BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24645_g1_i2 len=1305 path=[3101:0-50 3152:51-80 6484:81-85
6489:86-102 3319:103-818 4035:819-842 4035:843-866 2943:867-972
1222:973-1003 1217:1004-1008 1222:1009-1039 1217:1040-1044
1222:1045-1075 1252:1076-1304]

Length=1305
                                                                      Score     E

ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...    168   2e-44   
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   1e-40   
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g             156   4e-40   
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   9e-40   
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...    153   4e-39   
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    152   7e-39   
ref|XP_009381782.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   5e-35   
emb|CAN62804.1|  hypothetical protein VITISV_011795                     144   5e-35   Vitis vinifera
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   8e-35   
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   1e-34   Vitis vinifera
ref|NP_001130104.1|  hypothetical protein precursor                     140   2e-34   Zea mays [maize]
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                     139   3e-34   
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   4e-34   
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   8e-34   
ref|XP_002512774.1|  Glycoprotein X precursor, putative                 139   1e-33   Ricinus communis
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   2e-33   
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   2e-33   
ref|XP_002527970.1|  conserved hypothetical protein                     136   3e-33   Ricinus communis
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   4e-33   
ref|XP_003581094.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   5e-33   
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850          136   5e-33   Sorghum bicolor [broomcorn]
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   6e-33   
ref|XP_006371803.1|  putative surface family protein                    135   7e-33   
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   9e-33   
ref|XP_011015272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   1e-32   
gb|AFK40899.1|  unknown                                                 135   1e-32   
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   1e-32   
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   2e-32   
ref|XP_008799981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   2e-32   
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   5e-32   
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   5e-32   
gb|EPS65223.1|  hypothetical protein M569_09558                         133   6e-32   
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   6e-32   Vitis vinifera
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   7e-32   
ref|XP_011045030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   7e-32   
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                       131   1e-31   
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-31   
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                     132   2e-31   
gb|KDP41920.1|  hypothetical protein JCGZ_26938                         130   2e-31   
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   4e-31   
emb|CAN66163.1|  hypothetical protein VITISV_008126                     130   6e-31   Vitis vinifera
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   7e-31   
ref|XP_010938482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   9e-31   
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...    130   1e-30   
ref|XP_006382179.1|  putative surface family protein                    130   1e-30   
ref|XP_004486594.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-30   
gb|KEH39774.1|  fasciclin domain protein                                128   2e-30   
ref|NP_001046792.1|  Os02g0461500                                       129   3e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CDY36762.1|  BnaA03g11240D                                          125   5e-30   
ref|XP_010092859.1|  hypothetical protein L484_022454                   129   9e-30   
dbj|BAK06740.1|  predicted protein                                      126   1e-29   
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   2e-29   
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   3e-29   
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg             125   4e-29   
gb|EMT17229.1|  hypothetical protein F775_11240                         124   4e-29   
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   4e-29   
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   4e-29   
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   4e-29   
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   7e-29   
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                   126   1e-28   
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   1e-28   
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   1e-28   
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg             126   2e-28   
gb|KDP33435.1|  hypothetical protein JCGZ_07006                         123   2e-28   
gb|ABK24724.1|  unknown                                                 124   3e-28   Picea sitchensis
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   4e-28   
gb|ABR16637.1|  unknown                                                 124   5e-28   Picea sitchensis
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                       123   7e-28   
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11               123   8e-28   Gossypium hirsutum [American cotton]
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g             121   8e-28   
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1                123   1e-27   
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   1e-27   
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3                121   1e-27   
ref|XP_010102851.1|  hypothetical protein L484_004423                   120   2e-27   
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-27   
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190          122   2e-27   
gb|EYU22059.1|  hypothetical protein MIMGU_mgv1a011491mg                119   3e-27   
ref|XP_010938483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   4e-27   
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10               121   4e-27   Gossypium hirsutum [American cotton]
ref|XP_009417795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   4e-27   
gb|EPS61284.1|  hypothetical protein M569_13515                         117   5e-27   
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   6e-27   
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   6e-27   
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg             119   6e-27   
ref|NP_001149463.1|  fasciclin-like arabinogalactan protein 8 pre...    119   6e-27   Zea mays [maize]
gb|ABR16344.1|  unknown                                                 120   8e-27   Picea sitchensis
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659             120   8e-27   
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   9e-27   
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   9e-27   
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-26   
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   1e-26   
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...    117   1e-26   
ref|NP_001150349.1|  fasciclin-like arabinogalactan protein 8 pre...    117   1e-26   Zea mays [maize]
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-26   
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-26   
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-26   
ref|XP_010669451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   2e-26   
ref|XP_008649024.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   2e-26   
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-26   
emb|CDY42162.1|  BnaC05g40570D                                          116   3e-26   
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   3e-26   
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   4e-26   
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein                 118   5e-26   
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   5e-26   
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               118   5e-26   
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   6e-26   
ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   6e-26   
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   7e-26   
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   8e-26   
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   8e-26   
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   9e-26   
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g             117   1e-25   
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-25   
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg                117   1e-25   
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-25   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg             117   1e-25   
ref|XP_004305460.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   2e-25   
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   2e-25   
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10     111   3e-25   
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...    116   3e-25   Vitis vinifera
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-25   
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10     111   3e-25   
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             113   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-25   
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10     111   3e-25   
gb|ABK28554.1|  unknown                                                 113   4e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18927.1|  BnaC04g04230D                                          115   4e-25   
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             115   5e-25   
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   5e-25   
emb|CAN65447.1|  hypothetical protein VITISV_011425                     115   5e-25   Vitis vinifera
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1              115   5e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10     110   5e-25   
gb|AAM66074.1|  endosperm-specific protein-like protein                 115   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              115   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   5e-25   
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   5e-25   
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   6e-25   
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   6e-25   
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   7e-25   
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-25   
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             115   7e-25   
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg                114   7e-25   
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein             114   7e-25   
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g             114   8e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   9e-25   
emb|CDY20747.1|  BnaA02g08870D                                          114   9e-25   
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                    114   9e-25   
gb|EPS66997.1|  hypothetical protein M569_07779                         114   9e-25   
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...    114   1e-24   Trifolium pratense [peavine clover]
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-24   
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-24   
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-24   
gb|KHM99327.1|  Fasciclin-like arabinogalactan protein 3                112   2e-24   
ref|XP_006357096.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   2e-24   
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg             113   2e-24   
gb|ABV27488.1|  fasciclin-like arabinogalactan protein 17               111   2e-24   Gossypium hirsutum [American cotton]
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-24   
ref|XP_004305604.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   2e-24   
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-24   
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-24   
ref|XP_002522745.1|  conserved hypothetical protein                     113   3e-24   Ricinus communis
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   3e-24   
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   3e-24   
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg             113   3e-24   
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-24   
ref|XP_002438784.1|  hypothetical protein SORBIDRAFT_10g026140          110   4e-24   Sorghum bicolor [broomcorn]
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg             112   4e-24   
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             112   4e-24   
emb|CDP17792.1|  unnamed protein product                                113   5e-24   
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-24   
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-24   
ref|XP_004305605.1|  PREDICTED: uncharacterized protein LOC101308896    114   5e-24   
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-24   
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-24   
emb|CDY28643.1|  BnaC09g32320D                                          112   6e-24   
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   6e-24   
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                    112   6e-24   
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g             112   7e-24   
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    112   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg             112   7e-24   
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-24   
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...    112   7e-24   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-24   
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg                111   8e-24   
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   8e-24   
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1           111   8e-24   
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   9e-24   
ref|XP_010088447.1|  hypothetical protein L484_018219                   111   1e-23   
emb|CDX74743.1|  BnaA05g04890D                                          111   1e-23   
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   1e-23   
ref|XP_011082039.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    108   1e-23   
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   1e-23   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g             110   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625             108   2e-23   
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
emb|CDP13717.1|  unnamed protein product                                110   2e-23   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
emb|CDP12467.1|  unnamed protein product                                108   2e-23   
ref|XP_008777689.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-23   
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                        110   2e-23   
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
emb|CDY08417.1|  BnaA05g26530D                                          107   2e-23   
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         110   3e-23   
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-23   
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-23   
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-23   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   3e-23   
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   3e-23   
ref|XP_003526450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-23   
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   4e-23   
emb|CDY37904.1|  BnaA06g19130D                                          109   4e-23   
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   4e-23   
ref|XP_002511740.1|  conserved hypothetical protein                     109   4e-23   Ricinus communis
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg             107   4e-23   
emb|CDX87001.1|  BnaC03g52710D                                          109   4e-23   
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-23   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   6e-23   
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   7e-23   
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   7e-23   
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   8e-23   
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790          108   8e-23   
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   8e-23   
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   9e-23   
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22   
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22   
gb|KDP39270.1|  hypothetical protein JCGZ_01027                         108   1e-22   
ref|XP_008352034.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   1e-22   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22   
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                   108   1e-22   
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154             108   1e-22   
gb|KDP29933.1|  hypothetical protein JCGZ_18502                         108   1e-22   
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22   
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   1e-22   
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                    107   2e-22   
ref|NP_001058255.1|  Os06g0656800                                       105   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AFK41095.1|  unknown                                                 108   2e-22   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg             107   2e-22   
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-22   Vitis vinifera
gb|EAZ01938.1|  hypothetical protein OsI_23966                          105   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002880584.1|  hypothetical protein ARALYDRAFT_481301             105   2e-22   
gb|AAM65777.1|  putative pollen surface protein                         107   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657210.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-22   
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2      107   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2              107   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-22   
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-22   
emb|CAN61077.1|  hypothetical protein VITISV_012919                     107   3e-22   Vitis vinifera
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-22   
emb|CDX68507.1|  BnaC01g25850D                                          107   3e-22   
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830          106   3e-22   
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   4e-22   
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g             106   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   4e-22   
ref|NP_180021.1|  fasciclin-like arabinogalactan protein 3              105   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   5e-22   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   5e-22   Vitis vinifera
ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   5e-22   
emb|CBI28444.3|  unnamed protein product                                107   5e-22   
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   6e-22   
dbj|BAK07384.1|  predicted protein                                      103   6e-22   
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   7e-22   
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   7e-22   
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   7e-22   
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-22   
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                  106   7e-22   
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg             105   7e-22   
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   7e-22   
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   9e-22   
ref|XP_004501250.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   9e-22   
ref|XP_008803592.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-21   
dbj|BAK07804.1|  predicted protein                                      103   1e-21   
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                    102   1e-21   
emb|CDP18905.1|  unnamed protein product                                105   2e-21   
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g             105   2e-21   
ref|XP_006653238.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-21   
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-21   
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   3e-21   
gb|ABI95423.1|  fasciclin-like protein FLA33                            102   3e-21   
emb|CDY00793.1|  BnaC03g37770D                                          102   4e-21   
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-21   
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   5e-21   
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8           103   5e-21   
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   6e-21   
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg             101   7e-21   
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   8e-21   
ref|XP_010472452.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   8e-21   
ref|XP_010417204.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   8e-21   
ref|NP_001053617.1|  Os04g0574200                                       103   9e-21   
emb|CDY52668.1|  BnaC01g38580D                                          100   1e-20   
gb|ADP88924.1|  fasciclin-like AGP                                      102   1e-20   
gb|AIY35292.1|  fasciclin-like arabinogalactan 12                       102   1e-20   
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2                102   1e-20   
emb|CDX76814.1|  BnaC08g34000D                                          100   1e-20   
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-20   
ref|XP_010429425.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-20   
ref|XP_009133982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-20   
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-20   
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-20   
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-20   
gb|KHN16466.1|  Fasciclin-like arabinogalactan protein 14             99.0    2e-20   
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg             102   2e-20   
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-20   
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-20   
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                   102   2e-20   
emb|CDY37043.1|  BnaA04g26210D                                          102   2e-20   
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg             102   2e-20   
ref|XP_010527113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-20   
gb|KFK32632.1|  hypothetical protein AALP_AA6G268600                  99.8    2e-20   
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13               101   3e-20   
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein        101   4e-20   
gb|KEH39773.1|  fasciclin domain protein                              99.4    4e-20   
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg              99.0    4e-20   
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    4e-20   
gb|EMT00417.1|  hypothetical protein F775_14876                       98.6    5e-20   
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   5e-20   
ref|XP_011082038.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    5e-20   
gb|KEH39771.1|  fasciclin-like arabinogalactan protein                99.0    6e-20   
ref|XP_003523715.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    6e-20   
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19               100   6e-20   
ref|XP_009117125.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    7e-20   
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   7e-20   
emb|CDY34771.1|  BnaA09g41380D                                        98.6    7e-20   
ref|XP_010102850.1|  hypothetical protein L484_004422                 98.6    7e-20   
gb|AFK47920.1|  unknown                                               98.6    8e-20   
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    102   8e-20   
ref|XP_006296192.1|  hypothetical protein CARUB_v10025354mg           98.2    8e-20   
ref|XP_006404978.1|  hypothetical protein EUTSA_v10000470mg           98.2    9e-20   
dbj|BAJ90388.1|  predicted protein                                      100   9e-20   
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-19   
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-19   
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-19   
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330        99.4    2e-19   
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                         99.4    2e-19   
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    2e-19   
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10           99.4    2e-19   
gb|ACL36352.1|  fascilin-like arabinogalactan protein                 99.0    2e-19   
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg           99.0    3e-19   
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    3e-19   
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    3e-19   
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.2    3e-19   
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    3e-19   
gb|AAA91129.1|  putative surface protein                              95.9    4e-19   
gb|ABI95393.1|  fasciclin-like protein FLA3                           98.2    5e-19   
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein        97.8    5e-19   
emb|CDY50538.1|  BnaA01g30420D                                        95.5    5e-19   
gb|EAZ25443.1|  hypothetical protein OsJ_09260                        97.4    5e-19   
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg              97.4    7e-19   
gb|EAY87366.1|  hypothetical protein OsI_08770                        95.5    7e-19   
ref|NP_001047988.1|  Os02g0726000                                     95.5    7e-19   
emb|CDX71771.1|  BnaC08g31030D                                        97.4    8e-19   
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4     96.3    8e-19   
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.4    9e-19   
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030        97.4    1e-18   
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1              92.8    1e-18   
ref|NP_001061532.1|  Os08g0321000                                     97.1    1e-18   
ref|XP_003603528.1|  Fasciclin-like arabinogalactan protein           94.7    1e-18   
gb|EAZ42295.1|  hypothetical protein OsJ_26868                        96.7    1e-18   
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                   96.3    2e-18   
ref|XP_006601616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    2e-18   
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12             96.3    2e-18   
ref|XP_002878353.1|  AT3g60900/T4C21_310                              96.7    2e-18   
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...  96.3    3e-18   
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10       96.3    3e-18   
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    3e-18   
emb|CDY66159.1|  BnaCnng49680D                                        95.9    3e-18   
gb|ACN30673.1|  unknown                                               95.9    3e-18   
ref|XP_009363600.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    3e-18   
ref|NP_001147121.1|  rat frizzled homolog1                            95.9    3e-18   
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    4e-18   
gb|ABI95395.1|  fasciclin-like protein FLA5                           95.5    5e-18   
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380        95.1    5e-18   
ref|XP_008228867.1|  PREDICTED: mucin-17-like                         96.7    5e-18   
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700        95.1    6e-18   
emb|CDY20316.1|  BnaC04g36400D                                        93.2    6e-18   
ref|XP_007216704.1|  hypothetical protein PRUPE_ppa026501mg           95.9    6e-18   
gb|ABI95391.1|  fasciclin-like protein FLA1                           95.1    7e-18   
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    8e-18   
emb|CDX67846.1|  BnaA07g18860D                                        94.7    8e-18   
emb|CDX86346.1|  BnaA06g30630D                                        94.7    8e-18   
ref|XP_003560388.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    9e-18   
ref|XP_010104070.1|  hypothetical protein L484_014256                 94.0    9e-18   
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    1e-17   
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                94.4    1e-17   
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19             92.8    1e-17   
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein           94.4    1e-17   
gb|KEH39772.1|  fasciclin domain protein                              91.3    1e-17   
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...  94.0    1e-17   
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    1e-17   
gb|EMT07250.1|  hypothetical protein F775_26198                       94.0    1e-17   
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    1e-17   
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  93.6    1e-17   
ref|XP_010526275.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    1e-17   
emb|CDX73808.1|  BnaA03g32390D                                        91.3    1e-17   
emb|CDY52341.1|  BnaA09g38900D                                        93.6    2e-17   
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.3    2e-17   
emb|CBI39739.3|  unnamed protein product                              93.2    2e-17   
ref|XP_008228897.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    3e-17   
ref|XP_009140554.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    3e-17   
ref|XP_009391103.1|  PREDICTED: flocculation protein FLO11-like       93.6    3e-17   
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg           92.8    4e-17   
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    4e-17   
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    4e-17   
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                     92.4    4e-17   
gb|ABI95418.1|  fasciclin-like protein FLA28                          92.4    4e-17   
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    4e-17   
gb|EMT28749.1|  hypothetical protein F775_29839                       92.0    5e-17   
ref|XP_003560811.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    5e-17   
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.3    1e-16   
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.3    1e-16   
gb|ACU21313.1|  unknown                                               87.4    1e-16   
ref|XP_009370988.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    3e-16   
ref|XP_008342795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    3e-16   
dbj|BAK00054.1|  predicted protein                                    89.7    3e-16   
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    4e-16   
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.7    4e-16   
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.0    6e-16   
ref|XP_008342794.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.0    2e-15   
ref|XP_008362415.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    2e-15   
ref|XP_004244698.2|  PREDICTED: skin secretory protein xP2-like       85.9    2e-15   
ref|NP_001062666.1|  Os09g0248100                                     87.4    2e-15   
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor   87.4    2e-15   
ref|XP_003571006.2|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    2e-15   
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    3e-15   
gb|ABI95421.1|  fasciclin-like protein FLA31                          85.5    3e-15   
ref|XP_006286247.1|  hypothetical protein CARUB_v10007817mg           84.7    5e-15   
emb|CAD40213.2|  OSJNBa0019J05.11                                     84.3    6e-15   
gb|EAY93407.1|  hypothetical protein OsI_15204                        84.3    6e-15   
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    7e-15   
emb|CAH66152.1|  OSIGBa0097I11.4                                      84.3    7e-15   
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    9e-15   
emb|CDY36445.1|  BnaC03g67650D                                        84.0    9e-15   
emb|CDY23293.1|  BnaA08g12530D                                        83.6    1e-14   
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    1e-14   
ref|XP_002982557.1|  hypothetical protein SELMODRAFT_58104            82.0    1e-14   
gb|KHN31865.1|  Fasciclin-like arabinogalactan protein 3              83.6    1e-14   
ref|XP_006412600.1|  hypothetical protein EUTSA_v10027390mg           83.6    1e-14   
gb|EEC71769.1|  hypothetical protein OsI_04379                        85.5    1e-14   
ref|XP_010447580.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    1e-14   
gb|EMT13908.1|  hypothetical protein F775_11763                       82.8    2e-14   
ref|XP_006644987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    2e-14   
ref|XP_010438048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    2e-14   
ref|NP_001044764.1|  Os01g0841100                                     84.7    2e-14   
ref|XP_009370989.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    2e-14   
ref|XP_009365292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.6    3e-14   
ref|XP_010432871.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    3e-14   
ref|XP_004919247.1|  PREDICTED: translation initiation factor IF-...  80.9    3e-14   
ref|XP_009354314.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    5e-14   
ref|XP_008342793.1|  PREDICTED: uncharacterized protein LOC103405558  83.6    6e-14   
ref|XP_007150828.1|  hypothetical protein PHAVU_005G184100g           83.2    7e-14   
ref|XP_006595480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    8e-14   
ref|XP_009354315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    9e-14   
ref|XP_004919246.1|  PREDICTED: translation initiation factor IF-...  80.1    9e-14   
gb|EEE66152.1|  hypothetical protein OsJ_22221                        80.1    1e-13   
ref|XP_002488894.1|  hypothetical protein SORBIDRAFT_2276s002020      81.6    2e-13   
ref|XP_011089459.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    2e-13   
ref|NP_194865.1|  FASCICLIN-like arabinogalactan protein 5            79.7    2e-13   
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500        81.3    4e-13   
ref|XP_004987197.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    4e-13   
ref|XP_009108932.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    6e-13   
dbj|BAK03586.1|  predicted protein                                    78.6    7e-13   
gb|EYU18962.1|  hypothetical protein MIMGU_mgv1a021336mg              79.7    9e-13   
ref|NP_001169235.1|  uncharacterized protein LOC100383093 precursor   79.3    9e-13   
ref|NP_001105408.1|  endosperm specific protein1 precursor            79.3    9e-13   
ref|XP_011089814.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    1e-12   
ref|XP_002439922.1|  hypothetical protein SORBIDRAFT_09g022560        79.3    1e-12   
ref|XP_004961853.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.3    1e-12   
ref|XP_006838924.1|  hypothetical protein AMTR_s00002p00270100        79.3    1e-12   
ref|NP_001055752.1|  Os05g0459700                                     79.3    2e-12   
ref|NP_001131728.1|  endosperm specific protein precursor             79.3    2e-12   
ref|XP_006607004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.7    2e-12   
gb|EEE55648.1|  hypothetical protein OsJ_04030                        78.2    3e-12   
ref|XP_010685765.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    3e-12   
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...  78.6    3e-12   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...  78.6    3e-12   
ref|XP_007137111.1|  hypothetical protein PHAVU_009G1004000g          74.7    3e-12   
ref|XP_008674840.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    4e-12   
gb|ETN97653.1|  hypothetical protein RFI_39876                        75.1    5e-12   
gb|EEE63981.1|  hypothetical protein OsJ_18808                        78.2    5e-12   
ref|NP_001132327.1|  hypothetical protein precursor                   77.4    5e-12   
emb|CDM84950.1|  unnamed protein product                              77.0    6e-12   
ref|XP_008646777.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    9e-12   
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.6    1e-11   
ref|XP_004970532.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    2e-11   
ref|XP_004970533.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    2e-11   
tpg|DAA56901.1|  TPA: hypothetical protein ZEAMMB73_426702            75.9    2e-11   
ref|XP_010252126.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    2e-11   
ref|XP_010043558.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    3e-11   
emb|CDY11984.1|  BnaC03g14100D                                        70.5    4e-11   
ref|XP_002458743.1|  hypothetical protein SORBIDRAFT_03g039440        74.7    4e-11   
ref|NP_001048836.2|  Os03g0128000                                     71.2    5e-11   
ref|XP_008776771.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.9    6e-11   



>ref|XP_011082708.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Sesamum 
indicum]
Length=322

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I  FS +LLF SA A +IT VL QY SFSTF S+L+ T+LA EIN+RQ   T+LVV+N+N
Sbjct  8    ISLFSFSLLFHSAVAFNITQVLSQYASFSTFNSFLTLTNLASEINSRQS-ITVLVVENNN  66

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
            + PLSG S DVLKK+MSVHVIL+YFD  KL  L  +  + TTLFQ +G A   QGF+NVT
Sbjct  67   LSPLSGKSSDVLKKIMSVHVILDYFDVPKLQKLSNKSTIVTTLFQTTGLAKGQQGFVNVT  126

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
                  + F S   G+ +SS +VK V ++ Y+ SVLQ++NVIIP
Sbjct  127  QLSSDSIAFGSAVPGSTISSNLVKSVVSQPYNFSVLQVTNVIIP  170



>ref|XP_011034724.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Populus 
euphratica]
Length=314

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + FS  LLF++  A +IT +L QYP FSTF SYL+QT LA EIN+RQ   T+LVV+N N+
Sbjct  11   LCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQT-ITVLVVENGNM  69

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
             PLSG     +K V+S HVIL+Y+D  KL  L  +  + TTLFQ+SGQA   QGFLNVT 
Sbjct  70   SPLSGKPNGEIKNVLSEHVILDYYDVAKLQKLQKKTAMLTTLFQSSGQAKGQQGFLNVTV  129

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             G   V F S   G+++SS +VK V ++ Y++SVLQ+SN+I+P
Sbjct  130  LGSNSVAFGSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIVP  172



>ref|XP_006368661.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
 gb|ERP65230.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
Length=310

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + FS  LLF++  A +IT +L QYP FSTF SYL+QT LA EIN+RQ   T+LVV+N N+
Sbjct  11   LCFSSFLLFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQT-ITVLVVENGNM  69

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
             PLSG     +K V+S HVIL+Y+D  KL  L  +  + TTLFQ+SGQA   QGFLNVT 
Sbjct  70   SPLSGKPNGEIKNVLSGHVILDYYDVAKLQKLQNKTAMLTTLFQSSGQAKGQQGFLNVTV  129

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             G   V F S   G+++SS +VK V ++ Y++SVLQ+SN+I+
Sbjct  130  LGSNSVAFGSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIV  171



>ref|XP_009615226.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
tomentosiformis]
Length=299

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 1/159 (1%)
 Frame = +1

Query  91   LFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMS  270
            +   A A +IT +L QY SFS F +YL+QT +A  IN+RQ   T+LVV+N N+ PLSG S
Sbjct  16   ILCHAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQT-ITVLVVENSNLSPLSGKS  74

