RV+SV 
Sbjct  5     MSGPITIDRPVK--GLEIEYLEDEKKTRLGSLKKVAISASSKFKHSFKKGRRHNRVISV-  61

Query  1878  LDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQW  1699
              +DE D EE++++DAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADMLQW
Sbjct  62    FEDEIDTEELQAIDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEKTKQMWADMLQW  121

Query  1698  RKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDR  1519
             R+EFGADTI++DF+F+E DEVLKYYPQG HGVDKDGRP+YIERLGLVD+ KLMQVTTMDR
Sbjct  122   RREFGADTIMEDFEFEEVDEVLKYYPQGTHGVDKDGRPVYIERLGLVDSNKLMQVTTMDR  181

Query  1518  YLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKID  1339
             YLKYHV+EFE+T+N KM +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQKID
Sbjct  182   YLKYHVREFEKTSNVKMPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLIQRLQKID  241

Query  1338  GDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELP  1159
             GDNYPE+L RM+IINAGSGFR+LWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP
Sbjct  242   GDNYPESLNRMFIINAGSGFRILWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELP  301

Query  1158  DFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNv  979
             +FLGGTCTCADKGGCM SDKGPWNDPEI+KMV  G  KC  +     EEKTI ED GV  
Sbjct  302   EFLGGTCTCADKGGCMLSDKGPWNDPEILKMVQNGEAKCRRKTLSEVEEKTIVEDEGVCQ  361

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETR--QPDMYVPMVDKTVDLPNWHVVNNDNCK  805
                 S            E+   +  + ++    Q D  V M DK V   +W     ++ K
Sbjct  362   KGCDSFNKEYVLE----EACHAIAEVAKQCNAYQFDTLVSMNDKQV---SWEESLQNDQK  414

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNS  625
              +          +  ++      NQ    +M  V+GI+T +RMT+N+P K+T   LY NS
Sbjct  415   ALSKNCFGNNVCKTGFR------NQFSGRIMAMVLGIMTFIRMTRNIPTKMTAIALYGNS  468

Query  624   MHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSN  445
             ++++ + +K         P ++  + MA+MKRM  LEEK   LS + P+MPPE EE+L++
Sbjct  469   VYIDSNMVKA-------APVISVDDHMALMKRMTDLEEKVNILSMR-PSMPPEMEELLNS  520

Query  444   AMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              ++R+D LEQELA AKKAL+++ + Q EL ++I KKKKKK +F +
Sbjct  521   TLTRVDTLEQELATAKKALDDALAKQVELQSHINKKKKKKKLFHW  565



>emb|CBI37682.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 398/541 (74%), Gaps = 32/541 (6%)
 Frame = -2

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             V +D+ DAEE+++VDAFRQALIL+ELLP+KHDD  +MLRFLKARKF+I+K+KQMWADM+ 
Sbjct  5     VEEDDLDAEELQAVDAFRQALILEELLPSKHDDSRVMLRFLKARKFDIEKTKQMWADMIN  64

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF+FKE D+VL+YYPQGHHGVDKDGRP+YIERLG VD  KLMQVTT++
Sbjct  65    WRKEFGADTIMEDFEFKEIDDVLEYYPQGHHGVDKDGRPVYIERLGKVDPVKLMQVTTLE  124

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY+KYHV+EFERT   K  +CSIAAK+HIDQSTTILDVQGVGLKNF K ARELI  LQKI
Sbjct  125   RYVKYHVREFERTFKVKFPACSIAAKRHIDQSTTILDVQGVGLKNFNKSARELIMQLQKI  184

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPETLCRM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLE+IDASEL
Sbjct  185   DGENYPETLCRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEVIDASEL  244

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPE----  997
             P+FLGGTCTCADKGGCMRSDKGPWNDPEI+KM      K   + +  V +E T+      
Sbjct  245   PEFLGGTCTCADKGGCMRSDKGPWNDPEILKMAQNYDAKSFKKILIPVIDENTVSGEEMA  304

Query  996   -------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEET---RQPDM---------  874
                    D  ++           + A   +E  + L P+QEE    + P+          
Sbjct  305   HKKCDSFDSDISFDSGDKWSHSSRLAKEHVEH-QPLSPVQEEVSFLKYPNTKDYGGYEYE  363

Query  873   -YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQ-EAYKGQELASNQLLTGVMTFVM  700
              ++ +VDK VD   W    N+N +F + +  D +    +  + Q   ++Q+ +G+M+FV+
Sbjct  364   GFIQVVDKAVD-ATWPKAVNNNPQFALSR--DCFPTHGDPCRPQGRVTDQIFSGLMSFVV  420

Query  699   GIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAY--KPPEPAVTAAEFMAMMKRM  526
             GI+TM+R+TKNMP++LT++TLYS   +  D  +K H  +  K P P V++ ++M+++KR+
Sbjct  421   GIITMIRLTKNMPKRLTDATLYSTPDYCVDTIVKSHAQHPQKSPAPEVSSVDYMSIIKRV  480

Query  525   ASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYI  346
             A +EEK   LS +   M  EKEEM++ A++R +ALEQELA  +KALEE+   Q EL+ YI
Sbjct  481   AEVEEKMSVLSIKSMAMLAEKEEMMNAAINRANALEQELAANRKALEEALIRQGELMTYI  540

Query  345   E  343
             E
Sbjct  541   E  541



>ref|XP_008237008.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Prunus mume]
Length=607

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/541 (56%), Positives = 381/541 (70%), Gaps = 31/541 (6%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VM V+++D   AE++++VDAFRQALIL+ELLP+KHDD+HMMLRFL+ARKF+I ++K+MWA
Sbjct  21    VMPVLIEDNIGAEDLQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIVQTKKMWA  80

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFGADTI++DF+FKE DEV+KYYPQGHHGVDKDG+P+YIERLG VD+TKL+QV
Sbjct  81    DMLQWRKEFGADTIMEDFEFKEIDEVVKYYPQGHHGVDKDGQPVYIERLGQVDSTKLLQV  140

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TT+DRY+KYHV+EFERT   K+ +CSIAAKKHIDQSTTILDV GVGL +  K ARELIQ 
Sbjct  141   TTIDRYVKYHVREFERTFVCKLPACSIAAKKHIDQSTTILDVHGVGLTSLNKSARELIQC  200

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETL RMYIINAGSGFRL+WNT+KSFLDP+TT KI+VLGNKYQSKLLEIID
Sbjct  201   LQKVDGDNYPETLNRMYIINAGSGFRLIWNTLKSFLDPRTTGKIHVLGNKYQSKLLEIID  260

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMK---------------------MVHQ  1057
             +SELP+FLGG CTCAD+GGCMRSDKGPWNDP IMK                     MV  
Sbjct  261   SSELPEFLGGKCTCADRGGCMRSDKGPWNDPVIMKVISQLSNVNKKLTKLGILMNQMVQN  320

Query  1056  GAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE---TR  886
             G  KC        E+        +N      A    +     +    +   I +E   T 
Sbjct  321   GEAKCKRTALSGIEKAGSKRCDSLNSKTVPEADMKSQVKQQNLSPLPEDVVITKECNRTH  380

Query  885   QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTF  706
             + D ++PMVDK +D        +  C    P   D + +  A +  E  SNQ ++G+M F
Sbjct  381   EHDDFMPMVDKAMDTT---FTKSIQCDKTSP-SQDSFPVHYACRDLERLSNQFVSGMMVF  436

Query  705   VMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRM  526
             VMGI TMVR+ +NMP+KL E   Y + ++    A KGH     P PA+++  ++ MMKRM
Sbjct  437   VMGIFTMVRLARNMPKKLAEVAHYGSPVYSTGMANKGHHL---PAPAISSNAYVTMMKRM  493

Query  525   ASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYI  346
             + LEEK   LS +P  MPPEKEEML   ++RI+ LEQ+L   KKALE++   Q EL+AY+
Sbjct  494   SELEEKVNVLSTKPALMPPEKEEMLYTTLNRINVLEQDLPATKKALEDALVRQEELVAYL  553

Query  345   E  343
             +
Sbjct  554   D  554



>ref|XP_006590887.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3-like [Glycine max]
Length=561

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/532 (58%), Positives = 397/532 (75%), Gaps = 40/532 (8%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             V+SV ++D  DA+E++ VDAFRQALIL+ELLP K+DD+H MLRFL+ARKF+I+K+KQMWA
Sbjct  62    VVSVAIEDNVDAQELQVVDAFRQALILEELLPAKYDDHHTMLRFLRARKFDIEKTKQMWA  121

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWR+EFGADTI++DF+FKERDEV KYYPQGHHGVDK+GRP+YIE+LG VD+ KLMQV
Sbjct  122   DMLQWRREFGADTIMEDFEFKERDEVQKYYPQGHHGVDKEGRPVYIEKLGQVDSNKLMQV  181

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TTMDRYLKYHV+EFE+T   K  +CSI+AKKHIDQSTTILDVQGVGLK+  K AR+LIQ 
Sbjct  182   TTMDRYLKYHVREFEKTFVVKFPACSISAKKHIDQSTTILDVQGVGLKSLNKAARDLIQR  241

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDNYPE+L  M+IINAGSGFR+LWN++KSFLDPKTT+KI+VLGNKYQSKLLEIID
Sbjct  242   LQKIDGDNYPESLNSMFIINAGSGFRMLWNSIKSFLDPKTTSKIHVLGNKYQSKLLEIID  301

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             ASELP+FLGGTCTCADKGGCM SDKGPWND EI+KMV  G  KC  +     EEKTI +D
Sbjct  302   ASELPEFLGGTCTCADKGGCMLSDKGPWNDIEILKMVQNGEGKCKRKTLSGIEEKTIIQD  361

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ----PDM-YVPMVDKTVDLPNWH  829
                                 +I   K+  P  +E+ Q    P++ +VP++DK V+  +W 
Sbjct  362   --------------------EIACQKEHDPFNKESVQLGAVPEVAFVPVIDKQVN-ASWE  400

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
                 +N +    K          + G  +       G++T +MG++TM+RMT+NMPRK+T
Sbjct  401   KAVQNN-QLAASKDCFPSDASNTFNGFRIP---FTGGIITILMGVITMLRMTRNMPRKVT  456

Query  648   EST-LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             E+T LY+N ++ + + MK         PA++  + MA+MKRMA LEEK   LS + PTMP
Sbjct  457   EATALYANPLYCDGNMMKA--------PAISMNDQMALMKRMAELEEKVNVLSMK-PTMP  507

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIF  316
             PE EE+L+NA++R++ LEQEL   KK+L+++ + Q EL A+++KKKKKK  F
Sbjct  508   PEMEELLNNALNRVNTLEQELDSTKKSLDDALARQVELQAHLDKKKKKKKFF  559



>emb|CDX69225.1| BnaC01g02280D [Brassica napus]
Length=607

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/525 (60%), Positives = 381/525 (73%), Gaps = 43/525 (8%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             V  V ++D HDAEE+KSVDAFRQALILDELLP KHDDYHMMLRFLKARKF++DK+K MW 
Sbjct  25    VTPVEIEDVHDAEELKSVDAFRQALILDELLPEKHDDYHMMLRFLKARKFDLDKTKLMWT  84

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             +ML+WRKEFGADT++++F+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQV
Sbjct  85    EMLRWRKEFGADTVMEEFEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQV  144

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TT+DRY+ YHV EFERT N K  +CSIAAKK IDQSTTILDVQGVGLKNF K AR+L+  
Sbjct  145   TTLDRYVNYHVMEFERTFNVKFPACSIAAKKQIDQSTTILDVQGVGLKNFNKAARDLVTR  204

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQ +DG+NYPE+L RM+IINAGSGFR+LW+T +S         + VLGNKYQSKLLEIID
Sbjct  205   LQAVDGNNYPESLNRMFIINAGSGFRMLWSTQRS---------MQVLGNKYQSKLLEIID  255

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPE  997
              SELP+FLGGTCTCAD GGCMRSDKGPWN+PEIM+ V  G HKC+ R  A    E+TI E
Sbjct  256   ESELPEFLGGTCTCADSGGCMRSDKGPWNNPEIMQRVKNGDHKCTKRSQAENGAEETIFE  315

Query  996   DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR---QPDMYVPMVDKTVDLPNWHV  826
                                    EST +  P  EET+   QP      +      P W++
Sbjct  316   GS---------------------ESTAEQAP--EETKDSAQPSSSSSDIVPVAAHPAWNM  352

Query  825   VNNDNCKFVVPKGADLYQIQEAYK--GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
                +  KF + K  ++Y IQEA      +   + + TGVM  VMG+VTM+R+TKN+PRKL
Sbjct  353   --PEAHKFSLSK-KEVYAIQEACNTATSDGGRSPIFTGVMALVMGVVTMIRVTKNVPRKL  409

Query  651   TESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPT  478
             TESTLYS+ ++ +D +M      + K   PA++  +FMA+MKRMA LE+K   LS QP T
Sbjct  410   TESTLYSSPVYCDDASMNKSAMQSEKMMVPAISGEDFMAIMKRMAELEQKVTVLSAQPTT  469

Query  477   MPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             MPPEKEEML+ A+SR + LEQELA  KKAL++S   Q +L+AYIE
Sbjct  470   MPPEKEEMLNAAISRSNVLEQELAATKKALDDSLGRQEDLVAYIE  514



>ref|XP_006285920.1| hypothetical protein CARUB_v10007432mg [Capsella rubella]
 gb|EOA18818.1| hypothetical protein CARUB_v10007432mg [Capsella rubella]
Length=556

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/582 (55%), Positives = 405/582 (70%), Gaps = 48/582 (8%)
 Frame = -2

Query  2061  AGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMS  1885
             A  M   V+R  +   E    + D R T+L SL+K AINA+NK      K  RR SRV  
Sbjct  2     ADTMVAHVDRHNKIDVENSLSEDDKRLTKLCSLKKKAINATNKFKHSMTKKDRRHSRVTC  61

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             V + DE D EE+++VDAFRQALILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML
Sbjct  62    VSIVDEIDTEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADML  121

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
              WRKE+GADTI++DFDFKE D+V++YYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+
Sbjct  122   NWRKEYGADTIMEDFDFKEIDQVVQYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTI  181

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+KYHV+EFE+T N K  +CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QK
Sbjct  182   DRYVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQK  241

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             ID DNYPETL RM+IINAG GFRL+W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+E
Sbjct  242   IDNDNYPETLNRMFIINAGYGFRLVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANE  301

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGG CTC DKGGCMRSDKGPWNDPEI K+V  G  +C  R     EEKTI E    
Sbjct  302   LPEFLGGKCTCTDKGGCMRSDKGPWNDPEIFKLVQNGEGRCLRRNLSGIEEKTISE----  357

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQ-EETRQP---DMYVPMVDKTVDLPNW----H  829
                             +K ES K   P + EET +    +     +DKTVD  +W    H
Sbjct  358   ----------------YKKESKKTCEPCEAEETNKESTGEKEKKFIDKTVDAADWPTKFH  401

Query  828   VVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
               NN +     P+  D+Y      + +      L   VM  +MG+V ++R+TKNMPRKLT
Sbjct  402   KANNKS-----PEPKDVYSAANPLERK----GYLYGSVMALLMGLVGVMRLTKNMPRKLT  452

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPP  469
             E+ +YS          +G   Y+     ++  E+MAM+K+M  LEEK  ++  Q      
Sbjct  453   EANVYSR---------EGCSVYQDGVTVMSRQEYMAMVKKMTDLEEKCKSMEAQ-AAFSL  502

Query  468   EKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             E+ ++L  A+ R+D LE  L+E KKAL+E+ + Q+E++AYIE
Sbjct  503   ERNKILDAALRRVDQLELHLSETKKALDETMTRQHEMMAYIE  544



>gb|KHN39805.1| Sec14 cytosolic factor, partial [Glycine soja]
Length=591

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/532 (58%), Positives = 394/532 (74%), Gaps = 29/532 (5%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             V+SV ++D  DA+E++ VDAFRQALIL+ELLP K+DD+H MLRFL+ARKF+I+K+KQMWA
Sbjct  41    VVSVAIEDNVDAQELQVVDAFRQALILEELLPAKYDDHHTMLRFLRARKFDIEKTKQMWA  100

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWR+EFGADTI++DF+FKERDEV KYYPQGHHGVDK+GRP+YIE+LG VD+ KLMQV
Sbjct  101   DMLQWRREFGADTIMEDFEFKERDEVQKYYPQGHHGVDKEGRPVYIEKLGQVDSNKLMQV  160

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TTMDRYLKYHV+EFE+T   K  +CSI+AKKHIDQSTTILDVQGVGLK+  K AR+LIQ 
Sbjct  161   TTMDRYLKYHVREFEKTFVVKFPACSISAKKHIDQSTTILDVQGVGLKSLNKAARDLIQR  220

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDNYPE+L  M+IINAGSGFR+LWN++KSFLDPKTT+KI+VLGNKYQSKLLEIID
Sbjct  221   LQKIDGDNYPESLNSMFIINAGSGFRMLWNSIKSFLDPKTTSKIHVLGNKYQSKLLEIID  280

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             ASELP+FLGGTCTCADKGGCM SDKGPWND EI+KMV  G  KC  +     EEKTI +D
Sbjct  281   ASELPEFLGGTCTCADKGGCMLSDKGPWNDIEILKMVQNGEGKCKRKTLSGIEEKTIIQD  340

Query  993   G-GVNvsvsmsaksvkkpaSFKIESTKKLF--------PIQEETRQ----PDM-YVPMVD  856
                    VS    S K    +  +    LF        P  +E+ Q    P++ +VP++D
Sbjct  341   EIACQKVVSYLPYSFKFSLPYSDDLIAFLFSYNIKEHDPFNKESVQLGAVPEVAFVPVID  400

Query  855   KTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRM  676
             K V+  +W     +N +    K          + G  +       G++T +MG++TM+RM
Sbjct  401   KQVN-ASWEKAVQNN-QLAASKDCFPSDASNTFNGFRIP---FTGGIITILMGVITMLRM  455

Query  675   TKNMPRKLTEST-LYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFIT  499
             T+NMPRK+TE+T LY+N ++ + + MK         PA++  + MA+MKRMA LEEK   
Sbjct  456   TRNMPRKVTEATALYANPLYCDGNMMKA--------PAISMNDQMALMKRMAELEEKVNV  507

Query  498   LSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             LS + PTMPPE EE+L+NA++R++ LEQEL   KK+L+++ + Q EL A+++
Sbjct  508   LSMK-PTMPPEMEELLNNALNRVNTLEQELDSTKKSLDDALARQVELQAHLD  558



>ref|NP_195184.2| phosphatidylinositol transfer protein COW1 [Arabidopsis thaliana]
 sp|F4JLE5.1|SFH1_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1; AltName: Full=Phosphatidylinositol transfer 
protein 1; Short=AtPITP1; AltName: Full=Protein CAN OF WORMS1; 
AltName: Full=Protein SEC FOURTEEN HOMOLOGS 1; Short=AtSFH1; 
AltName: Full=Protein SHORT ROOT HAIR 1 [Arabidopsis thaliana]
 gb|AEE86395.1| phosphatidylinositol transfer protein COW1 [Arabidopsis thaliana]
Length=554

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/577 (57%), Positives = 431/577 (75%), Gaps = 39/577 (7%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIVKISSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DF+E DEV+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   DFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++K+      KCS     + E++    D G + S            
Sbjct  307   GCMRSDKGPWNDPEVLKIAINREAKCSP----ISEDEHKHVDQGRSTSG-----------  351

Query  939   SFKIESTKKLFPIQEETRQPDMY---VPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQI  769
                 ES ++   I+++T + ++Y   +  +DK++D+  W         F + KG + Y  
Sbjct  352   ---FESLER---IKKKTDEDNVYEKQIATIDKSMDMA-WLAKTQKAENFPISKGLECYVR  404

Query  768   QEA-YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND--HAMK  598
             + A  KG  L    L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   + +
Sbjct  405   KGAPKKGDGL----LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQ  460

Query  597   GHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDale  418
               G +  P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LE
Sbjct  461   NQGQFAAP---VSSSEYMLMVKRMAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLE  517

Query  417   qelaeakkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
             QEL E KKALEE+  +Q E++AYIEKKKKKK + FGF
Sbjct  518   QELTETKKALEEALVSQKEILAYIEKKKKKKKLFFGF  554



>emb|CAE82296.1| can of worms 1 protein [Arabidopsis thaliana]
 emb|CAE82297.1| can of worms 1 [Arabidopsis thaliana]
Length=557

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/565 (57%), Positives = 421/565 (75%), Gaps = 38/565 (7%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIVKISSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DF+E DEV+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   DFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++K+      KCS     + E++    D G + S            
Sbjct  307   GCMRSDKGPWNDPEVLKIAINREAKCSP----ISEDEHKHVDQGRSTSG-----------  351

Query  939   SFKIESTKKLFPIQEETRQPDMY---VPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQI  769
                 ES ++   I+++T + ++Y   +  +DK++D+  W         F + KG + Y  
Sbjct  352   ---FESLER---IKKKTDEDNVYEKQIATIDKSMDMA-WLAKTQKAENFPISKGLECYVR  404

Query  768   QEA-YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND--HAMK  598
             + A  KG  L    L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   + +
Sbjct  405   KGAPKKGDGL----LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQ  460

Query  597   GHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDale  418
               G +  P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LE
Sbjct  461   NQGQFAAP---VSSSEYMLMVKRMAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLE  517

Query  417   qelaeakkaleesqSNQNELIAYIE  343
             QEL E KKALEE+  +Q E++AYIE
Sbjct  518   QELTETKKALEEALVSQKEILAYIE  542



>ref|XP_004507471.1| PREDICTED: uncharacterized protein LOC101513836 [Cicer arietinum]
Length=563

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/565 (58%), Positives = 416/565 (74%), Gaps = 34/565 (6%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALIL  1813
             ++++T L SL+K A +AS+KF+HS K  RR SRVMSVV D E D EE++ VD+FRQALIL
Sbjct  25    EEKKTGLESLKKVARSASSKFKHSMKKGRRHSRVMSVVDDYEIDTEELQVVDSFRQALIL  84

Query  1812  DELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVL  1633
             +ELLP+KHDD+HMMLRFL+ARK++I+K+KQMWADM+QWR+EFG +TI++DF+FKE DEVL
Sbjct  85    EELLPSKHDDHHMMLRFLRARKYDIEKTKQMWADMIQWRREFGVETIMEDFEFKEIDEVL  144

Query  1632  KYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSI  1453
             KYYPQG HGVDKDGRP+YIERLG+VD+ KLMQVTTMDRYLKYHV+EFE+T N KM +CSI
Sbjct  145   KYYPQGTHGVDKDGRPVYIERLGMVDSNKLMQVTTMDRYLKYHVREFEKTFNVKMPACSI  204

Query  1452  AAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRL  1273
             AA KHIDQSTTILDVQG+GL++  K AR+L+Q LQKIDGDNYPE+L RM+IINAGSGFR+
Sbjct  205   AANKHIDQSTTILDVQGLGLRSMNKAARDLLQRLQKIDGDNYPESLNRMFIINAGSGFRM  264

Query  1272  LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGP  1093
             LWNTVKSFLDPKTT+KI+VLGNKYQSKLLEIIDASELP+FLGGTCTCADKGGCM SDKGP
Sbjct  265   LWNTVKSFLDPKTTSKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADKGGCMLSDKGP  324

Query  1092  WNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKK  913
             WNDP+I+KMV  G  K   +     EEKTI ED       +           + +E    
Sbjct  325   WNDPKILKMVQNGEAKYRSKPFFRIEEKTIIED-----VTACQKNCDSFNNEYALEEA--  377

Query  912   LFPIQEETRQPDMY-----VPMVDKTVDLPNW-HVVNNDNCKFVVPKGADLYQIQEAYKG  751
                I +  +Q ++Y     VPM +KT     W   + +D  K  + +G     + E   G
Sbjct  378   CHAIAKVAKQCNVYQFDTVVPMNEKT-----WKEAIQSD--KKALSEGCLGDDVCETSNG  430

Query  750   QELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
                  NQ + G+M+ V+GI+T +RM++NMP K+TE  +  NS++ N   MK         
Sbjct  431   ---IGNQFIGGIMSIVLGIITFIRMSRNMPNKMTE--VGDNSVYYNGDMMK--------V  477

Query  570   PAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakka  391
             P ++  + M MMKR+A LEEK  TLS + P+MP EKEE+L++A++R+  LEQELA  KKA
Sbjct  478   PVISIDDHMVMMKRIADLEEKVNTLSIR-PSMPLEKEELLNSALNRVATLEQELAMTKKA  536

Query  390   leesqSNQNELIAYIEkkkkkKNIF  316
             L+ +   Q EL +YI+KKK KK +F
Sbjct  537   LDGALVRQAELQSYIDKKKNKKKLF  561



>ref|XP_007131803.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
 gb|ESW03797.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
Length=565

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/540 (57%), Positives = 382/540 (71%), Gaps = 45/540 (8%)
 Frame = -2

Query  2025  RPS-AEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEE  1852
             RP+   +M+   DD++T+LGSL+K AI+AS+K      K  RR SRVMS+ ++DE DAEE
Sbjct  15    RPAKGVEMEYLEDDKKTKLGSLKKVAISASSKFKHSLQKKGRRHSRVMSIAIEDEVDAEE  74

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             ++SVDAFRQ LIL+ELLP+KHDD+HMMLRFL+ARK++I+K+KQMWADMLQWR+EFGADTI
Sbjct  75    LQSVDAFRQTLILEELLPSKHDDHHMMLRFLRARKYDIEKTKQMWADMLQWRREFGADTI  134

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE  EV KYYPQG+HGVDK G PIYIERLG VD+ KL+QVTT+DRYLKYHV+EF
Sbjct  135   MEDFEFKELQEVRKYYPQGNHGVDKQGLPIYIERLGQVDSNKLLQVTTLDRYLKYHVREF  194

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQKIDGDNYPETL 
Sbjct  195   ERTFLVKFPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLIQRLQKIDGDNYPETLN  254

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTC
Sbjct  255   RMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTC  314

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaks  955
              DKGGC+ SDKGPWNDPEI+KMV  G  KC  + ++ +E +  I ED         S   
Sbjct  315   RDKGGCLLSDKGPWNDPEILKMVQNGEGKCKRKTLSGIEVKTIIEEDTACQKVEYDSLNK  374

Query  954   vkkpaSFKIESTKKLF-PIQ----EETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPK  790
                       S K  F P+     E+T Q D      D +   P+    NN +  F +P 
Sbjct  375   ESAAVEHPSTSPKVTFAPVNNTSWEKTEQNDELGLSKDCS---PS----NNSSKGFRIP-  426

Query  789   GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND  610
                       + G          G+M+ +MG++ M+RM KNMPRK+T + L+ N+ + + 
Sbjct  427   ----------FTG----------GIMSIIMGVIAMIRMAKNMPRKITGAELFGNTAYCSS  466

Query  609   HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
             + MK         P ++  + M MMKR+  LEEK   LS + P MPPE EE+L+  ++R+
Sbjct  467   NEMK--------TPDISMDDQMPMMKRIVELEEKVNELSKK-PVMPPEMEELLNKTLNRV  517



>ref|XP_006412209.1| hypothetical protein EUTSA_v10024823mg [Eutrema salsugineum]
 gb|ESQ53662.1| hypothetical protein EUTSA_v10024823mg [Eutrema salsugineum]
Length=555

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/561 (57%), Positives = 416/561 (74%), Gaps = 31/561 (6%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AI+ASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIVKMCSLKKKAISASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+  DD HMMLRFL+ARKF+I+K+KQMW DM+QWRKEFGADTII+DF
Sbjct  67    DAFRQALVLDELLPSNLDDLHMMLRFLRARKFDIEKAKQMWGDMIQWRKEFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E D+V+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDDVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPSCSVAAHKHIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++KM      KCS     + E++    D G + SV           
Sbjct  307   GCMRSDKGPWNDPEVLKMAINREAKCSP----ISEDEQKHVDQGRSTSV-----------  351

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                +ES ++    ++E    +  +  +DK++D+  W         F + KG + Y  + A
Sbjct  352   ---LESLERTNKKRDEDNAYEKQITTIDKSMDMA-WPAKTQKTENFPISKGLECYVRKGA  407

Query  759   -YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA-  586
               KG  L    L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   K + A 
Sbjct  408   PKKGDGL----LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESMSKQNQAQ  463

Query  585   YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqela  406
             +  P   V++AE+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL 
Sbjct  464   FAAP---VSSAEYMLMVKRMAELEDKCMFLDLKPANVESEKEEKLQAALNRVQVLEQELT  520

Query  405   eakkaleesqSNQNELIAYIE  343
             E KKALEE+  +Q E++AYIE
Sbjct  521   ETKKALEEALVSQKEILAYIE  541



>emb|CAA18837.1| putative protein [Arabidopsis thaliana]
 emb|CAB80175.1| putative protein [Arabidopsis thaliana]
Length=560

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/562 (56%), Positives = 414/562 (74%), Gaps = 33/562 (6%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIVKISSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQALILDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             DF+E DEV+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   DFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++K+      KCS     + E++    D G + S            
Sbjct  307   GCMRSDKGPWNDPEVLKIAINREAKCSP----ISEDEHKHVDQGRSTSG-----------  351

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 ES +++    +E    +  +  +DK++D+  W         F + KG     I + 
Sbjct  352   ---FESLERIKKKTDEDNVYEKQIATIDKSMDMA-WLAKTQKAENFPISKG-----ITKL  402

Query  759   YKGQELASNQLLT-GVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDH--AMKGHG  589
              KG     + LL  GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   + +  G
Sbjct  403   MKGAPKKGDGLLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQG  462

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
              +  P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL
Sbjct  463   QFAAP---VSSSEYMLMVKRMAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLEQEL  519

Query  408   aeakkaleesqSNQNELIAYIE  343
              E KKALEE+  +Q E++AYIE
Sbjct  520   TETKKALEEALVSQKEILAYIE  541



>ref|XP_007131805.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
 gb|ESW03799.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
Length=556

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 387/540 (72%), Gaps = 45/540 (8%)
 Frame = -2

Query  2025  RPS-AEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEE  1852
             RP+   +M+   DD++T+LGSL+K AI+AS+KF+HS + + RR SRVMS+ ++DE DAEE
Sbjct  15    RPAKGVEMEYLEDDKKTKLGSLKKVAISASSKFKHSLQKKGRRHSRVMSIAIEDEVDAEE  74

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             ++SVDAFRQ LIL+ELLP+KHDD+HMMLRFL+ARK++I+K+KQMWADMLQWR+EFGADTI
Sbjct  75    LQSVDAFRQTLILEELLPSKHDDHHMMLRFLRARKYDIEKTKQMWADMLQWRREFGADTI  134

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE  EV KYYPQG+HGVDK G PIYIERLG VD+ KL+QVTT+DRYLKYHV+EF
Sbjct  135   MEDFEFKELQEVRKYYPQGNHGVDKQGLPIYIERLGQVDSNKLLQVTTLDRYLKYHVREF  194

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQKIDGDNYPETL 
Sbjct  195   ERTFLVKFPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLIQRLQKIDGDNYPETLN  254

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTC
Sbjct  255   RMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTC  314

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaks  955
              DKGGC+ SDKGPWNDPEI+KMV  G  KC  + ++ +E +  I ED         S   
Sbjct  315   RDKGGCLLSDKGPWNDPEILKMVQNGEGKCKRKTLSGIEVKTIIEEDTACQKVEYDSLNK  374

Query  954   vkkpaSFKIESTKKLF-PIQ----EETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPK  790
                       S K  F P+     E+T Q D      D +   P+    NN +  F +P 
Sbjct  375   ESAAVEHPSTSPKVTFAPVNNTSWEKTEQNDELGLSKDCS---PS----NNSSKGFRIP-  426

Query  789   GADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLND  610
                       + G          G+M+ +MG++ M+RM KNMPRK+T + L+ N+ + + 
Sbjct  427   ----------FTG----------GIMSIIMGVIAMIRMAKNMPRKITGAELFGNTAYCSS  466

Query  609   HAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
             + MK         P ++  + M MMKR+  LEEK   LS + P MPPE EE+L+  ++R+
Sbjct  467   NEMKT--------PDISMDDQMPMMKRIVELEEKVNELSKK-PVMPPEMEELLNKTLNRV  517



>ref|XP_007131802.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
 gb|ESW03796.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
Length=555

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/539 (58%), Positives = 385/539 (71%), Gaps = 44/539 (8%)
 Frame = -2

Query  2025  RPS-AEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEE  1852
             RP+   +M+   DD++T+LGSL+K AI+AS+KF+HS + + RR SRVMS+ ++DE DAEE
Sbjct  15    RPAKGVEMEYLEDDKKTKLGSLKKVAISASSKFKHSLQKKGRRHSRVMSIAIEDEVDAEE  74

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             ++SVDAFRQ LIL+ELLP+KHDD+HMMLRFL+ARK++I+K+KQMWADMLQWR+EFGADTI
Sbjct  75    LQSVDAFRQTLILEELLPSKHDDHHMMLRFLRARKYDIEKTKQMWADMLQWRREFGADTI  134

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE  EV KYYPQG+HGVDK G PIYIERLG VD+ KL+QVTT+DRYLKYHV+EF
Sbjct  135   MEDFEFKELQEVRKYYPQGNHGVDKQGLPIYIERLGQVDSNKLLQVTTLDRYLKYHVREF  194

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQKIDGDNYPETL 
Sbjct  195   ERTFLVKFPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLIQRLQKIDGDNYPETLN  254

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTC
Sbjct  255   RMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTC  314

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksv  952
              DKGGC+ SDKGPWNDPEI+KMV  G  KC  +     E KTI E+         S    
Sbjct  315   RDKGGCLLSDKGPWNDPEILKMVQNGEGKCKRKTLSGIEVKTIIEEDTACQKEYDSLNKE  374

Query  951   kkpaSFKIESTKKLF-PIQ----EETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKG  787
                      S K  F P+     E+T Q D      D +   P+    NN +  F +P  
Sbjct  375   SAAVEHPSTSPKVTFAPVNNTSWEKTEQNDELGLSKDCS---PS----NNSSKGFRIP--  425

Query  786   ADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDH  607
                      + G          G+M+ +MG++ M+RM KNMPRK+T + L+ N+ + + +
Sbjct  426   ---------FTG----------GIMSIIMGVIAMIRMAKNMPRKITGAELFGNTAYCSSN  466

Query  606   AMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
              MK         P ++  + M MMKR+  LEEK   LS + P MPPE EE+L+  ++R+
Sbjct  467   EMKT--------PDISMDDQMPMMKRIVELEEKVNELSKK-PVMPPEMEELLNKTLNRV  516



>ref|XP_004289116.1| PREDICTED: uncharacterized protein LOC101306761 [Fragaria vesca 
subsp. vesca]
Length=535

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/555 (55%), Positives = 393/555 (71%), Gaps = 55/555 (10%)
 Frame = -2

Query  2007  MDLDADDRQTRLGSLRKAAINAsnk--frhsfksrrrssRVMSVVLDDEHDAEEVKSVDA  1834
             +++  ++R+TR+GSL+K A+ AS +     + K RR  SRV+SV ++D HD EE K+V++
Sbjct  13    VEISEEERKTRMGSLKKKAMTASARFRNSLTRKHRRSQSRVLSVEMEDVHDIEETKAVES  72

Query  1833  FRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDF  1654
              RQALI +ELLP KHDDYH +LRFLKARKF+I+K+KQMW+DMLQWRK FGADTI++DFDF
Sbjct  73    LRQALIAEELLPAKHDDYHKILRFLKARKFDIEKTKQMWSDMLQWRKTFGADTILEDFDF  132

Query  1653  KERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNND  1474
             KE DEV++YYPQGHHGVDKDG+P+YIER+G V+A KLM+ TT++RY+KYHV+EFERT + 
Sbjct  133   KELDEVVQYYPQGHHGVDKDGQPVYIERIGQVNANKLMETTTIERYVKYHVREFERTFDA  192

Query  1473  KMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIIN  1294
             K  +CSIAAKKHIDQSTTILDVQGVGLK+F K ARELI  LQ IDG+NYPETL RM+IIN
Sbjct  193   KFPACSIAAKKHIDQSTTILDVQGVGLKSFNKAARELISCLQTIDGNNYPETLNRMFIIN  252

Query  1293  AGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGC  1114
             AGSGFR+LW+TVKSF+DPKTT KINVLGN YQSKLLEIIDASELP+FLGGTCTCAD+GGC
Sbjct  253   AGSGFRMLWSTVKSFIDPKTTEKINVLGNNYQSKLLEIIDASELPEFLGGTCTCADQGGC  312

Query  1113  MRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaS  937
             MRSDKGPW D  IM MV  G HKC+ +   ++ E +TI E                    
Sbjct  313   MRSDKGPWKDQLIMAMVQNGVHKCTKKPPVQISEMETISEPS------------------  354

