BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24640_g3_i1 len=1556 path=[598:0-196 795:197-209 808:210-539
1138:540-581 5653:582-687 1532:688-843 4600:844-868 1163:869-962
1257:963-988 4743:989-1127 4882:1128-1163 4917:1164-1196
1434:1197-1229 4981:1230-1232 56:1233-1307 6184:1308-1555]

Length=1556
                                                                      Score     E

ref|XP_009787886.1|  PREDICTED: probable glycosyltransferase At5g...    648   0.0      
ref|XP_006339262.1|  PREDICTED: probable glycosyltransferase At5g...    639   0.0      
ref|XP_004249828.2|  PREDICTED: probable glycosyltransferase At5g...    632   0.0      
ref|XP_009776098.1|  PREDICTED: probable glycosyltransferase At5g...    623   0.0      
ref|XP_011094445.1|  PREDICTED: probable glycosyltransferase At5g...    621   0.0      
ref|XP_011101497.1|  PREDICTED: probable glycosyltransferase At5g...    618   0.0      
gb|EYU41560.1|  hypothetical protein MIMGU_mgv1a005355mg                600   0.0      
ref|XP_009593674.1|  PREDICTED: probable glycosyltransferase At5g...    571   0.0      
ref|XP_009593673.1|  PREDICTED: probable glycosyltransferase At5g...    573   0.0      
ref|XP_009631064.1|  PREDICTED: probable glycosyltransferase At5g...    563   0.0      
ref|XP_009617933.1|  PREDICTED: probable glycosyltransferase At5g...    561   0.0      
ref|XP_009617934.1|  PREDICTED: probable glycosyltransferase At5g...    561   0.0      
ref|XP_004249790.2|  PREDICTED: probable glycosyltransferase At5g...    556   0.0      
ref|XP_009774930.1|  PREDICTED: probable glycosyltransferase At5g...    554   0.0      
ref|XP_009774931.1|  PREDICTED: probable glycosyltransferase At5g...    553   0.0      
ref|XP_006339310.1|  PREDICTED: probable glycosyltransferase At5g...    551   0.0      
ref|XP_006366795.1|  PREDICTED: probable glycosyltransferase At5g...    552   0.0      
ref|XP_009779883.1|  PREDICTED: probable glycosyltransferase At5g...    553   0.0      
ref|XP_004494122.1|  PREDICTED: probable glycosyltransferase At5g...    547   0.0      
ref|XP_004246587.1|  PREDICTED: probable glycosyltransferase At5g...    546   0.0      
ref|XP_010325948.1|  PREDICTED: probable glycosyltransferase At5g...    546   0.0      
ref|XP_002528630.1|  catalytic, putative                                547   0.0      Ricinus communis
gb|KEH24081.1|  glycosyltransferase                                     540   0.0      
ref|XP_002284018.2|  PREDICTED: probable glycosyltransferase At5g...    545   0.0      Vitis vinifera
gb|EYU41561.1|  hypothetical protein MIMGU_mgv1a004154mg                540   0.0      
ref|XP_003553575.1|  PREDICTED: probable glycosyltransferase At5g...    534   0.0      
ref|XP_010248410.1|  PREDICTED: probable glycosyltransferase At5g...    538   0.0      
gb|KDP29231.1|  hypothetical protein JCGZ_16620                         530   0.0      
gb|KHN02275.1|  Putative glycosyltransferase                            533   0.0      
ref|XP_010039041.1|  PREDICTED: probable glycosyltransferase At5g...    533   0.0      
ref|XP_010039055.1|  PREDICTED: probable glycosyltransferase At5g...    533   0.0      
ref|XP_010243080.1|  PREDICTED: probable glycosyltransferase At5g...    534   0.0      
ref|XP_010242926.1|  PREDICTED: probable glycosyltransferase At5g...    530   1e-180   
ref|XP_010683939.1|  PREDICTED: probable glycosyltransferase At5g...    530   2e-180   
ref|XP_011094446.1|  PREDICTED: probable glycosyltransferase At5g...    531   3e-180   
ref|XP_010243073.1|  PREDICTED: probable glycosyltransferase At5g...    532   5e-180   
gb|KEH24082.1|  glycosyltransferase                                     522   4e-179   
ref|XP_011101498.1|  PREDICTED: probable glycosyltransferase At5g...    525   5e-179   
ref|XP_004303053.1|  PREDICTED: probable glycosyltransferase At5g...    527   5e-179   
ref|XP_003542567.1|  PREDICTED: probable glycosyltransferase At5g...    525   1e-178   
emb|CDP15333.1|  unnamed protein product                                521   3e-178   
ref|XP_003521429.1|  PREDICTED: probable glycosyltransferase At5g...    524   4e-178   
gb|KHN18714.1|  Putative glycosyltransferase                            524   8e-178   
ref|XP_004497579.1|  PREDICTED: probable glycosyltransferase At5g...    523   9e-178   
gb|EYU38594.1|  hypothetical protein MIMGU_mgv1a021350mg                520   4e-177   
ref|XP_010098868.1|  putative glycosyltransferase                       519   4e-177   
ref|XP_007162830.1|  hypothetical protein PHAVU_001G184500g             521   5e-177   
ref|XP_003541440.1|  PREDICTED: probable glycosyltransferase At5g...    519   1e-176   
gb|AES60658.2|  exostosin family protein                                516   2e-175   
ref|XP_003590407.1|  hypothetical protein MTR_1g061760                  515   4e-175   
ref|XP_009375632.1|  PREDICTED: probable glycosyltransferase At5g...    516   5e-175   
ref|XP_010247793.1|  PREDICTED: probable glycosyltransferase At5g...    517   1e-174   
ref|XP_007202112.1|  hypothetical protein PRUPE_ppa006842mg             508   6e-174   
ref|XP_008359607.1|  PREDICTED: probable glycosyltransferase At5g...    512   3e-173   
ref|XP_008392545.1|  PREDICTED: probable glycosyltransferase At5g...    511   7e-173   
ref|XP_003537031.2|  PREDICTED: probable glycosyltransferase At5g...    509   9e-173   
gb|KHN24379.1|  Putative glycosyltransferase                            508   4e-172   
ref|XP_008241335.1|  PREDICTED: probable glycosyltransferase At5g...    508   2e-171   
ref|XP_003535253.1|  PREDICTED: probable glycosyltransferase At5g...    507   2e-171   
gb|KCW48746.1|  hypothetical protein EUGRSUZ_K02385                     500   2e-171   
ref|XP_009340969.1|  PREDICTED: probable glycosyltransferase At5g...    507   2e-171   
ref|XP_006381337.1|  hypothetical protein POPTR_0006s11930g             503   3e-170   
ref|XP_006481931.1|  PREDICTED: probable glycosyltransferase At5g...    505   3e-170   
ref|XP_011018855.1|  PREDICTED: probable glycosyltransferase At5g...    503   4e-170   
ref|XP_006430348.1|  hypothetical protein CICLE_v10011407mg             504   4e-170   
gb|KDO60990.1|  hypothetical protein CISIN_1g048582mg                   504   4e-170   
ref|XP_010039048.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    497   7e-170   
gb|EPS64188.1|  hypothetical protein M569_10593                         494   2e-168   
ref|XP_007027562.1|  Exostosin family protein                           499   7e-168   
gb|KHG20191.1|  hypothetical protein F383_08256                         498   4e-167   
gb|KHG04052.1|  hypothetical protein F383_28592                         496   7e-167   
ref|XP_009413449.1|  PREDICTED: probable glycosyltransferase At5g...    493   3e-166   
ref|XP_010543482.1|  PREDICTED: probable glycosyltransferase At5g...    492   5e-166   
gb|KCW48767.1|  hypothetical protein EUGRSUZ_K02411                     484   2e-165   
ref|XP_004156325.1|  PREDICTED: probable glycosyltransferase At5g...    489   1e-164   
ref|XP_009122667.1|  PREDICTED: probable glycosyltransferase At5g...    488   2e-164   
ref|XP_004143371.1|  PREDICTED: probable glycosyltransferase At5g...    488   4e-164   
emb|CDY42006.1|  BnaC04g00840D                                          485   2e-163   
ref|XP_008381668.1|  PREDICTED: probable glycosyltransferase At5g...    484   2e-162   
ref|XP_008462519.1|  PREDICTED: probable glycosyltransferase At5g...    483   2e-162   
ref|XP_006447859.1|  hypothetical protein CICLE_v10017948mg             483   4e-162   
ref|XP_006469477.1|  PREDICTED: probable glycosyltransferase At5g...    483   6e-162   
ref|XP_010252860.1|  PREDICTED: probable glycosyltransferase At3g...    481   1e-161   
emb|CBI30213.3|  unnamed protein product                                474   2e-161   
ref|XP_009622709.1|  PREDICTED: probable glycosyltransferase At5g...    478   3e-160   
ref|XP_002524591.1|  catalytic, putative                                477   6e-160   Ricinus communis
ref|XP_009782027.1|  PREDICTED: probable glycosyltransferase At5g...    477   6e-160   
gb|KEH35655.1|  exostosin family protein                                476   7e-160   
ref|XP_002320538.2|  hypothetical protein POPTR_0014s16920g             474   1e-159   Populus trichocarpa [western balsam poplar]
ref|XP_009782026.1|  PREDICTED: probable glycosyltransferase At5g...    476   2e-159   
ref|XP_009782025.1|  PREDICTED: probable glycosyltransferase At5g...    477   2e-159   
ref|XP_009782024.1|  PREDICTED: probable glycosyltransferase At5g...    477   3e-159   
ref|XP_007027565.1|  Exostosin family protein, putative                 476   6e-159   
ref|XP_006845223.1|  hypothetical protein AMTR_s00005p00255230          469   8e-159   
emb|CBI28483.3|  unnamed protein product                                470   9e-159   
gb|KHN45704.1|  Putative glycosyltransferase                            467   2e-158   
ref|XP_007049438.1|  Catalytic, putative                                473   4e-158   
ref|XP_007137813.1|  hypothetical protein PHAVU_009G157700g             471   1e-157   
ref|XP_011009812.1|  PREDICTED: probable glycosyltransferase At5g...    471   2e-157   
ref|XP_004292405.1|  PREDICTED: probable glycosyltransferase At5g...    471   2e-157   
ref|XP_002264076.2|  PREDICTED: probable glycosyltransferase At5g...    469   2e-157   Vitis vinifera
ref|XP_008237734.1|  PREDICTED: probable glycosyltransferase At5g...    465   1e-156   
ref|XP_011009813.1|  PREDICTED: probable glycosyltransferase At5g...    462   6e-156   
ref|XP_004503012.1|  PREDICTED: probable glycosyltransferase At5g...    464   2e-155   
ref|XP_008394205.1|  PREDICTED: probable glycosyltransferase At5g...    466   2e-155   
dbj|BAB08605.1|  unnamed protein product                                461   2e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354423.1|  PREDICTED: probable glycosyltransferase At5g...    464   8e-155   
ref|XP_009379540.1|  PREDICTED: probable glycosyltransferase At5g...    464   1e-154   
gb|KCW89058.1|  hypothetical protein EUGRSUZ_A01384                     465   2e-154   
ref|XP_010068733.1|  PREDICTED: probable glycosyltransferase At5g...    462   2e-154   
ref|XP_010490872.1|  PREDICTED: probable glycosyltransferase At5g...    463   2e-154   
ref|NP_001031828.1|  Exostosin family protein                           462   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320537.2|  hypothetical protein POPTR_0014s16900g             460   5e-154   Populus trichocarpa [western balsam poplar]
ref|XP_006398838.1|  hypothetical protein EUTSA_v10016080mg             462   5e-154   
gb|KFK24839.1|  hypothetical protein AALP_AA8G031400                    461   7e-154   
ref|XP_008794078.1|  PREDICTED: probable glycosyltransferase At5g...    462   8e-154   
ref|XP_004305861.1|  PREDICTED: probable glycosyltransferase At3g...    459   8e-154   
ref|XP_006287392.1|  hypothetical protein CARUB_v10000598mg             463   8e-154   
ref|XP_002873114.1|  hypothetical protein ARALYDRAFT_487158             461   1e-153   
ref|XP_008227726.1|  PREDICTED: probable glycosyltransferase At5g...    462   1e-153   
ref|XP_008459522.1|  PREDICTED: probable glycosyltransferase At5g...    461   1e-153   