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
             DVL  +M VHV+L+Y+D QKL  LP +   A TLFQ +GQA  +QG+LNVT+ G   V 
Sbjct  75   QDVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPTLFQTTGQANSDQGYLNVTDLGSGSVA  134

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
              S AKG+ + S +VK + ++ Y++S+LQISNVIIP  +
Sbjct  135  LGSAAKGSTLGSNLVKSIASQPYNISILQISNVIIPLGI  173



>ref|XP_009784353.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
sylvestris]
Length=300

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 106/155 (68%), Gaps = 1/155 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            A A +IT +L QY SFS F +YL+QT +A  IN+RQ   T+LVV+N N+ PLSG S DVL
Sbjct  21   AKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQT-ITVLVVENSNLSPLSGKSQDVL  79

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
              +M VHV+L+Y+D QKL  LP +   A  LFQ +GQA  +QG+LNVT+ G   V   S 
Sbjct  80   ANIMRVHVLLDYYDVQKLQKLPNKTMKAPALFQTTGQANSDQGYLNVTDLGSGSVALGSA  139

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            AKGA + S +VK V ++ Y++S+LQISN IIP  +
Sbjct  140  AKGATLGSNLVKSVASQPYNISILQISNAIIPLGI  174



>ref|XP_010265495.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nelumbo 
nucifera]
Length=295

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I+  S+ L F+S  A +IT +L QY  FS F  YL+QT LAD IN RQ   T+L VDN  
Sbjct  24   ILVLSLFLAFASTEAFNITRLLSQYSDFSNFNDYLTQTKLADSINRRQT-ITVLAVDNGA  82

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
            +  LSG SPD++KKV+S+HVIL+Y+D  K+  L  +  + TTLFQ++G AV+ QGFLNVT
Sbjct  83   VSSLSGKSPDLIKKVLSLHVILDYYDIDKIKKLSNKSTILTTLFQSTGVAVNKQGFLNVT  142

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
                  V+F S  KG+++ + ++K V  + Y+LSVLQ+S+VI P
Sbjct  143  RFASGEVRFGSAVKGSSLDAQLIKKVAAQPYNLSVLQVSSVIYP  186



>ref|XP_009381782.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 105/163 (64%), Gaps = 1/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + F +  + S+++A+DI  +L  +P +STF  YL+QT +ADEIN R+   T+LVV++  I
Sbjct  9    VLFLLLFVSSASSALDIVEILQPFPEYSTFTKYLTQTKVADEINRRKT-ITVLVVNDSAI  67

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
             PLS +S D LK  +SVHVIL+Y+D   L NLP +  L TTLFQASG A    GFLN T 
Sbjct  68   APLSSLSGDALKNAISVHVILDYYDPYTLDNLPNKTALLTTLFQASGHATGRLGFLNYTE  127

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
               + + F S A GA ++S + K V  R YD+SVL IS  I+P
Sbjct  128  LPGEQMTFGSAAPGAPLNSELNKVVAVRPYDISVLGISAAIVP  170



>emb|CAN62804.1| hypothetical protein VITISV_011795 [Vitis vinifera]
Length=365

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            ATA +IT +L QY  FSTF  YL+ T LA +IN RQ   TIL VDN  + PLSG   DV+
Sbjct  23   ATAFNITQLLAQYSDFSTFNGYLTDTQLAADINKRQS-ITILAVDNGGLSPLSGKPKDVI  81

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            KKV+S+HV+L+YFD  KL  LP       TLFQASG++   QGFLNVT+     V F S 
Sbjct  82   KKVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSA  141

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
              G  + + +VK + ++ Y++SVLQIS VIIP
Sbjct  142  VHGTTLGANLVKSIASQPYNISVLQISTVIIP  173



>ref|XP_006357108.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Solanum 
tuberosum]
Length=328

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            S A + +IT++L  Y S+S F +YL+QT +A  IN+RQ   T+LVV+N+N+ PL GMS D
Sbjct  18   SQAKSFNITSLLNHYSSYSNFNNYLTQTGVAAAINSRQT-ITVLVVENNNLSPLKGMSQD  76

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
            V+  +M VHV+L+Y+D  K+  LP +     TLFQ +G A ++QGFLN+T+ G   +   
Sbjct  77   VIANIMRVHVLLDYYDVPKMQMLPNKTMKTPTLFQTTGYANNDQGFLNMTDLGTGSISLG  136

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            S AKG  + S +VK + ++ Y++S+LQISNVIIP  +
Sbjct  137  SAAKGETLGSKLVKSIASQPYNISILQISNVIIPSGI  173



>ref|XP_002271150.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=312

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            ATA +IT +L Q+  FSTF  YL+ T LA +IN RQ   TIL VDN  + PLSG   DV+
Sbjct  23   ATAFNITQLLAQFSDFSTFNGYLTDTQLAADINKRQS-ITILAVDNGGLSPLSGKPKDVI  81

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            KKV+S+HV+L+YFD  KL  LP       TLFQASG++   QGFLNVT+     V F S 
Sbjct  82   KKVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSA  141

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
              G  + + +VK + ++ Y++SVLQIS VIIP
Sbjct  142  VHGTTLGANLVKSIASQPYNISVLQISTVIIP  173



>ref|NP_001130104.1| hypothetical protein precursor [Zea mays]
 gb|ACF78231.1| unknown [Zea mays]
 gb|AFW70826.1| hypothetical protein ZEAMMB73_792931 [Zea mays]
Length=296

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            I    I   FSS A A +IT +LGQ+  F+TF + LSQT LA++IN RQ   T+L VDN 
Sbjct  8    IALVLILACFSSPAAAFNITRLLGQFSDFTTFNNLLSQTKLAEDINRRQT-ITVLAVDNG  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
              G +S +  DV +KV+S+HV+L+Y+D  KL  +     L TT+FQ+SGQA D  GFLN 
Sbjct  67   AAGGISSLPSDVQRKVLSMHVVLDYYDTAKLEAIKNHSALLTTMFQSSGQATDRMGFLNF  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            T     V+ F S   GA ++S MVK V +R Y++SVLQ+S  I+P  V
Sbjct  127  TKRSDGVMVFGSAQPGAQMTSHMVKSVTSRPYNISVLQVSAPIVPPGV  174



>gb|KCW80704.1| hypothetical protein EUGRSUZ_C02101 [Eucalyptus grandis]
Length=286

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSA-TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
             +FF++ +  SSA +A +IT +L +YP FSTF  +L+QT L ++IN RQ   T+L +DN 
Sbjct  8    CLFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQT-ITVLALDNS  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             +G +SG   DVLK ++S HV+L+Y+D +KL +L  +  L TTL+Q+SG A + QGFLNV
Sbjct  67   AVGDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNV  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T    ++V F S  KGA+ ++ +VK V  + Y++SVLQ+S+ II
Sbjct  127  TKQSGEIV-FGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPII  169



>ref|XP_008799982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 1/161 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            LL SS  A +IT +L  +P F+TF +YL+QT L  EIN RQ   T+LVVDN  +  +S +
Sbjct  16   LLLSSTMAFNITMILEPFPEFATFSNYLNQTKLVHEINHRQT-ITVLVVDNSRMSAISSL  74

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVV  447
              + LK VM VHVIL+Y+D +K+  +P +  L TTLFQ +G A +  GFLN+T+   + V
Sbjct  75   PEESLKHVMEVHVILDYYDIRKISRIPRRSFLLTTLFQTTGIATNRMGFLNLTHKAGESV  134

Query  448  QFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
             F S  +GA  +S ++K + T  Y++SVLQIS  IIP  ++
Sbjct  135  VFGSAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGIY  175



>ref|XP_010048457.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Eucalyptus 
grandis]
Length=345

 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSA-TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
             +FF++ +  SSA +A +IT +L +YP FSTF  +L+QT L ++IN RQ   T+L +DN 
Sbjct  67   CLFFAVFIFSSSAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQT-ITVLALDNS  125

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             +G +SG   DVLK ++S HV+L+Y+D +KL +L  +  L TTL+Q+SG A + QGFLNV
Sbjct  126  AVGDISGKPADVLKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNV  185

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T    ++V F S  KGA+ ++ +VK V  + Y++SVLQ+S+ II
Sbjct  186  TKQSGEIV-FGSAVKGASHNAKLVKAVAAQPYNISVLQVSSPII  228



>ref|XP_002512774.1| Glycoprotein X precursor, putative [Ricinus communis]
 gb|EEF49277.1| Glycoprotein X precursor, putative [Ricinus communis]
Length=339

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + FS  +LFS+ +A +IT +L  +  FS F   L++T LA  IN+RQ   TIL VDN NI
Sbjct  14   LCFSFFILFSTVSAFNITKILSDHSDFSNFNDLLTKTQLAATINSRQT-ITILAVDNGNI  72

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
             P+SG S D+ KK++S+HVIL+Y+D  KL  LP + EL TTL+Q+SGQA   +GFLN T 
Sbjct  73   SPISGQSVDMQKKILSMHVILDYYDDAKLQKLPNKTELLTTLYQSSGQAKGQEGFLNATL  132

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               QV    S   G+ +++ +VK V T+ Y++S+LQ+S++I+
Sbjct  133  VNNQVT-LGSAVPGSGLNAKLVKAVVTQPYNVSILQVSSIIM  173



>ref|XP_004952427.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=295

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = +1

Query  91   LFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMS  270
            L S A A +IT +LG++P F+TF + LSQ  LAD+IN RQ   T+L VDN   G +S + 
Sbjct  17   LTSPAAAFNITRLLGEFPDFTTFNNLLSQAKLADDINRRQT-ITVLAVDNGAAGGISSLP  75

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
             DV +KV+S+HV+L+Y+D  KL  +     L TT+FQ+SGQA D  GFLN T      + 
Sbjct  76   SDVQRKVLSMHVVLDYYDTAKLGAIKNHTTLLTTMFQSSGQATDRMGFLNFTKRSDGTMV  135

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            F S   GA  +S MVK V +R Y++SVLQ+S  I+P  V
Sbjct  136  FGSAEPGAPKNSQMVKSVASRPYNISVLQVSAPIVPPGV  174



>ref|XP_008786366.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=277

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SSA A +ITA+L  +P F+TF +YL+QT L  EIN RQ   T+LVVDN  +  +S +  +
Sbjct  18   SSAVAFNITAILEPFPEFATFSNYLNQTKLVHEINHRQT-ITVLVVDNSRMSAISSLPEE  76

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             LK VM VHVIL+Y+D +K++N+P +  + TTLFQ +G A +  GFLNVT+   + V F 
Sbjct  77   SLKHVMGVHVILDYYDIRKINNIPRKSFILTTLFQTTGIATNRMGFLNVTHKAGESVVFG  136

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            S  +GA  +S ++K V    Y++SVL IS  IIP
Sbjct  137  SAVRGAPHTSTLIKKVVAMPYNISVLHISEPIIP  170



>ref|XP_002527970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34382.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 109/163 (67%), Gaps = 3/163 (2%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++F ++  +FSS +TA +IT +L  YP FSTF S L+QT LA +IN+RQ   T+L V N 
Sbjct  8    LLFLALFCIFSSTSTAFNITRILSNYPDFSTFNSLLTQTGLAQQINSRQT-ITVLAVSNG  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             IG +SG   D++K+++S HVIL+Y+D +KL N+  Q  + TTL+Q +G A D QGFLNV
Sbjct  67   AIGGVSGKPVDIVKRILSAHVILDYYDQKKLENIKKQSSILTTLYQTTGSANDQQGFLNV  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            T +   +V F S  KGA ++  +   V ++ Y++SVLQ+  VI
Sbjct  127  TKTPNGIV-FGSAVKGAPLTVSLEGSVASQPYNISVLQVGGVI  168



>ref|XP_009363599.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=262

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 112/167 (67%), Gaps = 4/167 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I+  +  L+FSSA+A DI  +L +   FS+F +YL +T L DEIN R    T+L VDN  
Sbjct  9    ILCLAFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKR-STITVLAVDNGG  67

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLN  420
            I  +SG S DV+KK++S HV+L+Y+D +KL NL    +++  TT+ Q++GQA D QGF+N
Sbjct  68   ISSISGKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFIN  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI-IP  558
            +    +  + F S  KG+ +++ +VK V ++ +++SVLQISNVI IP
Sbjct  128  LGKIDEGGLAFGSAVKGSKLNAKLVKSVVSQPFNISVLQISNVIEIP  174



>ref|XP_003581094.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brachypodium 
distachyon]
Length=277

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +1

Query  94   FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP  273
            FS++   +IT ++ + P F TF S LS+T +A+EINARQ   T+LVVD+   G ++ +  
Sbjct  21   FSNSAKFNITEIISESPEFKTFNSLLSKTKVAEEINARQDAITVLVVDDKAAGAITALPA  80

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
            D  KKV++VHVIL+Y+D  KL ++ G+  + TTLFQ +G A D+ G +  T    + + F
Sbjct  81   DTQKKVLAVHVILDYYDPMKLDSVHGKTAMLTTLFQTTGAAADSMGLIKYTQGADEQMSF  140

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             S   G++ SS +VK V  R Y+LSV+Q+S  IIP
Sbjct  141  ASAEPGSSASSQLVKVVACRPYNLSVMQVSAAIIP  175



>ref|XP_002452018.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
 gb|EES04994.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
Length=296

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS  261
            ++   S A A +IT +LG++  F+TF + LSQT LA++IN RQ   T+L VDN   G +S
Sbjct  14   LSYFSSPAAAFNITRLLGEFSDFTTFNNLLSQTKLAEDINRRQT-ITVLAVDNGAAGGIS  72

Query  262  GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
             +  DV +KV+S+HV+L+Y+D  KL  +     L TT+FQ+SG+A D  GFLN T     
Sbjct  73   SLPSDVQRKVLSMHVVLDYYDTAKLGAIKNHSALLTTMFQSSGKATDRMGFLNFTKRSDG  132

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            V+ F S   GA ++S MVK V +R Y++SVLQ+S+ I+P  V
Sbjct  133  VMLFGSAQPGAQMTSHMVKSVASRPYNISVLQVSDPIVPPGV  174



>ref|XP_009377364.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Pyrus x 
bretschneideri]
Length=283

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 111/167 (66%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I+  ++ L+FSSA+A DI  +L +    S+F +YL +T L DEIN R    T+L VDN  
Sbjct  9    ILCLALFLVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRST-ITVLAVDNGG  67

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLN  420
            +  +SG S DV+KK++S HV+L+YFD +KL +L G  + +  TT+ Q+SGQA D QGF+ 
Sbjct  68   MSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFII  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI-IP  558
            V  S  ++  F S  KGA +++ +VK V ++ Y++SVLQISN I IP
Sbjct  128  VGKSDGEIA-FGSAVKGAKLNAKLVKAVVSQPYNISVLQISNAIEIP  173



>ref|XP_006371803.1| putative surface family protein [Populus trichocarpa]
 gb|ERP49600.1| putative surface family protein [Populus trichocarpa]
Length=271

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 109/163 (67%), Gaps = 3/163 (2%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++F +I  L SS +TA +IT +L QYP F +F   L+Q+ LA E+++R+   T+L +DN 
Sbjct  8    LLFIAILCLISSTSTAFNITKILAQYPEFVSFNDLLTQSGLAKEMSSRET-ITVLALDNS  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +IG LSG   D+ K+++S HVIL+Y+D  KL  L     + TTL+QASG A D QGFLN+
Sbjct  67   SIGGLSGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNI  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            + + +  ++F S  KGA + + +VKPV  + Y++SVLQ+S  I
Sbjct  127  SRTAEG-IKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPI  168



>ref|XP_008361057.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=262

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I+  +  L+FSSA+A DI  +L +   FS+F +YL +T L DEIN R    T+L VDN  
Sbjct  9    ILCLAFFLVFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKR-STITVLAVDNGG  67

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLN  420
            I  +SG S DV+KK++S HV+L+Y+D +KL NL    +++  TT+ Q++GQA D QGF+N
Sbjct  68   ISSISGKSQDVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFIN  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI-IP  558
            +    +  + F S  KG+ +++  VK V ++ +++SVLQISNVI IP
Sbjct  128  LGKIDEGGLAFGSAVKGSKLNAKFVKSVVSQPFNISVLQISNVIEIP  174



>ref|XP_011015272.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Populus 
euphratica]
Length=271

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 109/163 (67%), Gaps = 3/163 (2%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++F +I  L SS +TA +IT +LGQYP F  F   L+Q+ LA E+++R+   T+L +DN 
Sbjct  8    LLFIAILCLISSTSTAFNITKILGQYPEFVGFNDLLTQSGLAKEMSSRET-ITVLALDNS  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +IG L+G   D+ K+++S HVIL+Y+D  KL  L     + TTL+QASG A D QGFLN+
Sbjct  67   SIGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNI  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            + + +  ++F S  KGA + + +VKPV  + Y++SVLQ+S  I
Sbjct  127  SRTAEG-IKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPI  168



>gb|AFK40899.1| unknown [Lotus japonicus]
Length=285

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = +1

Query  97   SSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP  273
            SSAT A DIT +L QYP FSTF  YL++T L ++IN+R    T+L VDN  I  +SG S 
Sbjct  18   SSATQAFDITKILSQYPEFSTFSKYLTETKLTEQINSRNT-ITVLAVDNSAISAISGKSA  76

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
            D +K V+S H++L++FD +KL    G  +  TTL+QASG AV+ QGFL V   G+  V F
Sbjct  77   DAIKAVVSTHIVLDFFDEKKLMEALGSKQQLTTLYQASGLAVNQQGFLKVALIGEGEVAF  136

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             S   GAA  + +VK V ++ Y++SVLQ+S  I+
Sbjct  137  GSAVNGAATDAELVKTVTSQPYNISVLQVSKPIV  170



>ref|XP_008466329.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=278

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 103/156 (66%), Gaps = 2/156 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            LLFS+A+A +IT +L Q+P F+ F   L+QT LAD+IN R+   TIL VDN  I  +SG 
Sbjct  15   LLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINNRKT-ITILAVDNGAISGISGK  73

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGE-LATTLFQASGQAVDNQGFLNVTNSGKQV  444
              DV+K+++SVHVIL+Y+D QKL  L      + TTL+Q SG A + QGFL VT   +  
Sbjct  74   PLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGAATNQQGFLKVTLINEGE  133

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            V F S  KGA   S +VK V ++ Y++SVLQI++ I
Sbjct  134  VAFESAVKGATADSKLVKSVASQPYNISVLQITSPI  169



>ref|XP_008378295.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Malus domestica]
Length=283

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 110/167 (66%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I+  ++ L+FSSA+A DI  +L +    S+F +YL +T L DEIN R    T+L VDN  
Sbjct  9    ILCLALFLVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRST-ITVLAVDNGG  67

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLN  420
            +  +SG S DV+KK++S HV+L+YFD +KL +L G  + +  TT+ Q+SGQA D QGF+ 
Sbjct  68   MSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGFII  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI-IP  558
            V  S  ++  F S  KG  +++ +VK V ++ Y++SVLQISN I IP
Sbjct  128  VGKSDGEIA-FGSAVKGGKLNAKLVKAVVSQPYNISVLQISNAIEIP  173



>ref|XP_008799981.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SSA A +IT +L  +P F+TF +YLSQT L  EIN RQ   T+LVVDN  +  +S +  +
Sbjct  19   SSAMAFNITMILEPFPEFATFSNYLSQTKLVHEINHRQT-ITVLVVDNSRMSAISSLPEE  77

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             LK VM VHVIL+Y+D  K+ ++P +  L TTLFQ +G A    GFLN+++   + V F 
Sbjct  78   SLKHVMEVHVILDYYDITKISSIPRKNFLLTTLFQTTGIATSRIGFLNLSHKAGKSVVFG  137

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
            S  +GA  +S ++K + T  Y++SVLQIS  IIP  ++
Sbjct  138  SAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGIY  175



>ref|XP_009418876.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            A + +IT +L Q+  FSTF S L+QT L  +IN+R+   T+L VDN     +S    D L
Sbjct  19   AASHNITRILAQFDDFSTFNSLLTQTQLVSDINSRRT-ITVLAVDNGAASSVSSRPTDEL  77

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            KK++SVHV+L+Y+D  KLH LP    + TTLFQA+G A    GFLNVTN G   + F S 
Sbjct  78   KKILSVHVVLDYYDDAKLHKLPNHTAILTTLFQATGLASGRNGFLNVTNMGNGQIAFGSA  137

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
              G+++ +  VK V TR Y++SV+QIS+VI+P
Sbjct  138  VPGSSLVANFVKVVATRPYNISVIQISSVIVP  169



>ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 ref|XP_004162501.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 gb|KGN60156.1| hypothetical protein Csa_3G881690 [Cucumis sativus]
Length=280

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%), Gaps = 2/156 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            LLFS+A+A +IT +L Q+P F+ F   L+QT LAD+IN+R+   TIL VDN  I  +SG 
Sbjct  15   LLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINSRKT-ITILAVDNGAISGISGK  73

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGE-LATTLFQASGQAVDNQGFLNVTNSGKQV  444
              DV+K+++SVHVIL+Y+D QKL  L      + TTL+Q SG A + QGFL VT   +  
Sbjct  74   PLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGTATNEQGFLKVTLINEGE  133

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            V F S  KGA   S +VK V ++ Y++ VLQI++ I
Sbjct  134  VAFKSAVKGATADSKLVKSVVSQPYNIVVLQITSPI  169



>gb|EPS65223.1| hypothetical protein M569_09558, partial [Genlisea aurea]
Length=276

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L QYP F +F ++L+Q  LA +IN+RQ   T+L VDN  +  LSGMS D +K V+
Sbjct  24   NITHILEQYPDFDSFNNFLTQAKLASQINSRQT-ITVLAVDNGGVSSLSGMSSDAMKNVL  82

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            S HV+L+Y+D  KLH L  +  + TTLFQ+SG     QGFLNVT      V F S   GA
Sbjct  83   SAHVVLDYYDEAKLHKLSNKSAILTTLFQSSGLGRGQQGFLNVTILSGGKVAFGSAVAGA  142

Query  475  AVSSFMVKPVETRAYDLSVLQISNVIIP  558
             + + +VK V ++ Y++SVLQ+S++IIP
Sbjct  143  PLGANLVKSVFSQPYNVSVLQVSSLIIP  170



>ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=305

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            +A A +IT +LGQ+P FSTF SYLSQT+++  IN RQ   T+L V+N  I P++G S D 
Sbjct  24   AAQAFNITRLLGQFPDFSTFNSYLSQTNISIGINRRQT-ITVLAVENGAIAPITGKSMDD  82

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            +K ++ +HVIL+Y+D  KLH L  +  L TTLFQA+GQA   QGFLNVT      V F S
Sbjct  83   IKNILRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGS  142

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               G+ + + +VK V ++ +++SVLQIS  I+
Sbjct  143  AVAGSGLQAKLVKTVASQPFNISVLQISTPIL  174



>ref|XP_009402000.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSAT--AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            ++F    LL SS+   A+DI  +L  +  FSTF  YL+QT +ADEIN RQ   T+L VDN
Sbjct  9    LVFLPYLLLISSSAVAALDIVGILQPFDEFSTFTKYLTQTKVADEINRRQT-ITVLAVDN  67

Query  241  DNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
              I  LS +S D LK V+SVHVIL+Y+D  KL  +P +  L TTLFQASG A +N GFLN
Sbjct  68   SAISALSSLSADTLKNVISVHVILDYYDPYKLDKVPKKTALLTTLFQASGLAANNMGFLN  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             T    + + F S A GA ++S + K V  R Y++SVLQ+S  I+P
Sbjct  128  YTELPGEQMMFGSAAPGAPLNSNLQKVVAARPYNVSVLQVSTAIMP  173



>ref|XP_011045030.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X1 
[Populus euphratica]
 ref|XP_011045031.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X2 
[Populus euphratica]
Length=271

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 108/163 (66%), Gaps = 3/163 (2%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++F +I  L SS +TA +IT +L QYP F  F   L+Q+ LA E+++R+   T+L +DN 
Sbjct  8    LLFIAILCLISSTSTAFNITKILAQYPEFVGFNDLLTQSGLAKEMSSRET-ITVLALDNS  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +IG L+G   D+ K+++S HVIL+Y+D  KL  L     + TTL+QASG A D QGFLN+
Sbjct  67   SIGGLNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNI  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            + + +  ++F S  KGA + + +VKPV  + Y++SVLQ+S  I
Sbjct  127  SRTAEG-IKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPI  168



>gb|EMS62729.1| hypothetical protein TRIUR3_26693 [Triticum urartu]
Length=261

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT VL + P F TF S LS+T+LA+EIN RQ   T+LVVDN     ++ +  D  KKV+
Sbjct  27   NITEVLNKSPEFLTFNSLLSKTNLAEEINKRQT-ITVLVVDNSAASGITSLPTDTQKKVL  85

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            +VHVILNY+D  KL N+     L T+LFQ +G A D  GF+N T+S    + F S   GA
Sbjct  86   AVHVILNYYDPMKLENIEKGTALLTSLFQTTGAATDRMGFVNYTHSADDQMVFGSAEPGA  145

Query  475  AVSSFMVKPVETRAYDLSVLQISNVIIP  558
             +SS +VK V  R Y+LSV+Q+S  IIP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVSAAIIP  173