Query  936   FKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAY  757
                        + +  + P  Y P        P W     +       K    Y+  + Y
Sbjct  355   -----------MSKSIQGPFKYPP-----TSAPTWQTAVRNG------KAGGCYEAPKVY  392

Query  756   KGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKP  577
              G     +Q++ G+M F+MGIV MV++T+NMP++LT+ST YS++++ +D        ++P
Sbjct  393   DG---FGSQIIAGIMAFLMGIVAMVKLTRNMPKRLTDSTFYSSTVYGDDTTFN----HQP  445

Query  576   PEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                 +  +E M++MKRMA LEE+      +P + P EKE +L+ A+SR+DALEQEL E K
Sbjct  446   SCSTIPGSELMSVMKRMAELEERV-----KPSSKPHEKEVLLNAAISRVDALEQELNETK  500

Query  396   kaleesqSNQNELIA  352
             KAL ES + Q+E++A
Sbjct  501   KALHESLARQDEILA  515



>ref|XP_007131804.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
 gb|ESW03798.1| hypothetical protein PHAVU_011G042900g [Phaseolus vulgaris]
Length=564

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/539 (57%), Positives = 380/539 (71%), Gaps = 44/539 (8%)
 Frame = -2

Query  2025  RPS-AEKMDLDADDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEE  1852
             RP+   +M+   DD++T+LGSL+K AI+AS+K      K  RR SRVMS+ ++DE DAEE
Sbjct  15    RPAKGVEMEYLEDDKKTKLGSLKKVAISASSKFKHSLQKKGRRHSRVMSIAIEDEVDAEE  74

Query  1851  VKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTI  1672
             ++SVDAFRQ LIL+ELLP+KHDD+HMMLRFL+ARK++I+K+KQMWADMLQWR+EFGADTI
Sbjct  75    LQSVDAFRQTLILEELLPSKHDDHHMMLRFLRARKYDIEKTKQMWADMLQWRREFGADTI  134

Query  1671  IDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEF  1492
             ++DF+FKE  EV KYYPQG+HGVDK G PIYIERLG VD+ KL+QVTT+DRYLKYHV+EF
Sbjct  135   MEDFEFKELQEVRKYYPQGNHGVDKQGLPIYIERLGQVDSNKLLQVTTLDRYLKYHVREF  194

Query  1491  ERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLC  1312
             ERT   K  +CSIAAKKHIDQSTTILDVQGVGLK+  K AR+LIQ LQKIDGDNYPETL 
Sbjct  195   ERTFLVKFPACSIAAKKHIDQSTTILDVQGVGLKSMNKAARDLIQRLQKIDGDNYPETLN  254

Query  1311  RMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTC  1132
             RM+IINAGSGFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIIDASELP+FLGGTCTC
Sbjct  255   RMFIINAGSGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGTCTC  314

Query  1131  ADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksv  952
              DKGGC+ SDKGPWNDPEI+KMV  G  KC  +     E KTI E+         S    
Sbjct  315   RDKGGCLLSDKGPWNDPEILKMVQNGEGKCKRKTLSGIEVKTIIEEDTACQKEYDSLNKE  374

Query  951   kkpaSFKIESTKKLF-PIQ----EETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKG  787
                      S K  F P+     E+T Q D      D +   P+    NN +  F +P  
Sbjct  375   SAAVEHPSTSPKVTFAPVNNTSWEKTEQNDELGLSKDCS---PS----NNSSKGFRIP--  425

Query  786   ADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDH  607
                      + G          G+M+ +MG++ M+RM KNMPRK+T + L+ N+ + + +
Sbjct  426   ---------FTG----------GIMSIIMGVIAMIRMAKNMPRKITGAELFGNTAYCSSN  466

Query  606   AMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRI  430
              MK         P ++  + M MMKR+  LEEK   LS + P MPPE EE+L+  ++R+
Sbjct  467   EMK--------TPDISMDDQMPMMKRIVELEEKVNELSKK-PVMPPEMEELLNKTLNRV  516



>ref|XP_009108722.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X2 [Brassica rapa]
Length=553

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/572 (57%), Positives = 427/572 (75%), Gaps = 30/572 (5%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++D+  ++R+  ++ SL+K AI+ASN+F++SFK +  R +SRVMSV ++D+ DAE+++++
Sbjct  7     EIDMSEEERKIVKMCSLKKKAISASNRFKNSFKKKGRRSTSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMWADM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWADMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F E D+V+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFDEIDDVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  +CS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KIKFPACSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++KM      KCS     + E++    D G + SV           
Sbjct  307   GCMRSDKGPWNDPEVLKMAINKEAKCSP----ISEDEHKHVDQGRSTSVP----------  352

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 ES ++    ++E    +  +  +DK++D   W V    +  F V KG + Y  + A
Sbjct  353   ----ESLERNNKKRDEDNAHEKQIATIDKSMDTA-WPVKTQKSESFKVSKGLEGYVRKGA  407

Query  759   YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA-Y  583
              K ++     L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   K + A +
Sbjct  408   PKKRD---GLLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESMSKQNKAQF  464

Query  582   KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
               P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL E
Sbjct  465   AAP---VSSSEYMLMVKRMAELEDKCMFLDLKPANVDSEKEEKLQAALNRVQVLEQELTE  521

Query  402   akkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
              KKALEE+  +Q E++AYIEKKKKKK + FGF
Sbjct  522   TKKALEEALVSQKEILAYIEKKKKKKKLFFGF  553



>ref|XP_002868891.1| hypothetical protein ARALYDRAFT_912375 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45150.1| hypothetical protein ARALYDRAFT_912375 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/558 (56%), Positives = 400/558 (72%), Gaps = 49/558 (9%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQALI
Sbjct  23    DNRLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVACVSIVDEIDTEELQAVDAFRQALI  82

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+++K+K MWADML WRKE+GADTI++DFDFKE DEV
Sbjct  83    LDELLPSKHDDHHMMLRFLRARKFDLEKAKHMWADMLNWRKEYGADTIMEDFDFKEIDEV  142

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +++YPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +CS
Sbjct  143   VQHYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACS  202

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  203   IAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYGFR  262

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLW+TVKSFLDPKTTAKI+VLGNKYQ+KLLEII+A+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  263   LLWSTVKSFLDPKTTAKIHVLGNKYQTKLLEIIEANELPEFLGGKCTCADKGGCMRSDKG  322

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  R     EEKTI E                    +  E+ K
Sbjct  323   PWNDPEIFKLVQNGEGRCLRRSLSGIEEKTISE--------------------YNSETKK  362

Query  915   KLFPIQEETRQ---PDMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQEAY  757
             K  P  EET +    +     +DK VD+ +W    H  NN + +       D+Y      
Sbjct  363   KCEP--EETYKQSAAEKEKKFIDKNVDVADWPTKIHKANNSSTEL-----KDVYSAVNPL  415

Query  756   KGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKP  577
             + +      L   VM  +MGIV ++R+TKNMPRKLTE+ +YS          +G   Y+ 
Sbjct  416   ERK----GYLYGSVMALLMGIVGVMRLTKNMPRKLTEANVYSR---------EGSAVYQD  462

Query  576   PEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                 ++  E+M M+K+M  LEEK  ++  Q      E+E++L  A+ R+D LE +L+E  
Sbjct  463   GVTVMSRQEYMVMVKKMTDLEEKCKSMEAQ-AAFSLEREKILDAALRRVDQLELQLSETN  521

Query  396   kaleesqSNQNELIAYIE  343
             KAL+E+ + Q+E++AYIE
Sbjct  522   KALDETMTRQHEIMAYIE  539



>ref|XP_010437021.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 isoform X1 [Camelina sativa]
 ref|XP_010437022.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 isoform X1 [Camelina sativa]
 ref|XP_010437023.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 isoform X1 [Camelina sativa]
Length=557

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/573 (57%), Positives = 412/573 (72%), Gaps = 47/573 (8%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D D R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDDKRLTKLVSLKKKAINATNKFKHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRKE+GADTI++DFDFKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKEYGADTIMEDFDFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIERLG VDATKL++VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIERLGQVDATKLLKVTTIDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FRL+W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRLVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C  R     EEKTI E                    +K E+
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRRSLSGIEEKTISE--------------------YKNET  360

Query  921   TKKLFPIQ-EETRQP---DMYVPMVDKTVDLPNWHV-VNNDNCKFVVPKGADLYQIQEAY  757
              KK  P + EET +    +     +DKTVD  +W   ++  N    VP+  D+Y   +  
Sbjct  361   QKKCEPFEAEETNKESAGEKEKKFIDKTVDAADWPTKLHKANKNLPVPEPKDVYSPVDP-  419

Query  756   KGQELASNQLLTG-VMTFVMGIVTMVRMTKNMPRKLTESTLYS---NSMHLNDHAMKGHG  589
                 L     L+G VM  +M IV ++R+TKNMPR+LTE+ +YS    S++ ND       
Sbjct  420   ----LERKGYLSGSVMALLMAIVGVMRLTKNMPRRLTEANVYSREGGSVYQNDGV-----  470

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
                     ++  E+MAM+K+M  LEEK  ++  Q  +   E++ +L  ++ R+D  E  L
Sbjct  471   ------TVMSRQEYMAMLKKMTDLEEKCKSMEAQAAS-SLERDRVLDASLRRVDQFELYL  523

Query  408   aeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             +E KKAL+E+ +  +E+ AYIEKKKKKK  F F
Sbjct  524   SETKKALDETMTRLHEMTAYIEKKKKKKRKFLF  556



>ref|XP_008440764.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Cucumis melo]
 ref|XP_008440765.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Cucumis melo]
 ref|XP_008440766.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12 [Cucumis melo]
Length=579

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/594 (56%), Positives = 417/594 (70%), Gaps = 30/594 (5%)
 Frame = -2

Query  2052  MSGAVERPLRPSAEKMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSV  1882
             MSG V    +P+ E  DL+   D++ T +GS ++ A NAS+KFRHS   R RRSS+V S 
Sbjct  1     MSGPVFS--KPALEGSDLENSEDEKNTHIGSFKQKAANASSKFRHSMTRRGRRSSKVSSE  58

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
             +++D  + EE++SVDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQ
Sbjct  59    IIEDVRNTEEMQSVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQ  118

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRKEFGADTI++DF F+E D+VL YYPQGHHGVDK+GRP+YIE+LG VD  KLMQVT +D
Sbjct  119   WRKEFGADTILEDFVFEELDQVLDYYPQGHHGVDKEGRPVYIEKLGKVDPAKLMQVTDLD  178

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RYLKYHV+EFERT   K  +CSIA+K+HIDQSTTILDVQGVGLKNF K ARELI  LQK+
Sbjct  179   RYLKYHVREFERTFLVKFPACSIASKRHIDQSTTILDVQGVGLKNFNKTARELISRLQKV  238

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             DG+NYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIID+SEL
Sbjct  239   DGENYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSSEL  298

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKC--------SHRMARVEEEKT  1006
             P+FLGGTCTCAD+GGCMRSDKGPW D  I+KMV+ G HKC         H +  V++  T
Sbjct  299   PEFLGGTCTCADQGGCMRSDKGPWKDQNILKMVNNGNHKCLRECGDNEGHHLPDVKDVCT  358

Query  1005  IPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP--DMYVPMVDKTVDLPNW  832
             I      N     S             S     PI +  + P  +  VP+VDK+VD   W
Sbjct  359   ISPKHSFNHVEHRSL------------SPLPEVPITKNIQVPYNEDCVPVVDKSVDFA-W  405

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               V     K +    A  Y +  + +      ++ +  ++ F+MGI   VR+ + MP+KL
Sbjct  406   KTVPEK--KMLASSKAIDYALAGSVEAPGGLKSKFVASIVAFLMGISATVRLARTMPKKL  463

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
             T +++YS  ++  D  M    +   P   +   ++M+ +KRMA LEE+   L  +P  MP
Sbjct  464   TNASIYSKPVYCVDDPMFKGQSQGQPPLLLPLPDYMSTVKRMAELEERVNKLCVKPVDMP  523

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              EKEE+L   +SR++ALEQEL  +KK LEE+Q+ Q E+ AYIEKKKKK+ +  F
Sbjct  524   REKEELLKATISRVEALEQELIISKKVLEETQARQAEIFAYIEKKKKKRRLISF  577



>emb|CDY17469.1| BnaC03g65940D [Brassica napus]
Length=571

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 410/549 (75%), Gaps = 28/549 (5%)
 Frame = -2

Query  1980  TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDE  1807
              ++ SL+K AI+ASN+F++SFK +  R +SRVMSV ++D+ DAE+++++DAFRQAL+LDE
Sbjct  9     VKMCSLKKKAISASNRFKNSFKKKGRRSTSRVMSVPIEDDIDAEDLQALDAFRQALVLDE  68

Query  1806  LLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKY  1627
             LLP+K DD HMMLRFL+ARKF+I+K+KQMWADM+QWRK+FGADTII+DF+F+E D+V+K+
Sbjct  69    LLPSKLDDLHMMLRFLRARKFDIEKAKQMWADMIQWRKDFGADTIIEDFEFEEIDDVMKH  128

Query  1626  YPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAA  1447
             YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T   K  +CS+AA
Sbjct  129   YPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKIKFPACSVAA  188

Query  1446  KKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLW  1267
              KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+IINAGSGFRLLW
Sbjct  189   NKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFIINAGSGFRLLW  248

Query  1266  NTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWN  1087
             +TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKGGCMRSDKGPWN
Sbjct  249   STVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWN  308

Query  1086  DPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLF  907
             DPE++KM      KCS     + E++    D G + SV               ES ++  
Sbjct  309   DPEVLKMAINKEAKCSP----ISEDEHKHVDQGRSTSVP--------------ESLERNN  350

Query  906   PIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
               ++E    +  +  +DK++D   W V    +  F V KG + Y  + A K ++     L
Sbjct  351   KKRDEDNAHEKQIATIDKSMDTA-WPVKTQKSESFKVSKGLEGYVRKGAPKKRD---GLL  406

Query  726   LTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA-YKPPEPAVTAAE  550
             + GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   K + A +  P   V+++E
Sbjct  407   VGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESMSKQNKAQFAAP---VSSSE  463

Query  549   FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSN  370
             +M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL E KKALEE+  +
Sbjct  464   YMLMVKRMAELEDKCMFLDLKPANVDSEKEEKLQAALNRVQVLEQELTETKKALEEALVS  523

Query  369   QNELIAYIE  343
             Q E++AYIE
Sbjct  524   QKEILAYIE  532



>emb|CDX76291.1| BnaA08g11090D [Brassica napus]
Length=592

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 410/549 (75%), Gaps = 28/549 (5%)
 Frame = -2

Query  1980  TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDE  1807
              ++ SL+K AI+ASN+F++SFK +  R +SRVMSV ++D+ DAE+++++DAFRQAL+LDE
Sbjct  9     VKMCSLKKKAISASNRFKNSFKKKGRRSTSRVMSVPIEDDIDAEDLQALDAFRQALVLDE  68

Query  1806  LLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKY  1627
             LLP+K DD HMMLRFL+ARKF+I+K+KQMWADM+QWRK+FGADTII+DF+F+E D+V+K+
Sbjct  69    LLPSKLDDLHMMLRFLRARKFDIEKAKQMWADMIQWRKDFGADTIIEDFEFEEIDDVMKH  128

Query  1626  YPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAA  1447
             YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T   K  +CS+AA
Sbjct  129   YPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKIKFPACSVAA  188

Query  1446  KKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLW  1267
              KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+IINAGSGFRLLW
Sbjct  189   NKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFIINAGSGFRLLW  248

Query  1266  NTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWN  1087
             +TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKGGCMRSDKGPWN
Sbjct  249   STVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWN  308

Query  1086  DPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLF  907
             DPE++KM      KCS     + E++    D G + SV               ES ++  
Sbjct  309   DPEVLKMAINKEAKCSP----ISEDEHKHVDQGRSTSVP--------------ESLERNN  350

Query  906   PIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
               ++E    +  +  +DK++D   W V    +  F V KG + Y  + A K ++     L
Sbjct  351   KKRDEDNAHEKQIATIDKSMDTA-WPVKTQKSESFKVSKGLECYVRKGAPKKRD---GLL  406

Query  726   LTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA-YKPPEPAVTAAE  550
             + GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   K + A +  P   V+++E
Sbjct  407   VGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESMSKQNKAQFAAP---VSSSE  463

Query  549   FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSN  370
             +M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL E KKALEE+  +
Sbjct  464   YMLMVKRMAELEDKCMFLDLKPANVDSEKEEKLQAALNRVQVLEQELTETKKALEEALVS  523

Query  369   QNELIAYIE  343
             Q E++AYIE
Sbjct  524   QKEILAYIE  532



>ref|XP_010437024.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 isoform X2 [Camelina sativa]
Length=556

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/569 (57%), Positives = 410/569 (72%), Gaps = 40/569 (7%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D D R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDDKRLTKLVSLKKKAINATNKFKHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRKE+GADTI++DFDFKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKEYGADTIMEDFDFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIERLG VDATKL++VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIERLGQVDATKLLKVTTIDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FRL+W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRLVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C  R     EEKTI E               +K   F+ E 
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRRSLSGIEEKTISE----------YKNETQKCEPFEAEE  370

Query  921   TKKLFPIQEETRQPDMYVPMVDKTVDLPNWHV-VNNDNCKFVVPKGADLYQIQEAYKGQE  745
             T K    ++E +        +DKTVD  +W   ++  N    VP+  D+Y   +      
Sbjct  371   TNKESAGEKEKK-------FIDKTVDAADWPTKLHKANKNLPVPEPKDVYSPVDP-----  418

Query  744   LASNQLLTG-VMTFVMGIVTMVRMTKNMPRKLTESTLYS---NSMHLNDHAMKGHGAYKP  577
             L     L+G VM  +M IV ++R+TKNMPR+LTE+ +YS    S++ ND           
Sbjct  419   LERKGYLSGSVMALLMAIVGVMRLTKNMPRRLTEANVYSREGGSVYQNDGV---------  469

Query  576   PEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                 ++  E+MAM+K+M  LEEK  ++  Q  +   E++ +L  ++ R+D  E  L+E K
Sbjct  470   --TVMSRQEYMAMLKKMTDLEEKCKSMEAQAAS-SLERDRVLDASLRRVDQFELYLSETK  526

Query  396   kaleesqSNQNELIAYIEkkkkkKNIFGF  310
             KAL+E+ +  +E+ AYIEKKKKKK  F F
Sbjct  527   KALDETMTRLHEMTAYIEKKKKKKRKFLF  555



>ref|XP_009108721.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X1 [Brassica rapa]
Length=556

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/575 (57%), Positives = 427/575 (74%), Gaps = 33/575 (6%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++D+  ++R+  ++ SL+K AI+ASN+F++SFK +  R +SRVMSV ++D+ DAE+++++
Sbjct  7     EIDMSEEERKIVKMCSLKKKAISASNRFKNSFKKKGRRSTSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMWADM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWADMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F E D+V+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFDEIDDVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  +CS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KIKFPACSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++KM      KCS     + E++    D G + SV           
Sbjct  307   GCMRSDKGPWNDPEVLKMAINKEAKCSP----ISEDEHKHVDQGRSTSVP----------  352

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKF---VVPKGADLYQI  769
                 ES ++    ++E    +  +  +DK++D   W V    +  F    VP G + Y  
Sbjct  353   ----ESLERNNKKRDEDNAHEKQIATIDKSMDTA-WPVKTQKSESFKVSKVPVGLEGYVR  407

Query  768   QEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG  589
             + A K ++     L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   K + 
Sbjct  408   KGAPKKRD---GLLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESMSKQNK  464

Query  588   A-YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqe  412
             A +  P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQE
Sbjct  465   AQFAAP---VSSSEYMLMVKRMAELEDKCMFLDLKPANVDSEKEEKLQAALNRVQVLEQE  521

Query  411   laeakkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
             L E KKALEE+  +Q E++AYIEKKKKKK + FGF
Sbjct  522   LTETKKALEEALVSQKEILAYIEKKKKKKKLFFGF  556



>ref|XP_010467630.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10 isoform X3 [Camelina sativa]
Length=476

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/482 (61%), Positives = 352/482 (73%), Gaps = 31/482 (6%)
 Frame = -2

Query  1773  MLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKD  1594
             M RFLKARKF+++K+KQMW+DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+
Sbjct  1     MCRFLKARKFDLEKTKQMWSDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKE  60

Query  1593  GRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTIL  1414
             GRP+YIERLG VD+TKLMQVTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTIL
Sbjct  61    GRPVYIERLGQVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTIL  120

Query  1413  DVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKT  1234
             DVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKT
Sbjct  121   DVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKT  180

Query  1233  TAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQG  1054
             TAKI+VLGNKYQSKLLEIIDASELP+FLGG+CTCAD GGCMRSDKGPWN+P+IMK V+ G
Sbjct  181   TAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNG  240

Query  1053  AHKCSHR--MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP  880
              HKCS R       E  T  ED                     I  +K      EE  + 
Sbjct  241   DHKCSKRSQAENAAENTTFEED---------------------IVHSKGNDSTAEEALET  279

Query  879   D--MYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMT  709
             D     P  +  V  P W++   +  KF + +G D+Y IQEA K   E+  + + TGVM 
Sbjct  280   DHSQLSPCQNVVVAHPAWNI--PEAHKFSISQG-DVYAIQEACKATNEIGRSPVFTGVMA  336

Query  708   FVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKR  529
             FVMG+ TM+R+TKN+PRKLTESTLYS  ++ +D +      +      ++  +FMA MKR
Sbjct  337   FVMGVFTMIRVTKNVPRKLTESTLYSTPVYCDDKSTNKSSMHST--ATISGEDFMAFMKR  394

Query  528   MASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAY  349
             +A LE K   LS QP TMPPEKEEML+ A+S+ D LEQEL+  KKAL++S   Q +L+AY
Sbjct  395   LAELEHKVTILSAQPATMPPEKEEMLNAAISQFDVLEQELSATKKALDDSLGRQEDLVAY  454

Query  348   IE  343
             IE
Sbjct  455   IE  456



>ref|XP_004150001.1| PREDICTED: uncharacterized protein LOC101208423 [Cucumis sativus]
Length=579

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/590 (55%), Positives = 412/590 (70%), Gaps = 38/590 (6%)
 Frame = -2

Query  2025  RPSAEKMDLD--ADDRQTRLGSLR-KAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAE  1855
             +P+ E  DL+   D++ T +GS + KAA  +S       +  RRSS+V SVV++D  + +
Sbjct  8     KPALEGSDLENSEDEKNTSIGSFKQKAAHASSKFRHSMTRRGRRSSKVSSVVIEDVRNTD  67

Query  1854  EVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADT  1675
             E+++VDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFGADT
Sbjct  68    EMQAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDIEKTKQMWSDMLQWRKEFGADT  127

Query  1674  IIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQE  1495
             I++DF F+E D+VL YYPQGHHGVDK+GRP+YIE+LG VD TKLMQVT +DRYLKYHV+E
Sbjct  128   ILEDFVFEELDQVLDYYPQGHHGVDKEGRPVYIEKLGKVDPTKLMQVTDLDRYLKYHVRE  187

Query  1494  FERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETL  1315
             FE+T   K  +CSIA+K+HIDQSTTILDVQGVGLKNF K ARELI  LQK+DG+NYPETL
Sbjct  188   FEKTFLVKFPACSIASKRHIDQSTTILDVQGVGLKNFNKTARELISRLQKVDGENYPETL  247

Query  1314  CRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCT  1135
              RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEIID+SELP+FLGGTCT
Sbjct  248   NRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSSELPEFLGGTCT  307

Query  1134  CADKGGCMRSDKGPWNDPEIMKMVHQGAHKC--------SHRMARVEEEKTIPEDGGVNv  979
             CAD+GGCMRSDKGPW D  I+KMV+ G HKC         H +  V++  TI      N 
Sbjct  308   CADQGGCMRSDKGPWKDLNILKMVNNGNHKCLMECGDNEGHHLPDVKDVCTISPKHSFNH  367

Query  978   svsmsaksvkkpaSFKIESTKKLFPIQEETRQP--DMYVPMVDKTVDLPNWHVVNNDNCK  805
                 S             S+    PI +  + P  +  V ++DK VD   W  V      
Sbjct  368   VEHQSL------------SSLPEVPITKNIQVPYNEDCVRVIDKNVDFA-WKTVPEKKM-  413

Query  804   FVVPKGAD--LYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYS  631
                 K  D  L    EA  G +    + +  ++ F+MGI   VR+ + MP+KLT +++YS
Sbjct  414   LASSKAIDCGLAGSVEAPGGLKF---KFVANIVAFLMGISATVRLARTMPKKLTNASIYS  470

Query  630   NSMHLNDHAM-KGHGAYKPP--EPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKE  460
             N ++  D  M KG    +PP  +P     ++M+ +KRMA LEE+   L  +PP MP EKE
Sbjct  471   NPVYCADDPMYKGQCQGQPPLLQP---LPDYMSTVKRMAELEERVNKLCIKPPDMPREKE  527

Query  459   EMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             E+L   ++R++ALEQEL  +KK LEE+ + Q E+ AYIEKKKKK+ +  F
Sbjct  528   ELLKATITRVEALEQELIVSKKVLEETMARQAEIFAYIEKKKKKRRLIPF  577



>ref|XP_010414018.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH10-like isoform X2 [Camelina sativa]
Length=476

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 356/482 (74%), Gaps = 31/482 (6%)
 Frame = -2

Query  1773  MLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKD  1594
             M RFLKARKF+++K+KQMW+DML WRKEFGADTI++DF+FKE DEVLKYYP GHHGVDK+
Sbjct  1     MCRFLKARKFDLEKTKQMWSDMLLWRKEFGADTIMEDFEFKEIDEVLKYYPHGHHGVDKE  60

Query  1593  GRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTIL  1414
             GRP+YIERLG VD+TKLMQVTTMDRY+ YHV EFERT N K  +CSIAAKKHIDQSTTIL
Sbjct  61    GRPVYIERLGQVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTIL  120

Query  1413  DVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKT  1234
             DVQGVGLKNF K AR+LI  LQK+DGDNYPETL RM+IINAGSGFR+LW+TVKSFLDPKT
Sbjct  121   DVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWSTVKSFLDPKT  180

Query  1233  TAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQG  1054
             TAKI+VLGNKYQSKLLEIIDA+ELP+FLGG+CTCA+ GGCMRSDKGPWN+P+IMK V+ G
Sbjct  181   TAKIHVLGNKYQSKLLEIIDATELPEFLGGSCTCAENGGCMRSDKGPWNNPDIMKRVNNG  240

Query  1053  AHKCSHR--MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP  880
              HKCS R       E  T  ED                     I  +K      EE  + 
Sbjct  241   DHKCSKRSQAENAAENTTFEED---------------------IVHSKGNDSAAEEALET  279

Query  879   D--MYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG-QELASNQLLTGVMT  709
             D     P  +  V  P W++   +  KF + KG D+Y IQEA K   E+  + + TGVM 
Sbjct  280   DHSQLSPCQNVVVAHPAWNI--PEAHKFSISKG-DVYAIQEACKATNEIGRSPVFTGVMA  336

Query  708   FVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKR  529
             FVMG+ TM+R+TKN+PRKLTESTLYS  ++ ++++M  + +       ++  +FMA MKR
Sbjct  337   FVMGVFTMIRVTKNVPRKLTESTLYSTPVYCDNNSM--NKSLMQSTSTISGEDFMAFMKR  394

Query  528   MASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAY  349
             MA LE K   LS QP TMPPEKEEML+ A+S++D LEQELA  KKAL++S   Q +L+AY
Sbjct  395   MAELEHKVNILSAQPATMPPEKEEMLNAAISQVDVLEQELAATKKALDDSLGRQKDLVAY  454

Query  348   IE  343
             IE
Sbjct  455   IE  456



>ref|XP_010548065.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 [Tarenaya hassleriana]
Length=562

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/589 (57%), Positives = 429/589 (73%), Gaps = 35/589 (6%)
 Frame = -2

Query  2052  MSGAVERPL-RPSAEKMDLDADDRQT-RLGSLRKAAINAsnkfrhsfk--srrrssRVMS  1885
             M+ A+  PL R +   +++  DD++  ++ S +K A+NASNKF++SFK   RR SSRV+S
Sbjct  1     MADALSGPLDRQTKTNVEMSEDDKKVMKICSFKKKAMNASNKFKNSFKKKVRRSSSRVIS  60

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
               ++D+ DAEE++S+DAFRQALILDELLP+KHDD HMMLRFL+ARKF+I+K+KQMWADM+
Sbjct  61    APIEDDIDAEELQSLDAFRQALILDELLPSKHDDLHMMLRFLRARKFDIEKAKQMWADMI  120

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
             QWRK+FGADTII+DF+FKE DEVLKYYPQG+HGVDK+GRPIYIERLG +DA KL+QVTTM
Sbjct  121   QWRKDFGADTIIEDFEFKEIDEVLKYYPQGYHGVDKEGRPIYIERLGQIDANKLLQVTTM  180

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DRY+KYHV+EFE+T   K  +CS AAKKHIDQSTTILDVQGVGLKNF+K AR+++Q + K
Sbjct  181   DRYVKYHVKEFEKTFKIKFPACSAAAKKHIDQSTTILDVQGVGLKNFSKSARDILQRILK  240

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
              D DNYPETL +MYIINAGSGFRLLWNTVKSFLD KTTAKI+VLGNKYQSKLLE IDA+E
Sbjct  241   TDNDNYPETLNKMYIINAGSGFRLLWNTVKSFLDAKTTAKIHVLGNKYQSKLLEAIDANE  300

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGV  985
             LP+FLGGTCTC+DKGGCMRSDKGPWNDP+++KM      KC   +   E+E    E G  
Sbjct  301   LPEFLGGTCTCSDKGGCMRSDKGPWNDPDVLKMDKNREAKC---LTISEDEHKSVEQGKY  357

Query  984   NvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCK  805
             +    +  +             K +  + E   +P      VDK +D+  W   ++    
Sbjct  358   SSLPELPER----------NKNKTVSEMCENRIKP------VDKPMDMA-WPAKSHQTEN  400

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLT-GVMTFVMGIVTMVRMTKNMPRKLTESTLYSN  628
             F  P   D Y      KG  +  +  L  GV+ FVMGIV MVR++K+MPRKLTE+ LY  
Sbjct  401   F--PVTGDRY----LRKGSPMKGDGFLVGGVIAFVMGIVAMVRLSKDMPRKLTEAALYGT  454

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP-TMPPEKEEML  451
             S++  + ++      + P P V+++EF+ M+KRMA LE+K   L ++P   +  EK+E L
Sbjct  455   SVYYEESSVSRQNQTQFPAP-VSSSEFILMVKRMAELEDKCKFLDSKPTNVVADEKDEKL  513

Query  450   SNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKN--IFGF  310
               A++R+ ALEQEL+E KKAL+E+ ++Q E++AYIEKKKKKK    FGF
Sbjct  514   QAALNRVQALEQELSETKKALDEALASQKEILAYIEKKKKKKKKLFFGF  562



>ref|XP_010255184.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Nelumbo nucifera]
Length=575

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/546 (58%), Positives = 390/546 (71%), Gaps = 71/546 (13%)
 Frame = -2

Query  1971  GSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTK  1792
             GSL+K ++NAS+ FR+S   R     VMS+ +DD  DAEE+++V+AFRQALILDELLP+K
Sbjct  86    GSLKKKSLNASSMFRNSLTRRSSR--VMSISIDDSMDAEELQAVEAFRQALILDELLPSK  143

Query  1791  HDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGH  1612
             HDDYHMMLRFLKARKF+++K+KQMWADM+QWRKEFGADTI+++F+F+E +EVL+ YPQGH
Sbjct  144   HDDYHMMLRFLKARKFDVEKTKQMWADMVQWRKEFGADTIMEEFEFEELNEVLEQYPQGH  203

Query  1611  HGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHID  1432
             HGVDK+G P+YIE+LG VD  KLMQVT MDRY+KYHV+EFER    K  +CSIA KKHID
Sbjct  204   HGVDKEGHPVYIEKLGQVDPVKLMQVTNMDRYVKYHVREFERNFAVKFPACSIAVKKHID  263

Query  1431  QSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKS  1252
             QSTTILDVQGVGLKNF K AR+LI  LQKIDGDNYPETLCRM+IINAGSGFRLLWNT+K+
Sbjct  264   QSTTILDVQGVGLKNFNKAARDLIVRLQKIDGDNYPETLCRMFIINAGSGFRLLWNTIKT  323

Query  1251  FLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCAD-KGGCMRSDKGPWNDPEI  1075
             FLDPKTTAKI+VLGNK+QSKLLE+IDASELP+FLGGTCTCAD +GGCMRSDKGPW DPEI
Sbjct  324   FLDPKTTAKIHVLGNKFQSKLLEVIDASELPEFLGGTCTCADHEGGCMRSDKGPWKDPEI  383

Query  1074  MKMVHQGAHKCSHRMARVEEEKT--IPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPI  901
             +KM+  G   C  ++    E +   I ED                      E     FP+
Sbjct  384   LKMIQDGVAVCKKKITTTTETEEKMISED----------------------EIDNSCFPV  421

Query  900   QEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLT  721
                                        ND CK      A  Y  +  + G       ++T
Sbjct  422   ---------------------------NDACK------APEYDNKHIFTG-------IMT  441

Query  720   GVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMA  541
              VM    G+VTMVR+T++MP+K+T++TLYS+ ++ ND  +KG    +   PA+++ E+++
Sbjct  442   FVM----GLVTMVRLTRSMPKKITDATLYSSPLYCNDTIIKGQPHQQLSGPAISSTEYLS  497

Query  540   MMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNE  361
             +MKRMA LEEK   LS +P TMPPEKEE L+ A+SRI+ALEQEL   KKALE+S + Q E
Sbjct  498   IMKRMAELEEKVNVLSTKPETMPPEKEEKLNAALSRIEALEQELMSTKKALEDSLAKQEE  557

Query  360   LIAYIE  343
              +AYIE
Sbjct  558   CLAYIE  563



>ref|XP_004170475.1| PREDICTED: uncharacterized LOC101208423, partial [Cucumis sativus]
Length=593

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/604 (54%), Positives = 414/604 (69%), Gaps = 38/604 (6%)
 Frame = -2

Query  2067  CSAGNMSGAVERPLRPSAEKMDLD--ADDRQTRLGSLR-KAAINAsnkfrhsfksrrrss  1897
             C  G      E+    S E  DL+   D++ T +GS + KAA  +S       +  RRSS
Sbjct  8     CQLGFRKNVHEKMDEISLEGSDLENSEDEKNTSIGSFKQKAAHASSKFRHSMTRRGRRSS  67

Query  1896  RVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMW  1717
             +V SVV++D  + +E+++VDAFRQALIL+ELLP KHDDYHMMLRFLKARKF+I+K+KQMW
Sbjct  68    KVSSVVIEDVRNTDEMQAVDAFRQALILEELLPAKHDDYHMMLRFLKARKFDIEKTKQMW  127

Query  1716  ADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQ  1537
             +DMLQWRKEFGADTI++DF F+E D+VL YYPQGHHGVDK+GRP+YIE+LG VD TKLMQ
Sbjct  128   SDMLQWRKEFGADTILEDFVFEELDQVLDYYPQGHHGVDKEGRPVYIEKLGKVDPTKLMQ  187

Query  1536  VTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQ  1357
             VT +DRYLKYHV+EFE+T   K  +CSIA+K+HIDQSTTILDVQGVGLKNF K ARELI 
Sbjct  188   VTDLDRYLKYHVREFEKTFLVKFPACSIASKRHIDQSTTILDVQGVGLKNFNKTARELIS  247

Query  1356  ALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEII  1177
              LQK+DG+NYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VLGNKYQSKLLEII
Sbjct  248   RLQKVDGENYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEII  307

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKC--------SHRMARV  1021
             D+SELP+FLGGTCTCAD+GGCMRSDKGPW D  I+KMV+ G HKC         H +  V
Sbjct  308   DSSELPEFLGGTCTCADQGGCMRSDKGPWKDLNILKMVNNGNHKCLRECGDNEGHHLPDV  367

Query  1020  EEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQP--DMYVPMVDKTV  847
             ++  TI      N     S             S+    PI +  + P  +  V ++DK V
Sbjct  368   KDVCTISPKHSFNHVEHQSL------------SSLPEVPITKNIQVPYNEDCVRVIDKNV  415

Query  846   DLPNWHVVNNDNCKFVVPKGAD--LYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMT  673
             D   W  V          K  D  L    EA  G +    + +  ++ F+MGI   VR+ 
Sbjct  416   DFA-WKTVPEKKM-LASSKAIDCGLAGSVEAPGGLKF---KFVANIVAFLMGISATVRLA  470

Query  672   KNMPRKLTESTLYSNSMHLNDHAM-KGHGAYKPP--EPAVTAAEFMAMMKRMASLEEKFI  502
             + MP+KLT +++YSN ++  D  M KG    +PP  +P     ++M+ +KRMA LEE+  
Sbjct  471   RTMPKKLTNASIYSNPVYCADDPMYKGQCQDQPPLLQP---LPDYMSTVKRMAELEERVN  527