ref|XP_010923285.1|  PREDICTED: probable glycosyltransferase At5g...    461   2e-153   
emb|CDP08577.1|  unnamed protein product                                460   2e-153   
ref|XP_011009816.1|  PREDICTED: probable glycosyltransferase At3g...    458   3e-153   
ref|XP_010423660.1|  PREDICTED: probable glycosyltransferase At5g...    460   3e-153   
gb|KGN52623.1|  hypothetical protein Csa_5G647450                       459   4e-153   
gb|KHN09672.1|  Putative glycosyltransferase                            455   4e-153   
gb|EMT30821.1|  Exostosin-2                                             460   6e-153   
ref|XP_010048370.1|  PREDICTED: probable glycosyltransferase At3g...    459   1e-152   
ref|XP_010657501.1|  PREDICTED: probable glycosyltransferase At3g...    454   2e-152   
ref|XP_009379539.1|  PREDICTED: probable glycosyltransferase At5g...    458   2e-152   
ref|XP_002264111.3|  PREDICTED: probable glycosyltransferase At3g...    455   4e-152   Vitis vinifera
ref|XP_004239536.1|  PREDICTED: probable glycosyltransferase At5g...    456   1e-151   
ref|XP_004243882.1|  PREDICTED: probable glycosyltransferase At5g...    455   2e-151   
ref|XP_008227680.1|  PREDICTED: probable glycosyltransferase At5g...    454   5e-151   
ref|XP_009379541.1|  PREDICTED: probable glycosyltransferase At5g...    454   8e-151   
ref|XP_006357695.1|  PREDICTED: probable glycosyltransferase At5g...    453   8e-151   
ref|XP_010246563.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    453   8e-151   
ref|XP_008796633.1|  PREDICTED: probable glycosyltransferase At5g...    451   7e-150   
emb|CBI28482.3|  unnamed protein product                                455   8e-150   
emb|CDY11270.1|  BnaA03g01060D                                          446   1e-149   
ref|XP_004289488.1|  PREDICTED: probable glycosyltransferase At5g...    446   1e-149   
ref|XP_007145275.1|  hypothetical protein PHAVU_007G225300g             449   2e-149   
ref|XP_007216463.1|  hypothetical protein PRUPE_ppa024503mg             448   3e-149   
emb|CDX80888.1|  BnaC03g01420D                                          449   7e-149   
ref|XP_009130782.1|  PREDICTED: probable glycosyltransferase At5g...    447   2e-148   
ref|XP_011085648.1|  PREDICTED: probable glycosyltransferase At5g...    444   3e-148   
ref|XP_008227724.1|  PREDICTED: probable glycosyltransferase At3g...    447   5e-148   
ref|XP_004955715.1|  PREDICTED: probable glycosyltransferase At5g...    447   1e-147   
ref|XP_008229804.1|  PREDICTED: probable glycosyltransferase At3g...    444   1e-147   
ref|XP_009759830.1|  PREDICTED: probable glycosyltransferase At3g...    442   6e-147   
gb|KDP22997.1|  hypothetical protein JCGZ_01719                         451   7e-147   
gb|AGV54221.1|  glycosyltransferase                                     442   2e-146   
ref|XP_008342266.1|  PREDICTED: probable glycosyltransferase At3g...    441   2e-146   
ref|XP_002524592.1|  catalytic, putative                                436   9e-146   Ricinus communis
ref|NP_001059081.1|  Os07g0188700                                       444   1e-145   Oryza sativa Japonica Group [Japonica rice]
gb|AGZ15405.1|  limonene cyclase-like protein                           439   1e-145   
ref|XP_007213348.1|  hypothetical protein PRUPE_ppa1027150mg            435   2e-145   
gb|EAZ03045.1|  hypothetical protein OsI_25187                          442   5e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_003555678.1|  PREDICTED: probable glycosyltransferase At3g...    438   5e-145   
gb|KHN15414.1|  Putative glycosyltransferase                            437   8e-145   
ref|XP_009361503.1|  PREDICTED: probable glycosyltransferase At3g...    438   1e-144   
emb|CDP15733.1|  unnamed protein product                                435   1e-143   
ref|XP_010933454.1|  PREDICTED: probable glycosyltransferase At5g...    435   2e-143   
ref|XP_004502077.1|  PREDICTED: probable glycosyltransferase At3g...    432   4e-143   
gb|KEH35171.1|  exostosin family protein                                430   2e-142   
ref|XP_004288781.1|  PREDICTED: probable glycosyltransferase At5g...    431   3e-142   
emb|CDP15735.1|  unnamed protein product                                428   3e-142   
ref|XP_008337560.1|  PREDICTED: probable glycosyltransferase At5g...    427   3e-142   
gb|AES71688.2|  exostosin family protein                                428   7e-142   
ref|XP_003601437.1|  hypothetical protein MTR_3g080690                  427   1e-141   
ref|XP_010228257.1|  PREDICTED: probable glycosyltransferase At5g...    431   1e-141   
ref|XP_010683539.1|  PREDICTED: probable glycosyltransferase At3g...    429   1e-141   
ref|XP_010228256.1|  PREDICTED: probable glycosyltransferase At5g...    431   2e-141   
ref|XP_008242868.1|  PREDICTED: probable glycosyltransferase At3g...    426   2e-141   
ref|XP_010418150.1|  PREDICTED: probable glycosyltransferase At3g...    426   4e-141   
ref|XP_008794982.1|  PREDICTED: probable glycosyltransferase At5g...    427   9e-141   
ref|XP_006299448.1|  hypothetical protein CARUB_v10015613mg             426   1e-140   
ref|XP_011100587.1|  PREDICTED: probable glycosyltransferase At3g...    428   2e-140   
gb|KCW74795.1|  hypothetical protein EUGRSUZ_E03530                     425   2e-140   
ref|NP_187419.1|  putative glycosyltransferase                          425   3e-140   Arabidopsis thaliana [mouse-ear cress]
gb|AHL38775.1|  glycosyltransferase                                     425   3e-140   
ref|XP_010489710.1|  PREDICTED: probable glycosyltransferase At3g...    424   3e-140   
ref|XP_010107365.1|  putative glycosyltransferase                       425   3e-140   
ref|XP_009124266.1|  PREDICTED: probable glycosyltransferase At3g...    424   4e-140   
ref|XP_010464397.1|  PREDICTED: probable glycosyltransferase At3g...    423   1e-139   
ref|XP_006407816.1|  hypothetical protein EUTSA_v10020696mg             422   4e-139   
ref|XP_008457132.1|  PREDICTED: probable glycosyltransferase At3g...    422   4e-139   
ref|XP_010552074.1|  PREDICTED: probable glycosyltransferase At3g...    422   4e-139   
ref|XP_010241628.1|  PREDICTED: probable glycosyltransferase At5g...    422   6e-139   
ref|XP_002884661.1|  predicted protein                                  422   6e-139   
ref|XP_006483712.1|  PREDICTED: probable glycosyltransferase At5g...    422   7e-139   
ref|XP_006856555.1|  hypothetical protein AMTR_s00046p00174470          424   1e-138   
ref|XP_010059401.1|  PREDICTED: probable glycosyltransferase At3g...    421   1e-138   
ref|XP_010905483.1|  PREDICTED: probable glycosyltransferase At5g...    421   1e-138   
ref|XP_006450385.1|  hypothetical protein CICLE_v10008151mg             421   1e-138   
ref|XP_007204886.1|  hypothetical protein PRUPE_ppa017740mg             418   1e-138   
ref|XP_007013571.1|  Exostosin family protein                           421   2e-138   
gb|EYU20246.1|  hypothetical protein MIMGU_mgv1a006806mg                418   3e-138   
ref|XP_009417384.1|  PREDICTED: probable glycosyltransferase At5g...    416   3e-138   
ref|XP_011085421.1|  PREDICTED: probable glycosyltransferase At3g...    417   5e-138   
ref|XP_004292977.1|  PREDICTED: probable glycosyltransferase At5g...    419   1e-137   
ref|XP_009346171.1|  PREDICTED: probable glycosyltransferase At5g...    415   1e-137   
ref|XP_008242869.1|  PREDICTED: probable glycosyltransferase At3g...    416   2e-137   
ref|XP_006600735.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    418   3e-137   
ref|XP_006856564.1|  hypothetical protein AMTR_s00046p00183980          417   3e-137   
ref|XP_003550809.2|  PREDICTED: probable glycosyltransferase At3g...    417   3e-137   
ref|XP_010250234.1|  PREDICTED: probable glycosyltransferase At5g...    418   3e-137   
ref|XP_003550810.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    418   4e-137   
ref|XP_006594253.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    417   5e-137   
ref|XP_010250233.1|  PREDICTED: probable glycosyltransferase At5g...    417   7e-137   
gb|KGN60712.1|  hypothetical protein Csa_2G008045                       416   7e-137   
ref|XP_006600734.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    417   7e-137   
gb|KHN47102.1|  Xylogalacturonan beta-1,3-xylosyltransferase            417   8e-137   
ref|XP_006594254.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    417   8e-137   
gb|KHN47103.1|  Putative glycosyltransferase                            415   2e-136   
ref|XP_011085420.1|  PREDICTED: probable glycosyltransferase At3g...    417   2e-136   
ref|XP_008336982.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    412   2e-136   
ref|XP_006856554.1|  hypothetical protein AMTR_s00046p00173940          416   2e-136   
ref|XP_008336981.1|  PREDICTED: probable glycosyltransferase At3g...    412   3e-136   
gb|KHG09514.1|  hypothetical protein F383_01906                         415   4e-136   
ref|XP_007013568.1|  Exostosin family protein, putative isoform 1       415   4e-136   
ref|XP_002515489.1|  catalytic, putative                                414   5e-136   Ricinus communis
ref|XP_010057604.1|  PREDICTED: probable glycosyltransferase At3g...    412   6e-136   
gb|KCW74792.1|  hypothetical protein EUGRSUZ_E03525                     414   7e-136   
gb|KHN15048.1|  Xylogalacturonan beta-1,3-xylosyltransferase            418   1e-135   
emb|CBI21065.3|  unnamed protein product                                410   1e-135   
ref|XP_010042007.1|  PREDICTED: probable glycosyltransferase At3g...    410   2e-135   
ref|XP_008352234.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    410   2e-135   
ref|XP_008361205.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    410   2e-135   
ref|XP_003541484.1|  PREDICTED: probable glycosyltransferase At3g...    412   3e-135   
ref|XP_007202437.1|  hypothetical protein PRUPE_ppa014750mg             409   3e-135   
gb|AAU04753.1|  EXO                                                     407   4e-135   Cucumis melo [Oriental melon]
ref|XP_002285239.2|  PREDICTED: probable glycosyltransferase At5g...    412   5e-135   Vitis vinifera
ref|XP_007011817.1|  Exostosin family protein                           412   6e-135   
ref|XP_011036587.1|  PREDICTED: probable glycosyltransferase At5g...    412   7e-135   
ref|XP_008242826.1|  PREDICTED: probable glycosyltransferase At5g...    412   8e-135   
ref|XP_007204648.1|  hypothetical protein PRUPE_ppa001571mg             421   1e-134   
ref|XP_009151057.1|  PREDICTED: probable glycosyltransferase At5g...    410   2e-134   
ref|XP_002285237.2|  PREDICTED: probable glycosyltransferase At5g...    410   3e-134   Vitis vinifera
ref|XP_008652150.1|  PREDICTED: probable glycosyltransferase At5g...    413   3e-134   
ref|XP_009151056.1|  PREDICTED: probable glycosyltransferase At5g...    410   4e-134   
tpg|DAA59884.1|  TPA: hypothetical protein ZEAMMB73_690759              413   5e-134   
ref|XP_008385236.1|  PREDICTED: probable glycosyltransferase At3g...    410   7e-134   
ref|XP_007155060.1|  hypothetical protein PHAVU_003G169700g             409   9e-134   
ref|XP_010096418.1|  T-complex protein 1 subunit beta                   425   9e-134   