>ref|XP_006664971.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Oryza 
brachyantha]
Length=305

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +LG+   FSTF + L Q  LADEIN RQ   T+L VDN   G +S +  DV +KV+
Sbjct  27   NITRILGELSDFSTFNNLLMQKKLADEINRRQT-ITVLAVDNGAAGGISSLPSDVQRKVL  85

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            SVHV+L+Y+D +KL+ +       TTLFQ+SGQA ++ GFLN T      + F S   GA
Sbjct  86   SVHVVLDYYDTKKLNAMKNHSTRLTTLFQSSGQATNHMGFLNCTKHSDGTMVFGSAEPGA  145

Query  475  AVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
             V+S +VK + +R Y++SVLQ+S+ I+P S+
Sbjct  146  PVTSQLVKLIASRPYNISVLQVSSAIVPPSI  176



>gb|KCW53929.1| hypothetical protein EUGRSUZ_J03138 [Eucalyptus grandis]
Length=309

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            ATA +IT +L +YP FSTF + L+ + +A  INARQ   T+L VDN  +  LSG   + +
Sbjct  20   ATAFNITNILSKYPEFSTFNNDLTLSQVASAINARQS-ITVLAVDNSGMSALSGNPAETV  78

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+ V+L+Y+D QKL  LP +  + TTL QASG+AV  QGFLNVT+S    + F S 
Sbjct  79   KDILSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSA  138

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             +G++V + +VK V ++ +++SVLQIS+ I+P
Sbjct  139  VQGSSVHANLVKSVTSQPFNISVLQISSAIVP  170



>gb|KDP41920.1| hypothetical protein JCGZ_26938 [Jatropha curcas]
Length=228

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = +1

Query  127  VLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVMSVHV  306
            +L QY  + TF   LS+T +A+ IN+R+   T+L VDN N+G L+G S DV K ++ +HV
Sbjct  1    MLNQYSDYGTFNDLLSKTRIAEAINSRRT-ITVLAVDNGNLGALTGYSTDVQKHILDLHV  59

Query  307  ILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGAAVSS  486
            +L+Y+D  KL N+  +  L TTL+Q++G A   QGFLNVTN G   ++F S  KG+ +++
Sbjct  60   VLDYYDETKLKNIKKKSALLTTLYQSTGSARGQQGFLNVTNDGGS-IRFGSAVKGSGLNA  118

Query  487  FMVKPVETRAYDLSVLQISNVIIP  558
             +V  V ++ Y++SVLQ+SN+IIP
Sbjct  119  NLVGSVTSQPYNISVLQVSNIIIP  142



>ref|XP_010034870.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Eucalyptus 
grandis]
Length=345

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            ATA +IT +L +YP FSTF + L+ + +A  INARQ   T+L VDN  +  LSG   + +
Sbjct  20   ATAFNITNILSKYPEFSTFNNDLTLSQVASAINARQS-ITVLAVDNSGMSALSGNPAETV  78

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+ V+L+Y+D QKL  LP +  + TTL QASG+AV  QGFLNVT+S    + F S 
Sbjct  79   KDILSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSA  138

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             +G++V + +VK V ++ +++SVLQIS+ I+P
Sbjct  139  VQGSSVHANLVKSVTSQPFNISVLQISSAIVP  170



>emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera]
Length=305

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            +A A +IT +LGQ+P FSTF SYLSQT+++  IN RQ   T+L V+N  I P++  S D 
Sbjct  24   AAQAFNITRLLGQFPDFSTFNSYLSQTNISIGINKRQT-ITVLAVENGAIAPITXKSLDD  82

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            +K ++ +HVIL+Y+D  KLH L  +  L TTLFQA+GQA   QGFLNVT      V F S
Sbjct  83   IKNILRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGS  142

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               G+ + + +VK V ++ +++SVLQIS  I+
Sbjct  143  AVAGSGLQAKLVKTVASQPFNISVLQISTPIL  174



>ref|XP_010909123.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=259

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            S  A +IT +L  Y S+STF +YL+QT LA+EIN RQ   TILVVDN  +  +     ++
Sbjct  17   SVEAFNITHILESYSSYSTFNNYLTQTKLAEEINHRQT-ITILVVDNSKMSAVFSKPIEI  75

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            LK +M++H+IL+Y+D  KL ++P +  L TTLFQ SG A +  GFLNVTN     V F S
Sbjct  76   LKNIMAIHIILDYYDTNKLSHIPHKSALLTTLFQTSGIANNKLGFLNVTNMPNDDVVFGS  135

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
                A +SS   K V T+ Y++S+L+IS++I+P
Sbjct  136  ATPEAPLSSTFTKMVVTKPYNISILEISDLILP  168



>ref|XP_010938482.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=257

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A  ITA+L  +  F+TF +YL+QT L  EIN RQ   TILVVDN  +  +S +  + LK 
Sbjct  2    AFKITAILKPFSEFATFSNYLNQTKLVHEINHRQT-ITILVVDNSKMSAISSLPEESLKH  60

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            VM VHVIL+Y+D +K+ ++P +  L TTLFQ +G A    GFLNVT    + V F S   
Sbjct  61   VMEVHVILDYYDIRKISHIPSKSFLLTTLFQTTGVATKRMGFLNVTRKADESVVFGSAVL  120

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            GA  +S ++K V T  Y++SVLQ+S  IIP
Sbjct  121  GAPHTSTLIKNVMTMPYNISVLQVSEPIIP  150



>ref|XP_007024813.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
 gb|EOY27435.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
Length=304

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            +A A +IT +L Q+P F+TF +YL  T +AD+IN+ Q   T+LVV N N+  +SG SPD 
Sbjct  21   AADAFNITQILSQFPDFTTFNNYLIHTGVADQINSEQT-VTVLVVANGNMSEVSGQSPDA  79

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELA-TTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
            +KK +SVHVIL+YF  +KL NL  +  L  TTL+Q SGQA + QGFLNV + G   V F 
Sbjct  80   MKKTLSVHVILDYFGVEKLKNLQNKTALTLTTLYQQSGQAQNQQGFLNVAHVGNGGVAFG  139

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            S A G+ + S  +KPV ++ Y++SVLQISN+I
Sbjct  140  SAAAGSNLDSIFIKPVASQPYNISVLQISNII  171



>ref|XP_006382179.1| putative surface family protein [Populus trichocarpa]
 gb|ERP59976.1| putative surface family protein [Populus trichocarpa]
Length=302

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++F +   L S++TA + T +L QYP F+ F   LSQ+ LA E+N+RQ   T+LV+DN +
Sbjct  8    LLFIAFLCLISTSTAFNSTKILAQYPEFANFNDLLSQSGLAQEMNSRQT-ITVLVLDNGS  66

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
            I  LSG   D+ K+++S HVIL+Y+D  KL  L     + TTL+QASG A + QGFLN++
Sbjct  67   IDGLSGRPLDIAKRILSAHVILDYYDQIKLSKLQKASTIVTTLYQASGVADNRQGFLNIS  126

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +  + ++F S  KGA + + +VK + ++ Y++SVLQ+S  I
Sbjct  127  RTA-EGIKFGSAMKGAPLVASLVKSIYSQPYNISVLQVSEPI  167



>ref|XP_004486594.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cicer 
arietinum]
Length=344

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 107/169 (63%), Gaps = 6/169 (4%)
 Frame = +1

Query  67   IIFFSITLLFS-SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            +IF  + +L   S T  D+T +L QYP++ST+ +YL+QT LA EINA+ P  T+LVVDN 
Sbjct  12   LIFVVVVMLLPISITCFDVTKMLSQYPAYSTYSNYLTQTQLATEINAK-PTITVLVVDNS  70

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             + P+SG   DV+KKV+SVHVIL+YFD QK  +L  +    +T+F++ G     + F+ +
Sbjct  71   GMAPISGKPMDVIKKVLSVHVILDYFDVQKFQHLGNKTITVSTMFESKGM----ERFIKI  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
            T+     V F S A      + ++K +  + Y++S++QIS VIIP S+ 
Sbjct  127  TDLNTGAVTFTSAADPNPTGANLIKAIVAQPYNISLVQISTVIIPPSLL  175



>gb|KEH39774.1| fasciclin domain protein [Medicago truncatula]
Length=268

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 96/153 (63%), Gaps = 1/153 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SS  A+DIT +LGQ P F+ F   L++T L D+IN+R    T+L V +  +  +SG SP 
Sbjct  19   SSIHALDITKLLGQNPDFAAFNKQLTETKLVDQINSRNT-ITVLAVSDGAMSAISGKSPQ  77

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             +K +MS HV+L+YFD +KL    G G L TTLFQASGQA + QGFL V   G+  + F 
Sbjct  78   AIKAIMSTHVVLDYFDEKKLSEAVGSGILLTTLFQASGQAKNQQGFLKVKLIGEGEMDFG  137

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            S   GA +   +VK V  + Y++S+LQ++  II
Sbjct  138  SAVSGAPIDVALVKTVVKQPYNISILQVAKPII  170



>ref|NP_001046792.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAD19640.1| endosperm specific protein-like [Oryza sativa Japonica Group]
 dbj|BAF08706.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAG98518.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 98/150 (65%), Gaps = 3/150 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +LG++  FSTF   L+QT LADEIN RQ   T+L +DN   G +S +  D  +KV+
Sbjct  33   NITRILGEFSDFSTFNHLLTQTKLADEINRRQT-ITVLALDNGAAGGVSSLPSDEQRKVL  91

Query  295  SVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            SVHV+L+Y+D +KL  +  +   A  TTLFQ+SGQA D  GFLN T     ++ F S   
Sbjct  92   SVHVVLDYYDTEKLGGMKMKNRSAVLTTLFQSSGQATDRMGFLNYTKRSDGIMVFGSAEP  151

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            GA  +S MVK V TR Y++SVLQ+++ I+P
Sbjct  152  GAQATSQMVKVVVTRPYNISVLQVNSPIVP  181



>emb|CDY36762.1| BnaA03g11240D [Brassica napus]
Length=196

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 4/162 (2%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--  261
            LL     A ++T +L  +PS S+F  YL+QTHLADEIN R    T+  VD+  +  L+  
Sbjct  15   LLAVETHAHNVTLLLANHPSLSSFNHYLTQTHLADEINQRNT-ITVCAVDDGAMYNLTSK  73

Query  262  GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
            G +   LK ++S+HV+L+YFDA+KLH LP    LA TLFQA+G A +N GF+ +TN    
Sbjct  74   GYTISTLKNILSLHVLLDYFDARKLHQLPDGSALAATLFQATGAAPENTGFVKITNKRGG  133

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
             ++F     G   SSF +K +E   YD+S++QIS +++  +V
Sbjct  134  NIRFGLNGAGDVSSSF-IKSIEQVPYDISIIQISGILLSDTV  174



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 109/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSA--TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            ++F  +++L  +A  +A +ITA+L ++P +S +  YL+QT LADEIN+R    T+LV++N
Sbjct  8    LVFLCLSILALNAVVSAHNITAILSEFPDYSDYNKYLTQTKLADEINSRTT-VTVLVLNN  66

Query  241  DNIGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
                 L+   P  VLKKV+S+H++L+YFDAQKLH LP    L+TTL+Q +G A  N G +
Sbjct  67   GAFSALASKHPASVLKKVLSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAPGNLGSI  126

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            N+T+     V F S A+G+ + S   K V+   Y++SVL+IS  II
Sbjct  127  NITDLKGGKVGFGSAAQGSKLDSTYTKTVKEIPYNISVLEISAPII  172



>dbj|BAK06740.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = +1

Query  106  TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLK  285
            T  +IT VL + P FSTF S LS+T+L +EIN RQ   T+LVVDN     ++ +  D  K
Sbjct  25   TKFNITEVLDESPEFSTFNSLLSKTNLVEEINKRQT-ITVLVVDNSAASAITSLPTDTQK  83

Query  286  KVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKA  465
            KV++V VIL+Y+D  KL  +  +  L TTLFQ +G A D  G +N T+S    + F S  
Sbjct  84   KVLAVQVILDYYDPMKLEGIEKRTALLTTLFQTTGAATDRAGLVNYTHSADDQMAFGSAE  143

Query  466  KGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             GA +SS +VK V  R Y+LSV+Q+S  IIP
Sbjct  144  PGAPLSSQLVKVVACRPYNLSVMQVSAAIIP  174



>ref|XP_009396684.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L Q P FSTF   L+QTHLA +IN+R    TIL V N  +  +S    D +KK++
Sbjct  26   NITKMLAQLPDFSTFNDLLTQTHLAADINSRST-ITILAVSNGAVSSVSDEPIDTIKKIL  84

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            S+HVIL+Y+D  K+H +     + TTLFQASG A    GFLNVTN     + F S   G+
Sbjct  85   SLHVILDYYDDNKIHKISNHTAILTTLFQASGGAAGQNGFLNVTNMENGQIAFGSAVAGS  144

Query  475  AVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            ++++  VK + T+ Y++SVLQIS+VI+P S+
Sbjct  145  SLTANFVKVLATQPYNISVLQISSVIVPPSL  175



>ref|XP_008219801.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=271

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 109/168 (65%), Gaps = 11/168 (7%)
 Frame = +1

Query  73   FFSITLLF----SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
               + LLF    SSA+A DIT +L +   FS F +YL +T L ++IN+R    T+L V N
Sbjct  8    ILCLALLFIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSR-STITVLAVGN  66

Query  241  DNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELAT--TLFQASGQAVDNQGF  414
              I  L+G S DV+KK++S HVIL+Y+D QKL  L    ++ T  T+FQ+SGQA + QGF
Sbjct  67   GAISSLAGKSQDVVKKILSAHVILDYYDEQKLTKLAKSSKVTTLTTMFQSSGQAQNQQGF  126

Query  415  LN--VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +N  V N G+  + F S AKG+ +++ +VK V ++ +++S+LQ+S +I
Sbjct  127  INAGVINEGE--LAFGSAAKGSILNAKLVKSVVSQPFNISILQVSELI  172



>ref|XP_007224727.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
 gb|EMJ25926.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
Length=268

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 110/171 (64%), Gaps = 12/171 (7%)
 Frame = +1

Query  73   FFSITLLF----SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
               + LLF    SSA+A DIT +L +   FS F +YL +T L ++IN+R    T+L V N
Sbjct  8    ILCLALLFIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSR-STITVLAVGN  66

Query  241  DNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELAT--TLFQASGQAVDNQGF  414
              I  L+G S DV+KK++S HVIL+Y+D QKL  L    +  T  T+FQ+SGQA + QGF
Sbjct  67   GAISSLAGKSQDVVKKILSAHVILDYYDEQKLTKLAKSSKATTLTTMFQSSGQAQNQQGF  126

Query  415  LN--VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI-IP  558
            +N  + N G+  + F S AKG+ +++ +VK V ++ +++SVLQ+S +I IP
Sbjct  127  INAGIVNEGE--LAFGSAAKGSKLNAKLVKSVVSQPFNISVLQVSELIDIP  175



>gb|EMT17229.1| hypothetical protein F775_11240 [Aegilops tauschii]
Length=261

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT VL + P F TF S LS+T+LA+EIN RQ   T+LVVDN     +  +  D  KKV+
Sbjct  27   NITEVLNESPEFLTFNSLLSKTNLAEEINKRQT-ITVLVVDNSAASGIMSLPTDTQKKVL  85

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            +VHVIL+Y+D  KL  +     L T+LFQ +G A D  GF+N T S    + F S   GA
Sbjct  86   AVHVILDYYDPMKLETIEKGTALLTSLFQTTGAATDRMGFVNYTRSADDQMVFGSAEPGA  145

Query  475  AVSSFMVKPVETRAYDLSVLQISNVIIP  558
             +SS +VK V  R Y+LSV+Q+   IIP
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVRAAIIP  173



>ref|XP_003545530.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Glycine 
max]
Length=306

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A DIT +LGQYP FSTF  YL++T LADEIN+R    T+L V++  +  ++  SP+ +K 
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNT-ITVLAVEDSAMNSIAAKSPEAIKA  81

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S HVIL++FD +KL       +  TTLFQASG AV+ QGFL V   G+  + F S   
Sbjct  82   IISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFGSAVS  141

Query  469  GAAV-SSFMVKPVETRAYDLSVLQISNVII  555
            GA V ++ +++ V +  Y++S+LQ++  I+
Sbjct  142  GAPVDATELMRTVTSEPYNISILQVTKPIL  171



>ref|XP_010914304.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=282

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 1/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            IF  ++LL SS  A ++T +L  +  F+TF +YL++T LADEIN RQ   T+LVVDN  +
Sbjct  8    IFLLLSLLLSSVMAYNVTQILEPFSDFATFNNYLTRTKLADEINRRQT-ITVLVVDNSKM  66

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
              LS +  + LK VM+VHVIL+Y+D  KL ++     L TTLFQ +G A +N GFLNVT 
Sbjct  67   SALSSLDVETLKHVMAVHVILDYYDENKLSHISNNSALLTTLFQTTGIAKNNLGFLNVTR  126

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
               + + F S  + A +SS   K + T  Y++S+LQIS+ I+P
Sbjct  127  KPNEAMLFGSAFQKAPLSSTFSKVIITMPYNISILQISDPIVP  169



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 97/148 (66%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +ITA+L  +P +S F SYLSQT LADEIN+RQ   T+L +DN  +  L+G  P  V+K  
Sbjct  26   NITAILEGFPEYSLFSSYLSQTKLADEINSRQT-ITVLALDNGAMSALAGKKPLSVIKNE  84

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            ++VHV+L+YFD QKLH +P    L+TTL+Q +G A  N GF+N+T+     V F + A G
Sbjct  85   LAVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAAPG  144

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVLQIS  I+
Sbjct  145  SKLDSSYTKSVKQIPYNISVLQISAPIL  172



>ref|XP_009394682.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            A + +IT +L ++P FSTF   L++T LA +IN+R+   T+L V+N  I   SG   DVL
Sbjct  16   AASHNITTILAKFPDFSTFSDLLTRTQLASDINSRKT-ITVLAVNNGAISSASGQPTDVL  74

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            KK++S+HV+L+Y+D  K H L  +  + TTLFQ+SG A    GFLNVT+     V F S 
Sbjct  75   KKILSLHVVLDYYDGDKFHKLRNRSAILTTLFQSSGVASGRSGFLNVTDMDNGQVSFGSA  134

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
              G+++ +  V  + T+ Y++SV++IS+VI+P
Sbjct  135  VPGSSLDANFVTVLATQPYNISVVEISSVIVP  166



>gb|KDO59100.1| hypothetical protein CISIN_1g015356mg [Citrus sinensis]
Length=408

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            S+A A +IT +L  +PSFSTF  YLS THLADEIN R+   T+  +DN  +  L    P 
Sbjct  18   SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEIN-RKTTITVCAIDNAGMSELLSKHPS  76

Query  277  V--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
            +  +K V+S+H++L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  77   ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  136

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F +K  G  + +  VK VE + Y++SV+QIS V+
Sbjct  137  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  170



>ref|XP_006474892.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Citrus 
sinensis]
Length=408

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            S+A A +IT +L  +PSFSTF  YLS THLADEIN R+   T+  +DN  +  L    P 
Sbjct  18   SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEIN-RKTTITVCAIDNAGMSELLSKHPS  76

Query  277  V--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
            +  +K V+S+H++L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  77   ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  136

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F +K  G  + +  VK VE + Y++SV+QIS V+
Sbjct  137  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  170



>ref|XP_010913663.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=312

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 99/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            +ATA +IT++LGQ+  FS   + L+QT LA EIN+RQ   T+L V+N  +  +S +  DV
Sbjct  19   AATAFNITSILGQFSDFSNLNNLLTQTQLASEINSRQI-ITVLSVNNAALSSVSNLPTDV  77

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            L+KV+S HV+L+YFD   +  L  +  + TTL QASG A    GFLNVT+ G   +   S
Sbjct  78   LEKVLSFHVVLDYFDRDNITKLSNRSAILTTLLQASGLATGQNGFLNVTDMGNGQIALGS  137

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             A G+ ++S  VK + T  Y++SVL IS+VI+P
Sbjct  138  AAPGSNLTSQFVKVLVTHPYNISVLHISSVIVP  170



>ref|XP_006452590.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
 gb|ESR65830.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
Length=460

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            S+A A +IT +L  +PSFSTF  YLS THLADEIN R+   T+  +DN  +  L    P 
Sbjct  70   SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEIN-RKTTITVCAIDNAGMSELLSKHPS  128

Query  277  V--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
            +  +K V+S+H++L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  129  ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  188

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F +K  G  + +  VK VE + Y++SV+QIS V+
Sbjct  189  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  222



>gb|KDP33435.1| hypothetical protein JCGZ_07006 [Jatropha curcas]
Length=299

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 104/163 (64%), Gaps = 3/163 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++F  +  +FSS + A +IT +L  YP FSTF   LSQT LA +IN+RQ   T+L V N 
Sbjct  9    LLFLVLFTVFSSTSMAFNITRLLSNYPEFSTFNRLLSQTGLAQQINSRQT-ITVLAVANR  67

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             I  LSG   DV K+V+  HVIL+Y+D  KL  L  +  + TTL+Q +G AVD QGFLNV
Sbjct  68   AIRDLSGKPLDVTKRVLGAHVILDYYDETKLSKLQEKSNILTTLYQTTGVAVDQQGFLNV  127

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            T + K ++ F   AKGA ++  +   V ++ Y++SVL++S VI
Sbjct  128  TRTPKGIM-FGPAAKGAPLTVSLKGVVASQPYNISVLKVSGVI  169



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A +IT +L +YP +S F   LSQT LADEIN+RQ   T+L + N  +  LSG+    LK+
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQT-ITVLALSNSQMASLSGLDLASLKR  80

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+L++FDA+KLH +     L+TTL+Q +G A  N GF+N+T+     V F   A 
Sbjct  81   VLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAH  140

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            GA + +  VK V+   Y++SV+++S  I
Sbjct  141  GAKLDATYVKSVKQEGYNISVIEVSKPI  168



>ref|XP_008781934.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=308

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 97/153 (63%), Gaps = 1/153 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            +ATA +IT +LGQ+  FS   + L++T LA EIN+RQ   T+L V+N  +  +S +  DV
Sbjct  19   AATAFNITQILGQFSDFSNLNNLLTRTQLASEINSRQT-VTVLAVNNAALSSVSNLPTDV  77

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            LKKV+++HV+L+YFD  K+  L  +  +  TLFQASG A    GFLNVT+ G   +   S
Sbjct  78   LKKVLALHVVLDYFDRDKITRLSNRSAILATLFQASGLATGQNGFLNVTDMGNGQIALGS  137

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             A G+ + +  V  + T  Y++SVL+IS VI P
Sbjct  138  AAPGSNLDARFVGVLVTHPYNISVLKISGVITP  170



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A +IT +L +YP +S F   LSQT LADEIN+RQ   T+L + N  +  LSG+    LK+
Sbjct  22   AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQT-ITVLALSNSEMALLSGLDLASLKR  80

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+L++FDA+KLH +     L+TTL+Q +G A  N GF+N+T+     V F   A 
Sbjct  81   VLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAH  140

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            GA + +  VK V+   Y++SV+++S  I
Sbjct  141  GAKLDATYVKSVKQEGYNISVIEVSKPI  168



>gb|AIY35291.1| fasciclin-like arabinogalactan 11 [Gossypium hirsutum]
Length=417

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ FS  LLF ++ A ++T +L ++PS STF  YL+ THLA EIN R+   T+L +DN  
Sbjct  10   LLIFSAFLLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEIN-RRTTITVLALDNAA  68

Query  247  IGPLSGMSPDV--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  L   +P +  +K ++S+HV+L+YF A+KLH +     LA T+FQA+G A    GF+N
Sbjct  69   MSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGFVN  128

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F ++  G +++SF VK VE   Y++SV+QIS  +
Sbjct  129  ITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYNISVIQISKAL  172



>gb|ABV27482.1| fasciclin-like arabinogalactan protein 11 [Gossypium hirsutum]
Length=417

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ FS  LLF ++ A ++T +L ++PS STF  YL+ THLA EIN R+   T+L +DN  
Sbjct  10   LLIFSAFLLFQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEIN-RRTTITVLALDNAA  68

Query  247  IGPLSGMSPDV--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  L   +P +  +K ++S+HV+L+YF A+KLH +     LA T+FQA+G A    GF+N
Sbjct  69   MSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGFVN  128

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F ++  G +++SF VK VE   Y++SV+QIS  +
Sbjct  129  ITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYNISVIQISKAL  172



>ref|XP_007161299.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
 gb|ESW33293.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
Length=282

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 103/165 (62%), Gaps = 4/165 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++  +  L FSSA    DIT +L + P  S+F  Y+++  LAD+IN+R    T+L V ND
Sbjct  8    LLCIAFLLAFSSAVYGFDITKMLEKEPELSSFNKYITEAKLADQINSRNT-ITVLAVGND  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             I  ++G SP+++K ++S HVIL+Y+D +KL          TTLFQ+SG AV  QGF+ V
Sbjct  67   AISSIAGKSPELIKAIISTHVILDYYDEKKLVEAQASTPQLTTLFQSSGNAVKEQGFVKV  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            +  G+  + F S   G++  S +VKP+ +  Y++S+LQ++  IIP
Sbjct  127  SLIGEGEIAFSS--VGSSDYSELVKPIASEPYNISILQVTKPIIP  169