Query  501   TLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKN  322
              L  +PP MP EKEE+L   ++R++ALEQEL  +KK LEE+ + Q E+ AYIEKKKKK+ 
Sbjct  528   KLCIKPPDMPREKEELLKATITRVEALEQELIVSKKVLEETMARQAEIFAYIEKKKKKRR  587

Query  321   IFGF  310
             +  F
Sbjct  588   LIPF  591



>ref|NP_195629.2| protein SECRETION 14 [Arabidopsis thaliana]
 sp|F4JVA9.1|SFH2_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
2; Short=AtSFH2 [Arabidopsis thaliana]
 gb|AEE87033.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=554

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/557 (57%), Positives = 396/557 (71%), Gaps = 44/557 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQALI
Sbjct  23    DKRLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVACVSIVDEIDTEELQAVDAFRQALI  82

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW+DML WRKE+GADTI++DFDFKE +EV
Sbjct  83    LDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEV  142

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +CS
Sbjct  143   VKYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACS  202

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  203   IAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGFR  262

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQ+KLLEIIDA+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  263   LLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIIDANELPEFLGGKCTCADKGGCMRSDKG  322

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  R     EEKTI E                    +  E+ K
Sbjct  323   PWNDPEIFKLVQNGEGRCLRRSLSGIEEKTIFE--------------------YNNETKK  362

Query  915   KLFPIQEETRQ---PDMYVPMVDKTVD---LPNWHVVNNDNCKFVVPKGADLYQIQEAYK  754
             K  P  EET +    +M    +D  VD     +W    N   K       DL  +  A  
Sbjct  363   KCEP--EETHKQSAAEMEKKFIDTNVDAAAAADWPTKLNKAEK----NPTDLKDVYSAVN  416

Query  753   GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPP  574
               E     L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   Y+  
Sbjct  417   PLE-RKGYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGSAVYQDG  466

Query  573   EPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
                ++  E++AM+K++  LEEK  ++  Q      E+E+ L  A+ RID LE +L+E  K
Sbjct  467   VTVMSKQEYIAMVKKITDLEEKCKSMEAQ-AAFYMEREKTLDAALRRIDQLELQLSETNK  525

Query  393   aleesqSNQNELIAYIE  343
             AL+E+ + Q+E++A+IE
Sbjct  526   ALDETMTRQHEIMAFIE  542



>gb|KEH36368.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=544

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/495 (59%), Positives = 361/495 (73%), Gaps = 33/495 (7%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMS+ ++D  DAEE+++VDA RQ LIL+ELLP+KHDD HMMLRFL+ARK++I+K+KQMW 
Sbjct  58    VMSICIEDSFDAEELQAVDALRQTLILEELLPSKHDDPHMMLRFLRARKYDIEKTKQMWT  117

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DML+WRKEFGADTI++DF+F+E DEVLK YPQGHHGVDKDGRP+YIERLG VD  KL+QV
Sbjct  118   DMLKWRKEFGADTIMEDFEFEELDEVLKCYPQGHHGVDKDGRPVYIERLGQVDCNKLLQV  177

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+++RYLKYHV+EFER    K+ +CSIAAKKHIDQSTTILDVQGVGL++  K AR+L+Q 
Sbjct  178   TSVERYLKYHVREFERAFAVKLPACSIAAKKHIDQSTTILDVQGVGLRSMNKAARDLLQR  237

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDNYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLE+ID
Sbjct  238   LQKIDGDNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEVID  297

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             ASELP+FLGGTCTCADKGGCM SDKGPWNDPEI+KM   G  + + +     EEKTI ++
Sbjct  298   ASELPEFLGGTCTCADKGGCMLSDKGPWNDPEILKMAQNGVGRYTIKALSGVEEKTIKQE  357

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKL------FPIQEETRQPDMYVPMVDKTVDLPNW  832
                                FK    + L       P      Q D +VP++DK VD    
Sbjct  358   ------------ETAYQKGFKDSFPETLDVHCLDQPKSYGVYQYDSFVPVLDKAVDSSWK  405

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               + ND  K+ + K  D +            S Q + G+M  VMGIVT++RMT +MPRK+
Sbjct  406   KTIQND--KYALSK--DCFSNNNGMNSSGF-SKQFVGGIMALVMGIVTIIRMTSSMPRKI  460

Query  651   TESTLY-SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTM  475
             TE+ LY  NS++ +   +K          A++  E+MAMMKRMA LEEK   LS + P M
Sbjct  461   TEAALYGGNSVYYDGSMIKA--------AAISNNEYMAMMKRMAELEEKVTVLSVK-PVM  511

Query  474   PPEKEEMLSNAMSRI  430
             PPEKEEML+NA++R+
Sbjct  512   PPEKEEMLNNALTRV  526



>gb|KHN41942.1| Sec14 cytosolic factor [Glycine soja]
Length=508

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/523 (58%), Positives = 362/523 (69%), Gaps = 59/523 (11%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D HDAEE+K VD FRQALILDELLP KHDDYHMMLRFLKARKF+I+K+KQMW+
Sbjct  16    VMSVEIEDVHDAEELKIVDEFRQALILDELLPAKHDDYHMMLRFLKARKFDIEKTKQMWS  75

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             +ML+WRKEFGADTI +DF+FKE DEVL+YYPQGHHGVDKDGRP+YIERLG VDATK+MQV
Sbjct  76    EMLKWRKEFGADTITEDFEFKELDEVLQYYPQGHHGVDKDGRPVYIERLGQVDATKMMQV  135

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TTMDRY+KYHV+EFERT + K ++CSIAAKKHIDQSTTILDVQGVGLK+F+K AREL+  
Sbjct  136   TTMDRYIKYHVKEFERTFDVKFAACSIAAKKHIDQSTTILDVQGVGLKSFSKHARELVTR  195

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKINVLGNKY +KLLEIID
Sbjct  196   LQKIDGDNYPETLNRMFIINAGSGFRILWNTVKSFLDPKTTAKINVLGNKYDTKLLEIID  255

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             ASELP+FLGGTCTCAD+GGCMRSDKGPW D E+M+MV  G HKCS + A           
Sbjct  256   ASELPEFLGGTCTCADQGGCMRSDKGPWKDAEVMRMVQNGDHKCSKKSAS----------  305

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE------TRQPDMYVPMVDKTVDLPNW  832
                            K +  +   T +L P+ EE      T QP    PM DK+      
Sbjct  306   ---QGEEEKENSEEHKTSKLEANHTPQLSPVVEEEVPATKTSQP--LSPMADKS------  354

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
                          K  D    ++A K ++LA     T   T ++ +   V +   +  K+
Sbjct  355   -----------AVKKVD----EKASKPKDLAPTADKTAASTVII-MSECVHVVWGICIKV  398

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
                 L  N                 P  A + AEF  +MKRMA LEEK +T++N+P  MP
Sbjct  399   CAQWLLINL----------------PATAFSRAEFSTVMKRMAELEEKIVTINNKPTAMP  442

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             PEKE+ML+  ++R D LE++L   KKALE+S   Q EL AY++
Sbjct  443   PEKEQMLNATITRADDLEKQLLATKKALEDSLVKQEELSAYLD  485



>ref|NP_001190963.1| protein SECRETION 14 [Arabidopsis thaliana]
 gb|AEE87034.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=553

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/557 (57%), Positives = 394/557 (71%), Gaps = 45/557 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQALI
Sbjct  23    DKRLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVACVSIVDEIDTEELQAVDAFRQALI  82

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW+DML WRKE+GADTI++DFDFKE +EV
Sbjct  83    LDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEV  142

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +CS
Sbjct  143   VKYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACS  202

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  203   IAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGFR  262

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQ+KLLEIIDA+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  263   LLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIIDANELPEFLGGKCTCADKGGCMRSDKG  322

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  R     EEKTI E                         TK
Sbjct  323   PWNDPEIFKLVQNGEGRCLRRSLSGIEEKTIFEYNN---------------------ETK  361

Query  915   KLFPIQEETRQ---PDMYVPMVDKTVD---LPNWHVVNNDNCKFVVPKGADLYQIQEAYK  754
             K  P  EET +    +M    +D  VD     +W    N   K       DL  +  A  
Sbjct  362   KCEP--EETHKQSAAEMEKKFIDTNVDAAAAADWPTKLNKAEK----NPTDLKDVYSAVN  415

Query  753   GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPP  574
               E     L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   Y+  
Sbjct  416   PLE-RKGYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGSAVYQDG  465

Query  573   EPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
                ++  E++AM+K++  LEEK  ++  Q      E+E+ L  A+ RID LE +L+E  K
Sbjct  466   VTVMSKQEYIAMVKKITDLEEKCKSMEAQ-AAFYMEREKTLDAALRRIDQLELQLSETNK  524

Query  393   aleesqSNQNELIAYIE  343
             AL+E+ + Q+E++A+IE
Sbjct  525   ALDETMTRQHEIMAFIE  541



>ref|NP_001045802.1| Os02g0133200 [Oryza sativa Japonica Group]
 dbj|BAD08000.1| putative phosphatidylinositol/ phophatidylcholine transfer protein 
[Oryza sativa Japonica Group]
 dbj|BAF07716.1| Os02g0133200 [Oryza sativa Japonica Group]
 dbj|BAG94817.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72423.1| hypothetical protein OsI_05741 [Oryza sativa Indica Group]
Length=632

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/546 (55%), Positives = 377/546 (69%), Gaps = 35/546 (6%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D  DAEE+KSVDAFRQ L+L+ELLP +HDDYHMMLRFL+ARKF+IDKSKQMW+
Sbjct  79    VMSVSIEDVRDAEEMKSVDAFRQTLVLEELLPARHDDYHMMLRFLRARKFDIDKSKQMWS  138

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFG+DTI+DDF F+E D+VL++YPQGHHGVD+DGRP+YIE+LG +D  KL+QV
Sbjct  139   DMLQWRKEFGSDTILDDFQFEEMDQVLEHYPQGHHGVDRDGRPVYIEKLGAIDTAKLLQV  198

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+MDRY+KYHV+EFER    K  +CSIAAK+H+DQSTTILDV GVG KNF K AR+LI  
Sbjct  199   TSMDRYVKYHVREFERAFAVKFPACSIAAKRHVDQSTTILDVSGVGYKNFNKAARDLIGR  258

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID
Sbjct  259   LQKVDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVID  318

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEE--EKTIP  1000
              SELP+FLGGTCTC  +GGCMRSDKGPW DPEI+KMV  G  +C    +   E  EK I 
Sbjct  319   PSELPEFLGGTCTC--EGGCMRSDKGPWKDPEIIKMVQCGMGRCGFNSSGHTEADEKMIT  376

Query  999   EDGGVNvsvsmsaksvkkpaSFKIESTK----KLFPIQE----ETRQP----------DM  874
             ED  V +     +       S KI   K    ++ P+ E    E++ P          D 
Sbjct  377   EDDIVAIPKKQESIRRDSVDSPKIPREKIEHPQMSPLHEMSTSESKAPPGQEGSSSRYDD  436

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMG  697
               PM DK +D  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVMG
Sbjct  437   LFPMPDKNMDF-NW---NGEVSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVMG  492

Query  696   IVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK--------PPEPAVTAAEFMA  541
             +V M R+ K  P++  ++ +   +M       K     +        P    V+ A++ A
Sbjct  493   VVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLMQQQQRQLEQLPGPDTVTVSTAQYEA  552

Query  540   MMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNE  361
             ++KR+  LEEK   L+++PP MP +KE++L  A++R++ALE EL   KK LE S   Q E
Sbjct  553   LIKRLGDLEEKVAALTSRPPEMPADKEDLLKAAVTRVEALETELESTKKLLETSSGQQEE  612

Query  360   LIAYIE  343
             ++AYIE
Sbjct  613   VLAYIE  618



>ref|XP_003603966.1| Sec14 cytosolic factor [Medicago truncatula]
 gb|AES74217.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=569

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/495 (59%), Positives = 361/495 (73%), Gaps = 33/495 (7%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMS+ ++D  DAEE+++VDA RQ LIL+ELLP+KHDD HMMLRFL+ARK++I+K+KQMW 
Sbjct  58    VMSICIEDSFDAEELQAVDALRQTLILEELLPSKHDDPHMMLRFLRARKYDIEKTKQMWT  117

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DML+WRKEFGADTI++DF+F+E DEVLK YPQGHHGVDKDGRP+YIERLG VD  KL+QV
Sbjct  118   DMLKWRKEFGADTIMEDFEFEELDEVLKCYPQGHHGVDKDGRPVYIERLGQVDCNKLLQV  177

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+++RYLKYHV+EFER    K+ +CSIAAKKHIDQSTTILDVQGVGL++  K AR+L+Q 
Sbjct  178   TSVERYLKYHVREFERAFAVKLPACSIAAKKHIDQSTTILDVQGVGLRSMNKAARDLLQR  237

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDNYPE+L RM+IINAGSGFRLLWNTVKSFLDPKTT+KI+VLGNKYQSKLLE+ID
Sbjct  238   LQKIDGDNYPESLNRMFIINAGSGFRLLWNTVKSFLDPKTTSKIHVLGNKYQSKLLEVID  297

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED  994
             ASELP+FLGGTCTCADKGGCM SDKGPWNDPEI+KM   G  + + +     EEKTI ++
Sbjct  298   ASELPEFLGGTCTCADKGGCMLSDKGPWNDPEILKMAQNGVGRYTIKALSGVEEKTIKQE  357

Query  993   GGVNvsvsmsaksvkkpaSFKIESTKKL------FPIQEETRQPDMYVPMVDKTVDLPNW  832
                                FK    + L       P      Q D +VP++DK VD    
Sbjct  358   ------------ETAYQKGFKDSFPETLDVHCLDQPKSYGVYQYDSFVPVLDKAVDSSWK  405

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
               + ND  K+ + K  D +            S Q + G+M  VMGIVT++RMT +MPRK+
Sbjct  406   KTIQND--KYALSK--DCFSNNNGMNSSGF-SKQFVGGIMALVMGIVTIIRMTSSMPRKI  460

Query  651   TESTLY-SNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTM  475
             TE+ LY  NS++ +   +K          A++  E+MAMMKRMA LEEK   LS + P M
Sbjct  461   TEAALYGGNSVYYDGSMIKA--------AAISNNEYMAMMKRMAELEEKVTVLSVK-PVM  511

Query  474   PPEKEEMLSNAMSRI  430
             PPEKEEML+NA++R+
Sbjct  512   PPEKEEMLNNALTRV  526



>ref|XP_010431881.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X1 [Camelina sativa]
 ref|XP_010431882.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X1 [Camelina sativa]
Length=557

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/562 (56%), Positives = 398/562 (71%), Gaps = 47/562 (8%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D D R T+L SL+K AINA+NKFRHS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDDKRLTKLVSLKKKAINATNKFRHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW DML WRKE+GADTI++DFDFKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDMEKAKQMWGDMLNWRKEYGADTIMEDFDFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIE LG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIEGLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FR +W+TVKSFLDPKTTAKI+VLGNKYQS LLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRFVWSTVKSFLDPKTTAKIHVLGNKYQSTLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C        EEKTI E                    +K E+
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRWSLLGIEEKTISE--------------------YKNET  360

Query  921   TKKLFPIQ-EETRQP---DMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQ  766
              KK  P + EET +    +     +DKTVD  +W    H  NN+     VP+  D+Y   
Sbjct  361   QKKCEPFEAEETNKESAGEKEKKFIDKTVDAADWPTKLHKANNN---LPVPEPKDVYSAV  417

Query  765   EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
             +  + +      L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   
Sbjct  418   DPLERK----GYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGGSV  464

Query  585   YKPPEPAVTA-AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             Y+     V +  E+MAM+K+M  LEEK  ++  Q      E++ +L  ++ R+D  E  L
Sbjct  465   YQDDGVTVMSRQEYMAMLKKMTDLEEKCKSMEAQ-AAFSLERDRVLDASLCRVDQFELYL  523

Query  408   aeakkaleesqSNQNELIAYIE  343
             +E KKAL+E+ +  +E+ AYIE
Sbjct  524   SETKKALDETMTRLHEMSAYIE  545



>ref|XP_010446449.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X2 [Camelina sativa]
Length=556

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/562 (56%), Positives = 397/562 (71%), Gaps = 48/562 (9%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D + R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDEKRLTKLVSLKKKAINATNKFKHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRKE+GADTI++DF+FKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKEYGADTIMEDFEFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTVDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FR +W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRFVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C        EEKTI E                         
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRSSLSDIEEKTISESKN---------------------Q  359

Query  921   TKKLFPIQ-EETRQP---DMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQ  766
             TKK  P + EET +    +     +DKT+D  +W    H  NN+     VP+  D+    
Sbjct  360   TKKCEPCEAEETYKESAGEKEKRFIDKTMDAADWPTKLHKANNN---LPVPEPKDVNSAV  416

Query  765   EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
             +  + +      L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   
Sbjct  417   DPLERK----GYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGGSV  463

Query  585   YKPPEPAV-TAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             Y+     V +  E+MAM+K+M  LEEK  +L  Q      E++ +L  ++ R+D  E  L
Sbjct  464   YQDDGVTVMSRQEYMAMLKKMTELEEKCKSLEAQ-AAFSLERDRVLDASLRRVDQFELHL  522

Query  408   aeakkaleesqSNQNELIAYIE  343
             +E KKAL+E+ +  +E+ AYIE
Sbjct  523   SETKKALDETMTRLHEMTAYIE  544



>ref|XP_002283681.2| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Vitis vinifera]
 emb|CBI37683.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/627 (52%), Positives = 423/627 (67%), Gaps = 73/627 (12%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGHDERRERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLPTKHDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELEAVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MW DM+QWRK+FGADTI++DF+FKE +EVLKYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWTDMIQWRKDFGADTILEDFEFKELNEVLKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVG KN 
Sbjct  181   KVDPYKLMQVTTMDRYVKYHVQEFEKSFALKFPACTIAAKRHIDSSTTILDVQGVGFKNL  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKAARDLIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLEIIDASELP+FLGGTCTCAD+GGC+RSDKGPWN+P+I+KM+H G  + + ++ +
Sbjct  301   YQNKLLEIIDASELPEFLGGTCTCADQGGCLRSDKGPWNNPDILKMMHNGDARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksvkkpaSFKIE---STKKLFPIQEETR--  886
             V   E K I       P   G + S + S    +  AS K+    S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPQYPMMKGSDTSTAESGSEAEDIASPKMTKSYSQLRLTPVREEAKVV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWH----VVNNDNCKFVVPKGADLYQIQEAYKGQ  748
                         D YVPMVDK VD   W     +    + K  +P       + +  K  
Sbjct  421   GKVSYAGSFGGYDEYVPMVDKAVD-AGWKKQAALQRPSSSKGTLP-------LLDTQKSP  472

Query  747   ELASNQLLTGVMTFVMGIVTM-----VRMTKNMPRKLTES----TLYSNSMHLNDHAMKG  595
             E    ++L+ ++ F M + T+     +R+T  +P ++        L  ++ H  D     
Sbjct  473   EGIHTRILSALLAFFMTLFTLFCTVALRVTNKLPDRVDHDENIPQLAPDATHKED-----  527

Query  594   HGAYKPPE--PAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDa  424
                ++PP   PA T A+ + +++K+++ LEEK  TL  +P  MP EKEE+L+ A+ R+DA
Sbjct  528   ---FRPPSPIPAFTEADLLSSVLKKLSELEEKVDTLQAKPSEMPYEKEELLNAAVCRVDA  584

Query  423   leqelaeakkaleesqSNQNELIAYIE  343
             LE EL   KKAL E+   Q EL+AYI+
Sbjct  585   LEAELIATKKALHEALLRQEELLAYID  611



>ref|XP_010446447.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X1 [Camelina sativa]
 ref|XP_010446448.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X1 [Camelina sativa]
Length=557

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/562 (56%), Positives = 399/562 (71%), Gaps = 47/562 (8%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D + R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDEKRLTKLVSLKKKAINATNKFKHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRKE+GADTI++DF+FKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKEYGADTIMEDFEFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTVDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FR +W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRFVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C        EEKTI E                     K ++
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRSSLSDIEEKTISES--------------------KNQT  360

Query  921   TKKLFPIQ-EETRQP---DMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQ  766
              KK  P + EET +    +     +DKT+D  +W    H  NN+     VP+  D+    
Sbjct  361   KKKCEPCEAEETYKESAGEKEKRFIDKTMDAADWPTKLHKANNN---LPVPEPKDVNSAV  417

Query  765   EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
             +  + +      L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   
Sbjct  418   DPLERK----GYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGGSV  464

Query  585   YKPPEPAV-TAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             Y+     V +  E+MAM+K+M  LEEK  +L  Q      E++ +L  ++ R+D  E  L
Sbjct  465   YQDDGVTVMSRQEYMAMLKKMTELEEKCKSLEAQ-AAFSLERDRVLDASLRRVDQFELHL  523

Query  408   aeakkaleesqSNQNELIAYIE  343
             +E KKAL+E+ +  +E+ AYIE
Sbjct  524   SETKKALDETMTRLHEMTAYIE  545



>ref|XP_006411720.1| hypothetical protein EUTSA_v10024853mg [Eutrema salsugineum]
 gb|ESQ53173.1| hypothetical protein EUTSA_v10024853mg [Eutrema salsugineum]
Length=544

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/561 (56%), Positives = 400/561 (71%), Gaps = 52/561 (9%)
 Frame = -2

Query  2007  MDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDA  1834
             +++  DD++ T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDA
Sbjct  17    VEMSEDDKKLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVRCVSIVDEIDTEELQAVDA  76

Query  1833  FRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDF  1654
             FRQALILDELLP+KHDD+HMMLRFL+ARKF+ +K+KQMWADML WRKE+GADTI++DFDF
Sbjct  77    FRQALILDELLPSKHDDHHMMLRFLRARKFDTEKAKQMWADMLNWRKEYGADTIMEDFDF  136

Query  1653  KERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNND  1474
             KE +EV+KYYPQG+HGVDK+GRPIYIERLG VDATK+M+VTT+DRY+KYHV+EFE+T N 
Sbjct  137   KEIEEVVKYYPQGYHGVDKEGRPIYIERLGQVDATKMMKVTTIDRYVKYHVKEFEKTFNV  196

Query  1473  KMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIIN  1294
             K  +CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IIN
Sbjct  197   KFPACSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIIN  256

Query  1293  AGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGC  1114
             AG GFRL+W+TVKSFLDPKTTAKI+VLGNKYQSKLLEIIDA+ELP+FLGG CTC DKGGC
Sbjct  257   AGYGFRLVWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDANELPEFLGGKCTCTDKGGC  316

Query  1113  MRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSF  934
             MRSDKGPWNDPEI K+V  G  +C  +     EEKTI E               +     
Sbjct  317   MRSDKGPWNDPEIFKLVQNGEGRCPRKSLSGIEEKTISEYKNETKLKKCETFEPE-----  371

Query  933   KIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQ  766
               E+T K  P ++E +        +DKTVD   W    H  NND       +  DL  ++
Sbjct  372   --ETTYKHSPTEKENK-------FIDKTVDAAAWPRKLHKANND-----FAESKDLNPLE  417

Query  765   EAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
                     +   L  GVM  +MGIV ++R+TKNMPRKLTE++       ++ H       
Sbjct  418   --------SKGYLYGGVMALLMGIVGVMRLTKNMPRKLTETSGTDGVTIMSRH-------  462

Query  585   YKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqela  406
                        ++MAM+K++  LEEK  ++  Q   +  E+E++L  A+ R+D LE +L+
Sbjct  463   -----------DYMAMVKKITDLEEKCNSMDAQ-AALSLEREKILDAALRRVDQLELQLS  510

Query  405   eakkaleesqSNQNELIAYIE  343
             E KKAL+E+ + Q+E++AYIE
Sbjct  511   ETKKALDETMARQHEVMAYIE  531



>emb|CAB43633.1| SEC14-like protein [Arabidopsis thaliana]
 emb|CAB80581.1| SEC14-like protein [Arabidopsis thaliana]
Length=550

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/529 (57%), Positives = 374/529 (71%), Gaps = 44/529 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D R T+L SL+K AINA+NKF+HS   + RR SRV  V + DE D EE+++VDAFRQALI
Sbjct  23    DKRLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVACVSIVDEIDTEELQAVDAFRQALI  82

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             LDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW+DML WRKE+GADTI++DFDFKE +EV
Sbjct  83    LDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEV  142

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRPIYIERLG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +CS
Sbjct  143   VKYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACS  202

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  203   IAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGFR  262

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVKSFLDPKTTAKI+VLGNKYQ+KLLEIIDA+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  263   LLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIIDANELPEFLGGKCTCADKGGCMRSDKG  322

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  R     EEKTI E                    +  E+ K
Sbjct  323   PWNDPEIFKLVQNGEGRCLRRSLSGIEEKTIFE--------------------YNNETKK  362

Query  915   KLFPIQEETRQ---PDMYVPMVDKTVD---LPNWHVVNNDNCKFVVPKGADLYQIQEAYK  754
             K  P  EET +    +M    +D  VD     +W    N   K       DL  +  A  
Sbjct  363   KCEP--EETHKQSAAEMEKKFIDTNVDAAAAADWPTKLNKAEK----NPTDLKDVYSAVN  416

Query  753   GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPP  574
               E     L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   Y+  
Sbjct  417   PLE-RKGYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGSAVYQDG  466

Query  573   EPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRID  427
                ++  E++AM+K++  LEEK  ++  Q      E+E+ L  A+ RID
Sbjct  467   VTVMSKQEYIAMVKKITDLEEKCKSMEAQ-AAFYMEREKTLDAALRRID  514



>ref|XP_010432395.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1-like [Camelina sativa]
Length=553

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/570 (57%), Positives = 424/570 (74%), Gaps = 26/570 (5%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIAKMSSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRPIYIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPIYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA K+IDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPSCSVAANKYIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+T+KSFLDPKTT+KI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTIKSFLDPKTTSKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPEI+KM      KCS     + E++    D G + SV+          
Sbjct  307   GCMRSDKGPWNDPEILKMAINREAKCSP----ISEDEQKHVDQGRSTSVA----------  352

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 ES +++    +E    +  +  +DK++D+  W V  +    F + KG + Y  + A
Sbjct  353   ----ESFERIKKKSDEGNAYEKQITTIDKSMDMA-WPVKTHKAENFPISKGLECYVRKGA  407

Query  759   YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK  580
                Q      L+ GVM FVMG+V MVR++K++PRKLTE+ LY NS+   +         +
Sbjct  408   ---QTKGDGMLVGGVMAFVMGVVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQAQ  464

Query  579   PPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
                P V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL E 
Sbjct  465   FAAP-VSSSEYMLMVKRMAELEDKCMYLDLKPANVESEKEEKLQAALNRVQVLEQELTET  523

Query  399   kkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             KKALEE+  +Q E++AYIEKKKKKK  FGF
Sbjct  524   KKALEEALVSQKEILAYIEKKKKKKKFFGF  553



>ref|XP_010431883.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2-like isoform X2 [Camelina sativa]
Length=556

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/558 (56%), Positives = 396/558 (71%), Gaps = 40/558 (7%)
 Frame = -2

Query  1998  DADDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQA  1822
             D D R T+L SL+K AINA+NKFRHS   + RR SRV  V + DE D EE+++VDAFRQA
Sbjct  21    DDDKRLTKLVSLKKKAINATNKFRHSMTKKGRRHSRVTCVSIVDEIDTEELQAVDAFRQA  80

Query  1821  LILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERD  1642
             LILDELLP+KHDD+HMMLRFL+ARKF+++K+KQMW DML WRKE+GADTI++DFDFKE D
Sbjct  81    LILDELLPSKHDDHHMMLRFLRARKFDMEKAKQMWGDMLNWRKEYGADTIMEDFDFKEID  140

Query  1641  EVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSS  1462
             EV++YYPQG+HGVDK+GRPIYIE LG VDATKLM+VTT+DRY+KYHV+EFE+T N K  +
Sbjct  141   EVVQYYPQGYHGVDKEGRPIYIEGLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPA  200

Query  1461  CSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSG  1282
             CSIAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG G
Sbjct  201   CSIAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYG  260

Query  1281  FRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSD  1102
             FR +W+TVKSFLDPKTTAKI+VLGNKYQS LLEIIDA+ELP+FLGG CTCADKGGCMRSD
Sbjct  261   FRFVWSTVKSFLDPKTTAKIHVLGNKYQSTLLEIIDANELPEFLGGKCTCADKGGCMRSD  320

Query  1101  KGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIES  922
             KGPWNDPEI K+V  G  +C        EEKTI E               +K   F+ E 
Sbjct  321   KGPWNDPEIFKLVQNGEGRCLRWSLLGIEEKTISE----------YKNETQKCEPFEAEE  370

Query  921   TKKLFPIQEETRQPDMYVPMVDKTVDLPNW----HVVNNDNCKFVVPKGADLYQIQEAYK  754
             T K    ++E +        +DKTVD  +W    H  NN+     VP+  D+Y   +  +
Sbjct  371   TNKESAGEKEKK-------FIDKTVDAADWPTKLHKANNN---LPVPEPKDVYSAVDPLE  420

Query  753   GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPP  574
              +      L   VM  +MGIV ++R+TKNMPR+LTE+ +YS          +G   Y+  
Sbjct  421   RK----GYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSR---------EGGSVYQDD  467

Query  573   EPAVTA-AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                V +  E+MAM+K+M  LEEK  ++  Q      E++ +L  ++ R+D  E  L+E K
Sbjct  468   GVTVMSRQEYMAMLKKMTDLEEKCKSMEAQ-AAFSLERDRVLDASLCRVDQFELYLSETK  526

Query  396   kaleesqSNQNELIAYIE  343
             KAL+E+ +  +E+ AYIE
Sbjct  527   KALDETMTRLHEMSAYIE  544



>ref|XP_010645229.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Vitis vinifera]
Length=626

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/628 (52%), Positives = 423/628 (67%), Gaps = 74/628 (12%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGHDERRERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLPTKHDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELEAVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MW DM+QWRK+FGADTI++DF+FKE +EVLKYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWTDMIQWRKDFGADTILEDFEFKELNEVLKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVG KN 
Sbjct  181   KVDPYKLMQVTTMDRYVKYHVQEFEKSFALKFPACTIAAKRHIDSSTTILDVQGVGFKNL  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKAARDLIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLEIIDASELP+FLGGTCTCAD+GGC+RSDKGPWN+P+I+KM+H G  + + ++ +
Sbjct  301   YQNKLLEIIDASELPEFLGGTCTCADQGGCLRSDKGPWNNPDILKMMHNGDARRARQVVK  360

Query  1023  V--EEEKTIP--------EDGGVNvsvsmsaksvkkpaSFKIE---STKKLFPIQEETR-  886
             V   E K I         +  G + S + S    +  AS K+    S  +L P++EE + 
Sbjct  361   VLNSEGKVIAYAKPQYPMQMKGSDTSTAESGSEAEDIASPKMTKSYSQLRLTPVREEAKV  420

Query  885   -----------QPDMYVPMVDKTVDLPNWH----VVNNDNCKFVVPKGADLYQIQEAYKG  751
                          D YVPMVDK VD   W     +    + K  +P       + +  K 
Sbjct  421   VGKVSYAGSFGGYDEYVPMVDKAVD-AGWKKQAALQRPSSSKGTLP-------LLDTQKS  472

Query  750   QELASNQLLTGVMTFVMGIVTM-----VRMTKNMPRKLTES----TLYSNSMHLNDHAMK  598
              E    ++L+ ++ F M + T+     +R+T  +P ++        L  ++ H  D    
Sbjct  473   PEGIHTRILSALLAFFMTLFTLFCTVALRVTNKLPDRVDHDENIPQLAPDATHKED----  528

Query  597   GHGAYKPPE--PAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRID  427
                 ++PP   PA T A+ + +++K+++ LEEK  TL  +P  MP EKEE+L+ A+ R+D
Sbjct  529   ----FRPPSPIPAFTEADLLSSVLKKLSELEEKVDTLQAKPSEMPYEKEELLNAAVCRVD  584

Query  426   aleqelaeakkaleesqSNQNELIAYIE  343
             ALE EL   KKAL E+   Q EL+AYI+
Sbjct  585   ALEAELIATKKALHEALLRQEELLAYID  612



>ref|XP_006648288.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like [Oryza brachyantha]
Length=551

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/545 (55%), Positives = 377/545 (69%), Gaps = 36/545 (7%)
 Frame = -2

Query  1890  MSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWAD  1711
             MSV ++D  DAEE++SVDAFRQ L+L+ELLP +HDDYHMMLRFL+ARKF+I+KSKQMW D
Sbjct  1     MSVSIEDVRDAEEMRSVDAFRQTLVLEELLPARHDDYHMMLRFLRARKFDIEKSKQMWTD  60

Query  1710  MLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVT  1531
             MLQWRKEFG+D I+D+F F+E D+VL++YPQGHHGVD+DGRP+YIE+LGL+D  KL+QVT
Sbjct  61    MLQWRKEFGSDGILDEFQFEELDQVLEHYPQGHHGVDRDGRPVYIEKLGLIDTNKLLQVT  120

Query  1530  TMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQAL  1351
             +MDRY+KYHV+EFER    K  +CSIAAK+HIDQSTTILDV GVG KNF K AR+LI  L
Sbjct  121   SMDRYVKYHVREFERAFAIKFPACSIAAKRHIDQSTTILDVSGVGYKNFNKAARDLIGRL  180

Query  1350  QKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDA  1171
             QK+DGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID 
Sbjct  181   QKVDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDP  240

Query  1170  SELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCS-HRMARVE-EEKTIPE  997
             SELP+FLGGTC C  + GCMRSDKGPW DPEI+KMV  G  +C  +    +E +EK I E
Sbjct  241   SELPEFLGGTCNC--EAGCMRSDKGPWKDPEILKMVQCGMGRCGMNSSGPIEADEKMITE  298

Query  996   DGGVNvsvsmsaksvkkpaSFKIESTK----KLFPIQE---------------ETRQPDM  874
             D  V +     +       S KI   K    ++ P+ E                TR  D+
Sbjct  299   DDIVPIPKKQESFRRDSVDSPKIPREKIEHPQMSPLHEMSTSDRKIPSGPEGSSTRYDDL  358

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMG  697
             + PMVDK ++  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVMG
Sbjct  359   F-PMVDKNMEF-NW---NGEVSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVMG  413

Query  696   IVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK-------PPEPAVTAAEFMAM  538
             +V M R+ K  P++  ++ +   +M       K     +       P    VTAA++ A+
Sbjct  414   VVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLLQQQQQQQQLTGPDTVTVTAAQYEAL  473

Query  537   MKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNEL  358
             +KR+  LEEK   LS++PP MP EKE+ML  A++R++ALE EL   KK LE S   Q E+
Sbjct  474   IKRLGDLEEKVAALSSRPPEMPAEKEDMLKAAVTRVEALETELESTKKLLETSNGQQEEV  533

Query  357   IAYIE  343
             +AYIE
Sbjct  534   LAYIE  538



>gb|EEE56248.1| hypothetical protein OsJ_05270 [Oryza sativa Japonica Group]
Length=632

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/546 (54%), Positives = 376/546 (69%), Gaps = 35/546 (6%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D  DAEE+KSVDAFRQ L+L+ELLP +HDDYHMMLRFL+ARKF+IDKSKQMW+
Sbjct  79    VMSVSIEDVRDAEEMKSVDAFRQTLVLEELLPARHDDYHMMLRFLRARKFDIDKSKQMWS  138

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFG+DTI+DDF F+E D+VL++YPQGHHGVD+DGRP+YIE+LG +D  KL+QV
Sbjct  139   DMLQWRKEFGSDTILDDFQFEEMDQVLEHYPQGHHGVDRDGRPVYIEKLGAIDTAKLLQV  198

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+MDRY+KYHV+EFER    K  +CSIAAK+H+DQSTTILDV GVG KNF K AR+LI  
Sbjct  199   TSMDRYVKYHVREFERAFAVKFPACSIAAKRHVDQSTTILDVSGVGYKNFNKAARDLIGR  258

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID
Sbjct  259   LQKVDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVID  318

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEE--EKTIP  1000
              SELP+FLGGTCTC  +GGCMRSDKGPW DPEI+KMV  G  +C    +   E  EK I 
Sbjct  319   PSELPEFLGGTCTC--EGGCMRSDKGPWKDPEIIKMVQCGMGRCGFNSSGHTEADEKMIT  376

Query  999   EDGGVNvsvsmsaksvkkpaSFKIESTK----KLFPIQE----ETRQP----------DM  874
             ED  V +     +       S KI   K    ++ P+ E    E++ P          D 
Sbjct  377   EDDIVAIPKKQESIRRDSVDSPKIPREKIEHPQMSPLHEMSTSESKAPPGQEGSSSRYDD  436

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMG  697
               PM DK +D  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVMG
Sbjct  437   LFPMPDKNMDF-NW---NGEVSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVMG  492