ref|XP_006389445.1|  hypothetical protein POPTR_0025s00760g             408   1e-133   
ref|XP_009393729.1|  PREDICTED: probable glycosyltransferase At5g...    407   2e-133   
ref|XP_009117358.1|  PREDICTED: probable glycosyltransferase At3g...    407   2e-133   
ref|XP_010099849.1|  putative glycosyltransferase                       407   3e-133   
ref|XP_009364050.1|  PREDICTED: probable glycosyltransferase At5g...    409   4e-133   
ref|XP_010491808.1|  PREDICTED: probable glycosyltransferase At5g...    407   5e-133   
ref|XP_008337135.1|  PREDICTED: probable glycosyltransferase At5g...    406   6e-133   
ref|XP_006474664.1|  PREDICTED: probable glycosyltransferase At5g...    404   6e-133   
ref|XP_002515488.1|  catalytic, putative                                406   6e-133   Ricinus communis
ref|XP_006289990.1|  hypothetical protein CARUB_v10003620mg             407   7e-133   
ref|XP_002459470.1|  hypothetical protein SORBIDRAFT_02g005180          410   7e-133   Sorghum bicolor [broomcorn]
ref|XP_009346174.1|  PREDICTED: probable glycosyltransferase At5g...    407   8e-133   
ref|XP_008352110.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    403   9e-133   
gb|EYU20247.1|  hypothetical protein MIMGU_mgv1a024162mg                403   9e-133   
ref|XP_007013570.1|  Exostosin family protein                           405   9e-133   
ref|XP_009802043.1|  PREDICTED: probable glycosyltransferase At5g...    406   1e-132   
emb|CDO99716.1|  unnamed protein product                                404   1e-132   
ref|XP_011017849.1|  PREDICTED: probable glycosyltransferase At5g...    405   1e-132   
ref|XP_006453093.1|  hypothetical protein CICLE_v10010441mg             405   1e-132   
ref|XP_008394108.1|  PREDICTED: probable glycosyltransferase At5g...    406   2e-132   
ref|XP_011016249.1|  PREDICTED: probable glycosyltransferase At5g...    405   2e-132   
ref|XP_007155062.1|  hypothetical protein PHAVU_003G169900g             405   2e-132   
ref|XP_009340649.1|  PREDICTED: probable glycosyltransferase At5g...    405   3e-132   
ref|XP_008389683.1|  PREDICTED: probable glycosyltransferase At5g...    401   4e-132   
ref|XP_010696519.1|  PREDICTED: probable glycosyltransferase At5g...    404   5e-132   
ref|XP_009355772.1|  PREDICTED: probable glycosyltransferase At5g...    404   5e-132   
ref|XP_006582516.1|  PREDICTED: probable glycosyltransferase At5g...    399   5e-132   
ref|XP_011017844.1|  PREDICTED: probable glycosyltransferase At5g...    405   7e-132   
emb|CDX76960.1|  BnaC08g35460D                                          403   1e-131   
ref|XP_003542647.2|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    405   1e-131   
ref|XP_011020197.1|  PREDICTED: probable glycosyltransferase At5g...    404   1e-131   
emb|CDX80499.1|  BnaC07g29450D                                          403   2e-131   
gb|KHN15047.1|  Putative glycosyltransferase                            401   2e-131   
ref|XP_010519637.1|  PREDICTED: probable glycosyltransferase At5g...    402   2e-131   
ref|XP_010519636.1|  PREDICTED: probable glycosyltransferase At5g...    402   2e-131   
gb|KHN47101.1|  Putative glycosyltransferase                            404   3e-131   
ref|XP_010419667.1|  PREDICTED: probable glycosyltransferase At5g...    403   3e-131   
ref|XP_011020204.1|  PREDICTED: probable glycosyltransferase At5g...    402   3e-131   
ref|XP_010454330.1|  PREDICTED: probable glycosyltransferase At5g...    401   4e-131   
ref|XP_004498960.1|  PREDICTED: probable glycosyltransferase At5g...    402   4e-131   
ref|XP_010533123.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    404   4e-131   
ref|XP_008443936.1|  PREDICTED: probable glycosyltransferase At5g...    402   5e-131   
ref|XP_010533124.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    404   5e-131   
ref|XP_003549738.1|  PREDICTED: probable glycosyltransferase At3g...    401   5e-131   
ref|XP_007205109.1|  hypothetical protein PRUPE_ppa004757mg             402   5e-131   
emb|CDY13789.1|  BnaA09g42910D                                          399   6e-131   
gb|AES91622.2|  glycosyltransferase                                     406   7e-131   
ref|XP_007200373.1|  hypothetical protein PRUPE_ppa008342mg             396   7e-131   
ref|XP_010050740.1|  PREDICTED: probable glycosyltransferase At5g...    398   8e-131   
ref|XP_009337990.1|  PREDICTED: probable glycosyltransferase At5g...    402   8e-131   
ref|XP_009364051.1|  PREDICTED: probable glycosyltransferase At5g...    398   8e-131   
gb|KHN15049.1|  Putative glycosyltransferase                            398   9e-131   
ref|XP_011020198.1|  PREDICTED: probable glycosyltransferase At5g...    402   9e-131   
ref|XP_008218430.1|  PREDICTED: probable glycosyltransferase At5g...    402   1e-130   
ref|XP_010454331.1|  PREDICTED: probable glycosyltransferase At5g...    400   1e-130   
ref|XP_010453152.1|  PREDICTED: probable glycosyltransferase At5g...    401   1e-130   
emb|CDY60376.1|  BnaCnng36170D                                          400   1e-130   
emb|CDP13539.1|  unnamed protein product                                403   1e-130   
ref|XP_010421383.1|  PREDICTED: probable glycosyltransferase At5g...    401   1e-130   
ref|XP_006381108.1|  hypothetical protein POPTR_0006s06330g             401   1e-130   
emb|CDY35818.1|  BnaC09g37500D                                          400   1e-130   
ref|XP_010493785.1|  PREDICTED: probable glycosyltransferase At5g...    400   2e-130   
ref|XP_009131787.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    400   2e-130   
emb|CDX92476.1|  BnaA10g15150D                                          399   2e-130   
ref|XP_006389446.1|  hypothetical protein POPTR_0025s00770g             401   2e-130   
ref|XP_004304808.1|  PREDICTED: probable glycosyltransferase At5g...    401   3e-130   
ref|XP_006400593.1|  hypothetical protein EUTSA_v10015371mg             399   3e-130   
ref|XP_002877250.1|  exostosin family protein                           397   3e-130   
ref|XP_002324873.2|  hypothetical protein POPTR_0018s01950g             396   4e-130   
ref|XP_006381109.1|  hypothetical protein POPTR_0006s06340g             400   5e-130   
emb|CDY35820.1|  BnaC09g37520D                                          398   7e-130   
ref|XP_010520570.1|  PREDICTED: probable glycosyltransferase At5g...    399   7e-130   
ref|NP_197526.5|  Exostosin family protein                              398   7e-130   
gb|KDP42268.1|  hypothetical protein JCGZ_01592                         395   8e-130   
gb|EYU42789.1|  hypothetical protein MIMGU_mgv1a009597mg                393   8e-130   
ref|XP_009120823.1|  PREDICTED: probable glycosyltransferase At5g...    398   9e-130   
sp|Q3E9A4.3|GLYT5_ARATH  RecName: Full=Probable glycosyltransfera...    398   9e-130   
ref|XP_009337989.1|  PREDICTED: probable glycosyltransferase At5g...    399   1e-129   
ref|XP_010493134.1|  PREDICTED: probable glycosyltransferase At5g...    398   1e-129   
ref|NP_196674.2|  exostosin family protein                              398   2e-129   
ref|XP_006287596.1|  hypothetical protein CARUB_v10000808mg             398   2e-129   
ref|XP_008337219.1|  PREDICTED: probable glycosyltransferase At5g...    394   2e-129   
ref|XP_009338023.1|  PREDICTED: probable glycosyltransferase At5g...    398   2e-129   
ref|XP_002308053.2|  hypothetical protein POPTR_0006s06350g             398   3e-129   
ref|XP_003550812.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    397   3e-129   
ref|XP_007161196.1|  hypothetical protein PHAVU_001G050100g             396   6e-129   
ref|XP_006394779.1|  hypothetical protein EUTSA_v10004121mg             396   7e-129   
ref|XP_011081538.1|  PREDICTED: probable glycosyltransferase At5g...    396   8e-129   
ref|XP_002264880.2|  PREDICTED: probable glycosyltransferase At5g...    395   1e-128   
gb|KCW44366.1|  hypothetical protein EUGRSUZ_L02165                     392   1e-128   
ref|XP_010541615.1|  PREDICTED: probable glycosyltransferase At5g...    395   1e-128   
ref|XP_010454855.1|  PREDICTED: probable glycosyltransferase At5g...    395   1e-128   
ref|XP_010656546.1|  PREDICTED: probable glycosyltransferase At3g...    395   2e-128   
ref|XP_011020203.1|  PREDICTED: probable glycosyltransferase At5g...    395   3e-128   
ref|XP_011036586.1|  PREDICTED: probable glycosyltransferase At5g...    394   4e-128   
ref|XP_004508620.1|  PREDICTED: probable glycosyltransferase At3g...    394   4e-128   
ref|XP_003609423.1|  Xylogalacturonan beta-1,3-xylosyltransferase       391   6e-128   
ref|XP_010041414.1|  PREDICTED: probable glycosyltransferase At5g...    394   7e-128   
ref|XP_010687901.1|  PREDICTED: probable glycosyltransferase At5g...    390   9e-128   
ref|XP_002264922.2|  PREDICTED: probable glycosyltransferase At5g...    393   1e-127   
ref|NP_197913.4|  Exostosin family protein                              393   1e-127   
ref|XP_006389444.1|  hypothetical protein POPTR_0025s00750g             401   1e-127   
ref|XP_009340668.1|  PREDICTED: probable glycosyltransferase At5g...    397   1e-127   
emb|CBI25537.3|  unnamed protein product                                393   1e-127   
gb|KGN65113.1|  hypothetical protein Csa_1G226410                       393   1e-127   
ref|XP_004302151.1|  PREDICTED: probable glycosyltransferase At5g...    392   2e-127   
ref|XP_007155061.1|  hypothetical protein PHAVU_003G169800g             392   2e-127   
ref|XP_010050741.1|  PREDICTED: probable glycosyltransferase At5g...    392   3e-127   
ref|XP_004139407.1|  PREDICTED: probable glycosyltransferase At3g...    391   3e-127   
ref|XP_007155059.1|  hypothetical protein PHAVU_003G169600g             392   3e-127   
ref|XP_006396181.1|  hypothetical protein EUTSA_v10002345mg             391   3e-127   
ref|XP_008218534.1|  PREDICTED: probable glycosyltransferase At5g...    395   3e-127   
ref|XP_004501350.1|  PREDICTED: probable glycosyltransferase At5g...    392   4e-127   
ref|XP_009615070.1|  PREDICTED: probable glycosyltransferase At5g...    392   4e-127   
emb|CBI25529.3|  unnamed protein product                                388   6e-127   
emb|CDX97082.1|  BnaC09g45430D                                          391   7e-127   
ref|XP_002531945.1|  catalytic, putative                                389   1e-126   
ref|XP_006399613.1|  hypothetical protein EUTSA_v10013399mg             390   1e-126   
ref|XP_010491807.1|  PREDICTED: probable glycosyltransferase At5g...    392   1e-126   
emb|CDX85728.1|  BnaA02g00850D                                          390   2e-126   
ref|XP_006856553.1|  hypothetical protein AMTR_s00046p00173420          384   2e-126   
emb|CDY22124.1|  BnaC01g39770D                                          394   3e-126   
emb|CDY51109.1|  BnaCnng20120D                                          389   3e-126   
ref|XP_009121991.1|  PREDICTED: probable glycosyltransferase At5g...    389   4e-126   
ref|XP_002266646.2|  PREDICTED: probable glycosyltransferase At5g...    389   5e-126   
gb|AES91613.2|  exostosin family protein                                388   6e-126   
ref|XP_006279358.1|  hypothetical protein CARUB_v10008022mg             388   7e-126   