>gb|KHG09433.1| Fasciclin-like arabinogalactan protein 1 [Gossypium arboreum]
Length=417

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ FS  LLF ++ A +IT +L ++PS STF  YL+ THLA EIN R+   T+L +DN  
Sbjct  10   LLIFSAFLLFQTSNAHNITRLLAKHPSLSTFNHYLTLTHLAPEIN-RRTTITVLALDNAA  68

Query  247  IGPLSGMSPDV--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  L   +P +  +K ++S+HV+L+YF A+KLH +     LA T+FQA+G A    GF+N
Sbjct  69   MSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVAPGVSGFVN  128

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F ++  G +++SF VK VE   Y++SV+QIS  +
Sbjct  129  ITDFKGGKVGFGAEDNGGSLNSFFVKSVEELPYNISVIQISKAL  172



>ref|XP_004498590.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cicer 
arietinum]
Length=316

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 98/153 (64%), Gaps = 1/153 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SS  A DIT +LGQ P F+TF  YL++T LA+ IN+R    TIL V +  +  LSG S  
Sbjct  19   SSIHAFDITKLLGQNPDFATFNKYLTETKLAEPINSRNT-ITILAVSDAGLSSLSGKSQQ  77

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             +K  +S HVIL++FD +KL    G G+L TTL+Q+SG A++ QGF+ V   G+  + F 
Sbjct  78   FIKASLSTHVILDFFDEKKLMEAQGSGQLLTTLYQSSGLAMNQQGFIKVALIGEGEIAFG  137

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            S   GA +   +VK V ++ Y++S+LQ++ +I+
Sbjct  138  SAVNGAPLDVSLVKTVVSQPYNISILQVTKLIV  170



>gb|KHN10392.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=305

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A DIT +LGQYP FSTF  YL++T LADEIN+R    T+L V++  +  ++  SP+ +K 
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNT-ITVLAVEDSAMNSIAAKSPEAIKA  81

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S HVIL++FD +KL       +  TTLFQASG AV+ QGFL V   G+  + F + + 
Sbjct  82   IISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFGAVSG  141

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVII  555
                ++ +++ V +  Y++S+LQ++  I+
Sbjct  142  APVDATELMRTVTSEPYNISILQVTKPIL  170



>ref|XP_010102851.1| hypothetical protein L484_004423 [Morus notabilis]
 gb|EXB94232.1| hypothetical protein L484_004423 [Morus notabilis]
Length=300

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A +IT +L Q+P F+TF  +LSQT LADEIN RQ   T+LVVDN     LSG   DV+KK
Sbjct  24   AFNITKILSQHPEFATFNGFLSQTKLADEINRRQ-TITVLVVDNAAASSLSGKPLDVVKK  82

Query  289  VMSVHVILNYFDAQKLHNL--PGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            ++SVHVIL+Y+D +KL  L    +    TTL   +G A D +GF+NV+   +  + F S 
Sbjct  83   ILSVHVILDYYDVEKLTKLGISNKTSALTTLLAGAG-AADQRGFINVSLVNEGEIAFGSS  141

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQIS  543
            AKG A++S +V+ V    +++SVLQI+
Sbjct  142  AKGGALNSKLVESVAAHPFNISVLQIT  168



>ref|XP_010545276.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=421

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 104/163 (64%), Gaps = 6/163 (4%)
 Frame = +1

Query  73   FFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            F +I+LLF+  A A ++T +L ++PSFSTF  YL+QTHLADEIN R+   TI  V+N  +
Sbjct  13   FIAISLLFAGDAHAHNVTRLLAKHPSFSTFSHYLTQTHLADEIN-RRTTITICAVENSAM  71

Query  250  GPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
              +   G +   +K ++S+HV+L+YF A+KLH +     LA TLFQA+G A    GF+N+
Sbjct  72   SDIISKGYTISTIKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGSAPGTTGFVNI  131

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            T+     V F     G  +S+F VK +E   Y++S++QIS V+
Sbjct  132  TDLRGGKVGF--GPDGGDLSAFFVKSLEEVPYNISIIQISKVL  172



>ref|XP_006845641.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
 gb|ERN07316.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
Length=398

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 101/155 (65%), Gaps = 6/155 (4%)
 Frame = +1

Query  106  TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSG--MSPDV  279
            T  +IT +L Q+P F+ F SYL+ T +  EIN R    TIL +++  +  ++G   +P+V
Sbjct  118  TCFNITKILDQHPEFNVFNSYLTLTKVVGEINKRNT-ITILAIEDSAMSSITGGNFAPEV  176

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQV--VQF  453
            L  +MSVHV+L+Y+D++KL NL     L T LFQ++G AV  QGFLNVT S KQ   + F
Sbjct  177  LHNIMSVHVVLDYYDSKKLDNLSEGTALLTALFQSTGSAVGQQGFLNVTKS-KQTGEILF  235

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
             S   G+A+S+ +VK V +  Y++SVLQIS  IIP
Sbjct  236  GSAVLGSALSAKLVKSVASEPYNISVLQISRPIIP  270



>gb|EYU22059.1| hypothetical protein MIMGU_mgv1a011491mg [Erythranthe guttata]
Length=280

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 102/162 (63%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +  ++ LL ++ +A +IT +L QYP F+T+ S L+ T LA +IN R+   TIL + ND I
Sbjct  11   VISAVLLLSATTSAHNITLILDQYPEFTTYNSLLTATDLATKINRRKT-LTILALTNDRI  69

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
            G L+G S DV  +++S H++L+YFD  KL+       + TTL+Q++G A D QGFLNV +
Sbjct  70   GDLAGKSVDVQTRILSTHIVLDYFDMLKLYKFKNTKSVVTTLYQSTGTADDMQGFLNVIH  129

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            S    + F S   GA + + +   V  + Y++SVL IS+VI+
Sbjct  130  STDGNIYFGSAMNGAPLDAKVEGSVAKQPYNISVLSISHVIV  171



>ref|XP_010938483.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=277

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 95/154 (62%), Gaps = 1/154 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            +SA A +ITA+L  +  F+TF +YL+QT L  EIN R+   TILV+DN  +  +S +  +
Sbjct  18   TSAMAFNITAILEPFSKFTTFSNYLNQTKLVHEINHRRT-ITILVIDNSRMSAISSLPEE  76

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             LK VM VHVIL+Y+D +K+ ++P +  L T LFQ +  A    GFLNVT    +   F 
Sbjct  77   SLKHVMEVHVILDYYDIRKISHIPRKSFLLTILFQTTDVATKRMGFLNVTRMADESEVFG  136

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            S    A  +S ++K V T  Y++SVLQ+S  IIP
Sbjct  137  SAILRAPHTSTLIKKVMTMPYNISVLQVSEPIIP  170



>gb|ABV27481.1| fasciclin-like arabinogalactan protein 10 [Gossypium hirsutum]
Length=414

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 102/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ FS+ L F ++   +IT +L ++PS STF  YL+ THLA EIN R+   T+L +DN  
Sbjct  10   LLIFSVFLSFQTSNGHNITRLLAKHPSLSTFNHYLTLTHLAQEIN-RRTTITVLALDNAA  68

Query  247  IGPLSGMSPDV--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  L   +P +  +K V+S+HV+L+YF A+KLH +     LA T+FQA+G A    GF+N
Sbjct  69   MSSLLNKNPSIYTMKNVLSLHVLLDYFGAKKLHQITNGTALAATMFQATGVAPGVSGFVN  128

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F ++  G  + SF VK VE   Y++SV+QIS  +
Sbjct  129  ITDFKGGKVGFGAEDNGGDLDSFFVKSVEELPYNISVIQISKAL  172



>ref|XP_009417795.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++F S  +L SSATA +IT +L Q+P FS F S LSQ  +A E+N RQ   T+L VDN  
Sbjct  11   LVFVSFLVLLSSATAHNITRLLSQFPDFSNFNSLLSQADIASEVNRRQT-ITVLAVDNSA  69

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
               LS +  D LK+V+S+HVIL+Y+D +K+HNL  +  L TTLFQ +G A +  GFLN T
Sbjct  70   ASSLSSLDSDTLKQVLSIHVILDYYDKEKIHNLKRRSTLFTTLFQTTGVAANRMGFLNAT  129

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
                  + F S   G+ + +  VK V  + Y+LSVLQIS VI+P
Sbjct  130  KLSDGRLAFGSGVPGSPLVATYVKSVAAKPYNLSVLQISAVIVP  173



>gb|EPS61284.1| hypothetical protein M569_13515, partial [Genlisea aurea]
Length=220

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            S +  +IT +LG+YP FS F   L++T LA+EIN R    T+L V ND +G ++G   DV
Sbjct  7    SVSGFNITVLLGRYPEFSNFSDLLTRTQLAEEINHRST-ITVLAVTNDKLGGVAGKPLDV  65

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
             K+++S HVIL+YFD  KL+ L       TTL+QASG A D QGFL++ +     V F S
Sbjct  66   AKRILSNHVILDYFDVLKLNKLKNTRTEVTTLYQASGVANDAQGFLDIVHKLDGSVVFGS  125

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
              +G+ +   +   V ++ Y++SVL +S VII
Sbjct  126  AVRGSGLDCKLEGSVASQPYNISVLAVSQVII  157



>ref|XP_009132640.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
Length=201

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 97/155 (63%), Gaps = 4/155 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PS S+F  YL+QTHLADEIN R    T+  VD+  +  L+  G +   L
Sbjct  27   AHNVTLLLANHPSLSSFNHYLAQTHLADEINQRNT-ITVCAVDDGAMYDLTSKGYTISTL  85

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YFDA+K   LP    LA T+FQA+G A +N GF+ +TN     ++F   
Sbjct  86   KNILSLHVLLDYFDARKRPQLPDGSALAATIFQATGAAPENTGFVKITNKRGGNIRFGLN  145

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
              G   SSF +K +E   YD+S++QIS +++  +V
Sbjct  146  GAGDVSSSF-IKSIEQVPYDISIIQISGILLSDTV  179



>ref|XP_008219800.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=285

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SS +A +IT +L +   FS F + LSQT LADEIN R+   TIL VDN   G LSG S D
Sbjct  25   SSVSAFNITKILEKQSDFSNFNNLLSQTKLADEIN-RRSTITILAVDNGGAGGLSGQSSD  83

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLNVT-NSGKQVV  447
            + KK++SVHV+L+Y+D  KL  +    + A  TTLFQ++GQA   QGF+ V+ N+G+  +
Sbjct  84   MAKKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQ--I  141

Query  448  QFVSKAKGAAVSSF-MVKPVETRAYDLSVLQISNVI  552
             F S AKG   +S   VK V ++ Y++SVLQ+ ++I
Sbjct  142  SFGSAAKGGNGNSVNFVKSVVSQPYNISVLQVGSII  177



>ref|XP_007221854.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
 gb|EMJ23053.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
Length=285

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SS +A +IT +L +   FS F + LSQT LADEIN R+   TIL VDN   G LSG S D
Sbjct  25   SSVSAFNITKLLEKQSDFSNFNNLLSQTKLADEIN-RRSTITILAVDNGGAGGLSGESSD  83

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLNVT-NSGKQVV  447
            + KK++SVHV+L+Y+D  KL  +    + A  TTLFQ++GQA   QGF+ V+ N+G+  +
Sbjct  84   MAKKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQ--I  141

Query  448  QFVSKAKGAAVSSF-MVKPVETRAYDLSVLQISNVI  552
             F S AKG   +S   VK V ++ Y++SVLQ+ ++I
Sbjct  142  SFESAAKGGNGNSVNFVKSVVSQPYNISVLQVGSII  177



>ref|NP_001149463.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|ACG35529.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|AFW87638.1| fasciclin-like arabinogalactan protein 8 [Zea mays]
Length=278

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +1

Query  106  TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--  279
            TA ++T +LG+YP F  F   LS+T +A E+N+R  P T+LV  N  +  L   S  +  
Sbjct  28   TAFNVTEILGRYPEFKLFNLLLSKTRVAREVNSRS-PVTVLVPGNSAVDWLLRRSARLPR  86

Query  280  --LKKVMSVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
              L +++SVHV L+Y DA KL +LP GQ  + TTLFQ +G A+   GFLNVT +G+    
Sbjct  87   AALVELVSVHVALDYIDAAKLASLPRGQPTVVTTLFQTTGSALGRTGFLNVTAAGRGGAS  146

Query  451  --FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
              FVS A G+ VS+ + + V  + Y++SVLQISN+++P
Sbjct  147  AVFVSAAPGSLVSATLKRAVTAKPYNISVLQISNLVVP  184



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 96/153 (63%), Gaps = 1/153 (1%)
 Frame = +1

Query  94   FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP  273
               A A +IT +L  YP +S F   L++T LADEIN+R+   T+LVV+N  +  LSG+  
Sbjct  13   LCCANAFNITKILDAYPDYSIFNDDLTRTKLADEINSRKT-ITVLVVNNGAMASLSGLDL  71

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K+ +S+HV+L++FDA+KLH +     L+TTL+Q +G A  N GF+N+T+     V F
Sbjct  72   ASVKRALSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINITDLKGGKVGF  131

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                +GA + S  VK V+   ++LSV+++S  I
Sbjct  132  GLSGRGAKLDSTYVKSVKQDGFNLSVVEVSQPI  164



>ref|XP_002866110.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42369.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 6/165 (4%)
 Frame = +1

Query  67   IIFFSITLLFSSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            I  F+I LL +  T A ++T +L  +PSFS+F  +L+QTHLADEIN R+   T+  VDN 
Sbjct  9    ISIFNILLLLTIQTHAHNVTRLLANHPSFSSFSHFLTQTHLADEIN-RRTTITVCAVDNA  67

Query  244  NIGPLS--GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
             +  L+  G +   LK ++S+HV+L+YF A+KLH +     LA TLFQA+G A    GF+
Sbjct  68   AMSALTSKGYTISTLKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAPGTTGFV  127

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            N+T+     V F     G  +SSF VK +E   Y++S++QIS V+
Sbjct  128  NITDLRGGKVGF--GPDGGDLSSFFVKSIEEVPYNISIIQISRVL  170



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 99/159 (62%), Gaps = 2/159 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-  273
            +SA+A +IT +L  +P +S F   LSQT LADEIN+R+P  T+ V+ N  +   +G  P 
Sbjct  19   ASASASNITEILSGFPEYSEFNDLLSQTKLADEINSREP-VTVCVLPNGALSSFTGKYPL  77

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
             V+K ++++HV+L+YFDA KLH +     L+TTL+Q +G A  N GF+N+T+     V F
Sbjct  78   SVIKNILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGF  137

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
             S   G+ + S   K V+   Y+LSV+++S  I P +V 
Sbjct  138  GSGVPGSPLDSTFTKSVKQVPYNLSVIEVSKAIAPSAVL  176



>ref|XP_010943291.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=412

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 95/148 (64%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVLKK  288
            +IT +L ++P FSTF  YL+ THLA EIN R+   TILVV N ++ PL    +S   LK 
Sbjct  26   NITKILAEHPEFSTFNHYLTATHLAGEIN-RRKTITILVVSNADMAPLLAKHLSLYTLKN  84

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+++YF A+KLH L G    ++TLFQA+G A    GF+N+TN     V F +   
Sbjct  85   VLSLHVLVDYFGAKKLHQLNGGAAASSTLFQATGSAQGTAGFVNITNHRAGRVSFAAVDA  144

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            G A     VK ++  +YD++V+QIS+V+
Sbjct  145  GGAPPVNFVKSIKEISYDIAVIQISSVL  172



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+ LL  +  A DIT +L ++P FSTF  YL+ THLA+EIN RQ   T+  VDN  +  
Sbjct  14   FSLALLLCATEAHDITRILAKHPQFSTFNHYLTTTHLANEINRRQT-ITVFAVDNAGMSD  72

Query  256  L--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
            L    +S   +K V+S HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+TN
Sbjct  73   LLSKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITN  132

Query  430  -SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G +VV   +   G   + F VK VE   Y++SV+QIS ++
Sbjct  133  VKGGKVVFSPADYDGPPPAKF-VKSVEEIPYNISVIQISTIL  173



>ref|XP_004305606.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=282

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 105/165 (64%), Gaps = 6/165 (4%)
 Frame = +1

Query  70   IFFSITLLFS--SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            +FF +  + S  S +A +IT +L +   FSTF  YLS T LADEIN +Q   T+L ++ND
Sbjct  10   MFFVLLSMLSIRSCSAFNITKLLNKESDFSTFNKYLSATKLADEIN-KQSTITVLALNND  68

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFL  417
             +G +S  +   LK VMSVH+IL+YFD +KL  L         TTLFQ+SG+A D QGF+
Sbjct  69   AMGGISSDNSFPLKSVMSVHIILDYFDKEKLAKLAKNNSSTKLTTLFQSSGEAKDQQGFV  128

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             V     ++  F S +KGA ++S +V+ V  + Y++SVL++S++I
Sbjct  129  RVEVVDGEIF-FGSASKGAQMNSKLVRSVTAQPYNISVLEVSSII  172



>ref|XP_007011569.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
 gb|EOY29188.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
Length=277

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 101/162 (62%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +F  +  L +++TA ++T VLGQYP + +F   LSQT LA+EI+ RQ   TIL +DN +I
Sbjct  10   VFAFLLALSTTSTAFNVTKVLGQYPDYGSFNDLLSQTKLAEEISHRQT-ITILALDNASI  68

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
              ++    D +KK++  HV+L+YFD  K+  L  +  + TTL+Q +G A   QGFLN+T 
Sbjct  69   SSIASRPSDEVKKILMNHVVLDYFDTFKIQKLGKKSVILTTLYQTTGLAQGQQGFLNITK  128

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             G   V F S  KGA + S ++  V ++ ++LSVL +S  I+
Sbjct  129  LGPGEVVFGSAVKGAPLVSKLLGSVVSQPFNLSVLHVSTPIV  170



>ref|NP_001150349.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|ACG38763.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
Length=276

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 7/162 (4%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL----SGMS  270
            A A ++T +L +YP F  F   LS+T +A E+N R+   T+LV DN  +  L    + + 
Sbjct  30   AAAFNVTEILSRYPEFKLFNLLLSKTRVAREVN-RRSAVTVLVPDNSAVDWLLRRSARLP  88

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLP--GQGELATTLFQASGQAVDNQGFLNVTNSGKQV  444
               L +++SVHV L+Y DA KL  +P  GQ  + TTLFQ +G A++  GFLNVT  G+  
Sbjct  89   RAALVELVSVHVALDYIDAAKLAAMPRSGQPAVVTTLFQTTGAALNRTGFLNVTAVGRAG  148

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
              FVS A G+ VS+ + + V  R Y++SVLQISN ++P  V 
Sbjct  149  AVFVSAAPGSLVSATLRRAVTARPYNISVLQISNFVVPPGVI  190



>ref|XP_008462050.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Cucumis 
melo]
Length=421

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMS  270
            SSA A +IT +L ++P FSTF  YL+ THLA EIN R+   T+L +DN  +  L     S
Sbjct  26   SSADAHNITRILAKHPEFSTFNHYLTITHLAGEIN-RRLTITVLALDNSAMSALLDKHFS  84

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
               +K V+S+HV+++Y+ A+KLH L     L++TLFQA+G A    G++N+TN     V 
Sbjct  85   VGTIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVG  144

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F S+  G  ++SF VK V    Y++S+LQIS VI
Sbjct  145  FGSEDNGGDLNSFYVKSVVEMPYNISILQISKVI  178



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 102/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++  S+ LL S++ A +IT +L ++P FSTF  YL+ T LA EIN R+   T+  VDN  
Sbjct  13   VLCISLFLLPSTSDAHNITRILAKFPEFSTFNHYLTVTQLAPEINRRET-ITVCAVDNAG  71

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  L    ++   LK V+S+HV+L+YFDA+KLH +     LA T+FQA+G A  + GF+N
Sbjct  72   MADLLSKHLTLGALKNVLSLHVLLDYFDAKKLHEITDGTALAATMFQATGSATGSSGFVN  131

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +  G  VS+  VK V+   Y++SV+QIS ++
Sbjct  132  ITDLKGGKVGFSPEDNGGVVSATFVKTVQAIPYNISVIQISTIL  175



>ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 gb|KGN43405.1| hypothetical protein Csa_7G031660 [Cucumis sativus]
Length=418

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMS  270
            SSA A +IT +L ++P FSTF  YL+ THLA EIN R+   T+L +DN  +  L     S
Sbjct  23   SSADAHNITRILAKHPEFSTFNHYLTITHLAGEIN-RRLTITVLALDNSAMSALLDKHFS  81

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
               +K V+S+HV+++Y+ A+KLH L     L++TLFQA+G A    G++N+TN     V 
Sbjct  82   VGTIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVG  141

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F S+  G  ++SF VK V    Y++S+LQIS VI
Sbjct  142  FGSEDNGGDLNSFYVKSVVEMPYNISILQISKVI  175



>ref|XP_010669451.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV  279
            S +A +IT  L Q+  FST+ + L+Q+ +A  IN +Q   T+LVVDN  +GP++G+    
Sbjct  22   SISAFNITYFLEQHSEFSTYNNLLTQSGVAAAIN-KQGTVTVLVVDNSAVGPITGVPQSK  80

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            L  +++ HVIL+Y+DA KL NL G+   AT LFQ +G+    QG LN+TNS   V+ F S
Sbjct  81   LSFILATHVILDYYDATKLDNLNGKSVKATNLFQQTGKTNGEQGLLNITNSDGNVI-FAS  139

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             AKGA   S MVK V ++ + +SV+QIS  I+
Sbjct  140  SAKGAPQDSKMVKVVSSQPFHISVIQISKPIV  171



>ref|XP_008649024.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Zea mays]
 gb|AFW76147.1| fasciclin-like arabinogalactan protein 8 [Zea mays]
Length=275

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL----SGMS  270
            A A ++T +L +YP F  F   LS+T +A E+N R+   T+LV DN  +  L    + + 
Sbjct  31   AAAFNVTEILSRYPEFKLFNLLLSKTRVAREVN-RRSAVTVLVPDNSAVDWLLRRSARLP  89

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLP--GQGELATTLFQASGQAVDNQGFLNVTNSGKQV  444
               L +++SVHV L+Y DA KL  LP  GQ  + TTLFQ +G A++  GFLNVT  G+  
Sbjct  90   RAALVELVSVHVALDYIDAAKLAALPRSGQPAVVTTLFQTTGAALNRTGFLNVTAVGRAG  149

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
              FVS A G+ VS+   + V  R Y++SVLQISN ++P  V 
Sbjct  150  AVFVSAAPGSLVSATFRRAVTARPYNISVLQISNFVVPPGVI  191



>ref|XP_010324668.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Solanum 
lycopersicum]
Length=265

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 100/163 (61%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   IFFSITLLF-SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            +  S  +LF SSA+A +IT +LGQY  +STF   LS++ LA +IN+R    T+L V N  
Sbjct  8    LLCSFLILFASSASAFNITKILGQYSDYSTFNELLSKSGLASDINSRGT-ITLLAVPNGA  66

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
            +G L+  S DVLK+V++ HV+L+Y+D  KL  +  +    TT+FQ SG+A  +QGFLNVT
Sbjct  67   VGDLTSKSDDVLKRVLATHVVLDYYDPMKLQKMKDKTAKMTTMFQQSGKAAYDQGFLNVT  126

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                  V F S   GA   S + K V  + Y++S+L IS  I+
Sbjct  127  AKDGSFV-FGSAVVGAQRDSKLEKSVMNQPYNISILGISQPIV  168



>emb|CDY42162.1| BnaC05g40570D [Brassica napus]
Length=251

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 101/163 (62%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   IFFSI--TLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            +FFS   T L++S+ + +IT +L Q   FSTF + L+QT+LA  IN+RQ   T+L + ND
Sbjct  10   LFFSFASTFLYTSSNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQT-ITVLALSND  68

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             +   S  S +  KKV+S+ +IL+Y+D +KL +L  +  + TTLFQASGQA   QGF+N 
Sbjct  69   AVSHFSDQSAEDNKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNA  128

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            T      V F S   G+ + S ++  V T  Y++SVL IS+ I
Sbjct  129  TVMNNGDVMFGSAVPGSILDSKLIDSVATHPYNISVLHISSYI  171



>ref|XP_009593249.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=272

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 96/156 (62%), Gaps = 2/156 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            LL SSA+A +IT +L Q+  +STF   LS++ LA EIN R    TIL V N  IG L+  
Sbjct  14   LLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRAT-ITILAVPNGAIGDLTSK  72

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVV  447
            S DVLK V+S +V+L+Y+D  KL NL  +    TT++Q SG+A  +QGFLNVT      V
Sbjct  73   SDDVLKSVLSTYVVLDYYDIPKLKNLKDKTAKLTTMYQQSGKAGYDQGFLNVTAKDGSFV  132

Query  448  QFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             F S  KGA   S + K V  + Y++S+L IS  I+
Sbjct  133  -FGSAVKGAQRDSRLEKSVMNQPYNISILGISQPIV  167