Query  696   IVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK--------PPEPAVTAAEFMA  541
             +V M R+ K  P++  ++ +   +M       K     +        P    V+ A++ A
Sbjct  493   VVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLMQQQQRQLEQLPGPDTVTVSTAQYEA  552

Query  540   MMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNE  361
             ++KR+  LEEK   L+++ P MP +KE++L  A++R++ALE EL   KK LE S   Q E
Sbjct  553   LIKRLGDLEEKVAALTSRLPEMPADKEDLLKAAVTRVEALETELESTKKLLETSSGQQEE  612

Query  360   LIAYIE  343
             ++AYIE
Sbjct  613   VLAYIE  618



>ref|XP_010437588.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X1 [Camelina sativa]
 ref|XP_010447055.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X1 [Camelina sativa]
Length=553

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/571 (57%), Positives = 423/571 (74%), Gaps = 28/571 (5%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIAKMSSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRPIYIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPIYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA K+IDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPSCSVAANKYIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+T+KSFLDPKTT+KI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTIKSFLDPKTTSKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPEI+KM      KCS     + E++    D G + SV  S        
Sbjct  307   GCMRSDKGPWNDPEILKMAINREAKCSP----ISEDEQKHVDQGRSTSVPES--------  354

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 E TKK     +E    +  +  +DK++D+  W V  +    F + KG + Y     
Sbjct  355   ---FERTKKK---SDEGNAYEKQITTIDKSMDMA-WPVKTHKAENFPISKGLECY----V  403

Query  759   YKGQELASNQLLT-GVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAY  583
              KG     + +L  GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +         
Sbjct  404   RKGAPTKGDGMLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQA  463

Query  582   KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
             +   P V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL E
Sbjct  464   QFAAP-VSSSEYMLMVKRMAELEDKCMFLDLKPANVESEKEEKLQAALNRVQVLEQELTE  522

Query  402   akkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              KKALEE+  +Q E++AYIEKKKKKK  FGF
Sbjct  523   TKKALEEALVSQKEILAYIEKKKKKKKFFGF  553



>ref|XP_006286142.1| hypothetical protein CARUB_v10007697mg [Capsella rubella]
 gb|EOA19040.1| hypothetical protein CARUB_v10007697mg [Capsella rubella]
Length=554

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/571 (57%), Positives = 424/571 (74%), Gaps = 27/571 (5%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIAKMSSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRPIYIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPIYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTT+KI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTSKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDP+++KM      KCS     + E++    D G + SV           
Sbjct  307   GCMRSDKGPWNDPDVLKMSINREAKCSP----ISEDEQKHVDQGRSTSVP----------  352

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 ES ++     +E    +  +  +DK++D+ +W V       F + KG D Y  + A
Sbjct  353   ----ESLERAKKKSDEDNAYEKQITTIDKSMDM-SWPVKTQKAENFPISKGLDCYVRKGA  407

Query  759   YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYK  580
              K        L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +         +
Sbjct  408   PKK---GDGMLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQAQ  464

Query  579   PPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
                P V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+ ALEQEL E 
Sbjct  465   FSAP-VSSSEYMLMVKRMAELEDKCMFLDLKPAYVESEKEEKLQAALNRVQALEQELTET  523

Query  399   kkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
             KKALEE+  +Q E++AYIEKKKKKK + FGF
Sbjct  524   KKALEEALVSQKEILAYIEKKKKKKKLFFGF  554



>emb|CDY45318.1| BnaA03g52910D [Brassica napus]
Length=500

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/517 (56%), Positives = 380/517 (74%), Gaps = 29/517 (6%)
 Frame = -2

Query  1974  LGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPT  1795
             +GSL+K A++ASN+F++S K + R SRVMSV ++++ DAE+++S+D FRQ L+LDELLP 
Sbjct  1     MGSLKKKALSASNRFKNSIKKKGRRSRVMSVPIENDIDAEDLQSIDVFRQVLVLDELLPY  60

Query  1794  KHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQG  1615
             K DD HMMLRFL+ARKF+I+K+KQMW DM+QWRK+FGADTII+DF+FKE DEV+KYYPQG
Sbjct  61    KLDDLHMMLRFLRARKFDIEKAKQMWKDMIQWRKDFGADTIIEDFEFKEIDEVMKYYPQG  120

Query  1614  HHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHI  1435
             +HG+DK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T N K  +CS+AA KHI
Sbjct  121   YHGIDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFNIKFPACSVAANKHI  180

Query  1434  DQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVK  1255
             DQSTTI DVQGVG+KNF+K AREL+Q+L KID DNY ETL RM+IINAGSGFRLLW+TVK
Sbjct  181   DQSTTIFDVQGVGMKNFSKSARELLQSLLKIDNDNYHETLNRMFIINAGSGFRLLWSTVK  240

Query  1254  SFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEI  1075
             SFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKGGCMRSDKGPWNDPE+
Sbjct  241   SFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWNDPEV  300

Query  1074  MKMVHQGAHKCSHRMARVEEEKTIP--EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPI  901
             +K+++      SH MA   E K  P  ED   +V    S            +S ++    
Sbjct  301   LKVLN-----ISH-MAINREVKCAPISEDEHEHVDQGRSISVP--------KSVERYNKK  346

Query  900   QEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA-YKGQELASNQLL  724
             ++E    +  +  +DK++D+  +    ND     + KG + Y  + A  KG       L+
Sbjct  347   KDEDNAQEEQITTIDKSMDMSRYQKAENDP----LSKGLECYVRKGAPNKG----GGSLV  398

Query  723   TGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSM-HLNDHAMKGHGAYKPPEPAVTAAEF  547
              GVM FVMGIV MVR++K++P KLTE+ +Y NS+ +    + K    +  P   V+++E+
Sbjct  399   GGVMAFVMGIVAMVRLSKDVPHKLTEAAIYGNSVCYEESRSKKTKVQFATP---VSSSEY  455

Query  546   MAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMS  436
             M M KRMA LEEK+++L  +P  +  EKEE L  A++
Sbjct  456   MLMTKRMAELEEKWMSLDLKPANIESEKEEKLQAALT  492



>ref|XP_004289639.1| PREDICTED: uncharacterized protein LOC101312875 [Fragaria vesca 
subsp. vesca]
Length=627

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/617 (53%), Positives = 416/617 (67%), Gaps = 52/617 (8%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLILDELLPDKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRKEFG+DTI++DF+FKE D+VL YYP GHHGVDK+GRP+YIERLG
Sbjct  121   DVEKAKHMWADMLQWRKEFGSDTIMEDFEFKELDDVLNYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQK+DGDNYPETLC+M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKSARELIMRLQKVDGDNYPETLCQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDASELPDFLGG+CTCAD+GGC+RSDKGPW +P+I+KMV  G  + + ++ +
Sbjct  301   YQSKLLEIIDASELPDFLGGSCTCADQGGCLRSDKGPWKNPDILKMVLSGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K +       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKFLAYAKPHYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEAKVV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD   W    +   K   PKG     +    K  E   
Sbjct  421   GKASCAGSFSGYDEYVPMVDKAVD-AGWKKQASLQ-KAHSPKGT--VPVPNIPKDPEGIQ  476

Query  735   NQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNSMHLNDHAMKGHGA--YKPPEPA  565
              ++L  VM F +  +T+ R +  ++ RKL + TL +   ++ +  +        +PP P 
Sbjct  477   ARILVAVMAFFVTFLTLFRSVASHVTRKLPD-TLANKEQNVTEPTVDATNKEECRPPSPT  535

Query  564   --VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
                  A+ +  ++K++A LEEK  TL ++P  MP EKEE+L+ A+ R+DALE EL   KK
Sbjct  536   SPFAGADLLPTVLKKLAELEEKVDTLQSKPSEMPYEKEELLNAAVCRVDALEAELIATKK  595

Query  393   aleesqSNQNELIAYIE  343
             AL E+   Q EL+AYI+
Sbjct  596   ALHEALMRQEELLAYID  612



>ref|XP_003570886.2| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X2 [Brachypodium distachyon]
Length=593

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/548 (54%), Positives = 374/548 (68%), Gaps = 37/548 (7%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D  DAEE+ +VDAFRQ L+L+ELLP +HDDYHMMLRFLKARKFEIDKSKQMW+
Sbjct  38    VMSVAIEDVRDAEEMAAVDAFRQTLVLEELLPARHDDYHMMLRFLKARKFEIDKSKQMWS  97

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFG+DTIIDDF+F+E D VL++YPQGHHGVDKDGRP+YIE+LG +D TKL+QV
Sbjct  98    DMLQWRKEFGSDTIIDDFEFEEMDAVLEHYPQGHHGVDKDGRPVYIEKLGAIDTTKLLQV  157

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+MDRY++YHV+EFER    K  +CSIAAK+H+DQSTTILDV GVG KNF K AR+LI  
Sbjct  158   TSMDRYVRYHVREFERAFAVKFPACSIAAKRHVDQSTTILDVSGVGYKNFNKAARDLISR  217

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID
Sbjct  218   LQKVDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVID  277

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR--VEEEKTIP  1000
              SELP+F GGTC C + GGCM+SDKGPW DPEIMKMV  G  +C    +     EEKTI 
Sbjct  278   PSELPEFFGGTCVC-EGGGCMKSDKGPWKDPEIMKMVQCGMGRCGMNSSDPVAAEEKTIT  336

Query  999   EDGGV-------NvsvsmsaksvkkpaSFKIESTKKLFPIQE----ETRQPDM-------  874
             ED          ++     +    K    KIE   ++ P+ E    ET+ P         
Sbjct  337   EDDTAPAPKKQDSMRRDRDSADSPKVPREKIEHP-QMSPLHEMATAETKAPAAKEGSSAP  395

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMG  697
             Y  + +K +D  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVMG
Sbjct  396   YDELFEKNMDF-NW---NGEVSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVMG  451

Query  696   IVTMVRMTKNMPRKLTESTLYSNSM----------HLNDHAMKGHGAYKPPEPAVTAAEF  547
             +V M R+ K  P++  ++ +   +M              H   G G      P V+ A++
Sbjct  452   VVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLLQAQQHGGGGGGGGGDCGPGVSVAQY  511

Query  546   MAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQ  367
              A++KR+  LEEK   +  +PP MP +K E+L+ A +R++ALE EL   KK LE S+  Q
Sbjct  512   EALVKRVGDLEEKIAAIGARPPEMPADKAELLATATARLEALETELDTTKKLLETSKGQQ  571

Query  366   NELIAYIE  343
              E++AYIE
Sbjct  572   EEVLAYIE  579



>ref|XP_002512943.1| phosphatidylinositol transporter, putative [Ricinus communis]
 gb|EEF49446.1| phosphatidylinositol transporter, putative [Ricinus communis]
Length=624

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/616 (53%), Positives = 413/616 (67%), Gaps = 52/616 (8%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQALI+DELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSNRRKSDGRVSSVSIEDVRDVEELQAVDEFRQALIMDELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWRKEFGADT+I+DF+FKE  EVLKYYP G+HGVDKDGRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRKEFGADTVIEDFEFKELSEVLKYYPHGNHGVDKDGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLM VTTMDRY+KYHV+EFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPHKLMHVTTMDRYVKYHVREFEKSLKIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLE+IDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQSKLLEMIDASELPEFLGGTCTCADQGGCLRSDKGPWRNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR---  886
             V   E K I      P   G + S + S         P + K  S  +L P++EE +   
Sbjct  361   VLNSEGKFIYAKPHYPMIKGSDTSTAESGSEAEDIASPKALKSYSHLRLTPVREEAKVIG  420

Query  885   ---------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                        D YVPMVDK VD   W   ++     +      L   Q++ +G  +   
Sbjct  421   KASYAANFSGYDEYVPMVDKAVD-SGWKKQSSTQRPSISKATFTLPNTQKSPEGIHV---  476

Query  732   QLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEP  568
             ++L  V+ F M + T+ R     +TK +P   +++   S S  L   A +       P P
Sbjct  477   RILVAVVAFFMTLFTLFRTMVSHVTKRLPYPSSDNN--STSPVLTSDATQEEFRPPSPTP  534

Query  567   AVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakka  391
               T A+ + +++KR+  LEEK  TL  +P  MP EKEE+L+ A+ R+DALE EL   KKA
Sbjct  535   VFTEADLLSSVLKRLGELEEKVDTLKAKPSEMPYEKEELLNAAVCRVDALEAELIATKKA  594

Query  390   leesqSNQNELIAYIE  343
             L E+   Q EL+AYI+
Sbjct  595   LHEALMRQEELLAYID  610



>ref|XP_010233769.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH12-like isoform X1 [Brachypodium distachyon]
Length=587

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/557 (55%), Positives = 382/557 (69%), Gaps = 37/557 (7%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D  DAEE+ +VDAFRQ L+L+ELLP +HDDYHMMLRFLKARKFEIDKSKQMW+
Sbjct  27    VMSVAIEDVRDAEEMAAVDAFRQTLVLEELLPARHDDYHMMLRFLKARKFEIDKSKQMWS  86

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFG+DTIIDDF+F+E D VL++YPQGHHGVDKDGRP+YIE+LG +D TKL+QV
Sbjct  87    DMLQWRKEFGSDTIIDDFEFEEMDAVLEHYPQGHHGVDKDGRPVYIEKLGAIDTTKLLQV  146

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+MDRY++YHV+EFER    K  +CSIAAK+H+DQSTTILDV GVG KNF K AR+LI  
Sbjct  147   TSMDRYVRYHVREFERAFAVKFPACSIAAKRHVDQSTTILDVSGVGYKNFNKAARDLISR  206

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQK+DGDNYPETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID
Sbjct  207   LQKVDGDNYPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVID  266

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR--VEEEKTIP  1000
              SELP+F GGTC C + GGCM+SDKGPW DPEIMKMV  G  +C    +     EEKTI 
Sbjct  267   PSELPEFFGGTCVC-EGGGCMKSDKGPWKDPEIMKMVQCGMGRCGMNSSDPVAAEEKTIT  325

Query  999   EDGGV-------NvsvsmsaksvkkpaSFKIESTKKLFPIQE----ETRQPDM-------  874
             ED          ++     +    K    KIE   ++ P+ E    ET+ P         
Sbjct  326   EDDTAPAPKKQDSMRRDRDSADSPKVPREKIEHP-QMSPLHEMATAETKAPAAKEGSSAP  384

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVMG  697
             Y  + +K +D  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVMG
Sbjct  385   YDELFEKNMDF-NW---NGEVSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVMG  440

Query  696   IVTMVRMTKNMPRKLTESTLYSNSM----------HLNDHAMKGHGAYKPPEPAVTAAEF  547
             +V M R+ K  P++  ++ +   +M              H   G G      P V+ A++
Sbjct  441   VVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLLQAQQHGGGGGGGGGDCGPGVSVAQY  500

Query  546   MAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQ  367
              A++KR+  LEEK   +  +PP MP +K E+L+ A +R++ALE EL   KK LE S+  Q
Sbjct  501   EALVKRVGDLEEKIAAIGARPPEMPADKAELLATATARLEALETELDTTKKLLETSKGQQ  560

Query  366   NELIAYIEkkkkkKNIF  316
              E++AYIEKKKKKK +F
Sbjct  561   EEVLAYIEKKKKKKGMF  577



>ref|XP_010105353.1| Sec14 cytosolic factor [Morus notabilis]
 gb|EXC04413.1| Sec14 cytosolic factor [Morus notabilis]
Length=651

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/614 (53%), Positives = 412/614 (67%), Gaps = 48/614 (8%)
 Frame = -2

Query  2070  ACSAG--NMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrss  1897
             AC  G    SG+ ER  R S    +   D+R+TR+GSL+K AINAS KF+HS K +    
Sbjct  27    ACVIGFEGFSGSDERRERKS--DFENSEDERRTRIGSLKKKAINASTKFKHSLKKKSSRR  84

Query  1896  R----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKS  1729
             +    V SV ++D  DAEE+++VDAFRQAL+LDELLP +HDDYHMMLRFLKARKF+I+K+
Sbjct  85    KSDGRVSSVSIEDVRDAEELQAVDAFRQALMLDELLPERHDDYHMMLRFLKARKFDIEKA  144

Query  1728  KQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDAT  1549
             K MW+DMLQWRK+F ADTI++DF+FKE +EVLKYYP GHHGVDK+GRPIYIERLG VD  
Sbjct  145   KHMWSDMLQWRKDFSADTIMEDFEFKELNEVLKYYPHGHHGVDKEGRPIYIERLGKVDPN  204

Query  1548  KLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQAR  1369
             KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVGLKNFTK AR
Sbjct  205   KLMQVTTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNFTKSAR  264

Query  1368  ELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKL  1189
             ELI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNKYQ+KL
Sbjct  265   ELIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNKYQNKL  324

Query  1188  LEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV--EE  1015
             LEIIDASELP FLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +V   E
Sbjct  325   LEIIDASELPVFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQIFKVLNSE  384

Query  1014  EKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP-----  880
              K I       P   G + S + S         P + K  S  +L P++EE +       
Sbjct  385   GKVIAYAKPHYPMVKGSDTSTAESGSEAEDIASPKATKSYSHLRLTPVREEAKVVGKSSY  444

Query  879   -------DMYVPMVDKTVDLPNW--HVV--NNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                    D YVPMVDK VD   W  HV    + + K  +P       +    K  E    
Sbjct  445   AVHFAGYDEYVPMVDKAVD-AEWKKHVSLQRSQSSKGTLP-------LPNTPKAPEGLRA  496

Query  732   QLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE--PAV  562
             Q+L  +  F + ++T +R +   + RK  ++    +              Y+PP   PA 
Sbjct  497   QVLILLTAFFLTLITFLRSVICRVIRKFPDTLPNCDQNTAESTVDANKEDYRPPSPTPAF  556

Query  561   TAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkale  385
             T A+ + A++KR+  LEEK   L ++P  MP EKEE+L+ A+ R+DALE EL   KKAL 
Sbjct  557   TEADVLSAVVKRLGELEEKVDALQSKPSRMPFEKEELLNAAVCRVDALEAELIATKKALY  616

Query  384   esqSNQNELIAYIE  343
             E+   Q EL+AYI+
Sbjct  617   EALMRQEELLAYID  630



>emb|CDY12126.1| BnaC03g60420D [Brassica napus]
Length=535

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/563 (55%), Positives = 396/563 (70%), Gaps = 42/563 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             + R T+L SL+K AINA+NKF+HS   R RR SRV  V + DE D EE++ VDAFRQALI
Sbjct  12    EKRLTKLCSLKKKAINATNKFKHSMTKRGRRHSRVRCVSIVDEIDTEELRQVDAFRQALI  71

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRK++G DTI++DFDF E DEV
Sbjct  72    LEELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKDYGTDTIMEDFDFGEIDEV  131

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRP+YIERLG VDA KLM+VTT+DRY+KYHV+EFE+T N K  +CS
Sbjct  132   VKYYPQGYHGVDKEGRPVYIERLGQVDAVKLMKVTTIDRYVKYHVKEFEKTFNVKFPACS  191

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  192   IAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGYGFR  251

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             L+WN VKSFLDPKTTAKI+VLGNK+QSKLLEII+A+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  252   LVWNGVKSFLDPKTTAKIHVLGNKFQSKLLEIINANELPEFLGGKCTCADKGGCMRSDKG  311

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  +     EEKTI     V                   E  +
Sbjct  312   PWNDPEIFKLVQNGEGRCPRKSLSGIEEKTISVCKNVT------------------EEKR  353

Query  915   KLFPIQEETRQPDMYV-PMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
             ++F  +E  ++    +   +DKTVD   +    +   K +VP   DL       +     
Sbjct  354   EVFEPEETYKKAAAEMEKFIDKTVDTGAYPTQEHHKAKNIVPDPKDLLLSPAVER-----  408

Query  738   SNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVT  559
                L   +M  +MGIV ++R+TKNMPRKLT+  +Y + + +                 + 
Sbjct  409   KGYLYGSMMALLMGIVGVMRLTKNMPRKLTQGNVYPDGVTV-----------------MP  451

Query  558   AAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkalees  379
               E+ AM+KRM  LEEK  ++      +  E+E++L  A+ R+D LE +L+E KKAL+E+
Sbjct  452   TQEYRAMVKRMTDLEEKCKSMEAAQVAISMEREKVLDAALRRVDQLELQLSETKKALDET  511

Query  378   qSNQNELIAYIEkkkkkKNIFGF  310
              + Q+E++AYIEKKKKKK  F F
Sbjct  512   MTRQHEIMAYIEKKKKKKRKFLF  534



>ref|XP_007131801.1| hypothetical protein PHAVU_011G042800g [Phaseolus vulgaris]
 gb|ESW03795.1| hypothetical protein PHAVU_011G042800g [Phaseolus vulgaris]
Length=625

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/619 (52%), Positives = 410/619 (66%), Gaps = 56/619 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A+NAS+KF+H+ K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKKERRSDFENSEDERRTRIGSLKKKALNASSKFKHTLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  + EE ++VDAFRQ+LI+DELLP KHDDYH+MLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRNFEEQQTVDAFRQSLIIDELLPGKHDDYHVMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFGADTII+DF+F E +EV+KYYP GHHGVD++GRP+YIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGADTIIEDFEFVELNEVMKYYPHGHHGVDREGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY++YHV+EFE+    K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVRYHVREFEKAFKIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARELIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLE+IDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+KM+  G  + +  + +
Sbjct  301   YQSKLLEVIDASELPEFLGGTCTCADQGGCLRSDKGPWKNPEILKMILSGEARRARPVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K I       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYASPQYPMVKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEAKVV  420

Query  885   ------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQEL  742
                           D YVPMVDK VD   W      + +    KG     +    K  E 
Sbjct  421   GKSSYVGGSILAGYDEYVPMVDKAVD-AGWK--KQASLRAQTSKGTP--SLPNPPKTPEG  475

Query  741   ASNQLLTGVMTFVMGIVTMV-----RMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKP  577
                +++  +  F M ++T+      R+TK +P   +     ++   LN      H     
Sbjct  476   IQARMVVALTAFFMTLLTLFHSVAYRVTKKLPASSSNEDQCTSETPLNTTTEDNHPP--S  533

Query  576   PEPAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             P PA T A+ + +MMKR+  LEEK  TL ++P  MP EK E+L+ A+ R+DALE EL   
Sbjct  534   PTPAHTEAKLLSSMMKRLGELEEKVDTLQSKPSEMPYEKVELLNAAVCRVDALEAELIAT  593

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q EL+AYI+
Sbjct  594   KKALYEALMRQEELLAYID  612



>ref|XP_010437589.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X2 [Camelina sativa]
 ref|XP_010447056.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 isoform X2 [Camelina sativa]
Length=551

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/573 (57%), Positives = 422/573 (74%), Gaps = 34/573 (6%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIAKMSSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRPIYIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPIYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA K+IDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPSCSVAANKYIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+T+KSFLDPKTT+KI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTIKSFLDPKTTSKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPEI+KM      KCS     + E++    D G + SV  S        
Sbjct  307   GCMRSDKGPWNDPEILKMAINREAKCSP----ISEDEQKHVDQGRSTSVPES--------  354

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                 E TKK     +E    +  +  +DK++D+  W V  +    F + K        E 
Sbjct  355   ---FERTKKK---SDEGNAYEKQITTIDKSMDMA-WPVKTHKAENFPISK--------EC  399

Query  759   Y--KGQELASNQLLT-GVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG  589
             Y  KG     + +L  GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +       
Sbjct  400   YVRKGAPTKGDGMLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQN  459

Query  588   AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
               +   P V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LEQEL
Sbjct  460   QAQFAAP-VSSSEYMLMVKRMAELEDKCMFLDLKPANVESEKEEKLQAALNRVQVLEQEL  518

Query  408   aeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
              E KKALEE+  +Q E++AYIEKKKKKK  FGF
Sbjct  519   TETKKALEEALVSQKEILAYIEKKKKKKKFFGF  551



>ref|XP_006847542.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda]
 gb|ERN09123.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda]
Length=649

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/651 (51%), Positives = 418/651 (64%), Gaps = 85/651 (13%)
 Frame = -2

Query  2094  GVGVLIYPACSAGNMSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKA  1954
             GVG++         MSG ++R  RP  E           K D +   D+R+TR+GSL+K 
Sbjct  3     GVGLI--------TMSGPLDRFARPCFEGFSSHDEKRERKSDFENSEDERRTRIGSLKKK  54

Query  1953  AINAsnk---frhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDD  1783
             AINAS K          R+  SRV+SV ++D  D EE+++VDAFRQ L+LDELLP++HDD
Sbjct  55    AINASTKFRHSLKKKGRRKSDSRVLSVSIEDVRDVEELQAVDAFRQTLLLDELLPSRHDD  114

Query  1782  YHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGV  1603
             YH+MLRFLKARKF+I+K+K MW++MLQWRKEFGADTI++DF+FKE +EV+KYYPQGHHGV
Sbjct  115   YHIMLRFLKARKFDIEKTKTMWSEMLQWRKEFGADTILEDFEFKEVEEVVKYYPQGHHGV  174

Query  1602  DKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQST  1423
             DK+GRP+YIERLG VD  KLMQVTTM+RY+ YHVQEFE+    K  +CSIAAK+HID ST
Sbjct  175   DKEGRPVYIERLGKVDPNKLMQVTTMERYIMYHVQEFEKNFAIKFPACSIAAKRHIDSST  234

Query  1422  TILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLD  1243
             TILDV GVG KNF K AR+LI  LQKIDGDNYPETLCRM+IINAGSGFRLLWNT+KSFLD
Sbjct  235   TILDVHGVGFKNFNKAARDLIMRLQKIDGDNYPETLCRMFIINAGSGFRLLWNTIKSFLD  294

Query  1242  PKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV  1063
             PKT++KI+VLGNKYQSKLLEIIDASELP+FLGGTCTCAD+GGCMRSDKGPW DP I+K+V
Sbjct  295   PKTSSKIHVLGNKYQSKLLEIIDASELPEFLGGTCTCADQGGCMRSDKGPWRDPTILKLV  354

Query  1062  HQGAHKCSHRMARVEEE--KTI-------PEDGGVNvsvsmsaksvkkpaSFK-----IE  925
               G ++C+ ++  V     KTI       P   G + S + S    +  AS K       
Sbjct  355   QNGQYRCARQIVTVSNSDGKTIAYARPYYPTIKGGDTSTAESGSEAEDIASPKAMRSYTS  414

Query  924   STKKLFPIQEETR------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGAD  781
             S  +L P++EE +            + D YVPMVDK VD   W        K  +PKG  
Sbjct  415   SHLRLTPVREEAKIGIKANYVDGNPEYDEYVPMVDKAVD-AGWK-KEVSYPKLAIPKGMP  472

Query  780   LYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAM  601
               +  E  K     S+++   ++ F   +VT+  +  +    L  ST     + L   A+
Sbjct  473   P-EFDEC-KAPMSISSRMFASIIAF---LVTLFALFCSFTHGLLLSTKEKLPLPL---AL  524

Query  600   KG------HGAYKP---PEPAVTAAEFMA----------------MMKRMASLEEKFITL  496
             +G      H  Y P   PEP  T  E  +                ++KR+  LEEK  TL
Sbjct  525   EGSGRPEQHEYYDPVFSPEPEPTTEELRSHPSPMPEFTQRDLLSNVLKRLGELEEKVDTL  584

Query  495   SNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              ++P  MP EKEE+L+ A+ R+DALE EL   KKAL E+   Q EL+AYI+
Sbjct  585   RDKPSQMPCEKEELLNAAVCRVDALEAELIATKKALHEALMKQEELLAYID  635



>dbj|BAK05246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=626

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/547 (54%), Positives = 368/547 (67%), Gaps = 35/547 (6%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             VMSV ++D  DA+E  SVDAFRQ L+L+ELLP +HDDYHMMLRFLKARKFEIDKSKQMW+
Sbjct  71    VMSVAIEDVRDAKEAASVDAFRQTLVLEELLPARHDDYHMMLRFLKARKFEIDKSKQMWS  130

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             DMLQWRKEFG DTI+DDF F+E ++VL++YPQGHHGVDKDGRPIYIE+LG +D TKL+QV
Sbjct  131   DMLQWRKEFGTDTIMDDFIFEEVEQVLEHYPQGHHGVDKDGRPIYIEKLGAIDTTKLLQV  190

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             T+MDRY++YHV+EFER    K  +CSI+AK+H+DQSTTILDV GVG KNF K AR+LI  
Sbjct  191   TSMDRYVRYHVREFERAFALKFPACSISAKRHVDQSTTILDVSGVGYKNFNKAARDLIGQ  250

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIID  1174
             LQKIDGDN+PETLCRM+IINAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQSKLLE+ID
Sbjct  251   LQKIDGDNFPETLCRMFIINAGQGFRLLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEVID  310

Query  1173  ASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA--RVEEEKTIP  1000
              SELP+FLGGTC C + GGCMRSDKGPW DPEI+KMV  G  +C    +     EEK + 
Sbjct  311   PSELPEFLGGTCVC-EGGGCMRSDKGPWKDPEIIKMVQCGLGRCGLNSSDPASAEEKIVT  369

Query  999   EDGGVNvsvsmsaksvkkpaSF---KIESTKKLFPIQ----EETRQP------------D  877
             ED     +    +            KIE   ++ P+     EET+              D
Sbjct  370   EDEAAPATKKQESMRAADSPKVVRDKIEHPPQMSPLHEVANEETKAAPSDGQGGSSAPYD  429

Query  876   MYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLY-QIQEAYKGQELASNQLLTGVMTFVM  700
                PMVDK ++  NW   N +     +    D+Y  + +AYK  +    Q++TG M FVM
Sbjct  430   DLFPMVDKGMEF-NW---NGEMSAEKLALARDMYASLPDAYKHGDAGDRQVVTGFMAFVM  485

Query  699   GIVTMVRMTKNMPRKLTESTLYSNSMH--------LNDHAMKGHGAYKPPEPAVTAAEFM  544
             G+V M R+ K  P++  ++ +   +M         L      G G        V+ A++ 
Sbjct  486   GVVAMFRVGKIAPKRAMDAAMGIATMEAMAKNRKLLQAQGQGGGGGGPVVVAGVSTAQYE  545

Query  543   AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQN  364
             A+ KR+  LEEK   L ++PP MP +K E L+ A +R+D LE EL   KK LE S+  Q 
Sbjct  546   ALAKRVGELEEKMAALGSRPPEMPADKAEQLAAAATRLDTLEAELEATKKLLETSKGQQE  605

Query  363   ELIAYIE  343
             E++AYIE
Sbjct  606   EVLAYIE  612



>ref|XP_003537860.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
 gb|KHN39806.1| Sec14 cytosolic factor [Glycine soja]
Length=629

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/630 (51%), Positives = 408/630 (65%), Gaps = 74/630 (12%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKKERRSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  + EE ++VDAFRQALI++ELLP KHDDYH+MLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRNFEEQQAVDAFRQALIMEELLPEKHDDYHVMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFG DTI++DF+FKE DEV+ YYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGTDTIMEDFEFKEIDEVVNYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKAFKIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+KM+  G  + +  + +
Sbjct  301   YQSKLLEIIDASELPEFLGGTCTCADQGGCLRSDKGPWKNPEILKMILSGEARRARPVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K I       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYARPQYPMVKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEAKVV  420

Query  885   ------------QPDMYVPMVDKTVDLP--NWHVVNNDNCKFVVPKGADLYQIQEAYKGQ  748
                           D YVPMVDK VD    N   +         P   D     E  +  
Sbjct  421   GKSSYAGGGNLAGYDEYVPMVDKAVDAAWKNQTSLQRSQTSKGTPPLPDTTNTPEGIQA-  479

Query  747   ELASNQLLTGVMTFVMGIVTMVR-----MTKNMP-------RKLTESTLYSNSMHLNDHA  604
                  +++  +  F M + T+ R     +TK +P       +  +E TL +   +  D  
Sbjct  480   -----RIVVALTVFFMTLFTLFRSVACHVTKKLPAVSSNDDQGTSEPTLDATKTNYED--  532

Query  603   MKGHGAYKPPEPA---VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSR  433
                   Y+PP P    V A    +MMKR+  LE K  TL ++P  MP EKEE+L+ A+ R
Sbjct  533   ------YRPPSPTPAYVEANLLSSMMKRLGELEVKVDTLQSKPSEMPYEKEELLNAAVCR  586

Query  432   IDaleqelaeakkaleesqSNQNELIAYIE  343
             +DALE EL   KKAL E+   Q EL+AYI+
Sbjct  587   VDALEAELIATKKALYEALMRQEELLAYID  616



>ref|XP_003541004.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
Length=629

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/638 (51%), Positives = 413/638 (65%), Gaps = 90/638 (14%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKKERRSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  + EE ++VDAFRQALI++ELLP KHDDYH+MLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRNFEEQQAVDAFRQALIMEELLPEKHDDYHVMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFG DTI++DF+FKE DEV+KYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGTDTIMEDFEFKEVDEVVKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKAFKIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKL EIIDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+KM+  G  + +  + +
Sbjct  301   YQSKLFEIIDASELPEFLGGTCTCADQGGCLRSDKGPWKNPEILKMILSGEARRARPVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksvkkpaSFKIE---STKKLFPIQEETR--  886
             V   E K I       P   G + S + S    +  AS K+    S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYARPQYPMVKGSDTSTAESGSEAEDIASPKVTKSYSHLRLTPVREEAKVV  420

Query  885   ------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQ--  748
                           D YVPMVDK VD   W             K     Q  +  KG+  
Sbjct  421   GKSSSAGGGNLAGYDEYVPMVDKAVDAA-W-------------KNQASLQRSQTSKGKPP  466

Query  747   --------ELASNQLLTGVMTFVMGIVTM-----VRMTKNMP-------RKLTESTLYSN  628
                     E    +++  +  F M + T+      R+TK +P       +  +E TL   
Sbjct  467   LPDTPNPPEGIRARIVVALTVFFMTLFTLFHSFACRVTKKLPAVSSNDDQGTSEPTLDIT  526

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
              ++ +D        Y+PP P    AE     +MMKR+  LE K  TL ++P  MP EKEE
Sbjct  527   KINNDD--------YRPPSPTPAYAEANLLSSMMKRLGELEVKVDTLQSKPSEMPYEKEE  578

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +L+ A+ R+DALE EL   KKAL E+   Q EL+AYI+
Sbjct  579   LLNAAVCRVDALEAELIATKKALYEALMRQEELLAYID  616



>ref|XP_002869137.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45396.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/577 (56%), Positives = 430/577 (75%), Gaps = 39/577 (7%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsnkfrhsfksr--rrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN+F++SFK +  R SSRVMSV ++D+ DAE+++++
Sbjct  7     EIEMSEEERKIVKMCSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQAL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+K DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII+DF
Sbjct  67    DAFRQALVLDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  SCS+AA KHIDQSTTILDVQGVGLKNF+K AREL+Q L KID +NYPETL RM+I
Sbjct  187   KVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCMRSDKGPWNDPE++K+      KCS     + E++    D G + S            
Sbjct  307   GCMRSDKGPWNDPEVLKIAINREAKCSP----ISEDEHKHVDQGRSTS------------  350

Query  939   SFKIESTKKLFPIQEETRQPDMY---VPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQI  769
                  +++ L  I+++T   ++Y   +  +DK++++  W         F + KG + Y  
Sbjct  351   -----ASESLERIKKKTDGDNVYEKQITTIDKSMNMA-WPAKTQKAENFPISKGLECYVR  404

Query  768   QEA-YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDH--AMK  598
             + A  KG  L    L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   +   + +
Sbjct  405   KGAPNKGDGL----LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQ  460

Query  597   GHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDale  418
               G +  P   V+++E+M M+KRMA LE+K + L  +P  +  EKEE L  A++R+  LE
Sbjct  461   NQGQFAAP---VSSSEYMLMVKRMAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLE  517

Query  417   qelaeakkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
             QEL E KKALEE+  +Q E++AYIEKKKKKK + FGF
Sbjct  518   QELTETKKALEEALVSQKEILAYIEKKKKKKKLFFGF  554



>ref|XP_009109490.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 [Brassica rapa]
 ref|XP_009109491.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 [Brassica rapa]
 ref|XP_009109492.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH2 [Brassica rapa]
Length=535

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/563 (55%), Positives = 397/563 (71%), Gaps = 42/563 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             + R T+L SL+K AINA+NKF+HS   R RR SRV  V + DE D EE++ VDAFRQALI
Sbjct  12    EKRLTKLCSLKKKAINATNKFKHSMTKRGRRHSRVRCVSIVDEIDTEELRQVDAFRQALI  71

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRK++GADTI++DFDF E DEV
Sbjct  72    LEELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKDYGADTIMEDFDFGEIDEV  131

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRP+YIERLG VDA KLM+VTT+DRY+KYHV+EFE+T   K  +CS
Sbjct  132   VKYYPQGYHGVDKEGRPVYIERLGQVDAVKLMKVTTIDRYVKYHVKEFEKTFTVKFPACS  191

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  192   IAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDSDNYPETLNRMFIINAGYGFR  251