gb|AGV54450.1|  glycosyltransferase                                     389   8e-126   
ref|XP_010520568.1|  PREDICTED: probable glycosyltransferase At3g...    388   1e-125   
ref|XP_008219689.1|  PREDICTED: probable glycosyltransferase At5g...    388   1e-125   
gb|ABA18105.1|  exostosin family protein                                385   1e-125   
ref|XP_009125787.1|  PREDICTED: probable glycosyltransferase At5g...    387   1e-125   
gb|KHN31216.1|  Putative glycosyltransferase                            382   2e-125   
ref|XP_004508619.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    387   2e-125   
ref|XP_010520569.1|  PREDICTED: probable glycosyltransferase At3g...    387   2e-125   
ref|XP_010250232.1|  PREDICTED: probable glycosyltransferase At5g...    387   2e-125   
ref|XP_011020199.1|  PREDICTED: probable glycosyltransferase At5g...    387   2e-125   
ref|XP_010314106.1|  PREDICTED: probable glycosyltransferase At3g...    386   3e-125   
ref|XP_010250231.1|  PREDICTED: probable glycosyltransferase At5g...    387   3e-125   
ref|XP_010514701.1|  PREDICTED: probable glycosyltransferase At3g...    386   3e-125   
ref|XP_009355880.1|  PREDICTED: probable glycosyltransferase At5g...    382   7e-125   
emb|CBI25530.3|  unnamed protein product                                382   1e-124   
ref|XP_006286824.1|  hypothetical protein CARUB_v10003769mg             385   1e-124   
ref|XP_006483713.1|  PREDICTED: probable glycosyltransferase At5g...    384   1e-124   
ref|XP_006450384.1|  hypothetical protein CICLE_v10010549mg             382   2e-124   
ref|XP_010425790.1|  PREDICTED: probable glycosyltransferase At3g...    384   2e-124   
ref|XP_010687902.1|  PREDICTED: probable glycosyltransferase At5g...    385   2e-124   
ref|XP_002266490.3|  PREDICTED: probable glycosyltransferase At5g...    386   2e-124   
ref|XP_011082204.1|  PREDICTED: probable glycosyltransferase At5g...    382   3e-124   
ref|XP_007206344.1|  hypothetical protein PRUPE_ppa017605mg             383   5e-124   
ref|XP_006353139.1|  PREDICTED: probable glycosyltransferase At3g...    385   6e-124   
ref|XP_007011816.1|  Exostosin family protein                           382   9e-124   
gb|KDP30240.1|  hypothetical protein JCGZ_17022                         377   1e-123   
ref|XP_008218431.1|  PREDICTED: probable glycosyltransferase At5g...    382   2e-123   
ref|XP_004288780.1|  PREDICTED: probable glycosyltransferase At5g...    382   3e-123   
ref|XP_004138850.1|  PREDICTED: probable glycosyltransferase At5g...    381   3e-123   
ref|XP_008370810.1|  PREDICTED: probable glycosyltransferase At5g...    381   4e-123   
ref|XP_006345657.1|  PREDICTED: probable glycosyltransferase At5g...    381   4e-123   
ref|XP_008370808.1|  PREDICTED: probable glycosyltransferase At5g...    381   5e-123   
gb|KCW58739.1|  hypothetical protein EUGRSUZ_H01381                     378   5e-123   
ref|XP_003549290.1|  PREDICTED: probable glycosyltransferase At5g...    381   6e-123   
ref|XP_002324871.2|  exostosin family protein                           375   6e-123   
ref|XP_004244985.2|  PREDICTED: probable glycosyltransferase At5g...    380   9e-123   
gb|KCW80354.1|  hypothetical protein EUGRSUZ_C01719                     375   9e-123   
ref|XP_010026197.1|  PREDICTED: probable glycosyltransferase At5g...    378   2e-122   
ref|XP_006474663.1|  PREDICTED: probable glycosyltransferase At3g...    380   2e-122   
ref|XP_009337994.1|  PREDICTED: probable glycosyltransferase At3g...    378   2e-122   
ref|XP_009802047.1|  PREDICTED: probable glycosyltransferase At5g...    377   3e-122   
ref|XP_008445236.1|  PREDICTED: probable glycosyltransferase At5g...    379   3e-122   
gb|KFK27864.1|  hypothetical protein AALP_AA8G439100                    380   3e-122   
ref|XP_006283529.1|  hypothetical protein CARUB_v10004583mg             380   3e-122   
ref|XP_011015263.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    379   3e-122   
ref|XP_009337993.1|  PREDICTED: probable glycosyltransferase At5g...    379   3e-122   
ref|XP_006283528.1|  hypothetical protein CARUB_v10004583mg             380   5e-122   
gb|ABG48476.1|  At3g42180                                               376   9e-122   
ref|XP_003545455.1|  PREDICTED: probable glycosyltransferase At5g...    378   1e-121   
ref|XP_006582483.1|  PREDICTED: probable glycosyltransferase At5g...    377   1e-121   
ref|NP_189804.4|  Exostosin family protein                              377   1e-121   
gb|KFK38224.1|  hypothetical protein AALP_AA3G084800                    375   2e-121   
ref|XP_009362346.1|  PREDICTED: probable glycosyltransferase At5g...    379   2e-121   
emb|CBI25528.3|  unnamed protein product                                389   2e-121   
ref|XP_003603357.1|  hypothetical protein MTR_3g106690                  374   3e-121   
ref|XP_009592269.1|  PREDICTED: probable glycosyltransferase At3g...    375   5e-121   
gb|KDP33570.1|  hypothetical protein JCGZ_07141                         376   6e-121   
ref|XP_002873987.1|  hypothetical protein ARALYDRAFT_326421             380   1e-120   
ref|XP_010440684.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    376   1e-120   
ref|NP_198314.2|  xylogalacturonan beta-1,3-xylosyltransferase          375   1e-120   
ref|XP_006345278.1|  PREDICTED: probable glycosyltransferase At5g...    372   1e-120   
ref|XP_003609425.1|  Xylogalacturonan beta-1,3-xylosyltransferase       379   1e-120   
emb|CDY12392.1|  BnaC08g08130D                                          375   1e-120   
ref|XP_010435387.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    376   1e-120   
ref|XP_004292976.1|  PREDICTED: probable glycosyltransferase At5g...    372   2e-120   
gb|KHN15046.1|  Xylogalacturonan beta-1,3-xylosyltransferase            372   2e-120   
ref|XP_002870405.1|  hypothetical protein ARALYDRAFT_493575             375   2e-120   
ref|XP_009108067.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    376   2e-120   
ref|XP_010449641.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    375   2e-120   
ref|XP_002989572.1|  xylosyltransferase-like protein                    369   3e-120   
ref|XP_010111057.1|  putative glycosyltransferase                       374   4e-120   
ref|XP_010435386.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    375   4e-120   
ref|XP_008645924.1|  PREDICTED: probable glycosyltransferase At5g...    373   5e-120   
ref|XP_002964241.1|  xylosyltransferase-like protein                    367   1e-119   
ref|XP_007226606.1|  hypothetical protein PRUPE_ppa023392mg             372   1e-119   
ref|XP_010908761.1|  PREDICTED: probable glycosyltransferase At5g...    372   1e-119   
ref|XP_009108068.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    374   1e-119   
gb|EPS67004.1|  hypothetical protein M569_07774                         367   1e-119   
ref|XP_010667144.1|  PREDICTED: probable glycosyltransferase At5g...    369   2e-119   
ref|XP_010449642.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    372   3e-119   
ref|XP_007137001.1|  hypothetical protein PHAVU_009G091800g             371   3e-119   
gb|KFK38225.1|  hypothetical protein AALP_AA3G084800                    369   4e-119   
ref|XP_010450333.1|  PREDICTED: xylogalacturonan beta-1,3-xylosyl...    371   7e-119   
gb|EMT14849.1|  Exostosin-1c                                            370   1e-118   
gb|KCW80353.1|  hypothetical protein EUGRSUZ_C01718                     365   1e-118   
ref|XP_004508451.1|  PREDICTED: probable glycosyltransferase At5g...    366   2e-118   
ref|XP_003561022.1|  PREDICTED: probable glycosyltransferase At5g...    369   2e-118   
ref|XP_008219690.1|  PREDICTED: probable glycosyltransferase At5g...    368   2e-118   
ref|XP_007223103.1|  hypothetical protein PRUPE_ppa007120mg             366   2e-118   
ref|XP_006453094.1|  hypothetical protein CICLE_v10010628mg             378   3e-118   
emb|CAB96648.1|  putative protein                                       363   3e-118   
ref|XP_004287275.1|  PREDICTED: probable glycosyltransferase At5g...    369   5e-118   
ref|XP_002871458.1|  exostosin family protein                           362   9e-118   
ref|XP_008364067.1|  PREDICTED: probable glycosyltransferase At5g...    374   1e-117   
ref|XP_007013569.1|  Exostosin family protein isoform 2                 362   2e-117   
emb|CDX88845.1|  BnaA03g08040D                                          375   2e-117   
ref|XP_004166098.1|  PREDICTED: probable glycosyltransferase At5g...    362   2e-117   
ref|XP_008794981.1|  PREDICTED: probable glycosyltransferase At5g...    364   2e-117   
ref|XP_009407372.1|  PREDICTED: probable glycosyltransferase At5g...    367   3e-117   
ref|XP_010493786.1|  PREDICTED: probable glycosyltransferase At5g...    365   3e-117   
ref|XP_009363968.1|  PREDICTED: probable glycosyltransferase At3g...    360   7e-117   
gb|EAY86665.1|  hypothetical protein OsI_08049                          365   7e-117   
ref|XP_006395978.1|  hypothetical protein EUTSA_v10004530mg             359   1e-116   
ref|XP_003572711.1|  PREDICTED: probable glycosyltransferase At5g...    364   2e-116   
gb|KHG16877.1|  Xylogalacturonan beta-1,3-xylosyltransferase -lik...    358   5e-116   
ref|XP_010496528.1|  PREDICTED: probable glycosyltransferase At3g...    357   9e-116   
gb|EPS58814.1|  hypothetical protein M569_15998                         357   1e-115   
emb|CAH67778.1|  H0201G08.5                                             360   1e-115   
ref|XP_010454857.1|  PREDICTED: probable glycosyltransferase At5g...    361   2e-115   
gb|KDO61791.1|  hypothetical protein CISIN_1g038832mg                   356   2e-115   
ref|XP_008344073.1|  PREDICTED: probable glycosyltransferase At3g...    357   6e-115   
dbj|BAK03842.1|  predicted protein                                      359   6e-115   
emb|CDP10462.1|  unnamed protein product                                355   7e-115   
gb|AHL38617.1|  glycosyltransferase                                     354   1e-114   
ref|NP_001052025.1|  Os04g0109900                                       358   1e-114   
gb|KDO73474.1|  hypothetical protein CISIN_1g048345mg                   354   2e-114   
ref|XP_003609416.1|  Xylogalacturonan beta-1,3-xylosyltransferase       355   3e-114   
gb|EYU23547.1|  hypothetical protein MIMGU_mgv1a009659mg                353   3e-114   
ref|XP_010096841.1|  putative glycosyltransferase                       353   4e-114   
ref|XP_002872156.1|  exostosin family protein                           352   1e-113   
gb|AFW85605.1|  hypothetical protein ZEAMMB73_586394                    358   1e-113   
gb|ABA18091.1|  exostosin family protein                                351   2e-113   
emb|CDY47558.1|  BnaA08g07290D                                          350   8e-113   
ref|XP_010535859.1|  PREDICTED: probable glycosyltransferase At5g...    349   1e-112   
gb|AHL38607.1|  glycosyltransferase                                     349   1e-112   
gb|KHN33893.1|  Putative glycosyltransferase                            349   2e-112   
ref|XP_008370811.1|  PREDICTED: probable glycosyltransferase At5g...    349   2e-112   