>ref|XP_008342240.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=391

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 97/153 (63%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            ++ A +IT +L Q+PS STF  YLS THLA EIN RQ   T+L +DN  +  L   G+S 
Sbjct  24   TSQAHNITRILDQHPSLSTFNHYLSLTHLATEINRRQT-ITVLTLDNAAMSSLISKGLSV  82

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+++YF A+KLH L     LA+++FQA+G A    G++N+TN     V F
Sbjct  83   YTIKNVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGF  142

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             ++  G  ++SF VK V    Y++SVLQIS  +
Sbjct  143  GAEDNGGTLNSFYVKSVLEMPYNISVLQISQAL  175



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 103/164 (63%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F+++ L  S  A +IT +L  +P +S + SYLSQT LADEIN+RQ   T LV++N  
Sbjct  6    LLVFALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQT-LTCLVLNNAA  64

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+G  P  V+KK + + V+L+Y+D +KLH +     L+TTL+Q +G A  N GF+N+
Sbjct  65   MSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNI  124

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS  II
Sbjct  125  TDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPII  168



>ref|XP_009385381.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 98/152 (64%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPD  276
            A   +IT +L Q+P FSTF  YLS THLA+EIN R+   T+L VDN  +G L    +S  
Sbjct  24   ARGHNITKILAQHPEFSTFNHYLSVTHLANEIN-RRLTITVLAVDNSGMGDLLAKHLSIL  82

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             L+ V+++H++ +Y+ A+KLH L G   +++++FQ+SG A    G++N+T+  +  V F+
Sbjct  83   TLRNVLALHILTDYYGAKKLHQLTGGSTISSSVFQSSGHAPGTTGYINITDHRRGKVTFI  142

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            ++  G A  +  VK V+   Y++S+LQIS ++
Sbjct  143  TEDAGGAAPAVFVKSVKEIPYNISILQISTIL  174



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLK  285
            A +IT +L  YP +S F + L+QT LADEI++R+P  T+L + N  +  +SG  P  V+K
Sbjct  1    ATNITKILDAYPEYSDFNALLTQTKLADEIDSREP-VTVLALPNSELSSISGKYPLGVVK  59

Query  286  KVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKA  465
             V+S+HV+L+YFDA KLH +     L+TTL Q +G A  N GF+N+T+     V F S  
Sbjct  60   SVLSLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGI  119

Query  466  KGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
             G+ + S   K V+   Y++SV+++S  I P ++ 
Sbjct  120  AGSPLDSTFTKSVQQIPYNISVIEVSKAIAPDAIL  154



>ref|XP_010497131.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=327

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F  YL+QTHLADEIN R+   T+  VDN  +  L+  G +   L
Sbjct  23   AHNVTRLLANHPSFSSFSHYLTQTHLADEIN-RRTTITVCAVDNAAMAALTSKGYTISTL  81

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF  +KLH +     LA T+FQA+G A    GF+N+T+     V F   
Sbjct  82   KNILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGF--G  139

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK +E   Y++S++QIS V+
Sbjct  140  PDGGDLSSFFVKSIEEVPYNISIIQISRVL  169



>ref|XP_004244694.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Solanum 
lycopersicum]
Length=251

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 99/166 (60%), Gaps = 5/166 (3%)
 Frame = +1

Query  67   IIFFSITLLF---SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVD  237
            II    + LF   SSA+A ++T +L QYP ++ F   +S+T LA EINA+    T+L + 
Sbjct  5    IIPLLCSFLFLSASSASAFNVTKILSQYPDYTNFNDLISKTGLASEINAKST-ITLLAIP  63

Query  238  NDNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
            N  IG L+    DV+KK+++ HV+L+Y+D  KL  L  +    TT+FQ SG+A ++QGFL
Sbjct  64   NGAIGDLTSKPNDVVKKILTTHVVLDYYDTMKLQKLKDKTSKLTTMFQESGKASNDQGFL  123

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            NVT      V F S  K A   S + K V  + Y++S+L IS  I+
Sbjct  124  NVTAKDNTFV-FGSAVKDAQRDSRLEKSVMNQPYNISILGISQPIV  168



>ref|XP_008445580.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=296

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L ++P F  F   L++T L ++IN RQ   T+L ++N  +G +SG S DV+K+++
Sbjct  34   NITRLLNRFPEFGAFNDLLTKTRLFEQINTRQT-ITVLALNNATVGAISGNSLDVIKQIL  92

Query  295  SVHVILNYFDAQKLHNLPG-QGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            S HVIL+Y+D  K+  L   +  + TT+FQ++G A + QGFL V  + +  V+F S +K 
Sbjct  93   SAHVILDYYDVAKMRKLSADKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSASKK  152

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            A +S+ +VKPV ++ Y++SVLQIS  I+
Sbjct  153  APLSAKLVKPVASQPYNISVLQISAPIV  180



>ref|XP_009398985.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPD  276
            SSA A D+T +L Q+  FSTF   L +T L+ +I+ R+   TIL V N  +   SG   +
Sbjct  21   SSAIAFDVTRLLAQFSDFSTFNDLLIRTQLSADISTRKS-VTILAVQNGALSSESGQPDE  79

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
            V+KK++++HV+L+Y D++KLH L     + TT+ QASG+A    GFLNVT+     V F 
Sbjct  80   VIKKIIALHVVLDYLDSEKLHQLSSHTAILTTMLQASGRASGLSGFLNVTDLKNGQVAFG  139

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSV  567
            S   G+ +SS+ V+ + T  YD+SV+QIS +I+P  +
Sbjct  140  SAVPGSPLSSYFVRVILTHPYDISVVQISGLIVPPGI  176



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMS  270
            S+  A +IT +L +YP FSTF  YL+ T LA EIN R+   T+  VDN  +  L    ++
Sbjct  24   STTYAHNITRILDKYPDFSTFNHYLTLTQLAPEINRRET-ITVCAVDNARMSDLLSKHLN  82

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
               +K V+S+HV+L+YFD++KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  83   IGAIKNVLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLKGGKVG  142

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F  +  G  VS+  VKPVE   Y++SV+QIS+++
Sbjct  143  FAPQDNGGVVSATFVKPVEAIPYNISVIQISSIL  176



>ref|XP_008788906.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=481

 Score =   118 bits (295),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 7/161 (4%)
 Frame = +1

Query  88   LLFSSATAI----DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            LLFS   A+    +IT +L ++P FSTF  YL+ THLA EIN R+   T+L V N  + P
Sbjct  84   LLFSGCLAVSREHNITKILAEHPEFSTFNHYLTATHLAGEINRRKT-ITVLAVSNTGMAP  142

Query  256  L--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
            L    +    LK V+S+HV+++YF A+KLH + G    ++TLFQA+G A    GF+N+TN
Sbjct  143  LLAKHLPLYTLKNVLSLHVLVDYFGAKKLHQINGGTAASSTLFQATGAASGTAGFVNITN  202

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 V F ++  G A     VK ++   YDL+V+QIS+V+
Sbjct  203  HRAGRVSFAAEDVGDAPPVNFVKSIKEIPYDLAVIQISSVL  243



>ref|XP_007142534.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
 gb|ESW14528.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
Length=403

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 93/148 (63%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVLKK  288
            +IT +L ++P FSTF  YLS THLADEIN RQ   T+L +DN  +  L    +S   LK 
Sbjct  24   NITRILEKHPGFSTFNHYLSATHLADEINRRQT-ITVLAIDNGAMNSLLDKHLSLPTLKN  82

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+++YF A+KLH +     L +++FQA+G A    G++N+TN     V F ++  
Sbjct  83   VLSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGAAAGTSGYVNITNLKGGKVGFAAEDN  142

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
              ++ SF VK V+   Y +SVLQISN I
Sbjct  143  DGSLHSFYVKSVQEFPYYISVLQISNPI  170



>ref|XP_009351261.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Pyrus x 
bretschneideri]
Length=391

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 96/153 (63%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            ++ A +IT +L Q+PS STF  YL  THLA EIN RQ   T+L +DN  +  L   G+S 
Sbjct  24   TSQAHNITRILDQHPSLSTFNHYLGLTHLATEINRRQT-ITVLALDNAAMSSLISKGLSV  82

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+++YF A+KLH L     LA+++FQA+G A    G++N+TN     V F
Sbjct  83   YTIKNVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGF  142

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             ++  G  ++SF VK V    Y++SVLQIS  +
Sbjct  143  GAEDNGGTLNSFYVKSVLEMPYNISVLQISQAL  175



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 98/159 (62%), Gaps = 2/159 (1%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-  273
            S A A +IT +L  YP +S F + LSQT LADEIN+R+P  T+ V+ N  +   +G  P 
Sbjct  19   SIAAATNITEILDGYPEYSEFNTLLSQTKLADEINSREP-VTVCVLPNGALSSFTGKYPL  77

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
             V++ ++++HV+L+YFDA KLH +     L+TTL+Q +G A  N GF+N+T+     V F
Sbjct  78   SVVENILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLGFVNITDLKGGKVGF  137

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
             S   G+ + S   K V+   Y++SV+++S  I P +V 
Sbjct  138  GSGVAGSPLDSTYTKSVKQIPYNVSVIEVSKAIAPAAVL  176



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 5/162 (3%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+ LL  +  A +IT +L ++P FSTF  YL+ THLA EIN RQ   TI  VDN  +  
Sbjct  14   FSLALLLCATEAHNITRILAKHPQFSTFNHYLTTTHLAYEINRRQT-ITICAVDNAGMSD  72

Query  256  L--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
            L    +S   +K V+S HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+TN
Sbjct  73   LLSKHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITN  132

Query  430  -SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G +VV   +   G   + F VK VE   Y++SV+QIS ++
Sbjct  133  LKGGKVVFSPADYDGPPPAKF-VKSVEEIPYNISVIQISTIL  173



>ref|XP_006401420.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
 gb|ESQ42873.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
Length=424

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 99/159 (62%), Gaps = 5/159 (3%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS  261
            + LL   + A ++T +L  +PSFS+F  +L+QTHLADEIN R+   T+  VDN  +  L+
Sbjct  17   LLLLTVKSHAHNVTRLLANHPSFSSFNHFLTQTHLADEIN-RRTTVTVCAVDNAAMSALT  75

Query  262  --GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G +   LK ++S+HV+L+YF A+KLH +     LA TLFQA+G A    GF+N+T+  
Sbjct  76   SKGYTITTLKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAQGMTGFVNITDLR  135

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F     G  +SSF VK +E   Y++S++QIS V+
Sbjct  136  GGKVGF--GPDGGDLSSFFVKSIEEVPYNISIIQISKVL  172



>ref|XP_004305460.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 101/167 (60%), Gaps = 5/167 (3%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +  S   LFS + A +IT +L  Y  FSTF  YL++T +AD+IN R+   TI VVDN  +
Sbjct  8    LLLSYFCLFSCSYAFNITQMLSNYKDFSTFNDYLTRTTVADQINKRES-LTIFVVDNGAM  66

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVT  426
            G ++  S D+  K++S+HV L YFD +KL  LP  +  L TTL QA+GQ    QGFL  T
Sbjct  67   GSVTKKSLDMASKILSLHVALEYFDTKKLQQLPTNEPTLMTTLLQANGQPTGQQGFLKAT  126

Query  427  ---NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
               NS       +S A  +  S+ +V+ V ++ Y++SV+QISN I+P
Sbjct  127  IGGNSSGGGGVSISLASSSDQSASVVQSVTSQPYNISVIQISNAIVP  173



>ref|XP_004138878.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 ref|XP_004160862.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 gb|KGN62878.1| hypothetical protein Csa_2G379090 [Cucumis sativus]
Length=300

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 102/150 (68%), Gaps = 3/150 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L ++P F  F   L++THL ++IN+RQ   T+L + N  +G ++G S DV+K+++
Sbjct  35   NITRLLNRFPDFGAFNELLTKTHLYEQINSRQT-ITVLALSNATVGAIAGNSLDVIKQIL  93

Query  295  SVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            S HVIL+Y+D +K+  L   +  + TT+FQ++G A + QGFL V  + +  V+F S AK 
Sbjct  94   SAHVILDYYDVEKMRKLSTDKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSAAKK  153

Query  472  AAVSSFMVKPVETRAYDLSVLQISN-VIIP  558
            A +S+ ++K V ++ Y++S+LQ+S  ++IP
Sbjct  154  APLSAKLMKTVASQPYNISLLQVSAPIVIP  183



>dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
             +++LL +  +  +IT +L  +P +S F SYLSQT LADEIN+RQ   T+L + N  +  
Sbjct  1    LTLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQT-LTVLALPNGAMSD  59

Query  256  LSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
            L+     V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+  
Sbjct  60   LAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQ  119

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               V F S A G+ + S   K V+   Y++SVL+I++ II
Sbjct  120  GGKVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPII  159



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++  +++ L  S  A +IT +L  +P +S + SYLSQT LADEIN+RQ   T LV++N  
Sbjct  6    LLVLALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQT-LTCLVLNNAA  64

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+G  P  V+KK + + V+L+Y+D +KLH +     L+TTL+Q +G A  N GF+N+
Sbjct  65   MSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNI  124

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS  II
Sbjct  125  TDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPII  168



>ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=402

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL-  258
            + LL  + TA +IT +L ++P FSTF  YL+QTHLA+EIN RQ   TIL +DN  +  L 
Sbjct  15   VVLLAPATTAFNITKILKKHPEFSTFNEYLTQTHLANEINHRQT-ITILALDNSAMSSLL  73

Query  259  -SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G++   L+ V+S+HV+++Y+ A+KLH +     +  +LFQ+SG A  N G++N+T+  
Sbjct  74   SKGLTLFTLRNVLSLHVLVDYYGAKKLHQITDGTTVTASLFQSSGDADGNSGYVNITDMH  133

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F     G  ++SF VK +    Y+LSV+QIS V+
Sbjct  134  GGKVAFAPADTG-DLNSFFVKTLVEMPYNLSVIQISAVL  171



>dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
             +++LL +  +  +IT +L  +P +S F SYLSQT LADEIN+RQ   T+L + N  +  
Sbjct  1    LTLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQT-ITVLALPNGAMSD  59

Query  256  LSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
            L+     V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+  
Sbjct  60   LAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQ  119

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               V F S A G+ + S   K V+   Y++SVL+I++ II
Sbjct  120  GGKVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPII  159



>ref|NP_187872.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
 sp|Q9LTW9.1|FLA14_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51033.1|AC069474_32 hypothetical protein; 8734-7967 [Arabidopsis thaliana]
 dbj|BAB02409.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65936.1| fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 gb|AEE75229.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
Length=255

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 1/157 (1%)
 Frame = +1

Query  85   TLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSG  264
            T L++S+ + +IT +L ++  FS F   LS+T LA  IN RQ   T+LVV N  +  LSG
Sbjct  15   TFLYTSSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQT-ITVLVVSNGALSSLSG  73

Query  265  MSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQV  444
                V+KK++S+H++L+Y+D +KL NL  +  L TTLFQ+SG A   QGFLN T      
Sbjct  74   QPTSVIKKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGD  133

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            V F S   G+++ + +   V    +++SVL IS+ I+
Sbjct  134  VAFGSAVPGSSLDAQLQDTVAALPFNISVLHISSAIM  170



>ref|XP_004965683.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=270

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 96/159 (60%), Gaps = 6/159 (4%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL----SG  264
            S   A ++T +L +YP F  F   LS+T +A EIN+R    TILV DN  +  L    + 
Sbjct  32   SGNNAFNVTEILRRYPEFKLFNLLLSKTRVAREINSRSS-VTILVPDNSAVDWLLRRSTR  90

Query  265  MSPDVLKKVMSVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
            ++   L ++MSVHV+L+Y D  KL  LP GQ  + TTLFQ +G A +  GFLNVT + + 
Sbjct  91   LARTSLVELMSVHVVLDYIDDAKLAALPRGQPTVVTTLFQTTGTARNRTGFLNVTAAPRG  150

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
               FVS A G+ VS+   + V  + Y++SVLQISN ++P
Sbjct  151  GAAFVSAAPGSLVSATFKRTVTAKPYNISVLQISNFVVP  189



>dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
             +++LL +  +  +IT +L  +P +S F SYLSQT LADEIN+RQ   T+L + N  +  
Sbjct  1    LTLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQT-ITVLALPNGAMSD  59

Query  256  LSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
            L+     V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+  
Sbjct  60   LAKHPLSVIKNALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQ  119

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               V F S A G+ + S   K V+   Y++SVL+I++ II
Sbjct  120  GGKVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPII  159



>gb|ABK28554.1| unknown [Arabidopsis thaliana]
Length=256

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 1/157 (1%)
 Frame = +1

Query  85   TLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSG  264
            T L++S+ + +IT +L ++  FS F   LS+T LA  IN RQ   T+LVV N  +  LSG
Sbjct  15   TFLYTSSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQT-ITVLVVSNGALSSLSG  73

Query  265  MSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQV  444
                V+KK++S+H++L+Y+D +KL NL  +  L TTLFQ+SG A   QGFLN T      
Sbjct  74   QPTSVIKKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGD  133

Query  445  VQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            V F S   G+++ + +   V    +++SVL IS+ I+
Sbjct  134  VAFGSAVPGSSLDAQLQDTVAALPFNISVLHISSAIM  170



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+  L S+    +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  
Sbjct  14   FSLLALASTVRCHNITQILADNPEYSSFNSYLSQTKLADEINSRST-ITLLVLNNGAMAS  72

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D QKLH +     L TTL+Q +G A  N GF+N+T+ 
Sbjct  73   LAGKHPLSVIKNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDL  132

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++SVL+I   II
Sbjct  133  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPII  173



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  70   IFFSITLL-FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            +F +++LL  + ++A +IT +L  +P +S F SYL+QT LADEIN+RQ   T+LV+ N  
Sbjct  6    LFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQT-ITVLVLPNGA  64

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+   P  V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+
Sbjct  65   MSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNI  124

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS+ II
Sbjct  125  TDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPII  168



>ref|XP_011038795.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=406

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            +IT++LG++PS STF  YL+ THLA EIN R+   T+  VDN  +  +    P +  +K 
Sbjct  24   NITSILGKHPSLSTFNHYLTLTHLAGEIN-RRTTITVCAVDNAAMSEILSKKPSISTIKN  82

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S+HV+L+YF  +KLH +     LA T+FQA+G A  + GF+N+T+     V F  K  
Sbjct  83   ILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPKDN  142

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            G ++  F VK VE   Y++SV+QIS ++
Sbjct  143  GGSLDVFYVKSVEEIPYNISVIQISKLL  170



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++  +++ L  S  A +IT +L  +P +S + SYLSQT LADEIN+RQ   T LV++N  
Sbjct  6    LLVXALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQT-LTCLVLNNAA  64

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+G  P  V+KK + + V+L+Y+D +KLH +     L+TTL+Q +G A  N GF+N+
Sbjct  65   MSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNI  124

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS  II
Sbjct  125  TDLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPII  168



>ref|NP_200384.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 ref|NP_001190550.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 sp|Q9FM65.1|FLA1_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20857.1|AF333970_1 fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana]
 dbj|BAB09240.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00897.1| putative protein [Arabidopsis thaliana]
 gb|AAP37869.1| At5g55730 [Arabidopsis thaliana]
 gb|AED96673.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 gb|AED96674.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
Length=424

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F  +L+QTHLADEIN R+   T+  VDN  +  L+  G +   L
Sbjct  24   AHNVTRLLANHPSFSSFSHFLTQTHLADEINRRRT-ITVCAVDNAAMSALTSKGYTLSTL  82

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF  +KLH +     LA TLFQA+G A    GF+N+T+     V F   
Sbjct  83   KNILSLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTSGFVNITDLRGGKVGF--G  140

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK +E   Y++S++QIS V+
Sbjct  141  PDGGDLSSFFVKSIEEVPYNISIIQISRVL  170



>dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
             +++LL +  +  +IT +L  +P +S F SYLSQT LADEIN+RQ   T+L + N  +  
Sbjct  1    LTLSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQT-ITVLALPNGAMSD  59

Query  256  LSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
            L+     V+K  +S+ ++L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+  
Sbjct  60   LAKHPLSVIKSALSLLILLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQ  119

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               V F S A G+ + S   K V+   Y++SVL+I++ II
Sbjct  120  GGKVGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPII  159



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+    S+ ++ +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  
Sbjct  14   FSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTT-ITVLVLNNGAMSA  72

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  73   LAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDL  132

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  133  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  173



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+    S+ ++ +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  
Sbjct  14   FSLLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTT-ITVLVLNNGAMSA  72

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  73   LAGKHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDL  132

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  133  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  173



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 97/152 (64%), Gaps = 2/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DV  279
            ++A +ITA+L  +P +S + S+L+QT LADEIN RQ   TILV++N  I  L+   P  V
Sbjct  21   SSAHNITAILSAFPEYSQYNSFLTQTRLADEINTRQT-ITILVLNNAAISALAAKHPLSV  79

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            +K  +S+HV+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T+     V F S
Sbjct  80   VKNALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGS  139

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             A G+ + S   K V+   Y++S+L+I+  II
Sbjct  140  AAPGSKLDSSYTKSVKQIPYNISILEINAPII  171



>ref|XP_009612463.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=276

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (60%), Gaps = 2/157 (1%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS  261
            + L  +SA+A +IT +L QY  +STF   LS++ LA EIN R    T+L V N  IG L+
Sbjct  13   LLLAATSASAFNITKILSQYSDYSTFNELLSKSGLATEINKRAT-ITVLAVPNGAIGDLT  71

Query  262  GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
              S DVLK+ +S HV+L+Y+D  KL N+  +    T ++Q SG+A  +QGFLNVT     
Sbjct  72   SKSDDVLKRDLSTHVVLDYYDPMKLRNMKEKTAKLTNMYQQSGKAAYDQGFLNVTAKDGS  131

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             V F S  KGA   S + K V  + Y++S+L IS  I
Sbjct  132  FV-FGSAVKGAQRDSRLEKSVMNQPYNISILGISQPI  167



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  70   IFFSITLL-FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            +F +++LL  + ++A +IT +L  +P +S F SYL+QT LADEIN+RQ   T+LV+ N  
Sbjct  47   LFLTLSLLAITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQT-ITVLVLPNGA  105

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+   P  V+K  +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+
Sbjct  106  MSDLTAKHPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNI  165

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS+ II
Sbjct  166  TDLQGGKVGFGSAASGSKLDSTYTKSVKQIPYNVSVLEISSPII  209



>ref|XP_004516114.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Cicer arietinum]
Length=478

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 99/159 (62%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS  261
            I+ +FS++ A +IT +L ++P FSTF  YL+ THLA EIN R    T+  VDN  +  L 
Sbjct  83   ISAIFSTSNAQNITRILEKHPEFSTFNHYLTLTHLALEINTRTT-ITVCAVDNSAMTNLL  141

Query  262  GMSPDV--LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
               P +  +K ++S+HV+L+YF A+KLH +     LA TL+QA+G A  + GF+N+T+  
Sbjct  142  AKHPSISTIKNILSLHVLLDYFGAKKLHQITNGTALAATLYQATGSAPGSSGFVNITDLR  201

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F ++    A+ +  VK VE   Y++SV+QIS ++
Sbjct  202  GGKVGFGAEDNNGALPALYVKSVEEIPYNISVIQISQIL  240



>ref|XP_010435371.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F + L FS ++A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  
Sbjct  32   VLIFQLHLFFSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSA  90

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G S   ++ ++S+HV+++Y+ A+KLH +        ++FQ++G A    G++N
Sbjct  91   MSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVN  150

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T++    V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  151  ITDTKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVL  194



>ref|XP_010465042.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=254

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (65%), Gaps = 1/161 (1%)
 Frame = +1

Query  73   FFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIG  252
            FF  T L++S+ + +IT +L ++  FSTF   L++T LA  IN+RQ   T+LVV N  + 
Sbjct  10   FFVSTFLYTSSNSFNITNILNEHDDFSTFNKLLTETQLASTINSRQT-ITVLVVSNGGLS  68

Query  253  PLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
             LSG   +++KK++S+H+IL+Y+D +KL NL  +  L TTLFQ+SGQA   QGFLN T +
Sbjct  69   SLSGQPINLIKKILSLHIILDYYDEKKLKNLNKKSVLLTTLFQSSGQARGQQGFLNATVT  128

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S   G  V++ ++  V +  +++SVL IS+ I+
Sbjct  129  KDGDVLFGSAVPGPDVNAELLDSVASLPFNISVLHISSAIM  169



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+    S+ ++ +IT +L   P +S+F SYL+QT LADEIN+R    T+LV++N  +  
Sbjct  14   FSLLAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTT-ITVLVLNNGAMSS  72

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D QKLH L     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  73   LAGKHPLSVIKGALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDL  132

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  133  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  173



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L +YP  STF  YL+ T LA EIN R+   T+  VDN  +G L    ++   +
Sbjct  30   AHNITRILAKYPELSTFNHYLTVTQLAPEINRRET-ITVCAVDNGGMGDLLSKRLTIGAI  88

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            + V+ +HV+L+YFDA+KLH +     LA T+FQA+G A  + GF+N+T      V F  +
Sbjct  89   RNVLELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKVGFSPE  148