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             L+W+ VKSFLDPKTTAKI+VL NKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  252   LVWSGVKSFLDPKTTAKIHVLSNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSDKG  311

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  + +   EEKTI     V                   E  +
Sbjct  312   PWNDPEIFKLVQNGEGRCPRKSSSGIEEKTISVCKNVT------------------EEKR  353

Query  915   KLFPIQEETRQPDMYV-PMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
             ++F  +E  ++    +   +DKTVD   +    +   K +VP   DL  +  A + +   
Sbjct  354   EVFEPEETYKKAAAEMEKFIDKTVDTGAYPTQEHHKAKNIVPDPKDLL-LSPAVESK---  409

Query  738   SNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVT  559
                L   VM  +MGIV ++R+TKNMPRK T+  +Y             +G    P     
Sbjct  410   -GYLYGSVMALLMGIVGVMRLTKNMPRKRTQGNVYP------------YGVTVMP-----  451

Query  558   AAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkalees  379
               E+ AM+K+M  LEEK  ++      +  E+E++L  A+ R+D LE +L+E KKAL+E+
Sbjct  452   TQEYRAMVKKMTDLEEKCKSMEAAQVAISMEREKVLDAALRRVDQLELQLSETKKALDET  511

Query  378   qSNQNELIAYIEkkkkkKNIFGF  310
              + Q+E++AYIEKKKKKK  F F
Sbjct  512   MTRQHEIMAYIEKKKKKKRKFLF  534



>ref|XP_010263587.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Nelumbo nucifera]
Length=623

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/617 (52%), Positives = 403/617 (65%), Gaps = 55/617 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS +FRHS K 
Sbjct  1     MSGPLDRFARPCFEGFAGHDERRERKSDFENSEDERKTRIGSLKKKAINASTRFRHSLKK  60

Query  1911  rrrssR---VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFE  1741
             + R      V+SV ++D  D EE+++V+AFRQ L+LDELLP +HDDYHMMLRFLKARKF+
Sbjct  61    KSRRKSDGRVVSVSIEDVRDVEELRAVEAFRQTLLLDELLPERHDDYHMMLRFLKARKFD  120

Query  1740  IDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGL  1561
             I+K+K MWA+MLQWRKEFGADTI++DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG 
Sbjct  121   IEKAKHMWAEMLQWRKEFGADTIMEDFEFKELNEVLQYYPHGHHGVDKEGRPVYIERLGK  180

Query  1560  VDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFT  1381
             VD  KLMQVT MDRY++YHVQEFER+   K  +CSIAAK+HID STTILDVQGV LKNF+
Sbjct  181   VDPNKLMQVTNMDRYVRYHVQEFERSFAVKFPACSIAAKRHIDSSTTILDVQGVSLKNFS  240

Query  1380  KQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKY  1201
             K ARELI  LQKID DNYPETLCRM+IINAG GFRLLW+TVK+FLDPKTT+KI+VLGNKY
Sbjct  241   KAARELIMRLQKIDNDNYPETLCRMFIINAGPGFRLLWSTVKTFLDPKTTSKIHVLGNKY  300

Query  1200  QSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV  1021
              SKLLEIIDASELPDFLGG CTCAD+GGC+RSDKGPW DP I+KMV  G  +C  ++  V
Sbjct  301   HSKLLEIIDASELPDFLGGICTCADQGGCLRSDKGPWKDPNILKMVLNGEARCDRQVVTV  360

Query  1020  EEEK------------TIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR---  886
                +            TI             A+ +  P + +     +L P++EE +   
Sbjct  361   SNSEGKIITYARPYYPTIKSGEASTAESGSEAEDISSPKAIRSYLHPRLTPVREEAKVAA  420

Query  885   ---------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                      + D YVPMVDK VD   W    +    F   KG       E+ K  E    
Sbjct  421   KANYTVGFSEYDEYVPMVDKAVD-AGWKKQPSFQRPF-ASKGT--LPSPESQKTPEGVQA  476

Query  732   QLLTGVMTFVMGIVTMV-----RMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEP  568
             Q+    MTFVM +  ++     R+ K +P  L+     ++   L   + +    + PP P
Sbjct  477   QIFRLSMTFVMILYALLHSVTSRVLKKLPDPLSTCVPNTSEFSLKPASKE----FCPPSP  532

Query  567   A-VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
                T  + + +++KR+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   KK
Sbjct  533   TRFTETDLLSSVLKRLGELEEKVDILRLKPTEMPCEKEELLNAAVCRVDALEAELIATKK  592

Query  393   aleesqSNQNELIAYIE  343
             AL E+   Q EL+AYI+
Sbjct  593   ALHEALMRQEELLAYID  609



>ref|XP_010531442.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Tarenaya hassleriana]
Length=629

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/617 (53%), Positives = 410/617 (66%), Gaps = 53/617 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFLSNDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALI+DELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQALIMDELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWRKEF  DTII DF+F+E +EVL+YYP G+HGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRKEFCTDTIIQDFEFEEINEVLRYYPHGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTT+DRY+KYHV+EFER+   K  SC+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTIDRYVKYHVKEFERSFMIKFPSCTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQKIDGDNYPETL +M+IINAG GFRLLW TVKSFLDPKTT+KI+VL NK
Sbjct  241   TKSARELITRLQKIDGDNYPETLHQMFIINAGPGFRLLWGTVKSFLDPKTTSKIHVLSNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCSHRMA  1027
             YQSKLLE+IDASELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+    + 
Sbjct  301   YQSKLLEVIDASELPEFLGGACTCADQGGCMLSDKGPWKNPEILKMVLHGGAHRAKQVVK  360

Query  1026  RVEEEKTI--------PEDGGVNvsvsmsaksvk---kpaSFKIESTKKLFPIQEETR--  886
              +  E  +        P   G + S + S    +    P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPSYPWIKGSDTSTAESGSEAEDIGSPKAVKSYSHLRLTPVREEAKIV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD  +W V      + V  KGA +       K  E   
Sbjct  421   GETSLAGSFPGYDEYVPMVDKAVD-ASWKV--KPTIQRVASKGALM--PPNTSKAPEGIC  475

Query  735   NQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG---AYKPPEPA  565
              ++L  +M  VM +V   R   +   K   +T   N     +   +G G    ++PP PA
Sbjct  476   AKVLVMLMAIVMAVVMFFRTISSQVAKTLPNT-SQNEGTGTEVTSRGGGIQEEFRPPSPA  534

Query  564   --VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
                T A+ + +++K+++ LEEK  TL ++P  MP EKEE+L+ A+ R+DALE EL   KK
Sbjct  535   SPFTDADLLSSVLKKLSELEEKIGTLQSKPSEMPYEKEELLNAAVCRVDALEAELIATKK  594

Query  393   aleesqSNQNELIAYIE  343
             AL E+   Q EL+AYI+
Sbjct  595   ALYEALMRQEELLAYID  611



>dbj|BAF98225.1| CM0216.430.nc [Lotus japonicus]
Length=631

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/630 (50%), Positives = 410/630 (65%), Gaps = 74/630 (12%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERKERKSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP +HDDYH+MLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIIDELLPERHDDYHIMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADML+WRKEFGADTI++DF+FKE  EV+KYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DVEKAKHMWADMLRWRKEFGADTIMEDFEFKELSEVVKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VDA KLM+ TTMDRY+KYHVQEFE++   K  +C+IAAK+HI+ STTILDVQGVGLKNF
Sbjct  181   KVDANKLMEATTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIESSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             +K AREL+  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   SKSARELMMRLQKIDGDNYPETLCQMFIINAGHGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIID+SELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+K++  G  + + ++ +
Sbjct  301   YQSKLLEIIDSSELPEFLGGTCTCADQGGCLRSDKGPWKNPEILKIILSGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K I       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPRCPMIKGSDTSTAESGSETEDIASPKTMKSYSHLRLTPVREEAKVV  420

Query  885   ------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAY-----  757
                           D Y+PMVDK VD   W             K   L QIQ ++     
Sbjct  421   GKSNYAGSGNLAGYDEYIPMVDKAVD-AGW-------------KKQALLQIQRSHSTKGT  466

Query  756   -------KGQELASNQLLTGVMTFVMGIVTM-----VRMTKNMPRKLTESTLYSNSMHLN  613
                    K  E    ++   V  F + + T+      R+TK +P   +   L ++   L+
Sbjct  467   PPLPDTPKAPEGIQARIWVAVTFFFLTLWTLFLSVACRVTKKLPTVSSTDYLRTSEPTLD  526

Query  612   DHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSR  433
                 +  G+         A    +MMKR+  LEEK  TL ++P  MP EKEE+L+ A+ R
Sbjct  527   TTNKEDSGSSSLTAAHTEADLLSSMMKRLGELEEKVETLQSKPSEMPNEKEELLNAAVCR  586

Query  432   IDaleqelaeakkaleesqSNQNELIAYIE  343
             +DALE EL   KKAL  +   Q EL+AYI+
Sbjct  587   VDALEAELIATKKALYGALMRQEELLAYID  616



>ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
 gb|EOX97950.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
Length=641

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/624 (51%), Positives = 407/624 (65%), Gaps = 66/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS +F+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKAINASTRFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQALI++ELLP KHDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDQFRQALIMEELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWADMLQWRKEF ADTI +DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWADMLQWRKEFVADTITEDFEFKELNEVLRYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHV+EFE+    K  +C+IAAK+HID STTILDV GVG KNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVREFEKAFTVKFPACTIAAKRHIDSSTTILDVHGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDASELP+FLGG+CTC ++GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQSKLLEIIDASELPEFLGGSCTCVEQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  VEEEKTIPEDGGV-----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQE  895
             V     +  DG V                        A+ +  P + K  S  +L P++E
Sbjct  361   V-----LNSDGKVIAFAKPQYPMLKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVRE  415

Query  894   ETRQP------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGAD-LYQIQEAYK  754
             E +              D YVPMVDK VD  +W          + P  +     + E  K
Sbjct  416   EAKVVGKTNYAANFSGYDEYVPMVDKAVD-SSW----KKQTALLRPSASKGTLMLPETPK  470

Query  753   GQELASNQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHG  589
               E    ++L  VM F M + T++R     +TK +P  +++     N   L   A +   
Sbjct  471   TPEDIRARILVTVMAFFMTLYTLLRSVACHITKKLPDTVSDHC--QNVTQLTPDATQKEE  528

Query  588   AYKP-PEPAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                P P P+ T A+ + +++KR+  LEEK  TL  +P  MP EKEE+L+ A+ R+DALE 
Sbjct  529   FRPPSPTPSFTQADLLSSVLKRLGELEEKVDTLQAKPSEMPYEKEELLNAAVCRVDALEA  588

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  589   ELIATKKALHEALMRQEELLAYID  612



>ref|XP_010936685.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6 [Elaeis guineensis]
Length=562

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/558 (55%), Positives = 384/558 (69%), Gaps = 53/558 (9%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnk-frhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             D+R+TR+GSL+K AINAS K      K  RRSSRVMSV ++D  DAEE+++VDAFRQ LI
Sbjct  36    DERKTRIGSLKKKAINASTKFRNSLSKRGRRSSRVMSVSIEDVRDAEEMQAVDAFRQILI  95

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP++HDDYHMMLRFLKARKF+I+K+KQMWADMLQWRKEFGADTI++DF+FKE D+V
Sbjct  96    LEELLPSRHDDYHMMLRFLKARKFDIEKTKQMWADMLQWRKEFGADTIVEDFEFKELDQV  155

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             L+YYPQGHHGVDK+GRP+YIE+LG +D  KLMQVT MDRY+KYHV+EFERT N K  +CS
Sbjct  156   LEYYPQGHHGVDKEGRPVYIEKLGQIDTNKLMQVTNMDRYIKYHVKEFERTFNVKFPACS  215

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             +A K+HIDQSTTILDVQGVG+K F K AR+LI  LQKIDGDNYPETLCRM+I+NAG GFR
Sbjct  216   VAVKRHIDQSTTILDVQGVGMKQFNKVARDLISRLQKIDGDNYPETLCRMFIVNAGQGFR  275

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             LLWNTVK FLDPKTTAKI+VLGNKYQSKLLE+IDASELP+FLGGTC C  +GGC+RSDKG
Sbjct  276   LLWNTVKGFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFLGGTCNC--EGGCLRSDKG  333

Query  1095  PWNDPEIMKMVHQGAHKC--SHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa-----S  937
             PW DPEI+K+V  G  +C  S +     +EKTI ED   +     +  +           
Sbjct  334   PWKDPEILKIVQSGMARCGRSCQATSGADEKTISEDEKQDSFFGETILAADDVRPPSPIM  393

Query  936   FKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAY  757
              ++     L P++EE   P   V    ++   P    V +D+   +V K  D    +E  
Sbjct  394   SRVIEHPHLSPVREEVVSPSYQVQSAKESFPTP----VADDDFIPMVDKIVDANWSKEVM  449

Query  756   KGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKP  577
               ++LA ++      T V G     +M +++P                            
Sbjct  450   NEEQLAPSK-----ETMVKG-----QMQQHLPAS--------------------------  473

Query  576   PEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                 V+AAEF + MKR+  LEEK   LS +P  MP EKEE L +A+SR++A+E ELA  K
Sbjct  474   ---TVSAAEFSSAMKRLGELEEKVNILSMKPAEMPVEKEEQLKDAVSRVNAMEAELAATK  530

Query  396   kaleesqSNQNELIAYIE  343
             KALE++ + Q EL+AY++
Sbjct  531   KALEDALARQEELVAYVD  548



>ref|XP_007042117.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007042118.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOX97948.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOX97949.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=626

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/624 (51%), Positives = 407/624 (65%), Gaps = 66/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS +F+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKAINASTRFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQALI++ELLP KHDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDQFRQALIMEELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWADMLQWRKEF ADTI +DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWADMLQWRKEFVADTITEDFEFKELNEVLRYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHV+EFE+    K  +C+IAAK+HID STTILDV GVG KNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVREFEKAFTVKFPACTIAAKRHIDSSTTILDVHGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVK+FLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDASELP+FLGG+CTC ++GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQSKLLEIIDASELPEFLGGSCTCVEQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  VEEEKTIPEDGGV-----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQE  895
             V     +  DG V                        A+ +  P + K  S  +L P++E
Sbjct  361   V-----LNSDGKVIAFAKPQYPMLKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVRE  415

Query  894   ETRQP------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGAD-LYQIQEAYK  754
             E +              D YVPMVDK VD  +W          + P  +     + E  K
Sbjct  416   EAKVVGKTNYAANFSGYDEYVPMVDKAVD-SSW----KKQTALLRPSASKGTLMLPETPK  470

Query  753   GQELASNQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHG  589
               E    ++L  VM F M + T++R     +TK +P  +++     N   L   A +   
Sbjct  471   TPEDIRARILVTVMAFFMTLYTLLRSVACHITKKLPDTVSDHC--QNVTQLTPDATQKEE  528

Query  588   AYKP-PEPAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                P P P+ T A+ + +++KR+  LEEK  TL  +P  MP EKEE+L+ A+ R+DALE 
Sbjct  529   FRPPSPTPSFTQADLLSSVLKRLGELEEKVDTLQAKPSEMPYEKEELLNAAVCRVDALEA  588

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  589   ELIATKKALHEALMRQEELLAYID  612



>ref|XP_004968250.1| PREDICTED: uncharacterized protein LOC101763275 [Setaria italica]
Length=609

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/567 (54%), Positives = 395/567 (70%), Gaps = 21/567 (4%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALIL  1813
             D+++  + SL+K A++AS K RHS K  R+SS+VMS+ + DE D EEV++VDAFRQ L+L
Sbjct  34    DEKKAMIASLKKKAMSASQKLRHSMKRGRKSSKVMSISILDERDPEEVQAVDAFRQLLVL  93

Query  1812  DELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVL  1633
             +ELLP++HDDYHMMLRFLKARKF+I+K+KQMW+DML+WRKEFGADTI+++F+F+E D+V 
Sbjct  94    EELLPSQHDDYHMMLRFLKARKFDIEKAKQMWSDMLKWRKEFGADTILEEFEFEEADKVA  153

Query  1632  KYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSI  1453
             + YPQG+HGVDK+GRP+YIERLG +D  +LMQVTTMDR++K HV+EFE+    K  +CSI
Sbjct  154   QCYPQGYHGVDKEGRPVYIERLGQIDVNRLMQVTTMDRFVKNHVKEFEKNFAVKFPACSI  213

Query  1452  AAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRL  1273
             AAK+HIDQSTTILDVQGVG+K F+K ARELI  LQKIDGDNYPETLCRM+IINAG GFRL
Sbjct  214   AAKRHIDQSTTILDVQGVGMKQFSKAARELIGMLQKIDGDNYPETLCRMFIINAGQGFRL  273

Query  1272  LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGP  1093
             LW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+F GGTC C  +GGCM++DKGP
Sbjct  274   LWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFFGGTCQC--EGGCMKADKGP  331

Query  1092  WNDPEIMKMVHQGAHKCSHRMARVEEEKTIPED------------GGVNvsvsmsaksvk  949
             W DPEIMKMV  GA +C   ++   E+K I ED            G   ++        +
Sbjct  332   WKDPEIMKMVQSGAGQCVSLISEA-EDKVICEDDIIYPKIQASFNGEAQLAGDGQPTLSR  390

Query  948   kpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQI  769
             K +  +IE   +L P+ E+        P    + D+P      +  CK       +   I
Sbjct  391   KISRSRIEHP-QLSPVHEDLIPTSYPTPGSPYSCDVPMVEKAIDAICKSQGTLPDEKLAI  449

Query  768   QEAYKGQELASN-QLLTGVMTFVMGIVTMVRMTKNMPRKLTESTL----YSNSMHLNDHA  604
              +A       SN  L  G++  VM I TM+R+T+NMP K+  +T+     S ++  +   
Sbjct  450   TKAVVNASNGSNPPLFGGIIALVMSIATMLRVTRNMPGKVLGATIGGDAKSATLTKSKSK  509

Query  603   MKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDa  424
             ++     K    AV AAE +  MKR+A LEEK   L  +  TMP +KEEML  A++RI  
Sbjct  510   VQARQRSKLSPEAVKAAEDVISMKRLAELEEKIKALLTKSATMPADKEEMLQAAVTRIST  569

Query  423   leqelaeakkaleesqSNQNELIAYIE  343
             LE+ELA  KKAL+++   Q E+IAYIE
Sbjct  570   LEEELAATKKALQKTLECQGEIIAYIE  596



>gb|KHN25399.1| Sec14 cytosolic factor [Glycine soja]
Length=692

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/638 (51%), Positives = 413/638 (65%), Gaps = 90/638 (14%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKKERRSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  + EE ++VDAFRQALI++ELLP KHDDYH+MLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRNFEEQQAVDAFRQALIMEELLPEKHDDYHVMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFG DTI++DF+FKE DEV+KYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGTDTIMEDFEFKEVDEVVKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKAFKIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETLC+M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLCQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKL EIIDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI+KM+  G  + +  + +
Sbjct  301   YQSKLFEIIDASELPEFLGGTCTCADQGGCLRSDKGPWKNPEILKMILSGEARRARPVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksvkkpaSFKIE---STKKLFPIQEETRQP  880
             V   E K I       P   G + S + S    +  AS K+    S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYARPQYPMVKGSDTSTAESGSEAEDIASPKVTKSYSHLRLTPVREEAKVV  420

Query  879   --------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQ--  748
                           D YVPMVDK VD   W             K     Q  +  KG+  
Sbjct  421   GKLSSAGGGNLAGYDEYVPMVDKAVD-AAW-------------KNQASLQRSQTSKGKPP  466

Query  747   --------ELASNQLLTGVMTFVMGIVTM-----VRMTKNMP-------RKLTESTLYSN  628
                     E    +++  +  F M + T+      R+TK +P       +  +E TL   
Sbjct  467   LPDTPNPPEGIRARIVVALTVFFMTLFTLFHSFACRVTKKLPAVSSNDDQGTSEPTLDIT  526

Query  627   SMHLNDHAMKGHGAYKPPEPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
              ++ +D        Y+PP P    AE     +MMKR+  LE K  TL ++P  MP EKEE
Sbjct  527   KINNDD--------YRPPSPTPAYAEANLLSSMMKRLGELEVKVDTLQSKPSEMPYEKEE  578

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             +L+ A+ R+DALE EL   KKAL E+   Q EL+AYI+
Sbjct  579   LLNAAVCRVDALEAELIATKKALYEALMRQEELLAYID  616



>emb|CDX90317.1| BnaA08g16670D [Brassica napus]
Length=537

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/551 (55%), Positives = 388/551 (70%), Gaps = 40/551 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALI  1816
             + R T+L SL+K AINA+NKF+HS   R RR SRV  V + DE D EE++ VDAFRQALI
Sbjct  12    EKRLTKLCSLKKKAINATNKFKHSMTKRGRRHSRVRCVSIVDEIDTEELRQVDAFRQALI  71

Query  1815  LDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEV  1636
             L+ELLP+KHDD+HMMLRFL+ARKF+I+K+KQMWADML WRK++GADTI++DFDF E DEV
Sbjct  72    LEELLPSKHDDHHMMLRFLRARKFDIEKAKQMWADMLNWRKDYGADTIMEDFDFGEIDEV  131

Query  1635  LKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCS  1456
             +KYYPQG+HGVDK+GRP+YIERLG VDA KLM+VTT+DRY+KYHV+EFE+T   K  +CS
Sbjct  132   VKYYPQGYHGVDKEGRPVYIERLGQVDAVKLMKVTTIDRYVKYHVKEFEKTFTVKFPACS  191

Query  1455  IAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFR  1276
             IAAK+HIDQSTTILDVQGVGL NF K A++L+Q++QKID DNYPETL RM+IINAG GFR
Sbjct  192   IAAKRHIDQSTTILDVQGVGLNNFNKAAKDLLQSIQKIDSDNYPETLNRMFIINAGYGFR  251

Query  1275  LLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKG  1096
             L+W+ VKSFLDPKTTAKI+VL NKYQSKLLEIIDA+ELP+FLGG CTCADKGGCMRSDKG
Sbjct  252   LVWSGVKSFLDPKTTAKIHVLSNKYQSKLLEIIDANELPEFLGGKCTCADKGGCMRSDKG  311

Query  1095  PWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTK  916
             PWNDPEI K+V  G  +C  + +   EEKTI     V       ++          E+ K
Sbjct  312   PWNDPEIFKLVQNGEGRCPRKSSSGIEEKTISVCKNVTEEKREVSEPE--------ETYK  363

Query  915   KLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
             K     E+          +DKTVD   +    +   K +VP   DL  +  A +      
Sbjct  364   KAAAAMEK---------FIDKTVDTGAYPTQEHHKAKNIVPDPKDLL-LSPAVE----CK  409

Query  735   NQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTA  556
               L   VM  +MGIV ++R+TKNMP+KLT+  +Y + + +                 +  
Sbjct  410   GYLYGSVMALLMGIVGVMRLTKNMPKKLTQGNVYPDGVTV-----------------MPT  452

Query  555   AEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesq  376
              E+ AM+K+M  LEEK  ++      +  E+E++L  A+ R+D LE +L+E KKAL+E+ 
Sbjct  453   QEYRAMVKKMTDLEEKCKSMEAAQVAISMEREKVLDAALRRVDQLELQLSETKKALDETM  512

Query  375   SNQNELIAYIE  343
             + Q+E++AYIE
Sbjct  513   TRQHEIMAYIE  523



>emb|CDX75444.1| BnaA01g02580D [Brassica napus]
Length=534

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/561 (58%), Positives = 406/561 (72%), Gaps = 39/561 (7%)
 Frame = -2

Query  1980  TRLGSLRKAAINAsn--kfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDE  1807
              ++ SL+K AINASN  K   S K R+ SS+VM V ++D+ DAE+++S+DAFRQAL+LDE
Sbjct  9     AKMSSLKKKAINASNRFKNSFSKKGRKSSSKVMCVTIEDDIDAEDLQSLDAFRQALVLDE  68

Query  1806  LLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKY  1627
             LLP+  DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGADTII++F+F+E DEV+K+
Sbjct  69    LLPSNLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEEFEFEEIDEVMKH  128

Query  1626  YPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAA  1447
             YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T   K  +CS+AA
Sbjct  129   YPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVREFEKTFKIKFPACSVAA  188

Query  1446  KKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLW  1267
             KKHIDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+IINAGSGFRLLW
Sbjct  189   KKHIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFIINAGSGFRLLW  248

Query  1266  NTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWN  1087
             +TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKGGCMRSDKGPWN
Sbjct  249   STVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWN  308

Query  1086  DPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLF  907
             DPE++KM      KCS     + E+    +D G + S   S             S+KK+ 
Sbjct  309   DPEVLKMAINRESKCSP----ISEDDLKHDDQGRSTSFQESLD----------RSSKKM-  353

Query  906   PIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA-YKGQELASNQ  730
                +E    +  V  +DK+V    W         F V KG + Y  + A  KG  L    
Sbjct  354   ---DEDNVHEKQVATIDKSV--MEWPTKIQKIENFPVSKGLECYVTKGAPKKGDGL----  404

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAE  550
             L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS        +    +  P   V+++E
Sbjct  405   LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNS--------QNQAQFAAP---VSSSE  453

Query  549   FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSN  370
             +M M+KRMA LEEK + L  +P  +  E EE L  A++R+  LEQEL E KKALEE+   
Sbjct  454   YMLMVKRMAELEEKCMFLDLKPANVDTETEEKLQAALNRVQVLEQELTETKKALEETLVG  513

Query  369   QNELIAYIEkkkkkKNI-FGF  310
             Q E++AYIEKKKKKK + FGF
Sbjct  514   QKEILAYIEKKKKKKKLFFGF  534



>ref|XP_010555281.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Tarenaya hassleriana]
Length=633

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/619 (52%), Positives = 407/619 (66%), Gaps = 55/619 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGLLSSDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALI++ELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQALIMEELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWRKEFG DTII DF+F+E +EVLKYYP G+HGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRKEFGTDTIIQDFEFEEVNEVLKYYPHGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHV+EFER+   K  SC+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVKEFERSFMIKFPSCTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQK+DGDNYPETL +M+IINAG GFRLLW TVKSFLDPKTT+KI+VL NK
Sbjct  241   TKSARELITRLQKVDGDNYPETLHQMFIINAGPGFRLLWGTVKSFLDPKTTSKIHVLSNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCSHRMA  1027
             YQSKLLEIID+SELP+FLGG+CTCAD+GGCM SDKGPW +PEI+KMV H GAH+    + 
Sbjct  301   YQSKLLEIIDSSELPEFLGGSCTCADQGGCMLSDKGPWKNPEILKMVLHGGAHRAKQVVK  360

Query  1026  RVEEEKTI--------PEDGGVNvsvsmsaksvkkpaSFKIESTK---KLFPIQEETR--  886
              +  E  +        P   G + S + S    +   S K  ++    +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPSYPWIKGSDTSTAESGSEAEDIGSPKAVNSYPHLRLTPVREEAKIV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD  +W++      + V  KGA +       K  E   
Sbjct  421   GETSLACSFPGYDEYVPMVDKAVD-ASWNL--KPTIQRVPSKGALM--APNTPKAPERDR  475

Query  735   NQLLTGVMTFVMGIVTM-----VRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
              ++L   M  VM +VT       R+TK +P     S        L  +       ++PP 
Sbjct  476   AKVLIMFMAIVMAVVTFFRTMSCRVTKRLPTPANGSQNQGTGTELTSNG-GIQEEFRPPS  534

Query  570   PAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             PA    E     +++ ++  LEEK  TL ++P  MP EKEE+L+ A+ R+DALE EL   
Sbjct  535   PAPPFTESDLLSSVLNKLNELEEKIGTLQSKPSEMPCEKEELLNAAVCRVDALEAELIST  594

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q EL+AYI+
Sbjct  595   KKALYEALMRQEELLAYID  613



>ref|XP_003603968.1| Sec14 cytosolic factor [Medicago truncatula]
 gb|AES74219.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=623

 Score =   540 bits (1392),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 317/624 (51%), Positives = 409/624 (66%), Gaps = 69/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A++AS KF+HS + 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKRERRSDFENSEDERRTRIGSLKKKALSASTKFKHSLRK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP   DDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMDELLPQAFDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWR+EFGADTI+ DF+FKE +EV+KYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRREFGADTIMQDFEFKELNEVVKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELIQ LQK+DGDNYPETLC+M+IINAG GFRLLW+TVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARELIQRLQKVDGDNYPETLCQMFIINAGPGFRLLWSTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLE+IDASELP+FLGGTC+CAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQSKLLEVIDASELPEFLGGTCSCADEGGCLRSDKGPWKNPEILKMVLNGEPRRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K I       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPRYPMVKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEAKIA  420

Query  879   -----------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                        D YVPMVDK VD   W    +            L  IQ   +G +  + 
Sbjct  421   GKASYANMSGYDEYVPMVDKPVD-AEWKRQTSLQRSHTFKGTRPLPDIQNTPEGIKARAW  479

Query  732   QLLTGVMTFVMGIVTMV--RMTKNMP-------RKLTESTLYSNSMHLNDHAMKGHGAYK  580
               L      +  +   V  RMT  +P       ++++E TL + +M +            
Sbjct  480   VALAAFFLTLFALFRQVACRMTNKLPAISSNDDQRISEPTLETTNMEVL-----------  528

Query  579   PPEPAVTAAE-----FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                P+ + A+     F +++KR+  LEEK  TL ++P  MP EK E+L+ A+ R+DALE 
Sbjct  529   ---PSTSQAQTEENLFPSLLKRLGELEEKVDTLQSKPSEMPYEKAELLNAAVCRVDALEA  585

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  586   ELIATKKALYEALMRQEELLAYID  609



>ref|XP_010263586.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X3 [Nelumbo nucifera]
Length=641

 Score =   541 bits (1393),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 320/633 (51%), Positives = 404/633 (64%), Gaps = 69/633 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS +FRHS K 
Sbjct  1     MSGPLDRFARPCFEGFAGHDERRERKSDFENSEDERKTRIGSLKKKAINASTRFRHSLKK  60

Query  1911  rrrssR---VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFE  1741
             + R      V+SV ++D  D EE+++V+AFRQ L+LDELLP +HDDYHMMLRFLKARKF+
Sbjct  61    KSRRKSDGRVVSVSIEDVRDVEELRAVEAFRQTLLLDELLPERHDDYHMMLRFLKARKFD  120

Query  1740  IDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGL  1561
             I+K+K MWA+MLQWRKEFGADTI++DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG 
Sbjct  121   IEKAKHMWAEMLQWRKEFGADTIMEDFEFKELNEVLQYYPHGHHGVDKEGRPVYIERLGK  180

Query  1560  VDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFT  1381
             VD  KLMQVT MDRY++YHVQEFER+   K  +CSIAAK+HID STTILDVQGV LKNF+
Sbjct  181   VDPNKLMQVTNMDRYVRYHVQEFERSFAVKFPACSIAAKRHIDSSTTILDVQGVSLKNFS  240

Query  1380  KQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKY  1201
             K ARELI  LQKID DNYPETLCRM+IINAG GFRLLW+TVK+FLDPKTT+KI+VLGNKY
Sbjct  241   KAARELIMRLQKIDNDNYPETLCRMFIINAGPGFRLLWSTVKTFLDPKTTSKIHVLGNKY  300

Query  1200  QSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV  1021
              SKLLEIIDASELPDFLGG CTCAD+GGC+RSDKGPW DP I+KMV  G  +C  ++  V
Sbjct  301   HSKLLEIIDASELPDFLGGICTCADQGGCLRSDKGPWKDPNILKMVLNGEARCDRQVVTV  360

Query  1020  EEEK------------TIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR---  886
                +            TI             A+ +  P + +     +L P++EE +   
Sbjct  361   SNSEGKIITYARPYYPTIKSGEASTAESGSEAEDISSPKAIRSYLHPRLTPVREEAKVAA  420

Query  885   ---------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADL---------------  778
                      + D YVPMVDK VD   W    +    F   KG  L               
Sbjct  421   KANYTVGFSEYDEYVPMVDKAVD-AGWKKQPSFQRPF-ASKGQKLMFESLSPMDFTFSQG  478

Query  777   -YQIQEAYKGQELASNQLLTGVMTFVMGIVTMV-----RMTKNMPRKLTESTLYSNSMHL  616
                  E+ K  E    Q+    MTFVM +  ++     R+ K +P  L+     ++   L
Sbjct  479   TLPSPESQKTPEGVQAQIFRLSMTFVMILYALLHSVTSRVLKKLPDPLSTCVPNTSEFSL  538

Query  615   NDHAMKGHGAYKPPEPA-VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNA  442
                + +    + PP P   T  + + +++KR+  LEEK   L  +P  MP EKEE+L+ A
Sbjct  539   KPASKE----FCPPSPTRFTETDLLSSVLKRLGELEEKVDILRLKPTEMPCEKEELLNAA  594

Query  441   MSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             + R+DALE EL   KKAL E+   Q EL+AYI+
Sbjct  595   VCRVDALEAELIATKKALHEALMRQEELLAYID  627



>gb|KFK32889.1| hypothetical protein AALP_AA6G300800 [Arabis alpina]
Length=639

 Score =   541 bits (1393),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 325/622 (52%), Positives = 405/622 (65%), Gaps = 56/622 (9%)
 Frame = -2

Query  2055  NMSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfk  1915
             +MSG ++R  RP  E           K D +   D+R+TR+G L+K AINAS KF+HS K
Sbjct  2     SMSGPLDRYARPCFEGFLSSDEKKERKSDFENSEDERKTRIGVLKKKAINASTKFKHSLK  61

Query  1914  srrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARK  1747
              +    +    V SV ++D  D EE+++VDAFRQAL++DELLP +HDDYHMMLRFLKARK
Sbjct  62    KKNGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQALLIDELLPDRHDDYHMMLRFLKARK  121

Query  1746  FEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERL  1567
             F+I+K+KQMWADM+QWRKEFG DTII DFDF+E +EVLKYYP G+HGVDK+GRPIYIERL
Sbjct  122   FDIEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKYYPHGYHGVDKEGRPIYIERL  181

Query  1566  GLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKN  1387
             G VD  +LMQVT+MDRY++YHV+EFER    K  SC+IAAKKHID STTILDVQGVGLKN
Sbjct  182   GKVDPNRLMQVTSMDRYIRYHVKEFERCFMIKFPSCTIAAKKHIDSSTTILDVQGVGLKN  241

Query  1386  FTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGN  1207
             FTK ARELI  LQ IDG+NYPETL +M+IINAG GFRLLWNTVKSFLDPKT++KI+VLG 
Sbjct  242   FTKSARELITRLQSIDGNNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTSSKIHVLGY  301

Query  1206  KYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCSHRM  1030
             KYQSKLLE+ID +ELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+    +
Sbjct  302   KYQSKLLEVIDVNELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRAKQVV  361

Query  1029  ARVEEEKTI-----PEDGGVNvsvsmsaksvkkp------aSFKIESTKKLFPIQEETRQ  883
               +  E  +     P    +  S + +A+S           + K  S  +L P++EE + 
Sbjct  362   KVLNSEGKVIAYAKPSYAWIKGSDTSTAESGSDADDIGSPKAIKSFSHLRLTPVREEAKI  421

Query  882   P------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
                          D YVPMVDK VD   W V        V  KGA +       K  E  
Sbjct  422   AGETSLASSFPGYDEYVPMVDKAVD-ATWKV--KPAIHKVASKGALMSPT--VPKDPEGI  476

Query  738   SNQLLTGVMTFVMGIVTMVRM-----TKNMPRKLTES-TLYSNSMHLNDHAMKG-HGAYK  580
               ++L   MT+VM I T  R      TKN+P   T       N+  L  +   G    ++
Sbjct  477   QARVLIMFMTYVMAIFTFFRTVSYRATKNLPETTTSRPETKGNATELGCNGEGGVQEEFR  536

Query  579   PPEPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             PP P     E     ++MK++  LE K  TL ++P  MP EKEE+L+ A+ R+DALE EL
Sbjct  537   PPSPVPDQTETELLTSVMKKLTELEGKIGTLQSKPCEMPYEKEELLNAAVCRVDALEAEL  596

Query  408   aeakkaleesqSNQNELIAYIE  343
                KKAL E+   Q EL+AYI+
Sbjct  597   IATKKALYEALMRQEELLAYID  618



>ref|XP_009117393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Brassica rapa]
Length=634

 Score =   540 bits (1392),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 318/620 (51%), Positives = 411/620 (66%), Gaps = 55/620 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFLSSDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFR AL++DELLP++HDDYHMMLRFLKARKF
Sbjct  61    KSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRHALLIDELLPSRHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MW+DM+QWRKEFG DTI+ DFDF+E +EVLKYYP G+HGVDK+GRPIYIERLG
Sbjct  121   DIEKAKHMWSDMIQWRKEFGTDTILQDFDFEEINEVLKYYPHGYHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVT+MDRY++YHV+EFER+   K  +C+IAAKKHID +TTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTSMDRYVRYHVKEFERSFMIKFPACTIAAKKHIDSNTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQKIDGDNYPETL +M+I+NAG+GFRLLWNTVK F+DPKT++KI+VLG K
Sbjct  241   TKSARELITRLQKIDGDNYPETLHQMFIVNAGAGFRLLWNTVKGFIDPKTSSKIHVLGYK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCSHRMA  1027
             YQ+KLLE+IDA+ELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+    + 
Sbjct  301   YQTKLLEVIDANELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRAKQVVK  360