>ref|XP_009787886.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=460

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/465 (68%), Positives = 373/465 (80%), Gaps = 24/465 (5%)
 Frame = +1

Query  109   ARWGSSSGVLCIIAVPLILVSAFYALHsssgfesvfsseTHPWLRGF------------S  252
             A   SSS V+ +I+V LILVS ++ L SSS         T P +  F            S
Sbjct  5     ATSSSSSRVVWLISVSLILVSLYFGLQSSS---------TFPLVLSFGNFSQFLATNVSS  55

Query  253   MPFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRN  426
                 QL +S P     KKL++LER+EAGL R RAAI+QAQ++N+  +DP+YVP GPIY N
Sbjct  56    KKESQLNNSQPIVKLQKKLSSLERLEAGLVRARAAIKQAQSKNQTFDDPEYVPTGPIYWN  115

Query  427   PHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKA  606
             P AFHRSYLEMEK FKI++YEEGEPPVFHYS SQGILGIEGILIHQLEISKFRT +PEKA
Sbjct  116   PIAFHRSYLEMEKHFKIYVYEEGEPPVFHYSASQGILGIEGILIHQLEISKFRTNDPEKA  175

Query  607   HVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHD  786
             HV+FLPFS  S+V +V+V D+ EW P++ TA DYI+ IS KYPYWNRSLG DHFMLACHD
Sbjct  176   HVYFLPFSVLSIVSYVYVVDSREWGPMRNTAADYIDNISRKYPYWNRSLGSDHFMLACHD  235

Query  787   WAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRS  966
             W P IS   P L+KNSIRV+CNANTSE F P+ DVSLPEIYLPQG  DGLIGGP PS+RS
Sbjct  236   WGPRISLAIPYLYKNSIRVLCNANTSERFNPSKDVSLPEIYLPQGTTDGLIGGPSPSHRS  295

Query  967   VLVFYAGGIHGYIRQVMMETW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVA  1143
             VLVFYAGGIHGYIRQV+ME W +N DP+V+IHEYLPKNVSYYGM+RKSKYCICPSG+EVA
Sbjct  296   VLVFYAGGIHGYIRQVLMEYWGKNDDPDVQIHEYLPKNVSYYGMIRKSKYCICPSGWEVA  355

Query  1144  SPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLS  1323
             SPRMVEA+YMGCVP+L+KDHY  PF+DVL+W +FAV++   +IPNLKKIL +IPQ +Y+ 
Sbjct  356   SPRMVEALYMGCVPILLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILNAIPQRQYIK  415

Query  1324  MQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
             MQ++G+QVRRHFEVNFPP+RYDVFHM+LHSIWLRRLNI VHD +E
Sbjct  416   MQKRGLQVRRHFEVNFPPRRYDVFHMILHSIWLRRLNIHVHDTKE  460



>ref|XP_006339262.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=456

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/443 (69%), Positives = 364/443 (82%), Gaps = 12/443 (3%)
 Frame = +1

Query  133   VLCIIAVPLILVSAFYALHsssgfesvfsseTHPWLRGFSMPFYQLPSSHPDAMKKLTNL  312
             VL +IA+PLILVS ++ L SS+ +    +          S P  QL        K ++NL
Sbjct  24    VLWLIAIPLILVSLYFGLKSSTSYVYAKNDH-----ENISPPIVQLEK------KLISNL  72

Query  313   ERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEE  492
             E+VEAGL RVR AI++AQ++N+  +DP+YVP GPIY NP AFHRSY+EMEK FKI++YEE
Sbjct  73    EKVEAGLVRVRVAIKEAQSKNQTFDDPEYVPTGPIYWNPTAFHRSYMEMEKHFKIYVYEE  132

Query  493   GEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFVFVRDAH  672
             GEPPVFHYS S+GILGIEGILIH +EISKFRT +PEKAHV+FLPFS  S+V +V+V ++ 
Sbjct  133   GEPPVFHYSASEGILGIEGILIHHIEISKFRTNDPEKAHVYFLPFSVLSIVSYVYVVNSR  192

Query  673   EWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCN  852
              W P+Q TA DYI+GIS KYPYWNRSLG DHFMLACHDWAPTIS   P L+KNSIRV+CN
Sbjct  193   SWGPMQNTAADYIDGISRKYPYWNRSLGADHFMLACHDWAPTISFAVPYLYKNSIRVLCN  252

Query  853   ANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETW-  1029
             ANTSE F P  DVSLPEIYLPQG MDGLIGGP PS+RSVLVFYAGGIHGYIRQV+ME W 
Sbjct  253   ANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQVLMELWG  312

Query  1030  ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYA  1209
             +N D +V+IHEYLPKN+SYYGM+RKSK+CICPSGYEVASPRMVEA+YMGCVPVL+KDHY 
Sbjct  313   KNDDSDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVLLKDHYV  372

Query  1210  KPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYD  1389
              PF DVL+W +FAV +   +IPNLKKIL+SI Q +Y+ MQ++G+QVRRHFEVNFPP+RYD
Sbjct  373   APFNDVLNWKSFAVQMNSTDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNFPPRRYD  432

Query  1390  VFHMVLHSIWLRRLNIEVHDIQE  1458
             VFHM+LHSIWLRRLNI+VHD ++
Sbjct  433   VFHMILHSIWLRRLNIQVHDTKD  455



>ref|XP_004249828.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=431

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/389 (75%), Positives = 342/389 (88%), Gaps = 1/389 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             K ++NLE+VEAGL RVR AI++AQ++N+ L+DP+YVP GPIY NP AFHRSY+EMEK FK
Sbjct  42    KFISNLEKVEAGLVRVRVAIKEAQSKNQTLDDPEYVPTGPIYWNPTAFHRSYMEMEKHFK  101