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +S++ VK +E   Y++SV+QIS ++
Sbjct  149  ENGGVISAYFVKSIEAIPYNISVIQISTIL  178



>ref|XP_003618047.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AET01006.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=421

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 103/172 (60%), Gaps = 14/172 (8%)
 Frame = +1

Query  67   IIFFSITLLFS---SATAI-------DITAVLGQYPSFSTFRSYLSQTHLADEINARQPP  216
            ++ FS+TL+ S   S TA        +IT +L ++P FSTF  YL+ THLADEIN RQ  
Sbjct  9    LVLFSLTLILSLIHSTTAAAATSGNHNITRILAKHPGFSTFNHYLTITHLADEINRRQT-  67

Query  217  YTILVVDNDNIGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASG  390
             TIL +DN  +  L    +S   LK V+S+HV+++YF A+KLH +     L +++FQA+G
Sbjct  68   ITILAIDNAAMSSLLDKHLSITTLKNVLSLHVLVDYFGAKKLHQITDGTTLVSSMFQATG  127

Query  391  QAVDNQGFLNVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISN  546
             A    G++N+TN     V F ++     + S+ VK VE   Y +SVLQISN
Sbjct  128  SAAGTAGYVNITNLKGGKVGFGAE-DNDGLHSYYVKSVEELPYVISVLQISN  178



>ref|XP_002298869.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
 gb|EEE83674.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
Length=406

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            +IT++LGQ+PS STF  YL+ THLA EIN R+   T+  VDN  +  +    P +  +K 
Sbjct  24   NITSILGQHPSLSTFNHYLTLTHLAGEIN-RRTTITVCAVDNAAMSEILSKKPSISTIKN  82

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S+HV+L+YF  +KLH +     LA T+FQA+G A  + GF+N+T+     V F  K  
Sbjct  83   ILSLHVLLDYFGTKKLHQIRDGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPKDN  142

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            G  +  F VK VE   Y++SV+QIS ++
Sbjct  143  GGNLDVFYVKSVEEIPYNISVIQISKLL  170



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 102/166 (61%), Gaps = 5/166 (3%)
 Frame = +1

Query  67   IIFFSITLLFS--SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            ++ FS+ LL S  + +A +IT +L +YP FSTF  YL++THLA EIN+R+   T+  VDN
Sbjct  11   MVVFSLGLLLSPHTTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRET-ITVCAVDN  69

Query  241  DNIGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGF  414
              +  L    +S   +K V+S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF
Sbjct  70   AGMEELLSKHLSIYTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGF  129

Query  415  LNVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +N+T+     V F        + +  VK VE   Y++SV+QIS ++
Sbjct  130  VNITDLKGGKVGFGPAENHGNLPATFVKSVEEIPYNISVIQISTML  175



>emb|CDY20747.1| BnaA02g08870D [Brassica napus]
Length=430

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 95/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F   L++THLADEIN R+   T+  V+N  +  L+  G +   L
Sbjct  27   AHNVTRLLANHPSFSSFNHLLTKTHLADEIN-RRTTITVCAVNNAAMSALTSKGYTISTL  85

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH + G   LA TLFQA+G A    GF+N+T      V F  +
Sbjct  86   KNILSLHVLLDYFGAKKLHQIGGGSALAATLFQATGAAPGTTGFVNITMLRGGKVGF--R  143

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK +E   Y++SV+QIS ++
Sbjct  144  PDGGDMSSFFVKSLEEVPYNISVIQISRIL  173



>gb|KFK27162.1| hypothetical protein AALP_AA8G343200 [Arabis alpina]
Length=425

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F  +L+QTHLADEIN R+   T+  VDN  +  L+  G S   L
Sbjct  28   AHNVTRLLANHPSFSSFNHFLTQTHLADEIN-RRTTITVCAVDNSVMSFLTSKGYSISTL  86

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF  +KLH +     LA TLFQA+G A    GF+N+T+     V F   
Sbjct  87   KNIISLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGF--G  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK +E   Y++S++QIS V+
Sbjct  145  PDGGDLSSFFVKSIEEVPYNISIIQISKVL  174



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   114 bits (285),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            +A A +IT +L +YP  STF  YL+ T LA EIN R+   T+  VDN  +  L    ++ 
Sbjct  18   AARAHNITTILDKYPELSTFNHYLTVTQLAPEINHRET-ITVCAVDNAGMSDLLSKHLTI  76

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+++HV+L+YFDA+KLH +     L+ T+FQA+G A  + GF+N+T+     V F
Sbjct  77   GAIKNVLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITDLAGGKVGF  136

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              +  G  V++  VK VE   Y++SV+QISN++
Sbjct  137  SPQDNGGDVAATFVKSVEAIPYNISVIQISNIL  169



>dbj|BAE71278.1| putative fasciclin-like arabinogalactan protein FLA2 [Trifolium 
pratense]
Length=418

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 102/171 (60%), Gaps = 14/171 (8%)
 Frame = +1

Query  67   IIFFSITLLFS---SATA-------IDITAVLGQYPSFSTFRSYLSQTHLADEINARQPP  216
            ++ FS+TLL S   S TA        +IT +L ++P FSTF  YL+ THLADEIN RQ  
Sbjct  8    LVLFSLTLLISLIHSTTAGAATSGSHNITRILAKHPGFSTFNHYLTITHLADEINRRQT-  66

Query  217  YTILVVDNDNIGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASG  390
             TIL +DN  +  L    +S   LK V+S+HV+++YF A+KLH +     L +++FQA+G
Sbjct  67   ITILAIDNAAMSSLLDKHLSVSTLKNVLSLHVLVDYFGAKKLHQITNGTTLVSSMFQATG  126

Query  391  QAVDNQGFLNVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQIS  543
             A    G++NVTN     V F ++     + SF VK +E   Y +SVL+IS
Sbjct  127  SAAGTAGYVNVTNLKGGKVGFAAE-DNDGLHSFYVKSIEELPYVISVLEIS  176



>ref|XP_009379991.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 8/150 (5%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL----SGMSPDVL  282
            +IT +L Q+P FSTF  YL+ THLA EIN R+   T+L VDN  +  L     G+S   L
Sbjct  27   NITRILAQHPEFSTFNHYLTATHLAGEIN-RRLTITVLAVDNPAMAALLTAHPGLSLYSL  85

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+++YF A+KLH L G   L +TLFQASG A D  GF+N+++     V F + 
Sbjct  86   KHLLSLHVLVDYFGAKKLHQLTGGSALTSTLFQASGAAPDTAGFVNISDYRAGHVLFSAS  145

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +  A   S  VK VE   Y+LSV+QIS+ +
Sbjct  146  SLPA---SAFVKSVEEIPYNLSVIQISSAL  172



>ref|XP_010536730.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=427

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +1

Query  70   IFFSITLLFSSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            +  +++LLF+  T A ++T +L ++PSFSTF  YLS+THLA+EIN R+   T+  VDN  
Sbjct  15   LILTLSLLFAGETRAHNVTRLLAKHPSFSTFNHYLSETHLANEIN-RRTTITVCAVDNAA  73

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G +   +K ++S+H++L+YF A+KLH +     +   LFQA+G A    GF+N
Sbjct  74   MSDIISKGYTISTVKNILSLHILLDYFGAKKLHQIRDGSGVCXXLFQATGSAPGTSGFVN  133

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F     G  +S+F VK +E   Y++SV+QIS V+
Sbjct  134  ITDLRGGKVGF--GPDGGDLSAFFVKSLEEVPYNISVIQISKVL  175



>ref|XP_010499304.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=250

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (65%), Gaps = 1/161 (1%)
 Frame = +1

Query  73   FFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIG  252
            FF  T L++S+ + +IT +L ++  FSTF   LS+T LA  IN+RQ   T+LVV N  + 
Sbjct  10   FFVSTFLYTSSNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQT-ITVLVVSNGALS  68

Query  253  PLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
             LSG   +++KK++S+H+IL+Y+D +KL NL  +  L TTLFQ+SGQA   QGFLN T +
Sbjct  69   SLSGQPANLIKKILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLNATVT  128

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S   G  +++ ++  V +  +++SVL IS+ I+
Sbjct  129  KDGNVLFGSAVPGPDLNAELLDSVASLPFNISVLHISSAIM  169



>gb|KHM99327.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=303

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A DIT +LGQYP FSTF  YL++T LAD+IN+R    T+L V++  +  ++  SP+ +K 
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADQINSRNT-ITVLAVEDSAMHSIAAKSPEAIKA  81

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++  HVIL++FD +KL       +  TTLFQASG AV+ QGFL V   G+  +     A 
Sbjct  82   IIGTHVILDFFDEKKLMEAQASSQQLTTLFQASGLAVNQQGFLKVALVGEGEIAAPVDA-  140

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVII  555
                 + +++ V +  Y++S+LQ++  I+
Sbjct  141  -----TELMRTVTSEPYNISILQVTKPIL  164



>ref|XP_006357096.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Solanum 
tuberosum]
Length=262

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 90/147 (61%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L QYP ++ F   +S+T LA EINA+    T+L + N  IG L+  S DV+KK++
Sbjct  24   NITKILSQYPDYTNFNDLISKTGLASEINAKST-ITLLAIPNGAIGDLTSKSNDVVKKIL  82

Query  295  SVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKGA  474
            + HV+L+Y+D  KL  L  +    TT+FQ SG+A ++QGFLNVT      V F S  K A
Sbjct  83   TTHVVLDYYDTMKLQKLKDKTTKLTTMFQESGKASNDQGFLNVTAKDNTFV-FGSAVKDA  141

Query  475  AVSSFMVKPVETRAYDLSVLQISNVII  555
               S + K V  + Y++S+L IS  I+
Sbjct  142  QRDSRLEKSVMNQPYNISILGISQPIV  168



>ref|XP_007215592.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
 gb|EMJ16791.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
Length=359

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 97/153 (63%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            ++ A +IT +L ++P  S+F  YL+ THLA EIN RQ   T+L +DN  +  L   G+S 
Sbjct  24   TSQAHNITRILAKHPELSSFNHYLTLTHLATEINRRQT-ITVLAIDNAAMSSLLSKGLSV  82

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+++YF A+KLH +     LA+++FQA+G A    G++N+TN     V F
Sbjct  83   YTIKNVLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGF  142

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             ++     ++SF VK V+   Y++SVLQIS V+
Sbjct  143  GAQDNDGKLNSFYVKSVQEIPYNISVLQISQVL  175



>gb|ABV27488.1| fasciclin-like arabinogalactan protein 17 [Gossypium hirsutum]
Length=285

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +1

Query  67   IIFFSITLLF---SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVD  237
            ++FF   +L    ++ TA++IT  L  Y  +ST      +T L D IN RQ   TIL +D
Sbjct  8    LLFFIAAILLPLATTCTALNITKSLAPYSDYSTLSDLFRKTKLTDAINRRQT-ITILALD  66

Query  238  NDNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
            N +I  ++  S D L+K++  H+IL+Y+D QK+  L  +  L TTL+Q +G A++ QGF+
Sbjct  67   NSSIQSITDRSSDELRKILMNHIILDYYDRQKIQKLGKKSALLTTLYQTTGSAINQQGFV  126

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            N+T   +  V F S  KGA +   ++  V ++ ++LSVL IS  I+
Sbjct  127  NITRIARGEVVFGSAVKGAPLVGKLLGSVISQPFNLSVLHISTPIV  172



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +1

Query  106  TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVL  282
            +A +IT +L  YP +S F +YL QT LADEIN+RQ   T+LVV N  + P+    P  V+
Sbjct  21   SAHNITDMLKDYPQYSVFSNYLQQTRLADEINSRQT-ITVLVVSNGALSPILDKHPLSVI  79

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+H++L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T+     V F S 
Sbjct  80   KNILSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSA  139

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
              G+ + S   K V +  Y++SV++IS  I+
Sbjct  140  VPGSKLESSYTKSVVSMPYNISVIEISAPIV  170



>ref|XP_004305604.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=276

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            IIF S  +L +S +AIDI  +L +   FSTFR+ L  + LAD+IN      T+L V N  
Sbjct  9    IIFLSF-VLVASTSAIDILKLLEKESDFSTFRTALKDSKLADDINNHGSSITVLAVANGA  67

Query  247  IGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELAT--TLFQASGQAVDNQGFLN  420
               LSG+SPD  KK+++ HV+L+YFD  KL  L  + + +T  T+ Q +G+A   QG +N
Sbjct  68   ASALSGLSPDEAKKLLATHVLLDYFDEAKLKGLAKKDKPSTVVTMLQTTGEAQHQQGMVN  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            V       V F S   G  + S  +K V  + Y++SVLQ+S++I
Sbjct  128  VGVLKSGEVAFGSAVHGGGLDSKYIKSVTAQPYNISVLQVSSLI  171



>ref|XP_004291803.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 98/163 (60%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +  S+ LLFS A A +IT +L ++P FSTF  YLS THLA +IN R    T+  VDN  +
Sbjct  12   LVLSVFLLFSFAHAHNITHLLAKHPEFSTFNRYLSLTHLAADINDRTT-ITVCAVDNSAM  70

Query  250  GPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
              L    +S   +K ++S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+
Sbjct  71   SALLAKHLSIYSIKNILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNI  130

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            T+     V F  +    + ++  VK VE   Y++SV+ IS V+
Sbjct  131  TDLKGGKVGFTPEDNDGSFAAHFVKSVEELPYNISVIHISAVL  173



>ref|XP_006352015.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Solanum 
tuberosum]
Length=393

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPD  276
            ++A +IT +L ++P FSTF  YL+ THLA EIN RQ   T+  V+N  +G L    MS  
Sbjct  24   SSAHNITLILAKHPEFSTFNRYLTLTHLASEINRRQT-ITVCAVNNAAMGDLLDKHMSIY  82

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             LK V+S+HV  +YF +++LH +     L  TLFQA+G+A    G++N+TN   + V F 
Sbjct  83   TLKNVLSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNITNMKGKKVGFA  142

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            ++      SS  VK ++   Y++SV+Q+SN+I
Sbjct  143  TEDNDGHFSSNFVKSIQEIPYNISVIQLSNII  174



>ref|XP_002522745.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39596.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT +L  +PSFSTF  YL+ THLADEIN R+   T+  +DN  +  L    P +  +
Sbjct  26   AHNITRLLSHHPSFSTFNHYLTITHLADEIN-RRTTITVCAIDNTAMSALLSKHPSIYTI  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V F  +
Sbjct  85   KNMLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPE  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 +  F VK +E   Y++S++QISN +
Sbjct  145  DNDGNLGVFFVKSLEEVPYNISIIQISNFL  174



>ref|XP_010063266.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW70477.1| hypothetical protein EUGRSUZ_F03689 [Eucalyptus grandis]
Length=409

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV-  279
            A A +IT +L ++P FSTF  YL++THLA EIN+R    T++ +DN  +  L    P + 
Sbjct  24   ARAHNITRLLAKHPEFSTFNHYLTETHLAAEINSRTT-ITVMALDNAAMSRLLAPHPTIA  82

Query  280  -LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             LK V+S+HV+L+YF  +KLH +     LA TLFQA+G A  + GF+N+T+     V F 
Sbjct  83   TLKNVLSLHVLLDYFGPKKLHQITNGTALAATLFQATGSAPGSTGFVNITDLKGGKVGFA  142

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +     + ++ VK +E   Y++S++QISN +
Sbjct  143  PEDNNGRLDTYFVKGLEEIPYNISIIQISNAL  174



>ref|XP_010479980.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 100/164 (61%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ + + L FS ++A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  
Sbjct  32   VLIYQLHLFFSLSSAHNITRILAKDPEFSTFNHYLSATHLADEINRRQT-ITVLAVDNSA  90

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G S   ++ ++S+HV+++Y+ A+KLH +        ++FQ++G A    G++N
Sbjct  91   MSSILSKGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVN  150

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  151  ITDIKGGKVAFGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVL  194



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DV  279
            ++A +IT +L  +P +S + S+L+QT LADEIN RQ   TILV++N  I  L+   P  V
Sbjct  21   SSAHNITEILSAFPDYSQYNSFLTQTKLADEINTRQT-ITILVLNNAAISALAAKHPLSV  79

Query  280  LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
            +K  +S+HV+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T+     V F S
Sbjct  80   VKNALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGS  139

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             A G+ + S   K V+   Y++S+L+I+  II
Sbjct  140  AAPGSKLDSSYTKSVKQIPYNISILEINAPII  171



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++F +I    +  +A +IT +L  +P +S F +YL QT LADEIN+RQ   T+LVV N  
Sbjct  8    LLFLAIAATAAIVSAHNITDMLKDFPQYSVFSNYLQQTRLADEINSRQT-ITVLVVANGA  66

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            + P+    P  V+K ++S+H++L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+
Sbjct  67   LSPILDKHPLSVIKNLLSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNI  126

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S   G+ + S   K V +  Y++SV++IS  I+
Sbjct  127  TDLQGGKVGFGSAVPGSKLESSYTKSVVSLPYNISVIEISAPIV  170



>ref|XP_002438784.1| hypothetical protein SORBIDRAFT_10g026140 [Sorghum bicolor]
 gb|EER90151.1| hypothetical protein SORBIDRAFT_10g026140 [Sorghum bicolor]
Length=288

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV----L  282
            ++T +L +YP F  F   LS T +A ++N+R    T+L+ DN  +  L   S  +    L
Sbjct  37   NVTEILSRYPEFELFSFLLSNTGVARKVNSRNS-VTVLIPDNSAVDWLLRRSARLPRAAL  95

Query  283  KKVMSVHVILNYFDAQKLHNLP--GQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             +++SVHV+L+Y DA KL  LP  GQ  + TTLFQ +G A +  GFLNVT +G+    FV
Sbjct  96   VELISVHVVLDYIDAAKLAALPRGGQPTVVTTLFQTTGTARNRTGFLNVTGTGRGGAVFV  155

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIP  558
            S A G+ +++   + V  R Y++SVLQISN ++P
Sbjct  156  SAAPGSLINATFKRAVTARPYNISVLQISNFVVP  189



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  L+G  P  V+K  
Sbjct  27   NITQILADSPEYSSFNSYLSQTKLADEINSRTT-ITLLVLNNGAMSSLAGKHPLSVIKNA  85

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+ V+L+Y+D QKLH +     L+TTL+Q +G A  N GF+N+T+     V F S A G
Sbjct  86   LSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVL+I   II
Sbjct  146  SKLDSSYTKSVKQIPYNISVLEIDAPII  173



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FS+  + S+ ++ +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  
Sbjct  14   FSLLAVASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTT-ITVLVLNNGAMSA  72

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  73   LAGKHPLSVIKSALSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDL  132

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  133  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  173



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLK  285
            A +IT +L  +P +S +  +L+ T LADEIN+R+   T+LV+ N  +  L+   P  V+K
Sbjct  62   AHNITEILSAFPEYSEYNKFLTDTKLADEINSRET-ITVLVLTNSAMDSLAAKHPLSVVK  120

Query  286  KVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKA  465
            K +S+HV+L+Y+DA KLH++     L+TTL+Q +G A  NQGF+N+T+     V F S  
Sbjct  121  KALSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGSAV  180

Query  466  KGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             G+ + S   K V+   Y++SV++IS  II
Sbjct  181  PGSKLDSTYTKSVKQIPYNISVIEISAPII  210



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FSI    S+ ++ +IT +L   P +S+F SYL+QT LADEIN+R    T+LV++N  +  
Sbjct  17   FSILACASTVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTT-ITVLVLNNGAMSS  75

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D  KLH L     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  76   LAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDL  135

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  136  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  176



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            I  F++  +  S  A +IT +L ++P +S F SYL+QT LADEIN+RQ   T+L + N  
Sbjct  6    IFLFTLMSITISIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRQT-ITVLALTNGA  64

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  + G  P  V+K V+S+H++L+YFD+ KLH +     L+TTL+Q +G A  N G +N+
Sbjct  65   MSDVVGKHPLSVIKNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNANGNLGSVNI  124

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S    + ++S   K V+   Y++SVL+IS+ II
Sbjct  125  TDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPII  168



>ref|XP_004305605.1| PREDICTED: uncharacterized protein LOC101308896 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 104/166 (63%), Gaps = 8/166 (5%)
 Frame = +1

Query  67   IIFFSITLLFS--SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            + FF + +L S  S +A +IT +L +   FSTF  +LS T LAD+IN R    T+L VDN
Sbjct  10   VSFFLVMMLLSISSCSAFNITKLLEKEDDFSTFNQHLSDTKLADQINKRS-TITVLAVDN  68

Query  241  DNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGF  414
              IG L   S  V+K +MSVHVIL+Y+D +KL  L    + A  TTL+Q SG A + QGF
Sbjct  69   SAIGGLGDDS--VVKAIMSVHVILDYYDKEKLTKLAKNNKSATLTTLYQTSGLAKNEQGF  126

Query  415  LNVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            + +      +  F S +KG+ ++S +VK V ++ Y++SVLQ+S++I
Sbjct  127  VRIATDDDGIT-FGSASKGSQMNSKLVKSVTSQPYNISVLQVSSII  171



>ref|XP_003519683.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=406

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L ++P FSTF  YLS THLA+EIN RQ   T+L +DN  +  L    +S   +
Sbjct  22   AHNITRMLAKHPGFSTFNHYLSLTHLAEEINRRQT-ITVLALDNAAMSSLLDKHLSLPTI  80

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+HV+++YF A+KLH +     L +++FQA+G A    G++N+TN     V F ++
Sbjct  81   KNVLSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAE  140

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                ++ SF VK V+   Y +SVLQIS  I
Sbjct  141  DNDGSLHSFYVKSVQEMPYYISVLQISAAI  170



>ref|XP_010496525.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 100/164 (61%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F + + FS ++A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  
Sbjct  32   VLIFQLHIFFSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSA  90

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G S   ++ ++S+HV+++Y+ A+KLH +        ++FQ++G A    G++N
Sbjct  91   MSSILSRGYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVN  150

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  151  ITDIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVL  194



>emb|CDY28643.1| BnaC09g32320D [Brassica napus]
Length=423

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 96/159 (60%), Gaps = 5/159 (3%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS  261
            I LL     A ++T +L  +PSFS+F  +L+QTHLA EIN R+   T+L VDN  +  L+
Sbjct  17   ILLLAVETHAHNVTRLLASHPSFSSFNHFLTQTHLAGEIN-RRTTITVLAVDNAAMSALT  75

Query  262  --GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G     +K ++S+HV+L+YF A+K+H +     LA TLFQA+G A    GF+N+T+  
Sbjct  76   SKGYPISTIKNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLR  135

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V       G  +SSF VK VE   Y++S++QIS V+
Sbjct  136  GGKVGL--GPDGGDLSSFFVKSVEEVPYNISIIQISKVL  172



>ref|XP_009338843.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=267

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 6/150 (4%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L +   FS F + LS+T LADEIN R+   TIL VDN   G LSG S D+ KK++
Sbjct  21   NITKLLEKQSDFSNFNNLLSETKLADEIN-RRSTITILAVDNGAAGGLSGKSSDLTKKIL  79

Query  295  SVHVILNYFDAQKLHNLPGQGELA--TTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            SVHV+L+Y+D  KL  +    + A  TTLFQ++G+A   QGF+ V+    Q V F S AK
Sbjct  80   SVHVVLDYYDTDKLKKIFKSNKSATLTTLFQSTGEARKEQGFITVSVKDNQ-VSFGSAAK  138

Query  469  GAAVSSF--MVKPVETRAYDLSVLQISNVI  552
            G    +   +VK V ++ Y++SVLQ+ ++I
Sbjct  139  GNNGDNHVSLVKSVISQPYNISVLQVGSII  168



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 104/166 (63%), Gaps = 4/166 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSAT--AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            ++  +++LL  S T  + +IT +L   P +S+F SYL+QT LADEIN+R    T+LV++N
Sbjct  9    LLAITLSLLAVSTTVKSHNITQILADSPDYSSFNSYLTQTKLADEINSRTT-ITLLVLNN  67

Query  241  DNIGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
              +  L+G  P  V+K  +S+ V+L+Y+D QKLH L     L+TTL+Q +G A  N GF+
Sbjct  68   GAMSSLAGKHPLSVIKNALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFV  127

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            N+T+     V F S A G+ + S   + V+   Y++SVL+I+  II
Sbjct  128  NITDLKGGKVGFGSAAPGSKLESSYTRSVKQIPYNISVLEINAPII  173



>ref|XP_007146643.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
 gb|ESW18637.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
Length=420

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT +L Q+P FSTF  YL+ THLA EIN R    T+  VDN  +  L    P +  +
Sbjct  26   AHNITRILAQHPEFSTFNHYLTLTHLAPEINGRTT-ITVCAVDNAAMDELLSKHPSIYTI  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH +     LA T++QA+G A  + GF+N+T+     V F ++
Sbjct  85   KNILSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAE  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 ++S  VK VE   Y++SV+QIS ++
Sbjct  145  NNDGTLTSTFVKSVEEMPYNISVIQISKIL  174



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F+++ L S+  A +IT +L  +P +S F  YL+QT LADEIN RQ   T+L ++N  
Sbjct  9    LLSFTLSALVSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQT-ITVLALNNGA  67