Query  1026  RVEEEKTI--------PEDGGVNvsvsmsaksvk---kpaSFKIESTKKLFPIQEETRQP  880
              +  E  +        P   G + S + S    +    P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPSYPWIKGSDTSTAESGSDAEDIGSPKAIKSFSHLRLTPVREEAKIA  420

Query  879   ------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD   W V      + V  KG  +     A K  E   
Sbjct  421   GETSLAGGLLGYDEYVPMVDKAVD-ATWKV--KPAIQRVASKGTLMSPT--APKDTEGIR  475

Query  735   NQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDH-AMKGHGAYKPP  574
              ++L  ++T+VM + T  R     + K +P  L ++  Y+  +  N   A       +PP
Sbjct  476   ARVLVMIITYVMAVFTFFRTVPFLVIKKLPASLPQTEGYATELGSNGEVAATTKEESRPP  535

Query  573   EPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P   +T  E + ++MK++  LE K  TL  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  536   SPVPDLTETELLTSVMKKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIA  595

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  596   TKKALYEALMRQEELLAYID  615



>ref|XP_004951982.1| PREDICTED: uncharacterized protein LOC101773137 isoform X3 [Setaria 
italica]
Length=653

 Score =   541 bits (1393),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 318/620 (51%), Positives = 409/620 (66%), Gaps = 64/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-------------KMDLDADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E               ++  D+++TR+GSL+K AI+AS K RHS K 
Sbjct  1     MSGHLDRLARPCFEGCSSHDERRDHKSDFEISEDEKKTRMGSLKKKAIDASTKIRHSLKK  60

Query  1911  rrrss--RVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
              RR S  RV+SV ++D  D EE+++V+AFRQAL+LDELLP +HDDYHMMLRFLKARK +I
Sbjct  61    NRRKSGSRVLSVSIEDVRDLEELRAVEAFRQALLLDELLPARHDDYHMMLRFLKARKMDI  120

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             +K+KQMW DMLQWRKE+G DTI+DDF++ E D VL+YYP G+HGVDK+GRP+YIERLG V
Sbjct  121   EKAKQMWTDMLQWRKEYGTDTIVDDFEYSELDAVLQYYPHGYHGVDKEGRPVYIERLGKV  180

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D +KLM VTTMDRY+KYHV+EFER+ + K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  181   DPSKLMNVTTMDRYVKYHVKEFERSFSIKFPACSLAAKRHIDSSTTILDVQGVGLKNFSK  240

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELIQ LQKID DNYPETL +M+I+NAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQ
Sbjct  241   TARELIQRLQKIDNDNYPETLYQMFIVNAGPGFRLLWSTVKSFLDPKTTAKIHVLGNKYQ  300

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
              KLLEIIDASELP+FLGGTCTC + GGC++ +KGPW DP I+K+V  G  +C+ ++  + 
Sbjct  301   PKLLEIIDASELPEFLGGTCTCPEYGGCLKGEKGPWKDPNILKLVQSGEVQCARQIVTIS  360

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +       A     S  KL P++EE     
Sbjct  361   NGEEKFISYAKPKHHNTRGSDTSTAESGSEADDVTSPKALRSYISHPKLTPVREEVKVVR  420

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W          + PK + L   + A +  + + +++
Sbjct  421   ATSFSTRLPEYDVPVVDKAVD-ATWKREQPRKTP-LPPKDSSL---KTATRPSDSSLDKI  475

Query  726   LTGVMTFVMGIVTMVR-----MTKNMPRKL----TESTLYSNSMHLNDHAMKGHGAYKPP  574
             +  +M  +M IV +VR      TK +P K     + STLY +S             ++PP
Sbjct  476   VATLMACLMAIVMLVRSVKDLATKRLPYKTESEESYSTLYPDST---------KEEFRPP  526

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    AE   F A+++R+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  527   SPTPGFAEADLFAAVLQRLGELEEKVQMLQEKPSEMPCEKEELLNAAVRRVDALEAELIV  586

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  587   TKKALHEALIRQEELLAYID  606



>ref|XP_004951981.1| PREDICTED: uncharacterized protein LOC101773137 isoform X2 [Setaria 
italica]
Length=659

 Score =   541 bits (1393),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 313/620 (50%), Positives = 405/620 (65%), Gaps = 64/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-------------KMDLDADDRQTRLGSLRKAAINAsnkf--rhsf  1918
             MSG ++R  RP  E               ++  D+++TR+GSL+K AI+AS K       
Sbjct  37    MSGHLDRLARPCFEGCSSHDERRDHKSDFEISEDEKKTRMGSLKKKAIDASTKIRHSLKK  96

Query  1917  ksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
               R+  SRV+SV ++D  D EE+++V+AFRQAL+LDELLP +HDDYHMMLRFLKARK +I
Sbjct  97    NRRKSGSRVLSVSIEDVRDLEELRAVEAFRQALLLDELLPARHDDYHMMLRFLKARKMDI  156

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             +K+KQMW DMLQWRKE+G DTI+DDF++ E D VL+YYP G+HGVDK+GRP+YIERLG V
Sbjct  157   EKAKQMWTDMLQWRKEYGTDTIVDDFEYSELDAVLQYYPHGYHGVDKEGRPVYIERLGKV  216

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D +KLM VTTMDRY+KYHV+EFER+ + K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  217   DPSKLMNVTTMDRYVKYHVKEFERSFSIKFPACSLAAKRHIDSSTTILDVQGVGLKNFSK  276

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELIQ LQKID DNYPETL +M+I+NAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQ
Sbjct  277   TARELIQRLQKIDNDNYPETLYQMFIVNAGPGFRLLWSTVKSFLDPKTTAKIHVLGNKYQ  336

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
              KLLEIIDASELP+FLGGTCTC + GGC++ +KGPW DP I+K+V  G  +C+ ++  + 
Sbjct  337   PKLLEIIDASELPEFLGGTCTCPEYGGCLKGEKGPWKDPNILKLVQSGEVQCARQIVTIS  396

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +       A     S  KL P++EE     
Sbjct  397   NGEEKFISYAKPKHHNTRGSDTSTAESGSEADDVTSPKALRSYISHPKLTPVREEVKVVR  456

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W          + PK + L   + A +  + + +++
Sbjct  457   ATSFSTRLPEYDVPVVDKAVDA-TWKREQPRKTP-LPPKDSSL---KTATRPSDSSLDKI  511

Query  726   LTGVMTFVMGIVTMVR-----MTKNMPRKL----TESTLYSNSMHLNDHAMKGHGAYKPP  574
             +  +M  +M IV +VR      TK +P K     + STLY +S             ++PP
Sbjct  512   VATLMACLMAIVMLVRSVKDLATKRLPYKTESEESYSTLYPDST---------KEEFRPP  562

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    AE   F A+++R+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  563   SPTPGFAEADLFAAVLQRLGELEEKVQMLQEKPSEMPCEKEELLNAAVRRVDALEAELIV  622

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  623   TKKALHEALIRQEELLAYID  642



>ref|XP_011088432.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Sesamum indicum]
 ref|XP_011088433.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Sesamum indicum]
Length=624

 Score =   540 bits (1390),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 318/624 (51%), Positives = 414/624 (66%), Gaps = 68/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGSSGNDERRERKSDFENSEDERRTRIGSLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  DAEE+++V++FRQALILDELLP K DDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDIRDAEELQAVESFRQALILDELLPEKFDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+KSK MWADM+QWRKEFG DTI +DF+FKE +EVLKYYP G+HGVDK+GRPIYIERLG
Sbjct  121   DIEKSKLMWADMIQWRKEFGTDTITEDFEFKELNEVLKYYPHGYHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHV+EFER+   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYIKYHVKEFERSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVK+F+DP+T  KI+VLGNK
Sbjct  241   TKSARDLITRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKNFIDPRTATKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ KLLEIIDAS+LP+FLGGTCTCAD+GGC+RSDKGPW +P+I+KMV  G  + + ++ +
Sbjct  301   YQHKLLEIIDASQLPEFLGGTCTCADQGGCLRSDKGPWKNPDILKMVLNGEARRARQVVK  360

Query  1023  VEEEKTIPEDGGV----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQEE  892
             +     I  DG V                       A+ +  P + +  S  +L P++EE
Sbjct  361   I-----INSDGKVVFAKPHYPMLKGSDTSTAESGSEAEDIASPKATRSYSHLRLTPVREE  415

Query  891   TRQP------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQ  748
              +              D YVPMVDK VD   W         +V     +++   ++ K +
Sbjct  416   GKAIGTAAYAGNFSGYDEYVPMVDKAVD-SGWKKPMPPPKLYV---SREMFSPPDSQKAE  471

Query  747   ELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHG------A  586
             E    +LL  +MTF M I+   R   ++  ++T+    ++S H  +H ++          
Sbjct  472   EGFRARLLAALMTFFMSILLFFR---SISCRVTKRLPDTSSQH--EHIIQEFSFDTPKEE  526

Query  585   YKPPE--PAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
             ++PP   P+ T AE + ++MKR+  LE+K  TL  +P  MP EKEE+L+ A+ R+DALE 
Sbjct  527   FRPPSPTPSFTEAELLSSVMKRLVELEDKVNTLQAKPSEMPYEKEELLNAAVYRVDALEA  586

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  587   ELIATKKALYEALMKQEELLAYID  610



>ref|XP_002306120.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
 gb|EEE86631.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
Length=636

 Score =   540 bits (1391),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 319/618 (52%), Positives = 407/618 (66%), Gaps = 56/618 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGNDERRERKSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQAL++DELLP KHDDYHMMLRFLKARKF
Sbjct  61    KSNRRKSDGRVSSVSIEDVRDVEELQAVDQFRQALVMDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFG DTI++DF+FKE DEVLKYYP G+HGVDK+GRPIYIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGTDTIMEDFEFKELDEVLKYYPHGNHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              V+  KLM VTTMDRY++YHV+EFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVEPNKLMHVTTMDRYVRYHVREFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
              K AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNT+K+FLDPKTT+KI+VLGNK
Sbjct  241   NKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTIKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLEIIDASELP+FLGGTCTCA +GGC++SDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQTKLLEIIDASELPEFLGGTCTCACQGGCLQSDKGPWKNPEILKMVLNGEPRRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K I       P   G + S + S         P + K  S  +L P++EE R  
Sbjct  361   VLNSEGKVIAYAKPRYPMFKGSDTSTAESGSEAEDIASPKTLKSYSHLRLTPVREEARVV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD   W     +      P       +    K  E   
Sbjct  421   GKAGYGGSFPGYDEYVPMVDKAVD-AGW----KNPAAIQRPVSKATITLPNTEKTPEGVR  475

Query  735   NQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
              ++   VM F M ++T+ R     +TK +P  L++    S  + L D   K     +PP 
Sbjct  476   VRIFIAVMAFFMTLLTLFRSLAFQVTKRLPGTLSDCDQSSPELAL-DATQKEEC--RPPS  532

Query  570   P--AVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
             P  A T  +  +++KR+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   K
Sbjct  533   PTAAFTETDLSSVLKRLGELEEKVDILQAKPSVMPYEKEELLNAAVCRVDALEAELIATK  592

Query  396   kaleesqSNQNELIAYIE  343
             KAL E+   Q EL+AYI+
Sbjct  593   KALYEALMRQEELLAYID  610



>ref|XP_008377274.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Malus domestica]
Length=623

 Score =   539 bits (1389),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 316/618 (51%), Positives = 411/618 (67%), Gaps = 58/618 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K +       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVLAYAKPQYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKAV  420

Query  879   ------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD  NW        K V  +     ++ +  K  E   
Sbjct  421   GKANCAGHFSGYDEYVPMVDKAVDT-NWK-------KQVALQRTHSSKVPDTPKNPEGIQ  472

Query  735   NQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYKPPEP  568
              ++L  +M F M  +T+ R +   + RKL ++ +  N       +D A K  G  +PP P
Sbjct  473   GRILVALMAFFMTFLTLFRSVASQVTRKLPDALVNHNQNIPESTSDEANKEEG--RPPSP  530

Query  567   A--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
                +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   K
Sbjct  531   TSPITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAELIATK  590

Query  396   kaleesqSNQNELIAYIE  343
             KAL E+   Q EL+AYI+
Sbjct  591   KALHEALMRQEELLAYID  608



>gb|KFK32888.1| hypothetical protein AALP_AA6G300800 [Arabis alpina]
Length=643

 Score =   540 bits (1391),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 325/626 (52%), Positives = 405/626 (65%), Gaps = 60/626 (10%)
 Frame = -2

Query  2055  NMSGAVERPLRPS---------------AEKMDLD--ADDRQTRLGSLRKAAINAsnkfr  1927
             +MSG ++R  RPS                 K D +   D+R+TR+G L+K AINAS KF+
Sbjct  2     SMSGPLDRYARPSFCTGFEGFLSSDEKKERKSDFENSEDERKTRIGVLKKKAINASTKFK  61

Query  1926  hsfksrrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFL  1759
             HS K +    +    V SV ++D  D EE+++VDAFRQAL++DELLP +HDDYHMMLRFL
Sbjct  62    HSLKKKNGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQALLIDELLPDRHDDYHMMLRFL  121

Query  1758  KARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIY  1579
             KARKF+I+K+KQMWADM+QWRKEFG DTII DFDF+E +EVLKYYP G+HGVDK+GRPIY
Sbjct  122   KARKFDIEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKYYPHGYHGVDKEGRPIY  181

Query  1578  IERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGV  1399
             IERLG VD  +LMQVT+MDRY++YHV+EFER    K  SC+IAAKKHID STTILDVQGV
Sbjct  182   IERLGKVDPNRLMQVTSMDRYIRYHVKEFERCFMIKFPSCTIAAKKHIDSSTTILDVQGV  241

Query  1398  GLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKIN  1219
             GLKNFTK ARELI  LQ IDG+NYPETL +M+IINAG GFRLLWNTVKSFLDPKT++KI+
Sbjct  242   GLKNFTKSARELITRLQSIDGNNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTSSKIH  301

Query  1218  VLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKC  1042
             VLG KYQSKLLE+ID +ELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+ 
Sbjct  302   VLGYKYQSKLLEVIDVNELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRA  361

Query  1041  SHRMARVEEEKTI-----PEDGGVNvsvsmsaksvkkp------aSFKIESTKKLFPIQE  895
                +  +  E  +     P    +  S + +A+S           + K  S  +L P++E
Sbjct  362   KQVVKVLNSEGKVIAYAKPSYAWIKGSDTSTAESGSDADDIGSPKAIKSFSHLRLTPVRE  421

Query  894   ETRQP------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG  751
             E +              D YVPMVDK VD   W V        V  KGA +       K 
Sbjct  422   EAKIAGETSLASSFPGYDEYVPMVDKAVD-ATWKV--KPAIHKVASKGALMSPT--VPKD  476

Query  750   QELASNQLLTGVMTFVMGIVTMVRM-----TKNMPRKLTES-TLYSNSMHLNDHAMKG-H  592
              E    ++L   MT+VM I T  R      TKN+P   T       N+  L  +   G  
Sbjct  477   PEGIQARVLIMFMTYVMAIFTFFRTVSYRATKNLPETTTSRPETKGNATELGCNGEGGVQ  536

Query  591   GAYKPPEPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDal  421
               ++PP P     E     ++MK++  LE K  TL ++P  MP EKEE+L+ A+ R+DAL
Sbjct  537   EEFRPPSPVPDQTETELLTSVMKKLTELEGKIGTLQSKPCEMPYEKEELLNAAVCRVDAL  596

Query  420   eqelaeakkaleesqSNQNELIAYIE  343
             E EL   KKAL E+   Q EL+AYI+
Sbjct  597   EAELIATKKALYEALMRQEELLAYID  622



>ref|XP_004951980.1| PREDICTED: uncharacterized protein LOC101773137 isoform X1 [Setaria 
italica]
Length=689

 Score =   541 bits (1394),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 313/620 (50%), Positives = 405/620 (65%), Gaps = 64/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-------------KMDLDADDRQTRLGSLRKAAINAsnkf--rhsf  1918
             MSG ++R  RP  E               ++  D+++TR+GSL+K AI+AS K       
Sbjct  37    MSGHLDRLARPCFEGCSSHDERRDHKSDFEISEDEKKTRMGSLKKKAIDASTKIRHSLKK  96

Query  1917  ksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
               R+  SRV+SV ++D  D EE+++V+AFRQAL+LDELLP +HDDYHMMLRFLKARK +I
Sbjct  97    NRRKSGSRVLSVSIEDVRDLEELRAVEAFRQALLLDELLPARHDDYHMMLRFLKARKMDI  156

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             +K+KQMW DMLQWRKE+G DTI+DDF++ E D VL+YYP G+HGVDK+GRP+YIERLG V
Sbjct  157   EKAKQMWTDMLQWRKEYGTDTIVDDFEYSELDAVLQYYPHGYHGVDKEGRPVYIERLGKV  216

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D +KLM VTTMDRY+KYHV+EFER+ + K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  217   DPSKLMNVTTMDRYVKYHVKEFERSFSIKFPACSLAAKRHIDSSTTILDVQGVGLKNFSK  276

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELIQ LQKID DNYPETL +M+I+NAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQ
Sbjct  277   TARELIQRLQKIDNDNYPETLYQMFIVNAGPGFRLLWSTVKSFLDPKTTAKIHVLGNKYQ  336

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
              KLLEIIDASELP+FLGGTCTC + GGC++ +KGPW DP I+K+V  G  +C+ ++  + 
Sbjct  337   PKLLEIIDASELPEFLGGTCTCPEYGGCLKGEKGPWKDPNILKLVQSGEVQCARQIVTIS  396

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +       A     S  KL P++EE     
Sbjct  397   NGEEKFISYAKPKHHNTRGSDTSTAESGSEADDVTSPKALRSYISHPKLTPVREEVKVVR  456

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W          + PK + L   + A +  + + +++
Sbjct  457   ATSFSTRLPEYDVPVVDKAVDA-TWKREQPRKTP-LPPKDSSL---KTATRPSDSSLDKI  511

Query  726   LTGVMTFVMGIVTMVR-----MTKNMPRKL----TESTLYSNSMHLNDHAMKGHGAYKPP  574
             +  +M  +M IV +VR      TK +P K     + STLY +S             ++PP
Sbjct  512   VATLMACLMAIVMLVRSVKDLATKRLPYKTESEESYSTLYPDST---------KEEFRPP  562

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    AE   F A+++R+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  563   SPTPGFAEADLFAAVLQRLGELEEKVQMLQEKPSEMPCEKEELLNAAVRRVDALEAELIV  622

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  623   TKKALHEALIRQEELLAYID  642



>ref|XP_009117392.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Brassica rapa]
Length=638

 Score =   540 bits (1390),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 318/624 (51%), Positives = 411/624 (66%), Gaps = 59/624 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPS---------------AEKMDLD--ADDRQTRLGSLRKAAINAsnkfrh  1924
             MSG ++R  RPS                 K D +   D+R+TR+GSL+K AINAS KF+H
Sbjct  1     MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKH  60

Query  1923  sfksrrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLK  1756
             S K +    +    V SV ++D  D EE+++VDAFR AL++DELLP++HDDYHMMLRFLK
Sbjct  61    SLKKKSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRHALLIDELLPSRHDDYHMMLRFLK  120

Query  1755  ARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYI  1576
             ARKF+I+K+K MW+DM+QWRKEFG DTI+ DFDF+E +EVLKYYP G+HGVDK+GRPIYI
Sbjct  121   ARKFDIEKAKHMWSDMIQWRKEFGTDTILQDFDFEEINEVLKYYPHGYHGVDKEGRPIYI  180

Query  1575  ERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVG  1396
             ERLG VD  KLMQVT+MDRY++YHV+EFER+   K  +C+IAAKKHID +TTILDVQGVG
Sbjct  181   ERLGKVDPNKLMQVTSMDRYVRYHVKEFERSFMIKFPACTIAAKKHIDSNTTILDVQGVG  240

Query  1395  LKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINV  1216
             LKNFTK ARELI  LQKIDGDNYPETL +M+I+NAG+GFRLLWNTVK F+DPKT++KI+V
Sbjct  241   LKNFTKSARELITRLQKIDGDNYPETLHQMFIVNAGAGFRLLWNTVKGFIDPKTSSKIHV  300

Query  1215  LGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCS  1039
             LG KYQ+KLLE+IDA+ELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+  
Sbjct  301   LGYKYQTKLLEVIDANELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRAK  360

Query  1038  HRMARVEEEKTI--------PEDGGVNvsvsmsaksvk---kpaSFKIESTKKLFPIQEE  892
               +  +  E  +        P   G + S + S    +    P + K  S  +L P++EE
Sbjct  361   QVVKVLNSEGKVIAYAKPSYPWIKGSDTSTAESGSDAEDIGSPKAIKSFSHLRLTPVREE  420

Query  891   TRQP------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQ  748
              +              D YVPMVDK VD   W V      + V  KG  +     A K  
Sbjct  421   AKIAGETSLAGGLLGYDEYVPMVDKAVD-ATWKV--KPAIQRVASKGTLMSPT--APKDT  475

Query  747   ELASNQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDH-AMKGHGA  586
             E    ++L  ++T+VM + T  R     + K +P  L ++  Y+  +  N   A      
Sbjct  476   EGIRARVLVMIITYVMAVFTFFRTVPFLVIKKLPASLPQTEGYATELGSNGEVAATTKEE  535

Query  585   YKPPEPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
              +PP P   +T  E + ++MK++  LE K  TL  +P  MP EKEE+L+ A+ R+DALE 
Sbjct  536   SRPPSPVPDLTETELLTSVMKKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEA  595

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  596   ELIATKKALYEALMRQEELLAYID  619



>ref|XP_006646841.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Oryza brachyantha]
Length=624

 Score =   539 bits (1388),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 314/624 (50%), Positives = 407/624 (65%), Gaps = 71/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkf--rhsf  1918
             MSG ++R  RP  E           K D++   DD++TR+GSL+K AI+AS K       
Sbjct  1     MSGHLDRLARPCFEGSSSNDDRRDHKSDVENSEDDKRTRMGSLKKKAIDASTKIRHSLKK  60

Query  1917  ksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
             K RR  SRV+SV ++D  D EE+++V+AFRQALILDELLP KHDDYHMMLRFLKAR+F+I
Sbjct  61    KKRRSGSRVLSVSIEDVRDLEELQAVEAFRQALILDELLPAKHDDYHMMLRFLKARRFDI  120

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             +K+KQMW DML+WR E+G DTI+DDFD+ E + VL+YYP G+HGVDKDGRP+YIERLG V
Sbjct  121   EKAKQMWTDMLKWRNEYGTDTIVDDFDYSELEAVLQYYPHGYHGVDKDGRPVYIERLGKV  180

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D  KLM VTTMDRY++YHV+EFER+   K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  181   DPNKLMHVTTMDRYVRYHVKEFERSFLIKFPACSLAAKRHIDSSTTILDVQGVGLKNFSK  240

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELI  LQKID DNYPETL +M+I+NAG GFRLLWNTVKSFLDPKTT+KI+VLGNKYQ
Sbjct  241   TARELIIRLQKIDNDNYPETLYQMFIVNAGPGFRLLWNTVKSFLDPKTTSKIHVLGNKYQ  300

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
             +KLLE+IDA ELP+FLGGTCTC + GGC++++KGPW DP I+ +V  G  +C+ ++  + 
Sbjct  301   NKLLEVIDARELPEFLGGTCTCPEYGGCLKAEKGPWKDPNILNIVLSGEAQCARQIVTIS  360

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +       A     S  KL P++EE     
Sbjct  361   NGEEKIISYAKSKYHTIRGSDTSTAESGSEADDVTSPKALRSYISHPKLTPVREEVKMVR  420

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN--  733
                  TR P+  VP+VDK VD   W        K  +P+         +    E +SN  
Sbjct  421   ATSFSTRMPEYDVPVVDKAVD-ATW--------KREMPRMPAFSSKDSSLASTERSSNGS  471

Query  732   --QLLTGVMTFVMGIVTMVR-----MTKNMPRKLTE----STLYSNSMHLNDHAMKGHGA  586
               +++  ++   M +VT+V+      TK +P K       STLY +SM   +        
Sbjct  472   WDRMVAVLVAIFMAVVTLVQSVKYLATKRLPYKDESEQQCSTLYPDSMPKEE--------  523

Query  585   YKPPEPA---VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
             ++PP P    V A  F ++++R++ LEEKF+ L  +P  MP EKEE+L+ A+ R+DALE 
Sbjct  524   FRPPSPTPAFVEAELFSSVLQRLSELEEKFVMLQEKPSEMPCEKEELLNAAVRRVDALEA  583

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  584   ELIVTKKALHEALIRQEELLAYID  607



>ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|ESR36594.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|KDO47888.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
 gb|KDO47889.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=623

 Score =   538 bits (1387),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 315/619 (51%), Positives = 407/619 (66%), Gaps = 59/619 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMDELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWA+MLQWRKEFG DTI++DF+FKE +EVL YYP G+HGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWAEMLQWRKEFGVDTIMEDFEFKEINEVLSYYPHGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD+ KLMQVTTMDRY++YHVQ FE+    K  +C+IAAK+HID ST+ILDVQGVGLKNF
Sbjct  181   KVDSNKLMQVTTMDRYIRYHVQGFEKAFAVKFPACTIAAKRHIDSSTSILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             +K ARELI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   SKNARELILRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDA ELP+FLGGTC CAD+GGC+RSDKGPW +PEI+KMV  G    + ++ +
Sbjct  301   YQSKLLEIIDARELPEFLGGTCNCADQGGCLRSDKGPWQNPEILKMVLNGGAPRARQIVK  360

Query  1023  VEEEKTIPEDGGV---------------NvsvsmsaksvkkpaSFKIESTKKLFPIQEET  889
             V     +  DG V                      A+ +  P + K  S  +L P++EE 
Sbjct  361   V-----LNSDGKVIAYAKPPMLKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEA  415

Query  888   R------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQE  745
             +              D YVPMVDK VD  +W      + +    KG+ L Q+  + K  E
Sbjct  416   KVVGKTSYAGSFSGYDEYVPMVDKAVD-SSWK--KQPSLRSPAAKGS-LPQLPTS-KTPE  470

Query  744   LASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA--YKPPE  571
                 ++   VM F M  VT+ R            T   + +++++ A+  +    ++PP 
Sbjct  471   GIRARIWAAVMAFFMMFVTLFRSVAYRVTHRIPETSTGHDLNISEVAVDANEKEEFRPPS  530

Query  570   PAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             P+ +  E     ++ KR++ LEEK  TL  +P  MP EKEE+L  A+ R+DALE EL   
Sbjct  531   PSPSLTEVDLLSSVTKRLSELEEKVDTLQAKPSEMPYEKEELLHAAVCRVDALEAELIAT  590

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q +L+AYI+
Sbjct  591   KKALHEALMRQEDLLAYID  609



>ref|XP_006384514.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa]
 gb|ERP62311.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa]
Length=625

 Score =   538 bits (1387),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 319/618 (52%), Positives = 407/618 (66%), Gaps = 56/618 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS+KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGNDERRERKSDFENSEDERRTRIGSLKKKALNASSKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQAL++DELLP KHDDYHMMLRFLKARKF
Sbjct  61    KSNRRKSDGRVSSVSIEDVRDVEELQAVDQFRQALVMDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+++K MWADMLQWRKEFG DTI++DF+FKE DEVLKYYP G+HGVDK+GRPIYIERLG
Sbjct  121   DIERAKHMWADMLQWRKEFGTDTIMEDFEFKELDEVLKYYPHGNHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              V+  KLM VTTMDRY++YHV+EFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVEPNKLMHVTTMDRYVRYHVREFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
              K AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNT+K+FLDPKTT+KI+VLGNK
Sbjct  241   NKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTIKTFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLEIIDASELP+FLGGTCTCA +GGC++SDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQTKLLEIIDASELPEFLGGTCTCACQGGCLQSDKGPWKNPEILKMVLNGEPRRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETR--  886
             V   E K I       P   G + S + S         P + K  S  +L P++EE R  
Sbjct  361   VLNSEGKVIAYAKPRYPMFKGSDTSTAESGSEAEDIASPKTLKSYSHLRLTPVREEARVV  420

Query  885   ----------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD   W     +      P       +    K  E   
Sbjct  421   GKAGYGGSFPGYDEYVPMVDKAVD-AGW----KNPAAIQRPVSKATITLPNTEKTPEGVR  475

Query  735   NQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
              ++   VM F M ++T+ R     +TK +P  L++    S  + L D   K     +PP 
Sbjct  476   VRIFIAVMAFFMTLLTLFRSLAFQVTKRLPGTLSDCDQSSPELAL-DATQKEEC--RPPS  532

Query  570   P--AVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeak  397
             P  A T  +  +++KR+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   K
Sbjct  533   PTAAFTETDLSSVLKRLGELEEKVDILQAKPSVMPYEKEELLNAAVCRVDALEAELIATK  592

Query  396   kaleesqSNQNELIAYIE  343
             KAL E+   Q EL+AYI+
Sbjct  593   KALYEALMRQEELLAYID  610



>emb|CDX69071.1| BnaC01g03820D [Brassica napus]
Length=534

 Score =   535 bits (1378),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 323/561 (58%), Positives = 405/561 (72%), Gaps = 39/561 (7%)
 Frame = -2

Query  1980  TRLGSLRKAAINAsn--kfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDE  1807
              ++ SL+K AINASN  K   S K R+ SS+VM V ++D+ DAE+++S+DAFRQAL+LDE
Sbjct  9     AKMSSLKKKAINASNRFKNSFSKKGRKSSSKVMCVTIEDDIDAEDLQSLDAFRQALVLDE  68

Query  1806  LLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKY  1627
             LLP+  DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGAD II++F+F+E DEV+K+
Sbjct  69    LLPSNLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADKIIEEFEFEEIDEVMKH  128

Query  1626  YPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAA  1447
             YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T   K  +CS+AA
Sbjct  129   YPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVREFEKTFKIKFPACSVAA  188

Query  1446  KKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLW  1267
             KKHIDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+IINAGSGFRLLW
Sbjct  189   KKHIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFIINAGSGFRLLW  248

Query  1266  NTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWN  1087
             +TVKSFLDPKTTAKI+VLGNKY SKLLE+IDAS+LP+F GG CTC DKGGCMRSDKGPWN
Sbjct  249   STVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASDLPEFFGGACTCEDKGGCMRSDKGPWN  308

Query  1086  DPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLF  907
             DPE++KM      KCS     + E+     D G + S   S             S+KK+ 
Sbjct  309   DPEVLKMAINRESKCSP----ISEDDLKHVDQGRSTSFQESLD----------RSSKKM-  353

Query  906   PIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA-YKGQELASNQ  730
                +E    +  V  +DK+V    W         F V KG + Y  + A  KG  L    
Sbjct  354   ---DEDNVHEKQVATIDKSV--MEWPTKTQKIENFPVSKGLECYVRKGAPKKGDGL----  404

Query  729   LLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAE  550
             L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS        +    +  P   V+++E
Sbjct  405   LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNS--------QNQAQFAAP---VSSSE  453

Query  549   FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSN  370
             +M M+KRMA LEEK + L  +P  +  E EE L  A++R+  LEQEL+E KKALEE+   
Sbjct  454   YMLMVKRMAELEEKCMFLDLKPANVDTETEEKLQAALNRVQVLEQELSETKKALEETLVG  513

Query  369   QNELIAYIEkkkkkKNI-FGF  310
             Q E++AYIEKKKKKK + FGF
Sbjct  514   QKEILAYIEKKKKKKKLFFGF  534



>ref|XP_008349909.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Malus domestica]
Length=627

 Score =   538 bits (1386),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 319/620 (51%), Positives = 413/620 (67%), Gaps = 58/620 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  r----rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +   RV SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGGRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK+F ADTI++DF+FKE +EVLK+YP GHHGVDK+GRP+YIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDFSADTIMEDFEFKELNEVLKHYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELPDFLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPDFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K +       P   G + S + S         P + K  S  +L P+ EE +  
Sbjct  361   VLNSEGKVLAYAKPQYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVHEEVKAV  420

Query  879   ------------DMYVPMVDKTVDLPNW--HVVNNDNCKFVVPKGADLYQIQEAYKGQEL  742
                         D YVPMVDK VD  NW   VV     + +  KG     + E+ K  E 
Sbjct  421   GKANSAGNFSGYDEYVPMVDKAVD-ANWKKQVVLQ---RTLSSKGT--LSVPESPKNPEG  474

Query  741   ASNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNSM---HLNDHAMKGHGAYKPP  574
                ++L  +M F +  +T+ R +   + RKL ++ +  N        D A K  G  +PP
Sbjct  475   IQGRILVALMAFFLTFLTLFRSVASQVTRKLPDALVNHNQTIQESTFDEANKEEG--RPP  532

Query  573   EPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P   +T  + + +++K++  LEEK   L  +P  MP +K E+L+ A+ R+DALE EL  
Sbjct  533   SPTTPITGTDLLPSVLKKLVELEEKVDMLQAKPSEMPYDKAELLNAAVCRVDALEAELIA  592

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  593   TKKALHEALMRQEELLAYID  612



>ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|ESR36595.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|KDO47886.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=624

 Score =   538 bits (1386),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 315/620 (51%), Positives = 407/620 (66%), Gaps = 60/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMDELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWA+MLQWRKEFG DTI++DF+FKE +EVL YYP G+HGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWAEMLQWRKEFGVDTIMEDFEFKEINEVLSYYPHGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD+ KLMQVTTMDRY++YHVQ FE+    K  +C+IAAK+HID ST+ILDVQGVGLKNF
Sbjct  181   KVDSNKLMQVTTMDRYIRYHVQGFEKAFAVKFPACTIAAKRHIDSSTSILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             +K ARELI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   SKNARELILRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDA ELP+FLGGTC CAD+GGC+RSDKGPW +PEI+KMV  G    + ++ +
Sbjct  301   YQSKLLEIIDARELPEFLGGTCNCADQGGCLRSDKGPWQNPEILKMVLNGGAPRARQIVK  360

Query  1023  VEEEKTIPEDGGV----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQEE  892
             V     +  DG V                       A+ +  P + K  S  +L P++EE
Sbjct  361   V-----LNSDGKVIAYAKPPMQLKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREE  415

Query  891   TR------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQ  748
              +              D YVPMVDK VD  +W      + +    KG+ L Q+  + K  
Sbjct  416   AKVVGKTSYAGSFSGYDEYVPMVDKAVD-SSWK--KQPSLRSPAAKGS-LPQLPTS-KTP  470

Query  747   ELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA--YKPP  574
             E    ++   VM F M  VT+ R            T   + +++++ A+  +    ++PP
Sbjct  471   EGIRARIWAAVMAFFMMFVTLFRSVAYRVTHRIPETSTGHDLNISEVAVDANEKEEFRPP  530

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P+ +  E     ++ KR++ LEEK  TL  +P  MP EKEE+L  A+ R+DALE EL  
Sbjct  531   SPSPSLTEVDLLSSVTKRLSELEEKVDTLQAKPSEMPYEKEELLHAAVCRVDALEAELIA  590

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q +L+AYI+
Sbjct  591   TKKALHEALMRQEDLLAYID  610



>ref|XP_008681485.1| PREDICTED: uncharacterized protein LOC100273833 isoform X1 [Zea 
mays]
 gb|AFW70029.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=626

 Score =   538 bits (1386),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 314/620 (51%), Positives = 411/620 (66%), Gaps = 61/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-------------KMDLDADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E               ++  D+++TR+GSL+K AI+AS K RHS K 
Sbjct  1     MSGHLDRFARPCFEGRSSHDECRDHKSDFEVSEDEKKTRMGSLKKKAIDASTKIRHSLKK  60

Query  1911  rrrss--RVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
              RR S  RV+SV ++D  D EE+++V+AFRQAL+LDELLP +HDDYHMMLRFLKARKF+I
Sbjct  61    NRRKSGSRVLSVSIEDVRDLEELQAVEAFRQALLLDELLPARHDDYHMMLRFLKARKFDI  120

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             DK+KQMW DML WR+E+G DTI++DF++ E D VL+YYP G+HGVDK+GRP+YIERLG V
Sbjct  121   DKAKQMWMDMLHWRREYGTDTILEDFEYTELDAVLQYYPHGYHGVDKEGRPVYIERLGKV  180

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D +KLM VTTMDRY++YHV+EFER+   K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  181   DPSKLMNVTTMDRYVRYHVKEFERSFLIKFPACSVAAKRHIDSSTTILDVQGVGLKNFSK  240