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             IF+YEEGEPPVFHYS S+GILGIEGILIHQ+EISKFRT +PEKAHV+FLPFS  S+V +V
Sbjct  102   IFVYEEGEPPVFHYSASEGILGIEGILIHQIEISKFRTNDPEKAHVYFLPFSVLSIVSYV  161

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             +V D+  W P+Q TA DYI+ IS KYPYWNRSLG DHFMLACHDWAPTIS   P L+KNS
Sbjct  162   YVVDSRSWGPMQNTAADYIDSISRKYPYWNRSLGSDHFMLACHDWAPTISFAVPYLYKNS  221

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNANTSE F P  DVSLPEIYLPQG MDGLIGGP PS+RSVLVFYAGGIHGYIRQV
Sbjct  222   IRVLCNANTSERFDPTKDVSLPEIYLPQGKMDGLIGGPSPSHRSVLVFYAGGIHGYIRQV  281

Query  1015  MMETW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +ME W +N D +V+IHEYLPKN+SYYGM+RKSK+CICPSGYEVASPRMVEA+YMGCVPVL
Sbjct  282   LMEHWGKNDDLDVQIHEYLPKNMSYYGMIRKSKFCICPSGYEVASPRMVEALYMGCVPVL  341

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             +KDHY  PF+DVL+W +F+V +  ++IPNLKKIL+SI Q +Y+ MQ++G+QVRRHFEVNF
Sbjct  342   LKDHYVAPFSDVLNWKSFSVQMNSRDIPNLKKILMSISQTQYIRMQKRGLQVRRHFEVNF  401

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
             PPKRYDVFHM+LHSIW RRLNI+VHD ++
Sbjct  402   PPKRYDVFHMILHSIWFRRLNIQVHDTKD  430



>ref|XP_009776098.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=484

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/390 (73%), Positives = 340/390 (87%), Gaps = 3/390 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQAQTE--NRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             + KKL+NL RVEAGL +VR AIR+AQ+   N+  +D +YVP GP Y NP AFHRSY+EME
Sbjct  94    SKKKLSNLGRVEAGLGKVRGAIREAQSNSNNQTFDDSEYVPRGPCYWNPSAFHRSYIEME  153

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSL  642
             K FKI++YE+GEPPVFHYS S+GILGIEGI+IHQ+EISKFRT +PEKAHV+FLPFS +S+
Sbjct  154   KHFKIYVYEKGEPPVFHYSSSEGILGIEGIMIHQIEISKFRTNDPEKAHVYFLPFSVFSI  213

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +V+V D+H+W P++ T  DYI+GISTKYPYWNRSLG DHFMLACHDWAP IS   P L
Sbjct  214   VSYVYVVDSHQWGPMKNTVADYIDGISTKYPYWNRSLGSDHFMLACHDWAPEISTAVPYL  273

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             +KNSIRV+CNANTSE F P+ DV+LPEIYLPQG M GLIGGP PS RSVLVF+AGGIHGY
Sbjct  274   YKNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMKGLIGGPSPSQRSVLVFHAGGIHGY  333

Query  1003  IRQVMMETW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             IRQV+ME W +N D EV+IHEYLPKNVSYYGM+RKSK+CICPSG+EVASPRMVEA+YMGC
Sbjct  334   IRQVLMEKWGKNDDQEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEALYMGC  393

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVL+KDHY  PF+DVL+W +FAV++   +IPNLKKIL++I Q++Y+ MQ++G+QVRRHF
Sbjct  394   VPVLLKDHYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMAISQKQYIKMQKRGLQVRRHF  453

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             EVNFPPKRYDVFHM+LHSIWLRRLNI+V D
Sbjct  454   EVNFPPKRYDVFHMILHSIWLRRLNIQVRD  483



>ref|XP_011094445.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=497

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/388 (72%), Positives = 330/388 (85%), Gaps = 0/388 (0%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
              L NL+ VEA LA+ RA I++AQ  N    DPDYVP GP+YRNP+AF RSYLEMEK FKI
Sbjct  110   NLDNLDMVEASLAQARATIQEAQRNNETSYDPDYVPTGPMYRNPNAFLRSYLEMEKLFKI  169

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFVF  657
             ++YE+GEPP++HYS S GILGIEGILIHQ+EISKFRT++P KAHV+F+P S  S+V + +
Sbjct  170   YVYEDGEPPLYHYSKSLGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIVAYAY  229

Query  658   VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSI  837
             VR    W P+Q  ARDY+  ISTKYPYWNR+LG DHF+L CHDW P IS+  P LFKNSI
Sbjct  230   VRHNRAWSPLQNIARDYVKLISTKYPYWNRTLGCDHFILGCHDWTPMISNAVPDLFKNSI  289

Query  838   RVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVM  1017
             RV+CNANTSEGFKP+ DVSLPEIYLP G MDGLIGG PPS RSVLVFYAGGIHGYIRQV+
Sbjct  290   RVLCNANTSEGFKPSTDVSLPEIYLPHGTMDGLIGGMPPSERSVLVFYAGGIHGYIRQVL  349

Query  1018  METWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIK  1197
             M+ W++KDP+++IHEYLPKN+SYY M RKSKYCICPSG+EVASPRMVE +YMGCVPVL+K
Sbjct  350   MDQWKDKDPDIQIHEYLPKNMSYYSMFRKSKYCICPSGWEVASPRMVEGLYMGCVPVLLK  409

Query  1198  DHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPP  1377
             DHYAKPF DVLDW TF+VD+PV +IP+LKKIL +IPQE+Y  MQ+ GI VRRHFEVNFPP
Sbjct  410   DHYAKPFNDVLDWSTFSVDVPVNQIPDLKKILTAIPQEQYQEMQKTGILVRRHFEVNFPP  469

Query  1378  KRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             KRYDVFHM+LHSIWLRR+NI++HD  E+
Sbjct  470   KRYDVFHMILHSIWLRRINIQLHDTHES  497



>ref|XP_011101497.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=465

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/389 (71%), Positives = 333/389 (86%), Gaps = 0/389 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             K  ++LER EA LAR RA I++AQ  N+   DPDYVP GP+YRNP+AFHRSYLEMEK F+
Sbjct  77    KNYSDLERAEASLARARARIQEAQRSNQTSYDPDYVPSGPMYRNPNAFHRSYLEMEKLFR  136

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             I++YE+G+PP+FHYS S GILGIEGILIH +EIS FRT++P KAHVFF+P S+ S+ ++ 
Sbjct  137   IYVYEDGDPPLFHYSKSLGILGIEGILIHHIEISNFRTRDPGKAHVFFVPISAQSIANYA  196

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             +V     W P+Q  ARDY+N ISTKYPYWNR+LG+DHFMLACHDWAP IS G P LFKNS
Sbjct  197   YVIHNRAWSPLQNIARDYVNLISTKYPYWNRTLGHDHFMLACHDWAPKISKGVPLLFKNS  256

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNANTSEGFKP++DVS+PEIYLP G MDGLIGGPPPS RSVLVFY+GG+HGYIRQ+
Sbjct  257   IRVLCNANTSEGFKPSVDVSMPEIYLPGGKMDGLIGGPPPSTRSVLVFYSGGVHGYIRQI  316

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             +M+ W++KDPEV+IHEYLP+N+SYYGM RKSKYCICPSG+EVASPR VEA+Y GCVPVL+
Sbjct  317   LMDQWKDKDPEVQIHEYLPRNMSYYGMFRKSKYCICPSGWEVASPRTVEALYTGCVPVLL  376

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
             KDHYAKPF DVLDW  F+VDI V +IP LK +L +IP+E+Y+ MQ  G++VRRHFEVNFP
Sbjct  377   KDHYAKPFDDVLDWSKFSVDIRVSQIPELKNVLKAIPEERYIEMQRIGVEVRRHFEVNFP  436

Query  1375  PKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PKRYDVFHM+LHSIWLRR+N+++HD  E 
Sbjct  437   PKRYDVFHMILHSIWLRRMNVQLHDTYEN  465



>gb|EYU41560.1| hypothetical protein MIMGU_mgv1a005355mg [Erythranthe guttata]
Length=487

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/389 (71%), Positives = 329/389 (85%), Gaps = 1/389 (0%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
              L NL+ VEA LA+ R  + QA+  N    DPDYVP G IYRN +AFHRSYLEMEK FKI
Sbjct  99    NLDNLDMVEASLAKARETMHQARLNNETSFDPDYVPEGSIYRNANAFHRSYLEMEKLFKI  158

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFVF  657
             ++YE+G+PP+FHYS S+GILGIEGILIHQ+EISKFRT++P KAHV+F+P S  S+  + +
Sbjct  159   YVYEDGDPPLFHYSKSKGILGIEGILIHQIEISKFRTRDPGKAHVYFIPLSVQSIATYAY  218

Query  658   VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSI  837
             V     W P+Q  ARDY+  ISTKYP+WN++LG DHF+L CHDW PTISHG P LFKNSI
Sbjct  219   VIHNRAWSPLQNIARDYVKLISTKYPHWNQTLGRDHFILGCHDWTPTISHGVPLLFKNSI  278

Query  838   RVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVM  1017
             RV+CNANTSEGFKP+IDVS+PEIYLP+G MDGLIGGPPPS+RS+LVFYAGG+HG IRQ++
Sbjct  279   RVLCNANTSEGFKPSIDVSMPEIYLPEGTMDGLIGGPPPSDRSILVFYAGGVHGPIRQML  338

Query  1018  METW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             M+ W +NKDPEV+IHEYLPKN+SYY + R+SKYCICPSG+EVASPRMVEA+YMGCVPVL+
Sbjct  339   MDQWKDNKDPEVQIHEYLPKNMSYYDVFRRSKYCICPSGWEVASPRMVEALYMGCVPVLL  398

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
             K+ YAKPF DVLDW TFAVD+ V EI +LKKIL+ I  EKY+ MQ +GI+VRRHFEVNFP
Sbjct  399   KESYAKPFDDVLDWSTFAVDVRVDEIRDLKKILMGISTEKYVEMQREGIRVRRHFEVNFP  458

Query  1375  PKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PKRYDVFHMVLHSIWLRR+N+++HD  ET
Sbjct  459   PKRYDVFHMVLHSIWLRRINVQLHDAHET  487



>ref|XP_009593674.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=402

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 312/362 (86%), Gaps = 1/362 (0%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
              + K L+NLE+VEAGL +VRAAIR+AQT+N   +D +Y P GP Y N  AFHRSYLEMEK
Sbjct  3     SSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYLEMEK  62

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLV  645
              FKI++YEEGEPPVFHYS S+GILGIEGILIHQ+EISKFRT  PEKAHV+FLPFS +S+V
Sbjct  63    HFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSVFSIV  122