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+   P  V+K  +S+ V+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+
Sbjct  68   MTALAAKHPLSVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNI  127

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++S+L+IS  II
Sbjct  128  TDLQGGKVGFGSAAPGSKLDSSYTKSVKQVPYNISILEISQPII  171



>ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
 gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
Length=405

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F   LLFS + A +IT +L + P FSTF  YL+ THLADEIN RQ   T+L VDN  
Sbjct  12   VLIFQFHLLFSLSNAHNITKILAKDPDFSTFNHYLTATHLADEINRRQT-ITVLAVDNSA  70

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G S   ++ ++S+HV+++YF A+KLH +        ++FQ++G A    G++N
Sbjct  71   MNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGTTSTASMFQSTGSATGTSGYVN  130

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  131  ITDIKGGKVAFGVQDDDSKLTAQYVKSIFEKAYNISVLHISQVL  174



>ref|XP_009379279.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Pyrus x 
bretschneideri]
Length=425

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 92/148 (62%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L  +P +S + SYL+QT LADEIN  Q   T+LV++N  I  L+   P  V+K  
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQT-ITVLVLNNAAISALAAKHPLAVIKNA  83

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+HV+L+Y+DA KLH +     L TTL+Q +G A  N GF+N+T+     V F S A G
Sbjct  84   LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVL+IS  +I
Sbjct  144  SKLDSSYTKSVKQIPYNISVLEISAPVI  171



>gb|AGV54413.1| fasciclin-like arabinogalactan protein 1-like protein [Phaseolus 
vulgaris]
Length=420

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT +L Q+P FSTF  YL+ THLA EIN R    T+  VDN  +  L    P +  +
Sbjct  26   AHNITRILAQHPEFSTFNHYLTLTHLAPEINGRTT-ITVCAVDNAAMDELLSKHPSIYTI  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH +     LA T++QA+G A  + GF+N+T+     V F ++
Sbjct  85   KNILSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAE  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 ++S  VK VE   Y++SV+QIS ++
Sbjct  145  NNDGTLTSTFVKSVEEMPYNISVIQISKIL  174



>ref|XP_009126981.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
Length=433

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F   L++THLADEIN R+   TI  V+N  +  L+  G +   L
Sbjct  27   AHNVTRLLANHPSFSSFNHLLTKTHLADEIN-RRTTITICAVNNAAMSALTSKGYTISTL  85

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH + G   LA TLFQA+  A    GF+N+T      V F  +
Sbjct  86   KNILSLHVLLDYFGAKKLHQIGGGSALAATLFQATRAAPGTTGFVNITMLRGGKVGF--R  143

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK +E   Y++SV+QIS ++
Sbjct  144  PDGGDMSSFFVKSIEEVPYNISVIQISRIL  173



>gb|EYU27439.1| hypothetical protein MIMGU_mgv1a007268mg [Erythranthe guttata]
Length=413

 Score =   111 bits (278),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPD  276
            A A +IT +L + P FSTF  YL+ T LA EIN R+   T+  VDN  +  L    +S  
Sbjct  28   AKAHNITHILEKNPEFSTFSHYLTVTQLAPEINRRET-ITVCAVDNAGMSDLLAKHLSIG  86

Query  277  VLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             ++ V+S+HV+L+YFDA+KLH +     LA T++QA+G+A  + GF+N+T+     V F 
Sbjct  87   GIRNVLSLHVLLDYFDAKKLHQITDGTALAATMYQATGEATGSAGFVNITDLKGGKVGFS  146

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +  G  VS+  VK VE   Y++SV+QIS+++
Sbjct  147  PQDSGGGVSATFVKTVEAIPYNISVIQISSIL  178



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   111 bits (278),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
            FSI    S+ ++ +IT +L   P +S+F +YL+QT LADEIN+R    T+LV++N  +  
Sbjct  17   FSILAFASTVSSHNITQILADSPDYSSFNNYLTQTKLADEINSRTT-ITVLVLNNGAMSS  75

Query  256  LSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
            L+G  P  V+K  +S+ V+L+Y+D  KLH L     L+TTL+Q +G A  N GF+N+T+ 
Sbjct  76   LAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDL  135

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S A G+ + S   K V+   Y++S+L+I   II
Sbjct  136  KGGKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPII  176



>ref|XP_007020499.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
 gb|EOY12024.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
Length=411

 Score =   111 bits (278),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            ++T +L ++PS STF  YL+ THLA EIN R+   T+L +DN  +  L   +P +  LK 
Sbjct  27   NVTRLLAKHPSLSTFNHYLTLTHLASEIN-RRTTITVLALDNAAMSSLLATNPSIYTLKN  85

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S+HV+L+YF  +KLH +     LA T+FQA+G A    GF+N+T+     V F ++  
Sbjct  86   ILSLHVLLDYFGTKKLHQIRNGTALAATMFQATGVAPGVAGFVNITDFKGGKVGFGAEDN  145

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
            G  + SF VK VE   Y++SV+QIS  +
Sbjct  146  GGKLDSFFVKSVEELPYNISVIQISKAL  173



>ref|XP_009787705.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=267

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 94/156 (60%), Gaps = 2/156 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            L  +SA+A +IT +L QY  +STF   LS++ LA EIN R    TIL V N  IG L+  
Sbjct  15   LAATSASAFNITKILSQYSDYSTFNELLSKSGLAAEINKRAT-ITILAVPNGAIGDLTSK  73

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVV  447
            S DVLK+ +S +VIL+Y+D  KL ++  +    T ++Q SG+A  +QGFLNVT      V
Sbjct  74   SDDVLKRELSTYVILDYYDIPKLRSMKEKTAKMTNMYQQSGKAAYDQGFLNVTAKDGSFV  133

Query  448  QFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             F S  KGA   S + K V  + Y++S+L IS  ++
Sbjct  134  -FGSAVKGAQRDSRLEKSVMNQPYNISILGISQPMV  168



>ref|XP_010088447.1| hypothetical protein L484_018219 [Morus notabilis]
 gb|EXB36062.1| hypothetical protein L484_018219 [Morus notabilis]
Length=417

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV-  279
            ++A +IT +L ++P FSTF  YL+ THLA EIN R+   T+L +DN  +  + G +P + 
Sbjct  22   SSAHNITKILAKHPEFSTFNHYLTLTHLAPEIN-RRTTITVLAIDNAAMSDILGKNPSIY  80

Query  280  -LKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFV  456
             +K ++S+HV+L+YF A+KLH +     L+ T+FQA+G A  + GF+N+T+     V F 
Sbjct  81   TVKNILSLHVLLDYFGAKKLHQITNGTALSATMFQATGSAPGSTGFVNITDQRGGKVGFA  140

Query  457  SKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +      SS  +K V+   Y++SV+QIS+ +
Sbjct  141  PEDNDGTFSSHFLKSVQEIPYNISVIQISHAL  172



>emb|CDX74743.1| BnaA05g04890D [Brassica napus]
Length=416

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  L+G  P  V+K  
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRST-ITLLVLNNGAMASLAGKHPLSVIKNA  85

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+ V+L+Y+D QKLH +     L TTL+Q +G A  N GF+N+T+     V F S A G
Sbjct  86   LSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVL+I   II
Sbjct  146  SKLDSSYTKSVKQIPYNISVLEIDAPII  173



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 99/163 (61%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + FSI    S+ ++ +IT +L   P +S+F SYL+QT LADEIN+R    T+LV++N  +
Sbjct  15   VTFSILAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTT-ITVLVLNNGAM  73

Query  250  GPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
              L+G  P  V+K  +S+ V+L+Y+D  KLH L     L+TTL+Q +G A  N GF+N+T
Sbjct  74   SSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNIT  133

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            +     V F S   G+ + S   K V+   Y++S+L+I   II
Sbjct  134  DLKGGKVGFGSAVSGSKLDSSYTKSVKQIPYNISILEIDAPII  176



>ref|XP_009143146.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=416

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L   P +S+F SYLSQT LADEIN+R    T+LV++N  +  L+G  P  V+K  
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRST-ITLLVLNNGAMASLAGKHPLSVIKNA  85

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+ V+L+Y+D QKLH +     L TTL+Q +G A  N GF+N+T+     V F S A G
Sbjct  86   LSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVL+I   II
Sbjct  146  SKLDSSYTKSVKQIPYNISVLEIDAPII  173



>ref|XP_008343059.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Malus domestica]
Length=425

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 91/148 (61%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L  +P +S + SYL+QT LADEIN  Q   T+LV +N  I  L+   P  V+K  
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQT-ITVLVFNNAAISALAAKHPLSVIKNA  83

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+HV+L+Y+DA KLH +     L TTL+Q +G A  N GF+N+T+     V F S A G
Sbjct  84   LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + S   K V+   Y++SVL+IS  +I
Sbjct  144  SKLDSSYTKSVKQIPYNISVLEISAPVI  171



>ref|XP_006603146.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Glycine max]
Length=309

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT +L ++P FSTF  YL+ THLA EIN +    T+  VDN  +  L    P +  +
Sbjct  21   AHNITTILSKHPEFSTFNHYLTLTHLAPEINGK-TTITVCAVDNAAMSDLLSKHPSIYTI  79

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH +     LA T++QA+G A  + GF+N+T+     V F ++
Sbjct  80   KNILSLHVLLDYFGAKKLHQITNGTALAATMYQATGSAPGSAGFVNITDLHGGKVGFGAE  139

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 +SS  VK VE   Y++SV+QIS V+
Sbjct  140  NNDGTLSSTFVKSVEEIPYNISVIQISKVL  169



>ref|XP_011082039.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 3 [Sesamum indicum]
Length=266

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 100/166 (60%), Gaps = 10/166 (6%)
 Frame = +1

Query  67   IIFFSITLLFSSA---TAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVD  237
            +I  +  LL SSA   +A +IT +L QYP FS F   LS+T        R+   T+L + 
Sbjct  6    MILIAAVLLISSAATTSAFNITRMLEQYPEFSEFNGLLSKTR-------RRRTVTVLALS  58

Query  238  NDNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFL  417
              ++G LS  + DV K+++S HV+L+Y+D  KL+ L     + TTL+QASG A D QGF+
Sbjct  59   AGHLGDLSSKTEDVQKRILSNHVVLDYYDTTKLNKLKNGKAVLTTLYQASGTADDQQGFI  118

Query  418  NVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            NVT++ +  + F S  KG+ ++S +   V  + Y++SVL IS+ II
Sbjct  119  NVTHNTEGHIIFGSAEKGSQMNSQLEGAVVAQPYNISVLSISSPII  164



>ref|XP_009418107.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = +1

Query  94   FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGM  267
            F  A   +IT +L Q+P FSTF  YLS THLA+EIN R+   T+L VDN  +  L    +
Sbjct  105  FPVARGHNITKILAQHPEFSTFNHYLSATHLANEIN-RRLTITVLAVDNAGMSDLLAKHL  163

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVV  447
            S   L+ V+S+H++ +Y+ ++KLH L     +++++FQ+SG A    G++N+T+  +  V
Sbjct  164  SLLTLRNVLSLHILSDYYSSRKLHQLSRGSTISSSVFQSSGHAPGTTGYINITDHRRGKV  223

Query  448  QFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             F+++  G A  + +VK ++   Y++S+LQIS ++
Sbjct  224  TFITEDAGGAPPAVLVKSLKEIPYNISILQISTIL  258



>ref|XP_008809683.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=410

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVLKK  288
            +IT +L  +P FSTF +YL+ THLA EIN R+   T+L V N  + PL    ++   LK 
Sbjct  27   NITEILADHPEFSTFNNYLTATHLAGEIN-RRKTITVLAVSNAGMAPLLAKHLTVSALKN  85

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+++YF A+ LH L G    +++LFQA+G A    GF+N+TN     V F ++  
Sbjct  86   VLSLHVLVDYFGAKNLHQLNGGTAASSSLFQATGTAPGTTGFVNITNHRAGRVSFSAEDV  145

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
              +     VK +E  +YDL+V++IS+V+
Sbjct  146  ADSAPVNFVKSIEEISYDLAVIEISSVL  173



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 94/153 (61%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            + +A +IT +L +YP FSTF  YL++THLA EIN+R+   T+  VDN  +  L    +S 
Sbjct  24   TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRET-ITVCAVDNAGMAELLSKHLSI  82

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V F
Sbjct  83   YTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGF  142

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                    + +  VK VE   Y++SV+QIS ++
Sbjct  143  GPAENHGTLPATFVKSVEEIPYNISVIQISTML  175



>ref|XP_008780048.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Phoenix 
dactylifera]
Length=419

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + F+  +   +    +ITA+L  +P +S + SYLSQT + DEIN+R+   T LV+ N  +
Sbjct  8    LLFAFMVSLVAGEGHNITAILDGFPEYSLYNSYLSQTKVCDEINSRET-VTCLVLPNAAM  66

Query  250  GPLSG-MSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
              L+   S   +K  + +  +L+YFD QKLH+LP    L TTL+Q +G A+ N GF+N+T
Sbjct  67   SALAAKQSLAGIKNALRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGNALGNSGFVNIT  126

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            N     V F + A G+ + S   K V    Y+LSVL+IS  I+
Sbjct  127  NLRGGRVAFAAAAPGSKLDSSYTKSVREVPYNLSVLEISAPIV  169



>ref|XP_002316776.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
 gb|EEE97388.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
Length=408

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            +IT +LG++PSFSTF  YL+ THLA EIN+R    T+  VDN  +  L    P +  +K 
Sbjct  25   NITHILGKHPSFSTFNHYLTLTHLAGEINSRNT-ITVCAVDNAAMSELLSKHPSIATIKN  83

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S+HV+L+YF  +KLH +     LA T+FQA+G A  + GF+N+T+     V F  +  
Sbjct  84   ILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPEDN  143

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
               +  F VK +E   Y++SV+QIS V+
Sbjct  144  EGNLDVFYVKSLEEIPYNISVIQISKVL  171



>ref|XP_002882785.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59044.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 102/161 (63%), Gaps = 1/161 (1%)
 Frame = +1

Query  73   FFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIG  252
            FF+ T L+SS+ + +IT +L ++  FSTF   LS+T LA  IN RQ   T+LVV N  + 
Sbjct  10   FFASTFLYSSSNSFNITNILNEHDDFSTFNQLLSETQLASTINKRQT-ITVLVVSNGALS  68

Query  253  PLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNS  432
             +SG    V+KK++S+H++L+Y+D +KL NL  +  L TTLFQ+SG A   QGFLN T +
Sbjct  69   SISGQPTAVIKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGLARGQQGFLNATVT  128

Query  433  GKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                V F S   G+++ + +   V +  +++SVL IS+ I+
Sbjct  129  KDGDVAFGSAVPGSSLDAQLQDTVASLPFNISVLHISSAIM  169



>ref|XP_011010616.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=407

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            +IT +LG++PSFSTF  YL+ THLA EIN++    T+  VDN  +  L    P +  +K 
Sbjct  25   NITRILGKHPSFSTFNHYLTLTHLAGEINSKTT-ITVCAVDNAAMSELLSKHPSIATIKN  83

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            ++S+HV+L+YF  +KLH +     LA T+FQA+G A  + GF+N+T+     V F  K  
Sbjct  84   ILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSAGFVNITDVKGGKVAFGPKDN  143

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
               +  F VK +E   Y++SV+QIS V+
Sbjct  144  EGNLDVFYVKSLEEIPYNISVIQISKVL  171



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 101/161 (63%), Gaps = 4/161 (2%)
 Frame = +1

Query  76   FSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGP  255
             ++ LL S   A +IT +L ++P FSTF  +L+ THLA++IN R+   T+  VDN  +  
Sbjct  18   LALILLPSPTEAHNITKILAEFPEFSTFNHFLTTTHLANDINNRET-ITVCAVDNAGMAD  76

Query  256  LSG--MSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
            L G  +S   LK V+S+HV+L+YF A+KLH++     LA T++QA+G A  + GF+N+T+
Sbjct  77   LLGKHLSIFALKNVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNITD  136

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 V F +   G   ++F VK V+   Y++SV+QIS ++
Sbjct  137  LKGGKVGFGAVDNGGIDATF-VKSVKEIPYNISVIQISKIL  176



>ref|XP_009616556.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
tomentosiformis]
Length=389

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L ++  FSTF  YL+ THLA EIN RQ   T+  VDN  +  L    +S   L
Sbjct  26   AHNITQILAKHREFSTFNRYLTLTHLASEINRRQT-ITVCAVDNAAMDDLLDKHLSIYTL  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+HV  +YF ++KLH +     L  TLFQA+G+A    G++N+TN+  + V F ++
Sbjct  85   KNVLSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTTGYINITNTKGKKVGFTTE  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                  S+  VK V+   Y++SV+QISN+I
Sbjct  145  DNNGHFSASFVKSVQEIPYNISVIQISNII  174



>emb|CDP12467.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 98/165 (59%), Gaps = 5/165 (3%)
 Frame = +1

Query  67   IIFFSITLLFSSAT--AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            +IF S  LL SS T  A +ITA+LG  PSFS F   LS+  L   IN+ Q P TIL + N
Sbjct  10   LIFLSCLLLASSVTTAAFNITAILGDIPSFSNFNDLLSKAGLVKAINS-QSPVTILAIPN  68

Query  241  DNIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            ++IG L+G   DV+K  +  HV+L+Y+D  KL N    G   TTLFQ +G A  +QGFL 
Sbjct  69   EHIGDLAGKPADVIKITLMTHVVLDYYDLLKLANA-KNGTRMTTLFQKTGVATYDQGFLI  127

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            +  S  Q++ F S AKGA  +  +V  V    ++ S++ +S+ I+
Sbjct  128  LNRSHGQLI-FSSAAKGAPHNVQVVATVTQHPFNYSIISVSSAIM  171



>ref|XP_008777689.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=272

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 1/149 (1%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKK  288
            A +IT +L  Y SFS F +YL+QT LADEIN R    T+LVVDN  +  +     ++LK 
Sbjct  22   AYNITQILEPYSSFSIFNNYLTQTKLADEIN-RHQTITVLVVDNSKMSVIFSYLNEILKH  80

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
             M++HVIL+Y+D  KL ++  +  L TTLF  SG A +  G LNVTN    +V F S   
Sbjct  81   TMAIHVILDYYDINKLSHILHKSTLLTTLFLTSGIANNKLGILNVTNMPNDIVIFGSATP  140

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVII  555
             A +SS  +K V T+ Y++SVLQ+SN+II
Sbjct  141  EATLSSTFIKVVITKPYNISVLQMSNLII  169



>ref|XP_009792211.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
sylvestris]
Length=414

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L ++  FSTF  YL+ THLA EIN RQ   T+  VDN  +  L    +S   L
Sbjct  48   AHNITQILAKHHEFSTFNRYLTLTHLASEINRRQT-ITVCAVDNAAMDDLLDKHLSIYTL  106

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+HV  +YF ++KLH +     L  TLFQA+G+A    G++N+TN+  + V F ++
Sbjct  107  KNVLSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTSGYINITNTKGKNVGFTTE  166

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                  S+  VK V+   Y++SV+QISN+I
Sbjct  167  ENDGHFSASFVKSVQEIPYNISVIQISNII  196



>ref|XP_010061458.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW68396.1| hypothetical protein EUGRSUZ_F02049 [Eucalyptus grandis]
Length=416

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 94/151 (62%), Gaps = 4/151 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT++L  +P FSTF  YLS THLA EIN+R    T+L V N  +  L    P    L
Sbjct  28   AHNITSLLAGHPDFSTFNHYLSATHLAAEINSRTT-ITVLAVSNAAMNDLLAEHPTTTTL  86

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF ++KLH L     LA TLFQ++G A  + GF+N+T+     V F  +
Sbjct  87   KNILSLHVLLDYFGSKKLHQLTDGSALAATLFQSTGSAPGSSGFVNITDLKGGKVGFAPE  146

Query  463  AKGAA-VSSFMVKPVETRAYDLSVLQISNVI  552
              G++   ++ VK +E  AY++SV++IS V+
Sbjct  147  EGGSSDAGAYFVKSLEELAYNISVIEISKVL  177



>gb|AEI98736.1| fasciclin-like arabinogalactan 2 [Pisum sativum]
Length=433

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L  +P FSTF  YLS THLA+EIN RQ   T+L +DN  +  L    +S   +
Sbjct  24   AHNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQT-ITVLALDNAAMSSLLDKHLSLPTI  82

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+H++++YF A+KLH +     L +++FQA+G A    G++N+TN     V F ++
Sbjct  83   KNVLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAE  142

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                ++ SF VK V+   Y +SVLQIS  I
Sbjct  143  DNDGSLHSFYVKSVQEMPYYISVLQISAAI  172



>ref|XP_008229928.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Prunus mume]
Length=394

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            ++ A +IT +L ++P  S+F  YL+ THLA EIN RQ   T+L +DN  +  L   G+  
Sbjct  24   TSQAHNITRILAKHPELSSFNHYLTLTHLATEINRRQT-ITVLAIDNAAMSSLLSKGLPV  82

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+++YF A+KLH +     LA+++FQA+G A    G++N+TN     V F
Sbjct  83   YTIKNVLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGF  142

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             ++     ++SF VK V+   Y++SVLQIS V+
Sbjct  143  GAQDNDGKLNSFYVKSVQEIPYNISVLQISQVL  175



>emb|CDY08417.1| BnaA05g26530D [Brassica napus]
Length=251

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 93/153 (61%), Gaps = 1/153 (1%)
 Frame = +1

Query  94   FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP  273
            ++S  + +IT +L Q   FSTF + L+QT+LA  IN+RQ   T+L + ND +   S  S 
Sbjct  20   YTSTNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQT-ITVLALSNDAVSHFSDQSA  78

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
            +  KKV+S+ +IL+Y+D +KL +L  +  + TTLFQASGQA   QGF+N T      V F
Sbjct  79   EDNKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNATVMDNGDVMF  138

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             S   G+ + S ++  V T  Y++SVL I + I
Sbjct  139  GSAVPGSILDSKLIDSVATHPYNISVLHIDSSI  171



>ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Elaeis guineensis]
Length=399

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--LKK  288
            +IT +L ++P FSTF  YL+ THLA EIN R+   T+L V N  + PL     +V  LK 
Sbjct  27   NITEILAEHPEFSTFNHYLTATHLAGEIN-RRKTITVLAVSNAGMAPLLAKHLNVYALKN  85

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
             +S+HV+++YF AQKLH L G    +++LFQA+G A    GF+N+TN     V F   A 
Sbjct  86   ALSLHVLVDYFGAQKLHQLNGGTAASSSLFQATGAAPGTTGFVNITNHRAGRVSF---AA  142

Query  469  GAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +A ++F VK ++  +YDL+++QIS+ +
Sbjct  143  DSAPANF-VKSIKEISYDLAIIQISSAL  169



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 101/162 (62%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +F S +++ ++ +A +IT +L  +P +S F  YL+QT LADEIN+R+   T+L ++N  I
Sbjct  8    LFLSFSVISTTISAHNITDILSGFPDYSEFNKYLTQTKLADEINSRET-ITVLALNNGAI  66

Query  250  GPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTN  429
              ++     V+K ++S+ V+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T+
Sbjct  67   SSIAKHPLPVIKNILSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNITD  126

Query  430  SGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
                 V F S A G+ + S   K V+   Y++SVL++S  II
Sbjct  127  LQGGKVGFGSAAPGSKLESSYTKSVKQVPYNISVLEVSAPII  168



>ref|XP_009120095.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
 emb|CDY17354.1| BnaA10g09880D [Brassica napus]
Length=426

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 5/150 (3%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLS--GMSPDVL  282
            A ++T +L  +PSFS+F  +L+QTHLA EIN R+   T+L VDN  +  L+  G     +
Sbjct  27   AHNVTRLLASHPSFSSFNHFLTQTHLAGEIN-RRTTITVLAVDNAAMSALTSKGYPISTV  85

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+K+H +     LA TLFQA+G A    GF+N+T+     V     
Sbjct  86   KNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGL--G  143

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
              G  +SSF VK VE   Y++S++QIS V+
Sbjct  144  PDGGDLSSFFVKSVEEVPYNISIIQISKVL  173



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 94/148 (64%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L + P +S+F SYLSQT L DEIN+R    TILV++ND +  L+G  P  V+K  
Sbjct  27   NITQILSESPEYSSFNSYLSQTKLNDEINSRTT-ITILVLNNDVMSSLAGKHPLSVVKTA  85

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+ V+L+Y+D  KLH +     L TTL+Q +G+A  N GF+NVT+     V F S A G
Sbjct  86   LSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + + +   K V+   Y++SVL+I+  II
Sbjct  146  SKLGANYTKSVKQIPYNISVLEINAPII  173



>ref|XP_003545484.2| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=443

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L  +P FSTF  YLS THLA+EIN RQ   T+L +DN  +  L    +S   +
Sbjct  60   AHNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQT-ITVLALDNAAMSSLLDKHLSLPTI  118

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+H++++YF A+KLH +     L +++FQA+G A    G++N+TN     V F ++
Sbjct  119  KNVLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAE  178

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                ++ SF VK V+   Y +SVLQIS  I
Sbjct  179  DNDGSLHSFYVKSVKEMPYYISVLQISAAI  208