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELIQ LQKID DNYPETL +M+I+NAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQ
Sbjct  241   TARELIQRLQKIDNDNYPETLYQMFIVNAGPGFRLLWNTVKSFLDPKTTAKIHVLGNKYQ  300

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
             SKLLEIIDASELP+FLGGTCTC + GGC++++KGPW DP I+K+V  G   C+ ++  + 
Sbjct  301   SKLLEIIDASELPEFLGGTCTCPEYGGCLKAEKGPWKDPNILKIVQSGEVHCARQIVTIS  360

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +  ++   A        KL P++EE     
Sbjct  361   NGEEKIITYAKPKHHSMRGSDTSTAESGSEADDAISPKALRSYIQHPKLTPVREEVKIVR  420

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W         F +P+ AD   ++   +  + + +++
Sbjct  421   ATSFSTRLPEYDVPVVDKAVD-ATWRREQPRKIPF-MPQDAD-SSVKTMSRPSDSSWDKI  477

Query  726   LTGVMTFVMGIVTMVRMTKNM-PRKL--------TESTLYSNSMHLNDHAMKGHGAYKPP  574
             +  +M  +M IV +VR  K++  R+L          STLY + +   +        ++PP
Sbjct  478   VATLMACLMAIVMLVRSVKDLVTRRLPYKGGSEEIHSTLYPDPIQKEE--------FRPP  529

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    AE   F  +++R+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  530   SPIPGFAEADLFAVVLQRLGELEEKVQMLQEKPSEMPCEKEELLNAAVRRVDALEAELIV  589

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  590   TKKALHEALIRQEELLAYID  609



>ref|XP_009378657.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Pyrus x bretschneideri]
Length=623

 Score =   538 bits (1385),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 314/616 (51%), Positives = 407/616 (66%), Gaps = 54/616 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADHGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K +       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVLAYAKPQYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKAV  420

Query  879   ------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD  NW        K V  +     ++ +  K  E   
Sbjct  421   GKANCAGHFSGYDEYVPMVDKAVDT-NWK-------KQVALQRTHSSKVPDTPKNPEGIQ  472

Query  735   NQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYKPPEP  568
              ++L  +M F +  +T+ R +   + RKL ++ +  N       +D A K  G    P  
Sbjct  473   GRILVALMAFFVTFLTLFRSVASQVTRKLPDALVNHNRNIPESTSDEANKEEGRPASPTA  532

Query  567   AVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakka  391
              +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   KKA
Sbjct  533   PITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAELIATKKA  592

Query  390   leesqSNQNELIAYIE  343
             L E+   Q EL+AYI+
Sbjct  593   LHEALMRQEELLAYID  608



>ref|NP_001064068.2| Os10g0122600 [Oryza sativa Japonica Group]
 dbj|BAF25982.2| Os10g0122600 [Oryza sativa Japonica Group]
Length=598

 Score =   537 bits (1383),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 303/583 (52%), Positives = 400/583 (69%), Gaps = 20/583 (3%)
 Frame = -2

Query  2064  SAGNMSGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMS  1885
             S+  + G  E   + + E      D+++ ++ SL+K A+++S K RHS K  RRSS+VMS
Sbjct  14    SSATLDGHYEEKRKSNVE---YSEDEKKAKIMSLKKKAMSSSQKLRHSMKKGRRSSKVMS  70

Query  1884  VVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADML  1705
             + + DE D EEV++VDAFRQ LIL+ELLP++HDDYHMMLRFLKARKF+++K+KQMWADML
Sbjct  71    ISIADERDPEEVQAVDAFRQLLILEELLPSQHDDYHMMLRFLKARKFDVEKAKQMWADML  130

Query  1704  QWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTM  1525
             +WRKEFGADTI++DF+F+E  +V + YPQG+HGVDK+GRP+YIERLG +D  +LMQVTTM
Sbjct  131   RWRKEFGADTILEDFEFEEAGKVAECYPQGYHGVDKEGRPVYIERLGQIDVNRLMQVTTM  190

Query  1524  DRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQK  1345
             DR++K HV+EFE+    K  +CSIA K HIDQSTTILDVQGVG+K F+K AR+LI  LQK
Sbjct  191   DRFIKNHVREFEKNFAVKFPACSIATKCHIDQSTTILDVQGVGMKQFSKAARDLIGQLQK  250

Query  1344  IDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASE  1165
             IDGDNYPETLCRM+IINAG GFRLLW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASE
Sbjct  251   IDGDNYPETLCRMFIINAGPGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASE  310

Query  1164  LPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSH---RMARVEEEKTIPED  994
             LP+F GGTC C  +GGCM++DKGPW D E+MKMV  G   C +        EE+  I ED
Sbjct  311   LPEFFGGTCQC--EGGCMKADKGPWKDDEVMKMVQSGVGWCGNLNLNHLEAEEKMMICED  368

Query  993   GGVNvsvsmsaksvkkpaSFKIESTK----KLFPIQEETRQPDMYVPMVDK--TVDLPNW  832
               +      S K   +  S KI   +     L P+ EE   P M +P      + D+P  
Sbjct  369   DTMYTKKQESFKDEGRTLSRKISRARIEHPTLSPVCEEL--PPMMLPTPGSPYSCDVPMV  426

Query  831   HVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKL  652
                 +  C+    +  ++   +        ++  L  GVM  VM I TM+R+++NMP+K+
Sbjct  427   EKAIDAICQSKGSRDENVAITKAIVNASNGSNPPLFGGVMALVMSIATMLRVSRNMPKKV  486

Query  651   TESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMP  472
               +TL + S       ++     K    AV+AAE+ +  KR++ +EEK I +  +P  MP
Sbjct  487   LGATLGAQST----SKIQAQQLSKISMEAVSAAEYASSTKRLSDIEEKVIAILTKPAEMP  542

Query  471   PEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
              +KEEML  A+SR+ ALE+ELA  KKAL+E+   Q E++AYIE
Sbjct  543   ADKEEMLKTAVSRVSALEEELAATKKALQETLERQEEIMAYIE  585



>ref|XP_004500794.1| PREDICTED: uncharacterized protein LOC101488984 [Cicer arietinum]
Length=626

 Score =   538 bits (1385),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 319/628 (51%), Positives = 406/628 (65%), Gaps = 74/628 (12%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A+NAS KF+HS + 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKRERRSDFENSEDERRTRIGSLKKKALNASTKFKHSLRK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI++ELLP   DDYHMMLRFLKARKF
Sbjct  61    KSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMEELLPDAFDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWR+EFGADTI+ DF+FKE DEV+KYYP GHHGVD++GRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRREFGADTILQDFEFKELDEVVKYYPHGHHGVDREGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQK+DGDNYPETLC+M+IINAG GFRLLW+TVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARELIMRLQKVDGDNYPETLCQMFIINAGPGFRLLWSTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLE+IDASELP+FLGGTCTCAD+GGC+RSDKGPW +PEI KMV  G  + + ++ +
Sbjct  301   YQSKLLEVIDASELPEFLGGTCTCADQGGCLRSDKGPWKNPEIFKMVLNGEARRARQVVK  360

Query  1023  VEEEKTIPEDGGV-----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQE  895
             V     +  DG V                        A+ +  P + K  S  +L P++E
Sbjct  361   V-----LNSDGKVIAYAKPRYPMVKGSDTSTAESGSEAEEIASPKAMKNYSHLRLTPVRE  415

Query  894   ETR------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGAD-LYQIQEAYK  754
             E +              D YVPMVDK VD       +    K  + KG+  L  IQ   +
Sbjct  416   EAKIVGKSSYASNLSGYDEYVPMVDKPVDAEWKKQTSLQRSKSNILKGSRPLPDIQNTPE  475

Query  753   GQELASNQLLTGVMTFVMGIVTMV--RMTKNMP-------RKLTESTLYSNSMHLNDHAM  601
                      LT     V+ I   V  RMT  +P       ++ +E TL + +M +     
Sbjct  476   RIHARIWIALTAFFLMVLTIFRQVACRMTNKLPAISSNDDQRTSEPTLETRNMTV-----  530

Query  600   KGHGAYKPPEPAVTAAEFM--AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRID  427
                    PP       E +  +++KR+  LEEK  TL ++P  MP EKEE+L+ A+ R+D
Sbjct  531   ------LPPSTQTHTEENLLPSLLKRLGDLEEKVDTLQSKPSEMPYEKEELLNAAVCRVD  584

Query  426   aleqelaeakkaleesqSNQNELIAYIE  343
             ALE EL   KKAL E+   Q EL+AYI+
Sbjct  585   ALEAELIATKKALYEALMRQEELLAYID  612



>ref|XP_008377272.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Malus domestica]
Length=627

 Score =   538 bits (1385),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 316/622 (51%), Positives = 412/622 (66%), Gaps = 62/622 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K +       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVLAYAKPQYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKAV  420

Query  879   ------------DMYVPMVDKTVDLPNWH----VVNNDNCKFVVPKGADLYQIQEAYKGQ  748
                         D YVPMVDK VD  NW     +    + K  +P       + +  K  
Sbjct  421   GKANCAGHFSGYDEYVPMVDKAVDT-NWKKQVALQRTHSSKGTLP-------VPDTPKNP  472

Query  747   ELASNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYK  580
             E    ++L  +M F M  +T+ R +   + RKL ++ +  N       +D A K  G  +
Sbjct  473   EGIQGRILVALMAFFMTFLTLFRSVASQVTRKLPDALVNHNQNIPESTSDEANKEEG--R  530

Query  579   PPEPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqel  409
             PP P   +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL
Sbjct  531   PPSPTSPITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAEL  590

Query  408   aeakkaleesqSNQNELIAYIE  343
                KKAL E+   Q EL+AYI+
Sbjct  591   IATKKALHEALMRQEELLAYID  612



>ref|XP_008377273.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X3 [Malus domestica]
Length=624

 Score =   537 bits (1384),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 314/619 (51%), Positives = 410/619 (66%), Gaps = 59/619 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI----PE-------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ  883
             V   E K +    P+                  A+ +  P + K  S  +L P++EE + 
Sbjct  361   VLNSEGKVLAYAKPQYPMQVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKA  420

Query  882   P------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
                          D YVPMVDK VD  NW        K V  +     ++ +  K  E  
Sbjct  421   VGKANCAGHFSGYDEYVPMVDKAVDT-NWK-------KQVALQRTHSSKVPDTPKNPEGI  472

Query  738   SNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYKPPE  571
               ++L  +M F M  +T+ R +   + RKL ++ +  N       +D A K  G  +PP 
Sbjct  473   QGRILVALMAFFMTFLTLFRSVASQVTRKLPDALVNHNQNIPESTSDEANKEEG--RPPS  530

Query  570   PA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             P   +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   
Sbjct  531   PTSPITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAELIAT  590

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q EL+AYI+
Sbjct  591   KKALHEALMRQEELLAYID  609



>ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Citrus sinensis]
Length=623

 Score =   537 bits (1384),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 315/619 (51%), Positives = 406/619 (66%), Gaps = 59/619 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFSGSDERRERKSDFENSEDERRTRIGSLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP +HDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMDELLPERHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWA+MLQWRKEFG DTI++DF+FKE +EVL YYP G+HGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWAEMLQWRKEFGVDTIMEDFEFKEINEVLSYYPHGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD+ KLMQVTTMDRY++YHVQ FE+    K  +C+IAAK+HID ST+ILDVQGVGLKNF
Sbjct  181   KVDSNKLMQVTTMDRYIRYHVQGFEKAFAVKFPACTIAAKRHIDSSTSILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             +K ARELI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVKSFLDPKTT+KI+VLGNK
Sbjct  241   SKNARELILRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLEIIDA ELP+FLGGTC CAD+GGC+RSDKGPW +PEI+KMV  G    + ++ +
Sbjct  301   YQSKLLEIIDARELPEFLGGTCNCADQGGCLRSDKGPWQNPEILKMVLNGGAPRARQIVK  360

Query  1023  VEEEKTIPEDGGV---------------NvsvsmsaksvkkpaSFKIESTKKLFPIQEET  889
             V     +  DG V                      A+ +  P + K  S  +L P++EE 
Sbjct  361   V-----LNSDGKVIAYAKPPMLKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEA  415

Query  888   R------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQE  745
             +              D YVPMVDK VD  +W      + +    KG+ L Q+  + K  E
Sbjct  416   KVVGKTSYAGSFSGYDEYVPMVDKAVD-SSWK--KQPSLRSPAAKGS-LPQLPTS-KTPE  470

Query  744   LASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA--YKPPE  571
                 ++   VM F M  VT  R            T   + +++++ A+  +    ++PP 
Sbjct  471   GIRARIWAAVMAFFMMFVTFFRSVAYRVTHRIPETSTGHDLNISEVAVDANEKEEFRPPS  530

Query  570   PAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             P+ +  E     ++ KR++ LEEK  TL  +P  MP EKEE+L  A+ R+DALE EL   
Sbjct  531   PSPSLTEVDLLSSVTKRLSELEEKVDTLQAKPSEMPYEKEELLHAAVCRVDALEAELIAT  590

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q +L+AYI+
Sbjct  591   KKALHEALMRQEDLLAYID  609



>ref|XP_003573065.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X2 [Brachypodium distachyon]
Length=603

 Score =   536 bits (1382),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 304/577 (53%), Positives = 390/577 (68%), Gaps = 47/577 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALIL  1813
             D+++ R+ SL+K A+NAS K RHS K  RRSS+VMS+ ++DE D EE  +VDAFRQ L+L
Sbjct  34    DEKKARIASLKKKAMNASQKLRHSMKKGRRSSKVMSISIEDERDPEEALAVDAFRQLLVL  93

Query  1812  DELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVL  1633
             +ELLP++HDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFGADTI++ F+F+E D+V 
Sbjct  94    EELLPSQHDDYHMMLRFLKARKFDIEKAKQMWSDMLQWRKEFGADTILEGFEFEEADKVA  153

Query  1632  KYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSI  1453
             + YPQG+HGVDK+GRP+YIERLG +D  KL+QVTTM+R++K HV+EFE+   DK  +CS+
Sbjct  154   ECYPQGYHGVDKEGRPVYIERLGQIDVNKLLQVTTMERFVKNHVKEFEKNFADKFPACSV  213

Query  1452  AAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRL  1273
             AAK+HIDQSTTILDVQGVG+K F+K AR+LI  LQKIDGDNYPETLCRM+IINAG GFRL
Sbjct  214   AAKRHIDQSTTILDVQGVGMKQFSKTARDLIGQLQKIDGDNYPETLCRMFIINAGQGFRL  273

Query  1272  LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGP  1093
             LW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+F GGTC C  +GGCM++DKGP
Sbjct  274   LWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFFGGTCQC--EGGCMKADKGP  331

Query  1092  WNDPEIMKMVHQGAHKCSHRMARVE--EEKTIPEDGGVNvsvsmsaksvk----------  949
             W DPE+MKMV  GA  C          EEKTI  D  +      ++              
Sbjct  332   WKDPEVMKMVQSGAGMCGKLNVDCSDAEEKTICADDTIYTKKQDASNVEAHLAGDEWRTL  391

Query  948   --kpaSFKIESTKKLFPIQEETRQPDMY----------VPMVDKTVDLPNWHVVNNDNCK  805
               K +  +IE   +L P+ EE   P ++          VPMV+K +D           CK
Sbjct  392   LHKTSRARIEHP-QLSPVHEELL-PTLFPTPGSPYSCDVPMVEKAIDA---------FCK  440

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNS  625
                    +L   +        +S  +  G++  VM I TM+R+++NMPRK+  +     S
Sbjct  441   SNGLPDEELALTKAVANASNGSSPPIFGGILALVMSIATMLRVSRNMPRKVLGAATGPQS  500

Query  624   ---MHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
                +H    + K          A++ AE+    KR A LEEK I L  +   MP +KE+M
Sbjct  501   TPKVHAQQQSKKA-------AEAMSTAEYTISAKRFADLEEKVIALLAKTAEMPADKEDM  553

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             L  A SR+ ALE+ELA  KKAL+E+   Q E+IAYIE
Sbjct  554   LKAATSRVSALEEELAITKKALQETLERQGEIIAYIE  590



>ref|XP_010234172.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brachypodium distachyon]
 ref|XP_010234173.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH3 isoform X1 [Brachypodium distachyon]
Length=604

 Score =   536 bits (1382),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 304/577 (53%), Positives = 390/577 (68%), Gaps = 47/577 (8%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALIL  1813
             D+++ R+ SL+K A+NAS K RHS K  RRSS+VMS+ ++DE D EE  +VDAFRQ L+L
Sbjct  35    DEKKARIASLKKKAMNASQKLRHSMKKGRRSSKVMSISIEDERDPEEALAVDAFRQLLVL  94

Query  1812  DELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVL  1633
             +ELLP++HDDYHMMLRFLKARKF+I+K+KQMW+DMLQWRKEFGADTI++ F+F+E D+V 
Sbjct  95    EELLPSQHDDYHMMLRFLKARKFDIEKAKQMWSDMLQWRKEFGADTILEGFEFEEADKVA  154

Query  1632  KYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSI  1453
             + YPQG+HGVDK+GRP+YIERLG +D  KL+QVTTM+R++K HV+EFE+   DK  +CS+
Sbjct  155   ECYPQGYHGVDKEGRPVYIERLGQIDVNKLLQVTTMERFVKNHVKEFEKNFADKFPACSV  214

Query  1452  AAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRL  1273
             AAK+HIDQSTTILDVQGVG+K F+K AR+LI  LQKIDGDNYPETLCRM+IINAG GFRL
Sbjct  215   AAKRHIDQSTTILDVQGVGMKQFSKTARDLIGQLQKIDGDNYPETLCRMFIINAGQGFRL  274

Query  1272  LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGP  1093
             LW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+F GGTC C  +GGCM++DKGP
Sbjct  275   LWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFFGGTCQC--EGGCMKADKGP  332

Query  1092  WNDPEIMKMVHQGAHKCSHRMARVE--EEKTIPEDGGVNvsvsmsaksvk----------  949
             W DPE+MKMV  GA  C          EEKTI  D  +      ++              
Sbjct  333   WKDPEVMKMVQSGAGMCGKLNVDCSDAEEKTICADDTIYTKKQDASNVEAHLAGDEWRTL  392

Query  948   --kpaSFKIESTKKLFPIQEETRQPDMY----------VPMVDKTVDLPNWHVVNNDNCK  805
               K +  +IE   +L P+ EE   P ++          VPMV+K +D           CK
Sbjct  393   LHKTSRARIEHP-QLSPVHEELL-PTLFPTPGSPYSCDVPMVEKAIDA---------FCK  441

Query  804   FVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNS  625
                    +L   +        +S  +  G++  VM I TM+R+++NMPRK+  +     S
Sbjct  442   SNGLPDEELALTKAVANASNGSSPPIFGGILALVMSIATMLRVSRNMPRKVLGAATGPQS  501

Query  624   ---MHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEM  454
                +H    + K          A++ AE+    KR A LEEK I L  +   MP +KE+M
Sbjct  502   TPKVHAQQQSKKA-------AEAMSTAEYTISAKRFADLEEKVIALLAKTAEMPADKEDM  554

Query  453   LSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             L  A SR+ ALE+ELA  KKAL+E+   Q E+IAYIE
Sbjct  555   LKAATSRVSALEEELAITKKALQETLERQGEIIAYIE  591



>ref|XP_003603967.1| Sec14 cytosolic factor [Medicago truncatula]
Length=709

 Score =   540 bits (1391),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 317/624 (51%), Positives = 409/624 (66%), Gaps = 69/624 (11%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           + D +   D+R+TR+GSL+K A++AS KF+HS + 
Sbjct  1     MSGPLDRFARPCFEGFSGSDEKRERRSDFENSEDERRTRIGSLKKKALSASTKFKHSLRK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQ+LI+DELLP   DDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLIMDELLPQAFDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MWADMLQWR+EFGADTI+ DF+FKE +EV+KYYP GHHGVDK+GRP+YIERLG
Sbjct  121   DIEKAKHMWADMLQWRREFGADTIMQDFEFKELNEVVKYYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTTMDRY+KYHVQEFE++   K  +C+IAAK+HID STTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTTMDRYVKYHVQEFEKSFAIKFPACTIAAKRHIDSSTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELIQ LQK+DGDNYPETLC+M+IINAG GFRLLW+TVKSFLDPKTT+KI+VLGNK
Sbjct  241   TKSARELIQRLQKVDGDNYPETLCQMFIINAGPGFRLLWSTVKSFLDPKTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQSKLLE+IDASELP+FLGGTC+CAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQSKLLEVIDASELPEFLGGTCSCADEGGCLRSDKGPWKNPEILKMVLNGEPRRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K I       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPRYPMVKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEAKIA  420

Query  879   -----------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                        D YVPMVDK VD   W    +            L  IQ   +G +  + 
Sbjct  421   GKASYANMSGYDEYVPMVDKPVD-AEWKRQTSLQRSHTFKGTRPLPDIQNTPEGIKARAW  479

Query  732   QLLTGVMTFVMGIVTMV--RMTKNMP-------RKLTESTLYSNSMHLNDHAMKGHGAYK  580
               L      +  +   V  RMT  +P       ++++E TL + +M +            
Sbjct  480   VALAAFFLTLFALFRQVACRMTNKLPAISSNDDQRISEPTLETTNMEVL-----------  528

Query  579   PPEPAVTAAE-----FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
                P+ + A+     F +++KR+  LEEK  TL ++P  MP EK E+L+ A+ R+DALE 
Sbjct  529   ---PSTSQAQTEENLFPSLLKRLGELEEKVDTLQSKPSEMPYEKAELLNAAVCRVDALEA  585

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  586   ELIATKKALYEALMRQEELLAYID  609



>ref|XP_009111282.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH1 [Brassica rapa]
Length=552

 Score =   534 bits (1376),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 325/572 (57%), Positives = 413/572 (72%), Gaps = 31/572 (5%)
 Frame = -2

Query  2010  KMDLDADDRQ-TRLGSLRKAAINAsn--kfrhsfksrrrssRVMSVVLDDEHDAEEVKSV  1840
             ++++  ++R+  ++ SL+K AINASN  K   S K R+ SS+VM V ++D+ DAE+++S+
Sbjct  7     EIEMSEEERKIAKMSSLKKKAINASNRFKNSFSKKGRKSSSKVMCVTIEDDIDAEDLQSL  66

Query  1839  DAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDF  1660
             DAFRQAL+LDELLP+  DD HMMLRFL+ARKF+I+K+KQMW+DM+QWRK+FGAD II++F
Sbjct  67    DAFRQALVLDELLPSNLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADKIIEEF  126

Query  1659  DFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTN  1480
             +F+E DEV+K+YPQG+HGVDK+GRP+YIERLG +DA KL+QVTTMDRY+KYHV+EFE+T 
Sbjct  127   EFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVREFEKTF  186

Query  1479  NDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYI  1300
               K  +CS+AAKKHIDQSTTILDVQGVGLKNF+K AREL+Q L KID DNYPETL RM+I
Sbjct  187   KIKFPACSVAAKKHIDQSTTILDVQGVGLKNFSKSARELLQRLLKIDNDNYPETLNRMFI  246

Query  1299  INAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKG  1120
             INAGSGFRLLW+TVKSFLDPKTTAKI+VLGNKY SKLLE+IDASELP+F GG CTC DKG
Sbjct  247   INAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKG  306

Query  1119  GCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVEEEKTIPEDGGVNvsvsmsaksvkkpa  940
             GCM SDKGPWNDPE++KM      KCS     + E+     D G + S   S        
Sbjct  307   GCMLSDKGPWNDPEVLKMAINRESKCSP----ISEDDLKHVDQGRSTSFQESLD------  356

Query  939   SFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEA  760
                  S+K++       +Q    V  +DK+  +  W         F V KG + Y  + A
Sbjct  357   ----RSSKQMVEDNVHEKQ----VATIDKS--MMEWPTKTQKIENFPVSKGLECYVRKGA  406

Query  759   -YKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLTESTLYSNSMHLNDHAMKGHGAY  583
               KG  L    L+ GVM FVMGIV MVR++K++PRKLTE+ LY NS+   D AM      
Sbjct  407   PKKGDGL----LVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSV-CYDEAMPKQNQA  461

Query  582   KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
             +   P V+++E+M M+KRMA LEEK + L  +P  +  E EE L  A++R+  LEQEL E
Sbjct  462   QFAAP-VSSSEYMLMVKRMAELEEKCMFLDLKPANVDTETEEKLQAALNRVQVLEQELTE  520

Query  402   akkaleesqSNQNELIAYIEkkkkkKNI-FGF  310
              KKALEE+   Q E++AYIEKKKKKK + FGF
Sbjct  521   TKKALEETLVGQKEILAYIEKKKKKKKLFFGF  552



>ref|XP_010940114.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Elaeis guineensis]
Length=625

 Score =   537 bits (1383),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 318/619 (51%), Positives = 405/619 (65%), Gaps = 57/619 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnk---frhs  1921
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS K       
Sbjct  1     MSGPLDRFARPCFEGFSSHDERKERKSDFENSEDERRTRIGSLKKKAINASTKFRHSLKK  60

Query  1920  fksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFE  1741
                R+ +SRV+SV ++D  D EE+++VDAFRQ+LILDELLP  HDDYHMMLRFLKARKF+
Sbjct  61    KNRRKSNSRVISVSIEDVRDIEELRTVDAFRQSLILDELLPACHDDYHMMLRFLKARKFD  120

Query  1740  IDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGL  1561
             IDK+K MWA+MLQWRKE+G DTI++DF++ E +EVL+YYP G+HGVDK+GRP+YIERLG 
Sbjct  121   IDKAKHMWAEMLQWRKEYGVDTIVEDFEYTELNEVLQYYPHGYHGVDKEGRPVYIERLGK  180

Query  1560  VDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFT  1381
             VD  KLMQVTTMDRY++YHV+EFER+   K  +CS+AAKKHID STTILDVQGVGLKNF+
Sbjct  181   VDPNKLMQVTTMDRYVRYHVREFERSFLIKFPACSLAAKKHIDSSTTILDVQGVGLKNFS  240

Query  1380  KQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKY  1201
             K AR+LI  LQKID DNYPETL RM+IINAG GFRLLWNTVKSFLDPKTT+KI+VLG KY
Sbjct  241   KTARDLIVRLQKIDNDNYPETLYRMFIINAGPGFRLLWNTVKSFLDPKTTSKIHVLGTKY  300

Query  1200  QSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV  1021
             Q+KLLEIIDASELP+F GGTCTCA+ GGC++ +KGPW DP I+KMV  G  +C+ ++  V
Sbjct  301   QNKLLEIIDASELPEFFGGTCTCAEYGGCLKCEKGPWKDPNILKMVLSGEARCARQIVTV  360

Query  1020  E--EEKTI-------PEDGGVNvsvsmsaksvkkpaSFKIEST----KKLFPIQEETR--  886
                E  TI       P   G + S + S   V+   S K   +     +L P++EE +  
Sbjct  361   SSGEGNTIAYAKPQYPAIKGSDTSTAESGSEVEDVTSPKASRSYIAHPQLTPVREEAKMV  420

Query  885   ---------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASN  733
                      + D YVPMVDK VD   W      N K  + KG+  + + +  K  E    
Sbjct  421   KAVSFSGFPEHDEYVPMVDKAVD-AGWK-KEASNQKLSLSKGS--FSLSDTCKPPEGLQA  476

Query  732   QLLTGVMTFVMGIVTMVRMT-----KNMPRKLTEST-LYSNSMHLNDHAMKGHGAYKPPE  571
             Q+    +   M + T+ R       K +P K ++   LYS   +  D   KG   ++PP 
Sbjct  477   QITALFVALFMMLFTLFRFVTSCVMKRLPDKTSKPDHLYST--YSVDPIPKGE--FRPPS  532

Query  570   PAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             PA    E     +++KR+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   
Sbjct  533   PAPGFTEVDLLSSVLKRLGELEEKIDILQAKPSEMPSEKEELLNAAVRRVDALEAELIVT  592

Query  399   kkaleesqSNQNELIAYIE  343
             KK L E+   Q EL+AYI+
Sbjct  593   KKVLHEALMRQEELLAYID  611



>ref|XP_010068556.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Eucalyptus grandis]
Length=648

 Score =   538 bits (1385),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 315/601 (52%), Positives = 399/601 (66%), Gaps = 37/601 (6%)
 Frame = -2

Query  2049  SGAVERPLRPSAEKMDLDADDRQTRLGSLRKAAINAsnkfrhsfksrrrssR----VMSV  1882
             SG+ E+  R S    ++  D+R+TR+GS  K AINAS KF+ S K +    +    V SV
Sbjct  39    SGSDEKRERKS--DFEISEDERKTRIGSFTKKAINASTKFKRSLKKKSSRRKSDGRVSSV  96

Query  1881  VLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQ  1702
              ++D  D EE+++VD FRQAL+LDELLP K DDYHMMLRFLKARKF+I+K+K MWADMLQ
Sbjct  97    SIEDVRDLEELQAVDEFRQALLLDELLPEKQDDYHMMLRFLKARKFDIEKAKHMWADMLQ  156

Query  1701  WRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMD  1522
             WRK+FG DTI+ DF+FKE DEVL YYP G+HGVDK+GRP+YIERLG VDATKLMQVTT+D
Sbjct  157   WRKDFGVDTIMKDFEFKELDEVLNYYPHGYHGVDKEGRPVYIERLGKVDATKLMQVTTLD  216

Query  1521  RYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKI  1342
             RY++YHVQEFER+   K  +C+IAAK+HID STTILDVQGVGLKNFTK ARELI  LQKI
Sbjct  217   RYIRYHVQEFERSFVVKFPACAIAAKRHIDSSTTILDVQGVGLKNFTKSARELITRLQKI  276

Query  1341  DGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASEL  1162
             D DNYPETL +M+IINAG GF+LLWNTVKSFLDPKTT+KI+VLGN+YQSKLLEIIDASEL
Sbjct  277   DSDNYPETLFQMFIINAGPGFKLLWNTVKSFLDPKTTSKIHVLGNRYQSKLLEIIDASEL  336

Query  1161  PDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV--EEEKTI-----  1003
             P FLGGTCTCAD+GGC+RSDKGPW +P+I+K+V  G  + + ++ +V   E K I     
Sbjct  337   PQFLGGTCTCADQGGCLRSDKGPWKNPDILKVVLSGEARRARQVVKVLNSEGKVIAYAKP  396

Query  1002  --PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP------------DM  874
               P   G + S + S         P + K  S  +L P++EE +              D 
Sbjct  397   GYPMVKGSDTSTAESGSEAEDIASPKAMKSYSHLRLTPVREEAKAIGRAGYAGTFSGYDE  456

Query  873   YVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGI  694
             YVPMVDK VD   W        +  +     + Q   + K + L +  LL  +  F+   
Sbjct  457   YVPMVDKAVD-AGWK--KQSTLQRPLASKGTVAQPDPSKKPEGLRARILLAAMAFFMTLF  513

Query  693   VTMVRMTKNMPRKLTESTLYSN---SMHLNDHAMKGHGAYKPPEPAVTAAEFM-AMMKRM  526
               +  +T  + +KL  + L  +   S    D   K       P PA T A+ + ++MKR+
Sbjct  514   AFLQSITHRVTKKLPSTPLDVDQKISEVAPDSTQKEEFRPPSPTPAFTEADLLSSVMKRL  573

Query  525   ASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYI  346
               LEEK  TL  +P  MP EKEE+L+ A+ R+DALE EL   KKAL E+   Q EL+AY+
Sbjct  574   GELEEKVDTLKAKPSEMPCEKEELLNAAVCRVDALEAELIATKKALYEALIRQEELLAYM  633

Query  345   E  343
             +
Sbjct  634   D  634



>ref|XP_008349908.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Malus domestica]
Length=628

 Score =   536 bits (1382),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 317/621 (51%), Positives = 412/621 (66%), Gaps = 59/621 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  r----rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +   RV SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGGRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK+F ADTI++DF+FKE +EVLK+YP GHHGVDK+GRP+YIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDFSADTIMEDFEFKELNEVLKHYPHGHHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELPDFLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPDFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI----PE-------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ  883
             V   E K +    P+                  A+ +  P + K  S  +L P+ EE + 
Sbjct  361   VLNSEGKVLAYAKPQYPMQVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVHEEVKA  420

Query  882   P------------DMYVPMVDKTVDLPNW--HVVNNDNCKFVVPKGADLYQIQEAYKGQE  745
                          D YVPMVDK VD  NW   VV     + +  KG     + E+ K  E
Sbjct  421   VGKANSAGNFSGYDEYVPMVDKAVD-ANWKKQVVLQ---RTLSSKGT--LSVPESPKNPE  474

Query  744   LASNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNSM---HLNDHAMKGHGAYKP  577
                 ++L  +M F +  +T+ R +   + RKL ++ +  N        D A K  G  +P
Sbjct  475   GIQGRILVALMAFFLTFLTLFRSVASQVTRKLPDALVNHNQTIQESTFDEANKEEG--RP  532

Query  576   PEPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqela  406
             P P   +T  + + +++K++  LEEK   L  +P  MP +K E+L+ A+ R+DALE EL 
Sbjct  533   PSPTTPITGTDLLPSVLKKLVELEEKVDMLQAKPSEMPYDKAELLNAAVCRVDALEAELI  592

Query  405   eakkaleesqSNQNELIAYIE  343
               KKAL E+   Q EL+AYI+
Sbjct  593   ATKKALHEALMRQEELLAYID  613



>ref|XP_004968249.1| PREDICTED: uncharacterized protein LOC101762865 [Setaria italica]
Length=611

 Score =   536 bits (1380),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 309/578 (53%), Positives = 394/578 (68%), Gaps = 41/578 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALIL  1813
             D+++  + SL+K A++AS   RHS K  R+SS+VMSV + DE D EEV++VDAFRQ LIL
Sbjct  34    DEKKAMIASLKKKAMSASQNMRHSMKRGRKSSKVMSVSILDERDPEEVQAVDAFRQLLIL  93

Query  1812  DELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVL  1633
             +E+LP++HDDYHMMLRFLKARKF+I+K+KQMW+D L+WRKEFGADTI+ +F F+E D+V 
Sbjct  94    EEMLPSQHDDYHMMLRFLKARKFDIEKAKQMWSDTLKWRKEFGADTILKEFKFEEADKVA  153

Query  1632  KYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSI  1453
             + YPQG+HGVDK+GRP+YIERLG +D  +LMQVTTMDR++K HV+EFE+    K  +CSI
Sbjct  154   QCYPQGYHGVDKEGRPVYIERLGQIDVNRLMQVTTMDRFVKNHVKEFEKNFAVKFPACSI  213

Query  1452  AAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRL  1273
             AAK+HIDQSTTILDVQGVG+K F+K AR+LI  LQKIDGDNYPE+LCRM+IINAG GFRL
Sbjct  214   AAKRHIDQSTTILDVQGVGMKQFSKAARDLIGMLQKIDGDNYPESLCRMFIINAGQGFRL  273

Query  1272  LWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGP  1093
             LW+TVKSFLDPKTTAKI+VLGNKYQSKLLE+IDASELP+F GGTC C  +GGCM++DKGP
Sbjct  274   LWSTVKSFLDPKTTAKIHVLGNKYQSKLLEVIDASELPEFFGGTCQC--EGGCMKADKGP  331

Query  1092  WNDPEIMKMVHQGAHKC-SHRMARVE-EEKTIPED------------GGVNvsvsmsaks  955
             W DPEIMKMV  G  +C S R A  E E+K I ED            G   +        
Sbjct  332   WKDPEIMKMVQSGVGRCGSRRSASSEVEDKVICEDDIIYPKKQTSSDGEAQLVGDGQPTL  391

Query  954   vkkpaSFKIESTKKLFPIQEETRQPDMY----------VPMVDKTVDLPNWHVVNNDNCK  805
              +K +  +IE  + L P+ EE   P +Y          VPMV+K +D           CK
Sbjct  392   SRKISRVQIEYPQ-LSPVHEEL-IPTLYPTPGSPYSCDVPMVEKAIDA---------ICK  440

Query  804   FVVPKGADLYQIQEAYKGQELASNQ-LLTGVMTFVMGIVTMVRMTKNMPRKLTESTL---  637
                    +   I +A       SN  L  G++  VM I TM+R+T+NMP K+  + +   
Sbjct  441   SQGTLPDEKLAITKAVVTASNGSNPPLFGGIIALVMSIATMLRLTRNMPVKVLGAAIGDA  500

Query  636   YSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEE  457
                +   +   ++     K    AV AAE +   KR+A LEEK + L  +P TMP +KEE
Sbjct  501   KPTTPTKSKSKIQARQRSKLSPEAVKAAEDVVSTKRLAELEEKILALLTKPATMPADKEE  560

Query  456   MLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             ML  A+SRI ALE+ELA  KKAL+++   Q E+I YIE
Sbjct  561   MLQAAVSRISALEEELAATKKALQKTLECQGEIIVYIE  598



>ref|XP_009378656.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X3 [Pyrus x bretschneideri]
Length=624

