BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24646_g1_i1 len=832 path=[1421:0-259 4488:260-262 1684:263-316
1738:317-393 1815:394-431 3236:432-502 2244:503-554 3876:555-631
2373:632-831]

Length=832
                                                                      Score     E

ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        50.4    2e-04   
ref|XP_009417114.1|  PREDICTED: horcolin {ECO:0000312|EMBL:AAV395...  49.7    3e-04   
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  49.3    4e-04   
gb|EAY98637.1|  hypothetical protein OsI_20561                        51.2    5e-04   Oryza sativa Indica Group [Indian rice]
gb|EEE64302.1|  hypothetical protein OsJ_19139                        51.2    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055995.1|  Os05g0508400                                     50.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDM80828.1|  unnamed protein product                              48.5    7e-04   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  50.8    8e-04   
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    0.001   



>ref|XP_006838698.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
 gb|ERN01267.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
Length=149

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  460  SGRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYV  344
            SG +G   G PFSF + DGK+VGFHGRA D+++A+G+ +
Sbjct  48   SGPYGLQIGTPFSFSMTDGKVVGFHGRASDYLNAMGLNI  86



>ref|XP_009417114.1| PREDICTED: horcolin {ECO:0000312|EMBL:AAV39531.1}-like [Musa 
acuminata subsp. malaccensis]
Length=142

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  457  GRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYV  344
            G  G+ +G PFS  V +GKI GF GRAG F+DAIGVY+
Sbjct  102  GPFGAYEGTPFSIPVAEGKIAGFFGRAGSFIDAIGVYL  139



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -1

Query  499  HMILQTPQVHNTFS--GRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYV  344
            H+++++ Q +      G +GS DG  FS  V+ GKIVGFHGR G  +D+IGVY+
Sbjct  92   HVVVRSIQFNTNARSYGPYGSTDGTAFSLPVKQGKIVGFHGRCGADLDSIGVYL  145



>gb|EAY98637.1| hypothetical protein OsI_20561 [Oryza sativa Indica Group]
Length=724

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -1

Query  478  QVHNTFSGRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYVTSI*VHRLSCNNVV  302
            Q + +  G  G+ DG PFS  V  GKI+GFHGR+G ++++IG Y+  + V   S + V+
Sbjct  227  QSNRSIYGPFGTEDGTPFSLPVSSGKIIGFHGRSGSYLNSIGFYLKQVNVSDRSNSPVL  285



>gb|EEE64302.1| hypothetical protein OsJ_19139 [Oryza sativa Japonica Group]
Length=1105

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -1

Query  478  QVHNTFSGRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYVTSI*VHRLSCNNVV  302
            Q + +  G  G+ DG PFS  V  GKI+GFHGR+G ++++IG Y+  + V   S + V+
Sbjct  608  QSNRSIYGPFGTEDGTPFSLPVSSGKIIGFHGRSGSYLNSIGFYLKQVNVSDRSNSPVL  666



>ref|NP_001055995.1| Os05g0508400 [Oryza sativa Japonica Group]
 gb|AAT44259.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17909.1| Os05g0508400 [Oryza sativa Japonica Group]
Length=604

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  484  TPQVHNTFSGRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYVTSI*VHRLSCNNV  305
            T Q + +  G  G+ DG PFS  V  GKI+GFHGR+G ++++IG Y+  + V   S + V
Sbjct  105  TFQSNRSIYGPFGTEDGTPFSLPVSSGKIIGFHGRSGSYLNSIGFYLKQVNVSDRSNSPV  164

Query  304  V  302
            +
Sbjct  165  L  165



>emb|CDM80828.1| unnamed protein product [Triticum aestivum]
Length=141

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  457  GRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYVTS  338
            G +G+  GAPF      G+I+GFHGR+G  VDA+G+YV +
Sbjct  100  GPYGTRKGAPFELPAAGGRIIGFHGRSGGLVDALGIYVET  139



>ref|XP_006654618.1| PREDICTED: myrosinase-binding protein-like At1g52040-like [Oryza 
brachyantha]
Length=605

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  484  TPQVHNTFSGRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYVTSI  335
            T Q + +  G  G+ DG PFS  V  GKI+GFHGR+G ++++IG Y+  +
Sbjct  106  TFQSNRSMYGPFGTEDGTPFSLPVSSGKIIGFHGRSGSYLNSIGFYLKQV  155



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 50.8 bits (120),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  457  GRHGSNDGAPFSFVVQDGKIVGFHGRAGDFVDAIGVYV  344
            G +G   G  FSF   +GKIVGFHGR+G ++DAIGVY+
Sbjct  956  GPYGVEQGTIFSFPTTEGKIVGFHGRSGLYLDAIGVYL  993



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590667407420