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              +V+V D+H+W P++ TA DYI+ IS KYP+WNRSLG DHFMLACHDWAP IS   P L+
Sbjct  123   SYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEISTAVPYLY  182

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KNSIRV+CNANTSE F P+ DV+LPEIYLPQG M+GLIGGP PS RS+LVFYAGGIHGYI
Sbjct  183   KNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYAGGIHGYI  242

Query  1006  RQVMMETW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             RQV+ME W EN DPEV+IHEYLPKNVSYYGM+RKSK+CICPSG+EVASPRMVEA Y+GCV
Sbjct  243   RQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEAFYIGCV  302

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVL+KD+Y  PF+DVL+W +FAV++   +IPNLKKIL+SI Q++Y+ MQ++G+QVRRHFE
Sbjct  303   PVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGLQVRRHFE  362

Query  1363  VN  1368
             VN
Sbjct  363   VN  364



>ref|XP_009593673.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=486

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 312/362 (86%), Gaps = 1/362 (0%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
              + K L+NLE+VEAGL +VRAAIR+AQT+N   +D +Y P GP Y N  AFHRSYLEMEK
Sbjct  87    SSKKNLSNLEKVEAGLGKVRAAIREAQTKNLTSDDSEYAPKGPCYWNSSAFHRSYLEMEK  146

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLV  645
              FKI++YEEGEPPVFHYS S+GILGIEGILIHQ+EISKFRT  PEKAHV+FLPFS +S+V
Sbjct  147   HFKIYVYEEGEPPVFHYSSSEGILGIEGILIHQIEISKFRTNYPEKAHVYFLPFSVFSIV  206

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              +V+V D+H+W P++ TA DYI+ IS KYP+WNRSLG DHFMLACHDWAP IS   P L+
Sbjct  207   SYVYVVDSHQWGPMKNTAADYIDSISRKYPFWNRSLGSDHFMLACHDWAPEISTAVPYLY  266

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KNSIRV+CNANTSE F P+ DV+LPEIYLPQG M+GLIGGP PS RS+LVFYAGGIHGYI
Sbjct  267   KNSIRVLCNANTSERFNPSKDVTLPEIYLPQGTMEGLIGGPSPSQRSILVFYAGGIHGYI  326

Query  1006  RQVMMETW-ENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             RQV+ME W EN DPEV+IHEYLPKNVSYYGM+RKSK+CICPSG+EVASPRMVEA Y+GCV
Sbjct  327   RQVLMEQWGENDDPEVQIHEYLPKNVSYYGMIRKSKFCICPSGWEVASPRMVEAFYIGCV  386

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVL+KD+Y  PF+DVL+W +FAV++   +IPNLKKIL+SI Q++Y+ MQ++G+QVRRHFE
Sbjct  387   PVLLKDNYVAPFSDVLNWKSFAVEMTSNDIPNLKKILMSISQKQYIKMQKRGLQVRRHFE  446

Query  1363  VN  1368
             VN
Sbjct  447   VN  448



>ref|XP_009631064.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=461

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 318/390 (82%), Gaps = 2/390 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAI-RQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             K+ + LE++EAGLA+ RAAI ++ ++ N   ED +Y+PHGP+Y N  AFHRSYLEME +F
Sbjct  73    KRYSKLEKLEAGLAKARAAILKENKSWNNQTED-EYIPHGPMYLNATAFHRSYLEMENKF  131

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             K+++Y+EGEPPVFH+   +    IEG  IH +EIS+FRT +P KAHV+FLP S   L  F
Sbjct  132   KVYVYKEGEPPVFHFGPCKHTYAIEGYFIHTMEISEFRTSDPNKAHVYFLPMSVTMLTQF  191

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             ++V D+HEW  ++ TA DY+N IS KYPYWNRSLG DHFMLACHDW P IS   P L+KN
Sbjct  192   IYVHDSHEWGLMKNTALDYVNVISNKYPYWNRSLGADHFMLACHDWGPEISFAIPYLYKN  251

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSE F P  DVS+PEI+LP G  +GL+GGPPPS R VLVF+AGG+HG IR 
Sbjct  252   SIRALCNANTSEKFNPTKDVSIPEIHLPYGTTEGLLGGPPPSERPVLVFFAGGLHGPIRP  311

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++++ WENKD +V+IH+YLPK +SYY M++KSKYCICPSGYEVASPRMVE +YMGCVPVL
Sbjct  312   ILLQHWENKDKDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVPVL  371

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             IKD+Y  PF+DVLDW+TF+V IPVK+IPNLKKILL IPQEKYL MQ++GIQ+R+HFEVN 
Sbjct  372   IKDNYVIPFSDVLDWNTFSVIIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRKHFEVNS  431

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PPKRYDVFHM+LHSIWLRRLN+ + D+ E+
Sbjct  432   PPKRYDVFHMILHSIWLRRLNVRIRDVDES  461



>ref|XP_009617933.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=550

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 316/388 (81%), Gaps = 1/388 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             +K +NLER+EA L + RAAI++A T     +D DY+P GP+Y N +AFHRSYLEMEK+FK
Sbjct  161   RKFSNLERLEAKLGKFRAAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFK  220

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +F+YEEG+ P+FH    + I  +EG  I+Q+E +KFRT++PEKAH+FFLP S  ++VHF+
Sbjct  221   VFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFI  280

Query  655   FVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             + R++ E W P+++T RDYIN ++ KYPYWNRSLG DHFMLACHDW P IS   P+LFKN
Sbjct  281   YDRNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKN  340

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGFKP+ DVS PEI LP G MDGLIGGP PS+RS+L F+AGG+HG IR 
Sbjct  341   SIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRP  400

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD ++++H YLPK VSYYGM+RKSKYC+CPSGYEVASPRMVEA+Y GCVPVL
Sbjct  401   ILLEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVL  460

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             IKDHY  PF+DVL+W +F+V++ V+EIPNLKKIL  I   +Y+ +Q +G QVRRHFEVN 
Sbjct  461   IKDHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNM  520

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKRYDVFHM+LHSIWLRRLN+ +  ++
Sbjct  521   PPKRYDVFHMILHSIWLRRLNMRIRGVE  548



>ref|XP_009617934.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=549

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 316/388 (81%), Gaps = 1/388 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             +K +NLER+EA L + RAAI++A T     +D DY+P GP+Y N +AFHRSYLEMEK+FK
Sbjct  160   RKFSNLERLEAKLGKFRAAIKEAATSGNQTDDADYIPSGPMYWNANAFHRSYLEMEKQFK  219

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +F+YEEG+ P+FH    + I  +EG  I+Q+E +KFRT++PEKAH+FFLP S  ++VHF+
Sbjct  220   VFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFI  279

Query  655   FVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             + R++ E W P+++T RDYIN ++ KYPYWNRSLG DHFMLACHDW P IS   P+LFKN
Sbjct  280   YDRNSKEHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFMLACHDWGPEISKAVPELFKN  339

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGFKP+ DVS PEI LP G MDGLIGGP PS+RS+L F+AGG+HG IR 
Sbjct  340   SIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSHRSILAFFAGGLHGPIRP  399

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD ++++H YLPK VSYYGM+RKSKYC+CPSGYEVASPRMVEA+Y GCVPVL
Sbjct  400   ILLEHWENKDDDIQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVL  459

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             IKDHY  PF+DVL+W +F+V++ V+EIPNLKKIL  I   +Y+ +Q +G QVRRHFEVN 
Sbjct  460   IKDHYVLPFSDVLNWKSFSVEVLVEEIPNLKKILAGISTRQYIRLQRRGKQVRRHFEVNM  519

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKRYDVFHM+LHSIWLRRLN+ +  ++
Sbjct  520   PPKRYDVFHMILHSIWLRRLNMRIRGVE  547



>ref|XP_004249790.2| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=472

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/453 (59%), Positives = 339/453 (75%), Gaps = 17/453 (4%)
 Frame = +1

Query  151   VPLILVSAFYALHsssgfesvfsseTHPWLRGFSMPFYQLPSSHPDAM------------  294
             +PL LV+AF  +++  G +   S   H +L   +       ++  D +            
Sbjct  21    LPLFLVAAFVVINNPQGSKFWLSISHHHYLETLNHGSSTKETNEKDEVPIINVNKNTTTP  80

Query  295   KKLTNLERVEAGLARVRAAI---RQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K+ + ++++EAGLAR RAAI   RQ +T N I E+ +Y+PHGP+Y N  +FHRSYLEMEK
Sbjct  81    KRFSKIDKLEAGLARSRAAILLSRQNKT-NHIEEEEEYIPHGPMYLNATSFHRSYLEMEK  139

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLV  645
             +FK+++Y+EG+PP++H+   +    IEG  I  +E+SKFRT+NP KAHV+FLP S   L+
Sbjct  140   KFKVYVYKEGDPPLYHFGPCKHTYAIEGYFIQAMEVSKFRTENPNKAHVYFLPLSITMLI  199

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              F++V ++HEW  ++ T  DYIN IS KYPYWN SLG DHFMLACHDW P IS   P L+
Sbjct  200   EFIYVAESHEWGLMKNTTMDYINVISQKYPYWNTSLGADHFMLACHDWGPEISFAIPHLY  259

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KNSIR +CNANTSE F P  DVS+PEI+LP G   GL+GGPPPS+R VLVF+AGG+HG I
Sbjct  260   KNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRRVLVFFAGGVHGPI  319

Query  1006  RQVMMETWEN-KDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             R ++++ WEN KD +V+IH+YLPK VSYY M+RKSKYCICPSGYEVASPRMVE +YMGCV
Sbjct  320   RPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRMVEGLYMGCV  379

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLIKD+Y  PF+DVLDWDTF V I VK+IPNLKKIL+ IPQ KYL MQ++GIQ+RRHFE
Sbjct  380   PVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPNLKKILMDIPQHKYLEMQKRGIQMRRHFE  439

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             VN PPKRYDVFHM+LHSIWLRRLN  VHD++E+
Sbjct  440   VNSPPKRYDVFHMILHSIWLRRLNFRVHDVEES  472



>ref|XP_009774930.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=455

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/392 (66%), Positives = 312/392 (80%), Gaps = 2/392 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAI-RQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             A K+ + LE++EAGLA+ RA I R+    N   ED +Y+PHGP+Y N  AFHRSYLEMEK
Sbjct  65    APKRYSKLEKLEAGLAKARATILRENNNWNNQTED-EYIPHGPMYLNATAFHRSYLEMEK  123

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLV  645
              FK+++Y+EGEPPVFH+   +    IEG  IH +EISKFRT +P KAHV+FLP S   L 
Sbjct  124   NFKVYVYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLT  183

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+VRD+HEW  ++  A DY+N IS KYP+WNRSLG DHF+LACHDW P IS   P L+
Sbjct  184   QFVYVRDSHEWGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLY  243