 Score =   536 bits (1380),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 312/617 (51%), Positives = 406/617 (66%), Gaps = 55/617 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADHGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI----PE-------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ  883
             V   E K +    P+                  A+ +  P + K  S  +L P++EE + 
Sbjct  361   VLNSEGKVLAYAKPQYPMQVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKA  420

Query  882   P------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELA  739
                          D YVPMVDK VD  NW        K V  +     ++ +  K  E  
Sbjct  421   VGKANCAGHFSGYDEYVPMVDKAVDT-NWK-------KQVALQRTHSSKVPDTPKNPEGI  472

Query  738   SNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYKPPE  571
               ++L  +M F +  +T+ R +   + RKL ++ +  N       +D A K  G    P 
Sbjct  473   QGRILVALMAFFVTFLTLFRSVASQVTRKLPDALVNHNRNIPESTSDEANKEEGRPASPT  532

Query  570   PAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaeakk  394
               +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL   KK
Sbjct  533   APITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAELIATKK  592

Query  393   aleesqSNQNELIAYIE  343
             AL E+   Q EL+AYI+
Sbjct  593   ALHEALMRQEELLAYID  609



>emb|CDY13810.1| BnaA09g43120D [Brassica napus]
Length=632

 Score =   536 bits (1381),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 317/619 (51%), Positives = 410/619 (66%), Gaps = 55/619 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+GSL+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFLSSDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFR AL++DELLP++HDDYHMMLRFLKARKF
Sbjct  61    KSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRHALLIDELLPSRHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +I+K+K MW+DM+QWRKEFG DTI+ DFDF+E +EVLKYYP G+HGVDK+GRPIYIERLG
Sbjct  121   DIEKAKHMWSDMIQWRKEFGTDTILQDFDFEEINEVLKYYPHGYHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVT+MDRY++YHV+EFER+   K  SC+IAAKKHID +TTILDVQGVGLKNF
Sbjct  181   KVDPNKLMQVTSMDRYVRYHVKEFERSFMIKFPSCTIAAKKHIDSNTTILDVQGVGLKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK ARELI  LQKIDGDNYPETL +M+I+NAG+GFRLLWNTVK F+DPKT++KI+VLG K
Sbjct  241   TKSARELITRLQKIDGDNYPETLHQMFIVNAGAGFRLLWNTVKGFIDPKTSSKIHVLGYK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMV-HQGAHKCSHRMA  1027
             YQ+KLLE+IDA+ELP+FLGG CTCAD+GGCM SDKGPW +PEI+KMV H GAH+    + 
Sbjct  301   YQTKLLEVIDANELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRAKQVVK  360

Query  1026  RVEEEKTI--------PEDGGVNvsvsmsaksvk---kpaSFKIESTKKLFPIQEETRQP  880
              +  E  +        P   G + S + S    +    P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVIAYAKPSYPWIKGSDTSTAESGSDAEDIGSPKAIKSFSHLRLTPVREEAKIA  420

Query  879   ------------DMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELAS  736
                         D YVPMVDK VD   W V      + V  KG  +     A K  E   
Sbjct  421   GETSLAGGLLGYDEYVPMVDKAVD-ATWKV--KPAIQRVASKGTLMSPT--APKDTEGIR  475

Query  735   NQLLTGVMTFVMGIVTMVR-----MTKNMPRKLTESTLYSNSMHLNDHAMKGHGAYKPPE  571
              ++L  ++T+VM + T  R     + K +P    ++   +  + L + A       +PP 
Sbjct  476   ARVLVMIITYVMAVFTFFRTVPFLVIKKLPASQPQTEGNATEL-LGEVAATTKEESRPPS  534

Query  570   PA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelaea  400
             P   +T  E + ++MK++  LE K  TL  +P  MP EKEE+L+ A+ R+DALE EL   
Sbjct  535   PVPDLTETELLTSVMKKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIAT  594

Query  399   kkaleesqSNQNELIAYIE  343
             KKAL E+   Q EL+AYI+
Sbjct  595   KKALYEALMRQEELLAYID  613



>ref|XP_009378655.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Pyrus x bretschneideri]
Length=627

 Score =   536 bits (1380),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 314/620 (51%), Positives = 408/620 (66%), Gaps = 58/620 (9%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K AINAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKAINASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADHGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI-------PEDGGVNvsvsmsaksv---kkpaSFKIESTKKLFPIQEETRQP  880
             V   E K +       P   G + S + S         P + K  S  +L P++EE +  
Sbjct  361   VLNSEGKVLAYAKPQYPMVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKAV  420

Query  879   ------------DMYVPMVDKTVDLPNWH----VVNNDNCKFVVPKGADLYQIQEAYKGQ  748
                         D YVPMVDK VD  NW     +    + K  +P       + +  K  
Sbjct  421   GKANCAGHFSGYDEYVPMVDKAVDT-NWKKQVALQRTHSSKGTLP-------VPDTPKNP  472

Query  747   ELASNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAYK  580
             E    ++L  +M F +  +T+ R +   + RKL ++ +  N       +D A K  G   
Sbjct  473   EGIQGRILVALMAFFVTFLTLFRSVASQVTRKLPDALVNHNRNIPESTSDEANKEEGRPA  532

Query  579   PPEPAVTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P   +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  533   SPTAPITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAELIA  592

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  593   TKKALHEALMRQEELLAYID  612



>ref|XP_008377271.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Malus domestica]
Length=628

 Score =   536 bits (1380),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 314/623 (50%), Positives = 411/623 (66%), Gaps = 63/623 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+TR+G+L+K A+NAS KF+HS K 
Sbjct  1     MSGPLDRFARPCFEGFYGSDERRERKSDFENSEDERRTRIGTLKKKALNASTKFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VDAFRQALILDELLP KHDDYHMMLRFLKARKF
Sbjct  61    KGSRRKSDGRVSSVSIEDVRDIEELQAVDAFRQALILDELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +++K+K MWADMLQWRK++ ADTI++DF+FKE +EVL++YP GHHGVDK+GRPIYIERLG
Sbjct  121   DVEKAKHMWADMLQWRKDYSADTIMEDFEFKELNEVLQHYPHGHHGVDKEGRPIYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  K+MQVTTMDRY+KYHVQEFE+    K  +C+IAAK+HID STTILDVQGVG KNF
Sbjct  181   KVDPNKVMQVTTMDRYVKYHVQEFEKNFAIKFPACTIAAKRHIDSSTTILDVQGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQ ID +NYPETLC+M+IINAG GFRLLWNTVK+FLDP+TT+KI+VLGNK
Sbjct  241   TKSARDLITRLQNIDNNNYPETLCQMFIINAGPGFRLLWNTVKTFLDPRTTSKIHVLGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLE+IDASELP+FLGG CTCAD+GGC+RSDKGPW +PEI+KMV  G  + + ++ +
Sbjct  301   YQNKLLEVIDASELPEFLGGNCTCADQGGCLRSDKGPWKNPEILKMVLNGEARRARQVVK  360

Query  1023  V--EEEKTI----PE-------DGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQ  883
             V   E K +    P+                  A+ +  P + K  S  +L P++EE + 
Sbjct  361   VLNSEGKVLAYAKPQYPMQVKGSDTSTAESGSEAEDIASPKALKNYSHLRLTPVREEVKA  420

Query  882   P------------DMYVPMVDKTVDLPNWH----VVNNDNCKFVVPKGADLYQIQEAYKG  751
                          D YVPMVDK VD  NW     +    + K  +P       + +  K 
Sbjct  421   VGKANCAGHFSGYDEYVPMVDKAVDT-NWKKQVALQRTHSSKGTLP-------VPDTPKN  472

Query  750   QELASNQLLTGVMTFVMGIVTMVR-MTKNMPRKLTESTLYSNS---MHLNDHAMKGHGAY  583
              E    ++L  +M F M  +T+ R +   + RKL ++ +  N       +D A K  G  
Sbjct  473   PEGIQGRILVALMAFFMTFLTLFRSVASQVTRKLPDALVNHNQNIPESTSDEANKEEG--  530

Query  582   KPPEPA--VTAAEFM-AMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqe  412
             +PP P   +T  + +  ++K++  LEEK   L  +P  MP EKEE+L+ A+ R+DALE E
Sbjct  531   RPPSPTSPITGTDLLPTVLKKLVELEEKVGMLEAKPSEMPYEKEELLNAAVCRVDALEAE  590

Query  411   laeakkaleesqSNQNELIAYIE  343
             L   KKAL E+   Q EL+AYI+
Sbjct  591   LIATKKALHEALMRQEELLAYID  613



>ref|XP_006572840.1| PREDICTED: uncharacterized protein LOC100527533 isoform X1 [Glycine 
max]
Length=481

 Score =   530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 267/382 (70%), Positives = 307/382 (80%), Gaps = 21/382 (5%)
 Frame = -2

Query  1971  GSLRKAAINAsnkfrhsfksr-rrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPT  1795
             GS +K AINASN  R+S   + RRSS+VMSV ++D HDAEE+K VD FRQALILDELLP 
Sbjct  9     GSFKKKAINASNMLRNSLTRKGRRSSKVMSVEIEDVHDAEELKIVDEFRQALILDELLPA  68

Query  1794  KHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQG  1615
             KHDDYHMMLRFLKARKF+I+K+KQMW++ML+WRKEFGADTI +DF+FKE DEVL+YYPQG
Sbjct  69    KHDDYHMMLRFLKARKFDIEKTKQMWSEMLKWRKEFGADTITEDFEFKEIDEVLQYYPQG  128

Query  1614  HHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHI  1435
             HHGVDKDGRP+YIERLG VDATK+MQVTTMDRY+KYHV+EFERT + K ++CSIAAKKHI
Sbjct  129   HHGVDKDGRPVYIERLGQVDATKMMQVTTMDRYIKYHVREFERTFDVKFAACSIAAKKHI  188

Query  1434  DQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVK  1255
             DQSTTILDVQGVGLKNF K AREL+  LQKIDGDNYPETL RM+IINAGSGFR+LWNTVK
Sbjct  189   DQSTTILDVQGVGLKNFNKHARELVTRLQKIDGDNYPETLNRMFIINAGSGFRILWNTVK  248

Query  1254  SFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEI  1075
             SFLDPKTTAKINVLGNKY +KLLEIIDASELP+FLGGTCTCAD+GGCMRSDKGPW D EI
Sbjct  249   SFLDPKTTAKINVLGNKYDTKLLEIIDASELPEFLGGTCTCADQGGCMRSDKGPWKDAEI  308

Query  1074  MKMVHQGAHKCSHR-MARVEEEKTIPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQ  898
             M+MV  G HKCS + +++ +EEK   E+   +                +   T  L P+ 
Sbjct  309   MRMVQNGDHKCSKKSVSQGKEEKENSEEHKTS--------------KLEANHTPHLSPVV  354

Query  897   EE-----TRQPDMYVPMVDKTV  847
             EE       QP    PM DK+ 
Sbjct  355   EEVPATKASQPKDLSPMADKSA  376


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 88/165 (53%), Gaps = 11/165 (7%)
 Frame = -2

Query  828  VVNNDN--CKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTK-NMPR  658
            V N D+   K  V +G +  +  E +K  +L +N         +  +V  V  TK + P+
Sbjct  312  VQNGDHKCSKKSVSQGKEEKENSEEHKTSKLEANH-----TPHLSPVVEEVPATKASQPK  366

Query  657  KLTESTLYSNSMHLNDHAMKGHGAYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPT  478
             L+     S    +++ A K       P+    + EF  +MKRMA LEEK +T++NQP  
Sbjct  367  DLSPMADKSAVKKVDEKASKPQNT---PDKTAASTEFSTVMKRMAELEEKMVTINNQPTA  423

Query  477  MPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
            MPPEKE+ML+  ++R D LE++L   KKALE S   Q EL AY++
Sbjct  424  MPPEKEQMLNATITRADDLEKQLLATKKALEASLVKQEELSAYLD  468



>ref|XP_009418458.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
 ref|XP_009418459.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
Length=631

 Score =   535 bits (1379),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 317/624 (51%), Positives = 402/624 (64%), Gaps = 61/624 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D++   D+R+TR+GSL+K AI+AS +FRHS + 
Sbjct  1     MSGPLDRFARPCFEGFSSHDEKKERKSDVENSEDERRTRIGSLKKKAISASTRFRHSLRR  60

Query  1911  rrrs---sRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFE  1741
             + R    +RV SV ++D  D EE+++VD+FRQ+LI DELLP+KHDDYHMMLRFLKARKF+
Sbjct  61    KSRKKLDTRVSSVSIEDIRDIEELRAVDSFRQSLIQDELLPSKHDDYHMMLRFLKARKFD  120

Query  1740  IDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGL  1561
              +K+K MW++ML+WR++FGADTII+DFD+ E +EVLKYYPQG+HGVDK+GRP+YIE LG 
Sbjct  121   TEKAKHMWSEMLKWRQDFGADTIIEDFDYTEIEEVLKYYPQGYHGVDKEGRPVYIEMLGK  180

Query  1560  VDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFT  1381
             VDA KLMQVTTMDRY+KYHV+EFER    +  +CSIAAK+HID STTILDVQGVGLKNFT
Sbjct  181   VDANKLMQVTTMDRYIKYHVKEFERCFLLRFPACSIAAKRHIDSSTTILDVQGVGLKNFT  240

Query  1380  KQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKY  1201
             K ARELI  LQKID DNYPETLCRM+IINAGSGF+LLWNTVKSFLDPKTT+KI+VLG KY
Sbjct  241   KAARELIIRLQKIDNDNYPETLCRMFIINAGSGFKLLWNTVKSFLDPKTTSKIHVLGTKY  300

Query  1200  QSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARV  1021
             Q+KLLE+ID+SELP+F GG CTC + GGC+RSD+GPW DP I+KM+  G  +C+ ++  V
Sbjct  301   QNKLLEVIDSSELPEFFGGCCTCTEYGGCLRSDRGPWKDPNILKMILNGEAQCARKIVTV  360

Query  1020  --EEEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETR--  886
                E K I             D     S S                  +L P+ EE +  
Sbjct  361   SNSEGKIIAYAKPRYPAIKGSDTSTAESGSEPEDIGYSRRPINYIHKPQLTPVHEEVKNM  420

Query  885   QPDMY---------------VPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKG  751
             Q  M                VPMVDK VD   W    N N   V P     +++ +    
Sbjct  421   QAKMLGKARVSGGSSEYEDCVPMVDKAVD-AAW---KNQNSSSVQPSSEGRFRLFDMSLP  476

Query  750   QELASNQLLTGVMTFVMGIVTMV-----RMTKNMPRKLTESTLYSNSMHLNDHAMKGHGA  586
                   Q++T +  F+M +  M      R+TK +P K  E  LYS    L DH  K    
Sbjct  477   SNGIHVQVITWLTAFIMTLYAMFCSVTSRVTKKLPEKTHEFDLYSPEYDL-DHMPKEE--  533

Query  585   YKPPEPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleq  415
             ++PP P+    E     +++KR+  LEEK   L  +P  MP EKEE+L  A+ R+DALE 
Sbjct  534   FRPPSPSPFYKEVDLLSSVLKRLGELEEKVDELQAKPSKMPYEKEELLDAAVRRVDALEA  593

Query  414   elaeakkaleesqSNQNELIAYIE  343
             EL   KKAL E+   Q EL+AYI+
Sbjct  594   ELIATKKALYEALIGQEELLAYID  617



>emb|CDX75576.1| BnaA01g01260D [Brassica napus]
Length=835

 Score =   542 bits (1397),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 302/526 (57%), Positives = 368/526 (70%), Gaps = 45/526 (9%)
 Frame = -2

Query  1893  VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWA  1714
             V  V ++D HDAEE+KSVDAFRQALILDELLP KHDDYHMMLRFLKARKF++DK+K MW 
Sbjct  29    VTPVEIEDVHDAEELKSVDAFRQALILDELLPEKHDDYHMMLRFLKARKFDLDKTKLMWT  88

Query  1713  DMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQV  1534
             +ML+WRKEFGADT++++F+FKE DEVLKYYPQGHHGVDK+GRP+YIERLG VD+TKLMQV
Sbjct  89    EMLRWRKEFGADTVMEEFEFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQV  148

Query  1533  TTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQA  1354
             TT+DRY+ YHV EFERT N K  +CSIAAKK IDQSTTILDVQGVGLKNF K AR+L+  
Sbjct  149   TTLDRYVNYHVMEFERTFNVKFPACSIAAKKQIDQSTTILDVQGVGLKNFNKAARDLVTR  208

Query  1353  LQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAK-INVLGNKYQSKLLEII  1177
             LQ +DG+NYPE        +   G RL        L P+   + + VLGNKYQSKLLEII
Sbjct  209   LQAVDGNNYPED-------SGCCGARL-----SPSLTPRLQQRSMQVLGNKYQSKLLEII  256

Query  1176  DASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHR-MARVEEEKTIP  1000
             D SELPDFLGGTCTCAD GGCMRSDKGPWN+PEIM+ V  G HKC+ R  A    E+TI 
Sbjct  257   DESELPDFLGGTCTCADSGGCMRSDKGPWNNPEIMQRVKNGDHKCTKRSQAENGAEETIF  316

Query  999   EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQ-EETRQPDMYVPMVD--KTVDLPNWH  829
             E                       EST +  P + +++ QP       D       P W+
Sbjct  317   EGS---------------------ESTAEQAPEEKKDSAQPSSSSSSSDIVPVAAHPAWN  355

Query  828   VVNNDNCKFVVPKGADLYQIQEAYK--GQELASNQLLTGVMTFVMGIVTMVRMTKNMPRK  655
             +   +  KF + K  ++Y IQEA      +   + + TGVM  VMG+VTM+R+TKN+PRK
Sbjct  356   MP--EAHKFSLSK-KEVYAIQEACNTATSDGGRSPIFTGVMALVMGVVTMIRVTKNVPRK  412

Query  654   LTESTLYSNSMHLNDHAMKGHG--AYKPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPP  481
             LTESTLYS+ M+ +D +M      + K   PA++  +FMA+MKRMA LE+K   LS QP 
Sbjct  413   LTESTLYSSPMYCDDASMNKSAMQSEKMMVPAISGEDFMAIMKRMAELEQKVTVLSAQPT  472

Query  480   TMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             TMPPEKEEML+ A+SR + LEQELA  KKAL++S   Q +L+AYIE
Sbjct  473   TMPPEKEEMLNAAISRSNVLEQELAATKKALDDSLGRQEDLVAYIE  518



>gb|KHG00771.1| Sec14 cytosolic factor [Gossypium arboreum]
Length=637

 Score =   536 bits (1380),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 317/620 (51%), Positives = 413/620 (67%), Gaps = 61/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E           K D +   D+R+T++GSL+K A+NAS +F+HS K 
Sbjct  1     MSGPLDRFARPCFEGISGSDEKRERKSDFENSEDERRTKMGSLKKKALNASTRFKHSLKK  60

Query  1911  rrrssR----VMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKF  1744
             +    +    V SV ++D  D EE+++VD FRQALI++ELLP KHDDYHMMLRFLKARKF
Sbjct  61    KSSRRKSDGRVSSVSIEDIRDVEELQAVDQFRQALIMEELLPEKHDDYHMMLRFLKARKF  120

Query  1743  EIDKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLG  1564
             +IDK+K MWADMLQWRKEFG+DTII+DF+F E +EVLKYYPQG+HGVDK+GRP+YIERLG
Sbjct  121   DIDKAKHMWADMLQWRKEFGSDTIIEDFEFSELNEVLKYYPQGYHGVDKEGRPVYIERLG  180

Query  1563  LVDATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNF  1384
              VD  KLMQVTT+DRY+KYHV+EFE+  + K  +C+IAA++HID STTILDV GVG KNF
Sbjct  181   KVDPNKLMQVTTLDRYVKYHVREFEKAFSVKFPACTIAARRHIDSSTTILDVHGVGFKNF  240

Query  1383  TKQARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNK  1204
             TK AR+LI  LQKIDGDNYPETL +M+IINAG GFRLLWNTVK+FLDPKTT+KI+V+GNK
Sbjct  241   TKSARDLIMRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKTFLDPKTTSKIHVIGNK  300

Query  1203  YQSKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMAR  1024
             YQ+KLLEIIDASELP+FLGG+CTCAD+GGC+RSDKGPW +PEI+KMV      C  R AR
Sbjct  301   YQNKLLEIIDASELPEFLGGSCTCADQGGCLRSDKGPWRNPEILKMVVN----CEARRAR  356

Query  1023  VEEEKTIPEDGGV-----------------NvsvsmsaksvkkpaSFKIESTKKLFPIQE  895
              + EK    +G V                        A+ +  P + K  S  +L P++E
Sbjct  357   -QVEKVWNGNGKVIAYAKPPYLMLKGSDTSTAESGSEAEEIASPKAMKNFSQLRLTPVRE  415

Query  894   ETR------------QPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGAD-LYQIQEAYK  754
             ET+              D YVPMVDK VD  +W    +     ++P G+  +  + E  K
Sbjct  416   ETKVVGKTGHAVNFSGYDEYVPMVDKAVD-ASWKKPTSP----LMPSGSKGVLTLPETPK  470

Query  753   GQELASNQLLTGVMTFVMGIVTMVR-MTKNMPRKL--TESTLYSNSMHLNDHAMKGHGAY  583
               +    ++L  +MTF + + T++R +  ++ RKL  T S    N   L   A +    +
Sbjct  471   TPDGIRARILLTLMTFFITLYTLLRSVACHITRKLPGTVSGHSQNITELTPDATQKE-EH  529

Query  582   KPPEPAVTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P  P   A    +++KR+  LEEK  TL  +P  MP +KEE+L+ A+ R+DALE EL  
Sbjct  530   SPSPPLSQADLLYSVLKRLVELEEKVDTLQAKPSVMPYDKEELLNAAVCRVDALEAELIA  589

Query  402   akkaleesqSNQNELIAYIE  343
             AKKAL ++   Q EL+AY++
Sbjct  590   AKKALHDALMRQEELLAYLD  609



>ref|XP_006404603.1| hypothetical protein EUTSA_v10000082mg [Eutrema salsugineum]
 gb|ESQ46056.1| hypothetical protein EUTSA_v10000082mg [Eutrema salsugineum]
Length=639

 Score =   536 bits (1380),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 315/588 (54%), Positives = 397/588 (68%), Gaps = 44/588 (7%)
 Frame = -2

Query  1992  DDRQTRLGSLRKAAINAsnkfrhsfksrrrssR----VMSVVLDDEHDAEEVKSVDAFRQ  1825
             D+R+TR+GSL+K AINAS KF+HS K +    +    V SV ++D  D EE+++VDAFRQ
Sbjct  38    DERRTRIGSLKKKAINASTKFKHSLKKKSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQ  97

Query  1824  ALILDELLPTKHDDYHMMLRFLKARKFEIDKSKQMWADMLQWRKEFGADTIIDDFDFKER  1645
             AL++DELLP +HDDYHMMLRFLKARKF+I+++K MWADM+QWRKEFG DTI+ DFDF+E 
Sbjct  98    ALLMDELLPNRHDDYHMMLRFLKARKFDIERAKHMWADMIQWRKEFGTDTILQDFDFEEI  157

Query  1644  DEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKLMQVTTMDRYLKYHVQEFERTNNDKMS  1465
             +EVLKYYP G+HGVDK+GRPIYIERLG VD  +LMQVT MDRY++YHV+EFER+   K  
Sbjct  158   NEVLKYYPHGYHGVDKEGRPIYIERLGKVDPNRLMQVTNMDRYVRYHVKEFERSFMIKFP  217

Query  1464  SCSIAAKKHIDQSTTILDVQGVGLKNFTKQARELIQALQKIDGDNYPETLCRMYIINAGS  1285
             SC+IAAKKHID +TTILDVQGVGLKNFTK ARELI  LQKIDGDNYPETL +M+IINAG 
Sbjct  218   SCTIAAKKHIDSNTTILDVQGVGLKNFTKSARELITRLQKIDGDNYPETLHQMFIINAGP  277

Query  1284  GFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLEIIDASELPDFLGGTCTCADKGGCMRS  1105
             GFRLLWNTVKSFLDPKT++KI+VLG KYQSKLLE+ID +ELP+FLGGTCTCAD+GGCM S
Sbjct  278   GFRLLWNTVKSFLDPKTSSKIHVLGYKYQSKLLEVIDVNELPEFLGGTCTCADQGGCMLS  337

Query  1104  DKGPWNDPEIMKMV-HQGAHKCSHRMARVEEEKTI--------PEDGGVNvsvsmsaksv  952
             DKGPW +PEI+KMV H GAH+    +  +  E  +        P   G + S + S    
Sbjct  338   DKGPWKNPEIVKMVLHGGAHRAKQVVKVLNSEGKVIAYAKPSYPWIKGSDTSTAESGSDA  397

Query  951   k---kpaSFKIESTKKLFPIQEETRQP------------DMYVPMVDKTVDLPNWHVVNN  817
             +    P + K  S  +L P++EE +              D YVPMVDK VD   W V   
Sbjct  398   EDIGSPKAIKSFSHLRLTPVREEAKIAGETSLAGSFPGYDEYVPMVDKAVD-ATWKV--K  454

Query  816   DNCKFVVPKGADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTM-----VRMTKNMPRKL  652
                + V  KGA +       K  E    ++L   M FVM +         R+ K +P   
Sbjct  455   PAIQRVASKGALMS--PSVPKDPEGIRARVLVMFMAFVMAVFRFFRTVSFRVIKKLP-AT  511

Query  651   TESTLYS--NSMHLNDHAMKGHGAYKPPEPA--VTAAEFM-AMMKRMASLEEKFITLSNQ  487
             T S L +  N+  L  +        +PP P   +T  E + ++MK++  LE+K  TL ++
Sbjct  512   TASQLQTEGNATELGSNGGGVQEESRPPSPVPDLTETELLTSVMKKLTELEDKIGTLQSK  571

Query  486   PPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIE  343
             P  MP EKEE+L+ A+ R+DALE EL   KKAL E+   Q EL+AYI+
Sbjct  572   PCEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELLAYID  619



>dbj|BAD07999.1| putative phosphatidylinositol/ phophatidylcholine transfer protein 
[Oryza sativa Japonica Group]
 gb|EAY84365.1| hypothetical protein OsI_05740 [Oryza sativa Indica Group]
 gb|EAZ21640.1| hypothetical protein OsJ_05269 [Oryza sativa Japonica Group]
Length=624

 Score =   535 bits (1378),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 312/620 (50%), Positives = 405/620 (65%), Gaps = 63/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-----------KMDLD--ADDRQTRLGSLRKAAINAsnkf--rhsf  1918
             MSG ++R  RP  E           K D++   DD++TR+GSL+K AI+AS K       
Sbjct  1     MSGHLDRLARPCFEGSSSNDDKRDHKSDVENSEDDKRTRMGSLKKKAIDASTKIRHSLKK  60

Query  1917  ksrrrssRVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
             K RR  SRV+SV ++D  D EE+++V+AFRQALILDELLP +HDDYHMMLRFLKAR+F+I
Sbjct  61    KKRRSGSRVLSVSIEDVRDLEELQAVEAFRQALILDELLPARHDDYHMMLRFLKARRFDI  120

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             +K+KQMW DML+WRKE+G DTI++DFD+ E D VL+YYP G+HGVDKDGRP+YIERLG V
Sbjct  121   EKAKQMWTDMLKWRKEYGTDTIVEDFDYNELDAVLQYYPHGYHGVDKDGRPVYIERLGKV  180

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D  KLM VTTMDRY++YHV+EFER+   K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  181   DPNKLMHVTTMDRYVRYHVKEFERSFLIKFPACSLAAKRHIDSSTTILDVQGVGLKNFSK  240

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELI  LQKID DNYPETL +M+I+NAG GFRLLWNTVKSFLDPKTT+KI+VLGNKYQ
Sbjct  241   TARELIVRLQKIDNDNYPETLYQMFIVNAGPGFRLLWNTVKSFLDPKTTSKIHVLGNKYQ  300

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
             SKLLE+IDASELP+FLGG CTC + GGC++++KGPW D  I+ +V  G  +C+ ++  V 
Sbjct  301   SKLLEVIDASELPEFLGGACTCPEYGGCLKAEKGPWKDQNILNIVLSGEAQCARQIVTVS  360

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +             S  KL P++EE     
Sbjct  361   NGEEKIISYAKSKHHTIRGSDTSTAESGSEAEDVTSPKVLRSYISHPKLTPVREEVKMVR  420

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W         F   K + L   + +  G   + +++
Sbjct  421   ATSFSTRMPEYDVPVVDKAVD-ATWKREVTRKTAF-SSKDSSLTSTESSSNG---SLDRI  475

Query  726   LTGVMTFVMGIVTMVRMTKNMPRKLTE---------STLYSNSMHLNDHAMKGHGAYKPP  574
             +  ++   M I+T+VR  K++  K            STLY +SM   +        ++PP
Sbjct  476   VAVLLAVFMAIITLVRSVKDLAAKRLPDKNESEQKYSTLYPDSMPKEE--------FRPP  527

Query  573   EPA---VTAAEFMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    V A  F ++++R+  LEEKF+ L ++P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  528   SPTPGFVEAELFSSVLQRLGDLEEKFLMLQDKPSEMPCEKEELLNAAVRRVDALEAELIV  587

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  588   TKKALHEALIRQEELLAYID  607



>ref|XP_004509311.1| PREDICTED: SEC14 cytosolic factor-like isoform X4 [Cicer arietinum]
Length=459

 Score =   529 bits (1362),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 292/480 (61%), Positives = 351/480 (73%), Gaps = 30/480 (6%)
 Frame = -2

Query  1722  MWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLVDATKL  1543
             MW+DMLQWRKEFGADTI++DF+FKE +EVL+YYP GHHGVDK+GRP+YIERLG VDATKL
Sbjct  1     MWSDMLQWRKEFGADTIVEDFEFKELEEVLQYYPHGHHGVDKEGRPVYIERLGQVDATKL  60

Query  1542  MQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTKQAREL  1363
             MQVTTMDRY+KYHV+EFE+T + K ++CSIAAKKHIDQSTTILDVQGVGLK+F KQAREL
Sbjct  61    MQVTTMDRYIKYHVKEFEKTFDLKFAACSIAAKKHIDQSTTILDVQGVGLKSFNKQAREL  120

Query  1362  IQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQSKLLE  1183
             I  LQKIDGDNYPETL RM+IINAGSGFR+LWNTVKSFLDPKTTAKI+VL NKY+SKLLE
Sbjct  121   IMRLQKIDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLSNKYESKLLE  180

Query  1182  IIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMA-RVEEEKT  1006
             IIDASELP+FLGGTCTCA+ GGCMRSDKGPW D EI +MV  G HKCS +    V EEKT
Sbjct  181   IIDASELPEFLGGTCTCAEHGGCMRSDKGPWKDQEIYRMVQNGEHKCSSKYEPPVVEEKT  240

Query  1005  IPEDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEETRQPDMYVPMVDKTVDLPNWHV  826
                +   +  +     +       + +S+K            + +VPM DKT     W  
Sbjct  241   TTSEVSESSKMEAMLTAQFSKVFAEADSSKAC--------NYEDFVPMADKTA----WKK  288

Query  825   VNNDNCKFVVPKG-ADLYQIQEAYKGQELASNQLLTGVMTFVMGIVTMVRMTKNMPRKLT  649
             V  +N  F V K     + + +++K  E  ++Q+ TGVM FVMGIVTMVRMT+NMP+KLT
Sbjct  289   V-EENETFAVSKAEVQNFTMPDSFKIHEKVNSQIFTGVMAFVMGIVTMVRMTRNMPKKLT  347

Query  648   ESTLYSNSMHLNDHAMKGHGAYKPPEPA-------VTAAEFMAMMKRMASLEEKFITLSN  490
             ++  YSNS +         G YK  +P        ++A EFM +MKRMA LE+K + + N
Sbjct  348   DANFYSNSAY-------SCGDYKGQDPCDQMTNPTISAQEFMTVMKRMAELEDKMVNM-N  399

Query  489   QPPTMPPEKEEMLSNAMSRIDaleqelaeakkaleesqSNQNELIAYIEkkkkkKNIFGF  310
             Q   MPPEKEEML+ A+SR DALEQEL   KKALE+S + Q EL  YIEKKKKKK +F +
Sbjct  400   QITCMPPEKEEMLNAAISRADALEQELMATKKALEDSLARQEELSDYIEKKKKKKKLFAW  459



>ref|XP_008681487.1| PREDICTED: uncharacterized protein LOC100273833 isoform X2 [Zea 
mays]
 gb|AFW70030.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=624

 Score =   535 bits (1378),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 312/620 (50%), Positives = 410/620 (66%), Gaps = 63/620 (10%)
 Frame = -2

Query  2052  MSGAVERPLRPSAE-------------KMDLDADDRQTRLGSLRKAAINAsnkfrhsfks  1912
             MSG ++R  RP  E               ++  D+++TR+GSL+K AI+AS K RHS K 
Sbjct  1     MSGHLDRFARPCFEGRSSHDECRDHKSDFEVSEDEKKTRMGSLKKKAIDASTKIRHSLKK  60

Query  1911  rrrss--RVMSVVLDDEHDAEEVKSVDAFRQALILDELLPTKHDDYHMMLRFLKARKFEI  1738
              RR S  RV+SV ++D  D EE+++V+AFRQAL+LDELLP +HDDYHMMLRFLKARKF+I
Sbjct  61    NRRKSGSRVLSVSIEDVRDLEELQAVEAFRQALLLDELLPARHDDYHMMLRFLKARKFDI  120

Query  1737  DKSKQMWADMLQWRKEFGADTIIDDFDFKERDEVLKYYPQGHHGVDKDGRPIYIERLGLV  1558
             DK+KQMW DML WR+E+G DTI++DF++ E D VL+YYP G+HGVDK+GRP+YIERLG V
Sbjct  121   DKAKQMWMDMLHWRREYGTDTILEDFEYTELDAVLQYYPHGYHGVDKEGRPVYIERLGKV  180

Query  1557  DATKLMQVTTMDRYLKYHVQEFERTNNDKMSSCSIAAKKHIDQSTTILDVQGVGLKNFTK  1378
             D +KLM VTTMDRY++YHV+EFER+   K  +CS+AAK+HID STTILDVQGVGLKNF+K
Sbjct  181   DPSKLMNVTTMDRYVRYHVKEFERSFLIKFPACSVAAKRHIDSSTTILDVQGVGLKNFSK  240

Query  1377  QARELIQALQKIDGDNYPETLCRMYIINAGSGFRLLWNTVKSFLDPKTTAKINVLGNKYQ  1198
              ARELIQ LQKID DNYPETL +M+I+NAG GFRLLWNTVKSFLDPKTTAKI+VLGNKYQ
Sbjct  241   TARELIQRLQKIDNDNYPETLYQMFIVNAGPGFRLLWNTVKSFLDPKTTAKIHVLGNKYQ  300

Query  1197  SKLLEIIDASELPDFLGGTCTCADKGGCMRSDKGPWNDPEIMKMVHQGAHKCSHRMARVE  1018
             SKLLEIIDASELP+FLGGTCTC + GGC++++KGPW DP I+K+V  G   C+ ++  + 
Sbjct  301   SKLLEIIDASELPEFLGGTCTCPEYGGCLKAEKGPWKDPNILKIVQSGEVHCARQIVTIS  360

Query  1017  --EEKTIP-----------EDGGVNvsvsmsaksvkkpaSFKIESTKKLFPIQEE-----  892
               EEK I             D     S S +  ++   A        KL P++EE     
Sbjct  361   NGEEKIITYAKPKHHSMRGSDTSTAESGSEADDAISPKALRSYIQHPKLTPVREEVKIVR  420

Query  891   -----TRQPDMYVPMVDKTVDLPNWHVVNNDNCKFVVPKGADLYQIQEAYKGQELASNQL  727
                  TR P+  VP+VDK VD   W         F +P+ +    ++   +  + + +++
Sbjct  421   ATSFSTRLPEYDVPVVDKAVD-ATWRREQPRKIPF-MPQDS---SVKTMSRPSDSSWDKI  475

Query  726   LTGVMTFVMGIVTMVRMTKNM-PRKL--------TESTLYSNSMHLNDHAMKGHGAYKPP  574
             +  +M  +M IV +VR  K++  R+L          STLY + +   +        ++PP
Sbjct  476   VATLMACLMAIVMLVRSVKDLVTRRLPYKGGSEEIHSTLYPDPIQKEE--------FRPP  527

Query  573   EPAVTAAE---FMAMMKRMASLEEKFITLSNQPPTMPPEKEEMLSNAMSRIDaleqelae  403
              P    AE   F  +++R+  LEEK   L  +P  MP EKEE+L+ A+ R+DALE EL  
Sbjct  528   SPIPGFAEADLFAVVLQRLGELEEKVQMLQEKPSEMPCEKEELLNAAVRRVDALEAELIV  587

Query  402   akkaleesqSNQNELIAYIE  343
              KKAL E+   Q EL+AYI+
Sbjct  588   TKKALHEALIRQEELLAYID  607



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6341621592896