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 96/159 (60%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL-  258
            I  LF+ + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  +  + 
Sbjct  14   IMQLFTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQT-ITVLAVDNSAMNSIL  72

Query  259  -SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G S   ++ ++S+HV+++YF A+KLH +        ++FQ++G A    G++N+T+  
Sbjct  73   SKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIK  132

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  133  GGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVL  171



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L ++P FSTF  YL+ THLA EIN R+   T+  VDN  +  L    +S   +
Sbjct  26   AHNITRILAKHPEFSTFNHYLTVTHLAAEINRRET-ITVCAVDNAGMSELLSKHLSIYAI  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+H++L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V F ++
Sbjct  85   KNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGAE  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            A    + S  VK ++   Y++S++QIS ++
Sbjct  145  ANDGKIDSTFVKSIQEIPYNISIIQISKIL  174



>ref|XP_003526450.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=239

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +1

Query  67   IIFFSITLLF-SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++  ++ L F SS   +DIT +LG+YP ++ F  YL++T LAD+IN+R    T+L +D+ 
Sbjct  8    LLSVALVLAFCSSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNA-VTVLALDDA  66

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             +  LSG S D +K ++S HV++N++D +KL    G      TLFQ+SG A  NQG++ V
Sbjct  67   AMASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIYV  126

Query  424  T--NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
               N G+      + A  A     +V+ V ++   +SVLQ+S  I+
Sbjct  127  ALINEGEIAFGSAAAAPNAPFEVVLVRSVTSQPDTVSVLQVSKPIV  172



>ref|XP_004491619.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cicer 
arietinum]
Length=413

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVLKK  288
            +IT +L ++P FSTF  YL+ THLADEIN RQ   TIL +DN  +  L    +S   LK 
Sbjct  33   NITRILAKHPDFSTFNHYLTVTHLADEINRRQT-ITILAIDNAAMSSLLDKHLSVSTLKN  91

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            V+S+HV+++YF A+KLH +     L +++FQA+G A    G++NVTN     V F ++  
Sbjct  92   VLSLHVLVDYFGAKKLHQITNGTTLVSSMFQATGSAAGTAGYVNVTNLKGGKVGFAAE-D  150

Query  469  GAAVSSFMVKPVETRAYDLSVLQIS  543
               + SF VK V+   Y +SVLQIS
Sbjct  151  NDGLHSFYVKSVQEIPYVISVLQIS  175



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 96/159 (60%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL-  258
            I  LF+ + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  +  + 
Sbjct  14   IMQLFTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQT-ITVLAVDNSAMNSIL  72

Query  259  -SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G S   ++ ++S+HV+++YF A+KLH +        ++FQ++G A    G++N+T+  
Sbjct  73   SKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIK  132

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  133  GGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVL  171



>ref|XP_010557720.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
 ref|XP_010557721.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=409

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 94/150 (63%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVL  282
            A +IT +L + PSFSTF  YLS THLAD+IN RQ   T+L VDN  +  +   G S   +
Sbjct  26   AHNITRILAKDPSFSTFNHYLSATHLADDINRRQT-ITVLAVDNAGMSSILSKGYSLYTI  84

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            + ++S+HV+++YF A+KLH +       +T+FQA+G A    G++N+T+     V F  +
Sbjct  85   RNILSLHVLVDYFGAKKLHQITDGTTSTSTMFQATGSATGTSGYVNITDLKGGKVAFGVQ  144

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               + +++  +K V  +AY++SVLQIS V+
Sbjct  145  DDDSKLTAHYIKSVFEKAYNISVLQISQVL  174



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 101/168 (60%), Gaps = 2/168 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            +F + + L ++ TA +IT +L  +P +S F  YL+QT LADEIN+R+   T+L + N  +
Sbjct  10   LFLAFSALSTTITAHNITDILSGFPDYSEFNKYLTQTKLADEINSRET-ITVLALSNGAM  68

Query  250  GPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
              L+   P  V+K  +S+ V+L+Y+D  KLH +     L+TTL+Q +G A  N GF+N+T
Sbjct  69   SALASKHPLSVIKNALSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPGNLGFVNIT  128

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
            +     V F S A G+ + S   K V+   Y++SV+++S  I+   +F
Sbjct  129  DLQGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVIEVSAPIVAPGIF  176



>ref|XP_006298989.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
 gb|EOA31887.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
Length=252

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 99/154 (64%), Gaps = 1/154 (1%)
 Frame = +1

Query  94   FSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP  273
            ++S+ + +IT +L ++  FSTF + LS+T LA  IN RQ   T+LVV N  +  LSG   
Sbjct  19   YTSSNSFNITNILNEHDDFSTFNNLLSETQLASTINKRQT-ITVLVVSNGALSSLSGQPT  77

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
            DV+KK++S+H++L+Y+D +KL NL  +  L TTLFQ+SGQA   QGFLN T      V F
Sbjct  78   DVIKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGQAKGQQGFLNATVMTNGDVAF  137

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
             S   G+  +S ++  V +  +++SVL IS+ I+
Sbjct  138  GSAVPGSDRNSQLLDSVASLPFNISVLHISSAIM  171



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 96/159 (60%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL-  258
            I  LF+ + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  +  + 
Sbjct  14   IMQLFTLSNAHNITKILAKDPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSAMNSIL  72

Query  259  -SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G S   ++ ++S+HV+++YF A+KLH +        ++FQ++G A    G++N+T+  
Sbjct  73   SKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIK  132

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  133  GGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVL  171



>ref|XP_009781936.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=273

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 2/152 (1%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGM  267
            LL SSA+A +IT +L Q+  +STF   LS++ LA EIN R    TIL V N  IG L+  
Sbjct  14   LLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRTT-ITILAVPNGAIGDLTSK  72

Query  268  SPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVV  447
            S DVL  V+S +V+L+Y+D  KL +L  +    TT++Q SG+A  +QGFLN+T      V
Sbjct  73   SDDVLNSVLSTYVVLDYYDIPKLKSLKDKTAKMTTMYQQSGKARFDQGFLNMTAKDGSFV  132

Query  448  QFVSKAKGAAVSSFMVKPVETRAYDLSVLQIS  543
             F S  K A   S + K V  + Y++SVL IS
Sbjct  133  -FGSAVKDAQRDSRLEKSVMNQPYNISVLGIS  163



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMS  270
            ++  A +IT +L +YP FSTF  YL++THLA EIN R+   T+  VDN  +  L    +S
Sbjct  23   NTTEAHNITKILAKYPQFSTFNHYLTETHLAAEINNRET-ITVCAVDNAGMAELLSKHLS  81

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
               +K V+S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  82   IYTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVA  141

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F        + +  VK VE   Y++SV+QIS ++
Sbjct  142  FGPAENHGNLPATFVKAVEEIPYNISVIQISTML  175



>ref|XP_008380005.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=448

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 96/153 (63%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            ++ A +IT +L ++PS +TF  YLS THLA EIN RQ   T+L +DN  +  L   G+  
Sbjct  83   TSQAHNITRILDKHPSLTTFNHYLSLTHLATEINRRQT-ITVLALDNAAMSSLISKGLPI  141

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              +K V+S+HV+++YF ++KLH +     LA+++FQA+G A    G++N+TN     V F
Sbjct  142  YTIKNVLSLHVLVDYFGSKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGF  201

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             ++     ++SF VK V    Y++SVLQIS V+
Sbjct  202  GAEDNDGKLNSFYVKSVLEMPYNISVLQISQVL  234



>ref|XP_004251538.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum 
lycopersicum]
Length=387

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = +1

Query  73   FFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIG  252
            F +IT   ++++A +IT +L ++P FSTF  YL+ THLA EIN RQ   T+  V+N  + 
Sbjct  13   FVAIT---TTSSAHNITLILTKHPEFSTFNRYLTLTHLASEINRRQT-ITVCAVNNAAMD  68

Query  253  PL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
             L    +S   LK V+S+HV  +YF +++LH +     L  TLFQA+G+A    G++N+T
Sbjct  69   DLLDKHLSIYTLKNVLSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNIT  128

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            N   + V F ++      SS  VK ++   Y++SV+Q+SN+I
Sbjct  129  NMKGKKVGFATEDNDGHFSSNFVKSIQEIPYNISVIQLSNII  170



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   SSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMS  270
            ++  A +IT +L +YP FSTF  YL++THLA EIN R+   T+  VDN  +  L    +S
Sbjct  23   NATEAHNITKILAKYPQFSTFNHYLTETHLAAEINNRET-ITVCAVDNAGMAELLSKHLS  81

Query  271  PDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQ  450
               +K V+S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V 
Sbjct  82   IYTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVG  141

Query  451  FVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            F        + +  VK VE   Y++SV+QIS ++
Sbjct  142  FGPAENHGNLPATFVKAVEEIPYNISVIQISTML  175



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 95/151 (63%), Gaps = 1/151 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            ++A +IT +L  +P +S + SYL+QT L DEIN RQ   T+ V++N  +  L+     V+
Sbjct  22   SSAHNITEMLSAFPDYSLYNSYLTQTKLCDEINTRQT-LTVFVLNNAAMSALAKHPLSVV  80

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+ ++L+YFD QKLH++     L+TTL+Q +G A  N GF+N+T+     V F S 
Sbjct  81   KNVLSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGSA  140

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            A G+ + S   K V+   Y++SV++IS  II
Sbjct  141  APGSPLDSTYTKSVKQVPYNISVMEISAPII  171



>ref|XP_010942271.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=410

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 101/166 (61%), Gaps = 6/166 (4%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++  S+    ++    +IT +L  +P FSTF  YLS T LA EIN R+   T+L VDN  
Sbjct  16   VLAGSVPATLAATHTYNITKILADHPEFSTFNHYLSATRLAGEINRRRT-ITVLAVDNSA  74

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            + PL    ++ + L+ V+ +H++ +Y+ A+KLH L G   +A+++FQA+G A    G++N
Sbjct  75   MAPLLAKHLTLESLRNVLRLHILADYYGAKKLHQLTGGSAVASSMFQATGDAPGTSGYVN  134

Query  421  VTNSGKQVVQFVSKAKG--AAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F+++  G   A +SF VK V+   YDLSV++I+ V+
Sbjct  135  ITDHRAGKVTFIAQDAGDSTAPASF-VKSVKEMPYDLSVIEINAVL  179



>ref|XP_010919185.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=429

 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   IFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNI  249
            + F+  +  ++    +ITA+L  +P +S + SYLSQT + DEIN+R+   T LV+ N  +
Sbjct  8    LLFAFMVSLAAGDGHNITAILDGFPEYSLYNSYLSQTKVCDEINSRET-VTCLVLPNAAM  66

Query  250  GPLSG-MSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
              L+   S   +K  + +  +L+YFD QKLH+LP    L TTL+Q +G A  N GF+N+T
Sbjct  67   SALAAKQSLAGIKNALRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGDATGNSGFVNIT  126

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            N     V F +   G+   S   K V    Y+LSVL+IS  I+
Sbjct  127  NLRGGRVAFAAATPGSKFDSSYTKSVRQVPYNLSVLEISAPIV  169



>ref|XP_003532178.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Glycine 
max]
Length=415

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 91/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A +IT++L ++P  STF  YL+ THLA EIN +    T+  VDN  +  L    P +  +
Sbjct  21   AHNITSILAKHPELSTFNHYLTLTHLAPEINGKTT-ITVCAVDNAAMSDLLSKHPSIYTV  79

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K V+S+HV+L+YF A+KLH +     LA T++QA+G A  + GF+N+T+     V F  +
Sbjct  80   KNVLSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVAFAPE  139

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 +SS  VK VE   Y++SV+QIS V+
Sbjct  140  NNDGTLSSTFVKSVEEIPYNISVIQISKVL  169



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 4/157 (3%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--S  261
            L+ S+ATA +IT +L ++P FSTF  YL+ THLA EIN R+   T+ VVDN  +  L   
Sbjct  21   LVISTATAHNITKLLEKHPEFSTFNHYLTTTHLAPEIN-RRTTITVCVVDNSAMSDLLAK  79

Query  262  GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
             +S   +K  +S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+    
Sbjct  80   QLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGG  139

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             V F        + +  VK VE   Y++S++QIS ++
Sbjct  140  KVGF-GLQDSDDIDAMFVKSVEEVPYNISIIQISKIL  175



>gb|KDP39270.1| hypothetical protein JCGZ_01027 [Jatropha curcas]
Length=404

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 91/150 (61%), Gaps = 3/150 (2%)
 Frame = +1

Query  109  AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV--L  282
            A ++T +L ++PS STF  YL+ THLA EIN R+   T+  VDN  +  L    P +  +
Sbjct  22   AHNVTRLLAKHPSLSTFNHYLTITHLAGEIN-RRTTITVCAVDNAAMSELLSKHPSIYTI  80

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            K ++S+HV+L+YF A+KLH +     LA T+FQA+G A  + GF+N+T+     V F  +
Sbjct  81   KNILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPE  140

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                 +  + VK VE   Y++S++QIS ++
Sbjct  141  DNDGKLGVYFVKSVEEVPYNISIIQISKIL  170



>ref|XP_008352034.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
 ref|XP_008361056.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=291

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVLKKVM  294
            +IT +L +   FS F S LS+T LA+EIN R+   TIL VDN  +G LSG S D+ KK++
Sbjct  25   NITKILEKQSDFSNFNSLLSETKLANEINKRKT-ITILAVDNGGVGGLSGQSSDLTKKIL  83

Query  295  SVHVILNYFDAQKLHNL--PGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAK  468
            SVHVIL+Y+D+ KL  L    +    TT+FQ++GQA   QGF+ V+      + F S  K
Sbjct  84   SVHVILDYYDSDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVSVKDNH-ISFASAYK  142

Query  469  GAAVSSF---MVKPVETRAYDLSVLQISNVI  552
            G         +VK V ++ Y++SVLQ+ ++I
Sbjct  143  GNNNGGNHVNLVKSVVSQPYNISVLQVGSII  173



>ref|XP_008797603.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=414

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSPDVLKK  288
            +IT +L ++P FSTF  YLS T LA EIN R+   T+L VDN  +  +    ++ + L+ 
Sbjct  32   NITKILAEHPEFSTFSHYLSVTRLAGEINRRRT-ITVLAVDNAGMASILAKHLTLESLRN  90

Query  289  VMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK-A  465
            V+ +H++ +YF A+KLH L G   LA+++FQA+G A    G++N+T+     V F+ K A
Sbjct  91   VLRLHILADYFGAKKLHQLTGGSALASSMFQATGDAPGTSGYVNITDHRAGKVTFIPKDA  150

Query  466  KGAAVSSFMVKPVETRAYDLSVLQISNVI  552
                V    VK V+   YDLSV+QIS V+
Sbjct  151  DDGTVPVAFVKSVKEMPYDLSVIQISAVL  179



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = +1

Query  82   ITLLFSSAT---AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIG  252
            I  +FSS+T   A +IT +L ++P FSTF  YL+ THLA EIN RQ   T+L +DN  + 
Sbjct  16   ILFIFSSSTTSNAHNITRILAKHPEFSTFNHYLTTTHLASEINRRQT-ITVLALDNAAMS  74

Query  253  PL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVT  426
             L    +S   +K V+S+HV+++YF ++KLH +     L +T+FQA+G A  + G++N+T
Sbjct  75   ALLDKQLSLYTVKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGAAPGSSGYINIT  134

Query  427  NSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +     V F ++     + +  VK V    Y++SVLQIS V+
Sbjct  135  DLKGGKVGFGAEDNNGKLDAVYVKSVAEIPYNISVLQISQVL  176



>ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++   + L  S + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  
Sbjct  12   VLISQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSA  70

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +   G S   ++ ++S+HV+++YF A+KLH +        ++FQ++G A    G++N
Sbjct  71   MSSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVN  130

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  131  ITDIKGGKVAFGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVL  174



>gb|KDP29933.1| hypothetical protein JCGZ_18502 [Jatropha curcas]
Length=408

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 93/153 (61%), Gaps = 3/153 (2%)
 Frame = +1

Query  100  SATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--SGMSP  273
            +  A +IT +L ++P+FSTF  YL+ THLA EIN RQ   T+L +DN  +  L    +S 
Sbjct  23   TCCAHNITRILAKHPAFSTFNHYLTVTHLAAEINRRQT-ITVLALDNAAMSSLLAKQLSV  81

Query  274  DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQF  453
              L+ V+S+HV+++YF A+KLH +     L +T+FQA+G A    G++N+T+     V F
Sbjct  82   YTLRNVLSLHVLVDYFGAKKLHQITDGTTLTSTMFQATGSATGTSGYVNITDLKGGKVAF  141

Query  454  VSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             S+     + +  VK +E   Y++SV+QIS  +
Sbjct  142  GSEDNNGKLDAVYVKSLEEIPYNISVMQISQAL  174



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 97/164 (59%), Gaps = 2/164 (1%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++F S+++    +TA +IT +L  +P +S    YL++T LADEIN R+   T LV+ N  
Sbjct  11   LLFLSLSIFVIPSTAHNITEILSGFPEYSAMNDYLTRTKLADEINTRET-ITCLVLPNSA  69

Query  247  IGPLSGMSP-DVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
            +  L+   P  V+K V+ + V+L+Y+D  KLH +     L TTL+Q +G A  N GF+N+
Sbjct  70   MSALAANKPLSVVKNVLRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNI  129

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T+     V F S A G+ + S   K V+   Y++SVL+IS  II
Sbjct  130  TDLKGGKVGFGSAAPGSKLDSTYTKSVKQIPYNISVLEISAPII  173



>ref|XP_009120424.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=264

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = +1

Query  103  ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDVL  282
            A A +IT +L     FS+F + LSQT LA  IN+RQ   T+L + ND +   S  S +  
Sbjct  23   ANAFNITRILNLNNEFSSFNNLLSQTGLASTINSRQT-ITVLALSNDAMSIFSDQSTEDN  81

Query  283  KKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSK  462
            KK +S+H++L+Y+D +KL +L  +  + TTLFQ+SGQA   QGF+N T      V F S 
Sbjct  82   KKSLSLHIVLDYYDIKKLKSLNKRSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSA  141

Query  463  AKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             +G+ + S ++  V T  Y++SVL IS+ I
Sbjct  142  VRGSLLDSKLIDSVATHPYNISVLHISSYI  171



>gb|KFK32403.1| hypothetical protein AALP_AA6G237100 [Arabis alpina]
Length=397

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 96/159 (60%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   ITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL-  258
            +T LFS + A +IT +L + P FSTF  YL+ THLADEIN RQ   T+L VDN  +  + 
Sbjct  13   LTFLFSLSNAHNITKILAKDPEFSTFNHYLTATHLADEINRRQT-ITVLAVDNSAMSSIL  71

Query  259  -SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSG  435
              G S   ++ ++S+HV+++YF  +KLH +        ++FQ++G A    G++N+T+  
Sbjct  72   SKGYSLYTIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIK  131

Query  436  KQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
               V F  +   + +++  VK +  +AY++SV+ IS V+
Sbjct  132  GGKVAFGVQDDDSELTARYVKSIFEKAYNISVVHISQVL  170



>ref|NP_001058255.1| Os06g0656800 [Oryza sativa Japonica Group]
 dbj|BAD37593.1| endosperm specific protein-like [Oryza sativa Japonica Group]
 dbj|BAF20169.1| Os06g0656800 [Oryza sativa Japonica Group]
Length=269

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV----L  282
            ++T +LG++P F  F   +S+TH+  +IN+R    T+LV DN  +  L   S  +    L
Sbjct  40   NVTEILGRFPEFGLFSYLISKTHVDRDINSRNT-VTVLVPDNSAVDWLLRRSARLPRAAL  98

Query  283  KKVMSVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
             +++SVHV+L+YFDA K+  LP G+  ++TTLFQ +G A    GFL +T + K    F S
Sbjct  99   VELLSVHVVLDYFDAAKIAALPPGKPTVSTTLFQTTGNARRRTGFLAITPTAKGGAVFAS  158

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPF  561
             A GA V++ + + V    Y++SVLQISN ++P 
Sbjct  159  AAPGALVNATLKRVVAAVPYNISVLQISNFVVPL  192



>gb|AFK41095.1| unknown [Lotus japonicus]
Length=423

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 92/148 (62%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSP-DVLKKV  291
            +IT +L   P +S++ S+LSQT LADEIN+RQ   T+LV+ N     ++   P  V+K V
Sbjct  25   NITEILAANPDYSSYNSFLSQTKLADEINSRQT-ITVLVIPNSAFSAITASHPLPVVKNV  83

Query  292  MSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVSKAKG  471
            +S+ ++L+YFD  KLH L     L+TTLFQ +G A  N G +N+T+     V F S A G
Sbjct  84   LSLLILLDYFDNTKLHQLTDGTTLSTTLFQTTGTATGNVGSVNITDLKGGKVAFGSAAPG  143

Query  472  AAVSSFMVKPVETRAYDLSVLQISNVII  555
            + ++S   K V+   Y++SVL+IS  II
Sbjct  144  SKLASTYTKSVKQIPYNISVLEISAPII  171



>ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
 gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
Length=402

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 95/157 (61%), Gaps = 3/157 (2%)
 Frame = +1

Query  88   LLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPL--S  261
            LL S + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  +  +   
Sbjct  19   LLSSLSNAHNITRILAKNPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSAMSSILSK  77

Query  262  GMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNVTNSGKQ  441
            G S   ++ ++S+HV+++Y+ A+KLH +        ++FQ++G A    G++N+T+    
Sbjct  78   GYSLYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGG  137

Query  442  VVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
             V F  +   + +++  VK +  +AY++SVL IS V+
Sbjct  138  KVAFGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVL  174



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = +1

Query  67   IIFFSITLLF-SSAT-AIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDN  240
            ++  S+ LLF S AT A +IT +L +YP FSTF  YL+ THLA EIN RQ   T+L V N
Sbjct  10   LLTLSVCLLFLSCATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQT-ITVLAVSN  68

Query  241  DNIGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGF  414
              +  L    +S  V+K V+S+HV+++YF A+KLH +      + TLFQ++G A    GF
Sbjct  69   AGMADLLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGF  128

Query  415  LNVTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +N+T+     V F ++  G  ++++ VK V    Y++SVL+IS ++
Sbjct  129  VNITDLKHGKVGFGAQDSG-HLNAYFVKSVVEIPYNISVLEISQIL  173



>gb|EAZ01938.1| hypothetical protein OsI_23966 [Oryza sativa Indica Group]
Length=289

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = +1

Query  115  DITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDNIGPLSGMSPDV----L  282
            ++T +LG++P F  F   +S+TH+  +IN+R    T+LV DN  +  L   S  +    L
Sbjct  40   NVTEILGRFPEFGLFSYLISKTHVDRDINSRNT-VTVLVPDNSAVDWLLRRSARLPRAAL  98

Query  283  KKVMSVHVILNYFDAQKLHNLP-GQGELATTLFQASGQAVDNQGFLNVTNSGKQVVQFVS  459
             +++SVHV+L+YFDA K+  LP G+  ++TTLFQ +G A    GFL +T + K    F S
Sbjct  99   VELLSVHVVLDYFDAAKIAALPPGKPTVSTTLFQTTGNARRRTGFLAITPTAKGGAVFAS  158

Query  460  KAKGAAVSSFMVKPVETRAYDLSVLQISNVIIPFSVF  570
             A GA V++ + + V    Y++SVLQISN ++P  V 
Sbjct  159  AAPGALVNATLKRVVAAVPYNISVLQISNFVVPPGVL  195



>ref|XP_002880584.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56843.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 95/164 (58%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSS-ATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDND  243
            ++  +I L  SS  +A++IT VL +YP FST    L++T L   IN RQ   T+L + ND
Sbjct  9    LVCLTILLGVSSIVSAVNITRVLEKYPEFSTMTELLAKTELTPIINKRQT-ITVLALSND  67

Query  244  NIGPLSGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLNV  423
             IG +SG   + LK ++  HVIL+YFD  KL  L  +  L TTL+Q++G      GFLN 
Sbjct  68   AIGSISGRPEEELKNILMNHVILDYFDELKLKALKERSTLLTTLYQSTGLGQQQNGFLNC  127

Query  424  TNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVII  555
            T S  ++  F S  KGA  ++  +  V    Y+LSV+QIS  I+
Sbjct  128  TKSNGKIY-FGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIV  170



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = +1

Query  67   IIFFSITLLFSSATAIDITAVLGQYPSFSTFRSYLSQTHLADEINARQPPYTILVVDNDN  246
            ++ F + L  S + A +IT +L + P FSTF  YLS THLADEIN RQ   T+L VDN  
Sbjct  12   VLIFQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT-ITVLAVDNSA  70

Query  247  IGPL--SGMSPDVLKKVMSVHVILNYFDAQKLHNLPGQGELATTLFQASGQAVDNQGFLN  420
            +  +  +G S   ++ ++S+HV+++YF  +KLH +        ++FQ++G A    G++N
Sbjct  71   MSSILSNGYSLYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYIN  130

Query  421  VTNSGKQVVQFVSKAKGAAVSSFMVKPVETRAYDLSVLQISNVI  552
            +T+     V F  +   + +++  VK V  + Y++SVL IS V+
Sbjct  131  ITDIKGGKVAFGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVL  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3380901351172