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KNSIR +CNANTSE F P  DVS+PEI+LP G   GL+GGPPPS R VLVF+AGG+HG I
Sbjct  244   KNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPI  303

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R ++++ WENKD +V+IH+YLPK +SYY M++KSKYCICPSGYEVASPRMVE +YMGCVP
Sbjct  304   RPILLQHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVP  363

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLIKD+Y  PF+DVLDW TF+V IPVK+IPNLKKILL IPQEKYL MQ++GIQ+RRHFEV
Sbjct  364   VLIKDNYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEV  423

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             N PPK YDVFHM+LHSIWLRRLN+ +  + E+
Sbjct  424   NSPPKIYDVFHMILHSIWLRRLNVRIRHVDES  455



>ref|XP_009774931.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=454

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/392 (66%), Positives = 312/392 (80%), Gaps = 2/392 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAI-RQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             A K+ + LE++EAGLA+ RA I R+    N   ED +Y+PHGP+Y N  AFHRSYLEMEK
Sbjct  64    APKRYSKLEKLEAGLAKARATILRENNNWNNQTED-EYIPHGPMYLNATAFHRSYLEMEK  122

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLV  645
              FK+++Y+EGEPPVFH+   +    IEG  IH +EISKFRT +P KAHV+FLP S   L 
Sbjct  123   NFKVYVYKEGEPPVFHFGPCKHTYAIEGYFIHAMEISKFRTSDPNKAHVYFLPMSVTMLT  182

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+VRD+HEW  ++  A DY+N IS KYP+WNRSLG DHF+LACHDW P IS   P L+
Sbjct  183   QFVYVRDSHEWGLMKNIALDYVNIISNKYPFWNRSLGADHFILACHDWGPEISFAIPYLY  242

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KNSIR +CNANTSE F P  DVS+PEI+LP G   GL+GGPPPS R VLVF+AGG+HG I
Sbjct  243   KNSIRALCNANTSEKFNPTKDVSIPEIHLPYGTTKGLLGGPPPSERPVLVFFAGGLHGPI  302

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R ++++ WENKD +V+IH+YLPK +SYY M++KSKYCICPSGYEVASPRMVE +YMGCVP
Sbjct  303   RPILLQHWENKDEDVQIHKYLPKGISYYDMIKKSKYCICPSGYEVASPRMVEGLYMGCVP  362

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLIKD+Y  PF+DVLDW TF+V IPVK+IPNLKKILL IPQEKYL MQ++GIQ+RRHFEV
Sbjct  363   VLIKDNYVIPFSDVLDWTTFSVLIPVKDIPNLKKILLDIPQEKYLEMQKRGIQMRRHFEV  422

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             N PPK YDVFHM+LHSIWLRRLN+ +  + E+
Sbjct  423   NSPPKIYDVFHMILHSIWLRRLNVRIRHVDES  454



>ref|XP_006339310.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=427

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 317/395 (80%), Gaps = 6/395 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAI---RQAQTEN--RILEDPDYVPHGPIYRNPHAFHRSYLEM  459
             K+ + +E++EAGLAR RAAI   RQ ++ +     ED +Y+PHGP+Y N  +FHRSYLEM
Sbjct  33    KRFSKIEKLEAGLARARAAILLLRQNKSNHIEEEEEDDEYIPHGPMYLNATSFHRSYLEM  92

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYS  639
             EK+FK+++Y+EGEPP++H+   +    IEG  I  +E+SKFRT+NP KAHV+FLP S   
Sbjct  93    EKKFKVYVYKEGEPPLYHFGPCKQTYAIEGYFIQAIEVSKFRTENPNKAHVYFLPLSVTM  152

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             L+ F++V ++HEW  ++ T  DY+N IS KYPYWNRSLG DHFMLACHDWAP IS   P 
Sbjct  153   LIEFIYVAESHEWGLMKNTTMDYVNVISQKYPYWNRSLGADHFMLACHDWAPEISFAIPH  212

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             L+KNSIR +CNANTSE F P  DVS+PEI+LP G   GL+GGPPPS+R VLVF+AGG+HG
Sbjct  213   LYKNSIRALCNANTSEKFNPTKDVSIPEIHLPLGTTKGLLGGPPPSDRPVLVFFAGGVHG  272

Query  1000  YIRQVMMETWEN-KDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
              IR ++++ WEN KD +V+IH+YLPK VSYY M+RKSKYCICPSGYEVASPRMVE +YMG
Sbjct  273   PIRPILLQHWENSKDEDVQIHKYLPKGVSYYDMIRKSKYCICPSGYEVASPRMVEGLYMG  332

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLIKD+Y  PF+DVLDWDTF V I VK+IP LKKIL+ IPQ+KYL MQ++GIQ+RRH
Sbjct  333   CVPVLIKDNYVTPFSDVLDWDTFVVTIHVKDIPKLKKILMDIPQDKYLEMQKRGIQMRRH  392

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             FEVN PPKRYDVFHM+LHSIWLRRLN  VHD+ E+
Sbjct  393   FEVNSPPKRYDVFHMILHSIWLRRLNFRVHDVDES  427



>ref|XP_006366795.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=519

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/388 (63%), Positives = 309/388 (80%), Gaps = 1/388 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             KK TNLE++E  L + RAAI++A       +D DYVP GP+Y NP AFHRSYLEMEK FK
Sbjct  130   KKFTNLEKLEVKLGKARAAIKEAAVSGNQTDDSDYVPSGPMYWNPKAFHRSYLEMEKEFK  189

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +F+YEEGE P+FH    + I  +EG  I+Q+E SKFRT++PEKAHVFFLP S  S+VHF+
Sbjct  190   VFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSIVHFI  249

Query  655   FVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             + R++ E W P+++T  DYIN +S KYPYWNRSLG DHFMLACHDW P +S   P+LFKN
Sbjct  250   YDRNSREHWNPMKQTLTDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKAVPELFKN  309

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGFKP+ DVS PEI LP G M+GLIGGP PS RS+L F+AGG+HG IR 
Sbjct  310   SIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLIGGPSPSRRSILAFFAGGLHGPIRP  369

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD ++++H YLPK VSYYGM+R SK+C+CPSGYEVASPRMVEA+Y GCVPVL
Sbjct  370   ILLEHWENKDDDIQVHRYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGCVPVL  429

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             +KDHY  PF+DVL+W +F+V++PV  IP+LKKIL  I   +Y+ +Q +G QVRRHFEVN 
Sbjct  430   LKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILAGISTRQYIRLQRRGKQVRRHFEVNM  489

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
              P+RYDVFHM+LHS+WLRRLN+ +H ++
Sbjct  490   IPQRYDVFHMILHSVWLRRLNMRLHGLE  517



>ref|XP_009779883.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=550

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/388 (63%), Positives = 314/388 (81%), Gaps = 1/388 (0%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             +K +NLER+EA L + RA+I++A       +D DYVP GP+Y N +AFHRSYLEMEK+FK
Sbjct  161   RKFSNLERLEAKLWKSRASIKEAAMSGNQTDDSDYVPSGPMYWNANAFHRSYLEMEKQFK  220

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +F+YEEG+ P+FH    + I  +EG  I+Q+E +KFRT++PEKAH+FFLP S  ++VHF+
Sbjct  221   VFVYEEGDQPIFHNGPCKSIYAMEGNFIYQMETTKFRTRDPEKAHIFFLPISVTAIVHFI  280

Query  655   FVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             + R++ E W P+++T RDYIN ++ KYPYWNRSLG DHF+LACHDW P IS   P+LFKN
Sbjct  281   YDRNSREHWNPMKQTLRDYINLVAGKYPYWNRSLGADHFILACHDWGPEISKAVPELFKN  340

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGFKP+ DVS PEI LP G MDGLIGGP PS RS+L F+AGG+HG IR 
Sbjct  341   SIRALCNANTSEGFKPSKDVSFPEILLPGGTMDGLIGGPSPSRRSILAFFAGGLHGPIRP  400

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++++ WENKD ++++H YLPK VSYYGM+RKSKYC+CPSGYEVASPRMVEA+Y GCVPVL
Sbjct  401   ILLDHWENKDDDMQVHRYLPKGVSYYGMLRKSKYCLCPSGYEVASPRMVEALYTGCVPVL  460

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             +KDHY  PF+DVL+W +F+V++PV+EIPNLK IL  I   +Y+ +Q +G QVRRHFEVN 
Sbjct  461   LKDHYVPPFSDVLNWKSFSVEVPVEEIPNLKNILAGISTRQYIRLQRRGKQVRRHFEVNL  520

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKRYDVFHM+LHSIWLRRLN+ +  ++
Sbjct  521   PPKRYDVFHMILHSIWLRRLNMRLRGVE  548



>ref|XP_004494122.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=526

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/409 (62%), Positives = 322/409 (79%), Gaps = 3/409 (1%)
 Frame = +1

Query  235   WLRGFSM-PFYQLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHG  411
             W    SM   Y +P   P+  +K + L+R EAGL + RAAIR+A+  N+  +D DYVP G
Sbjct  119   WTNTTSMNESYYIPLEKPNLPRKFSILDRTEAGLLQARAAIRKARNGNQT-QDIDYVPIG  177

Query  412   PIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRT  588
             P+Y NP+AFHRSYLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT
Sbjct  178   PMYYNPNAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHTIEMNDQFRT  237

Query  589   KNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHF  768
             ++P+KAHVFFLPFS   +V FV+VRD+H++ PI+KT  DYIN IS +YP+WNRSLG DHF
Sbjct  238   RDPDKAHVFFLPFSVAMMVQFVYVRDSHDFSPIKKTVADYINVISERYPFWNRSLGADHF  297

Query  769   MLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGP  948
             ML+CHDW P +S+  P L+KNSIR +CNANTSEGFKPA DVS PEI L  G + G +GGP
Sbjct  298   MLSCHDWGPEVSNSVPNLYKNSIRALCNANTSEGFKPAKDVSFPEINLQTGTIHGFVGGP  357

Query  949   PPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPS  1128
              PS RSVL F+AGG+HG IR ++++ WENKD ++++H+YLPK VSYY M+RKSK+C+CPS
Sbjct  358   SPSKRSVLAFFAGGLHGPIRPILLDHWENKDEDIQVHKYLPKGVSYYDMLRKSKFCLCPS  417

Query  1129  GYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQ  1308
             GYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ V +IPNLKKILLSI  
Sbjct  418   GYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVDDIPNLKKILLSISP  477

Query  1309  EKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
              +Y+ MQ +  QVRRHFEV+ PPKR+DVFHM+LHSIWLRRLN  VHD Q
Sbjct  478   RQYIRMQRRVGQVRRHFEVHSPPKRFDVFHMILHSIWLRRLNFRVHDDQ  526



>ref|XP_004246587.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Solanum lycopersicum]
Length=534

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 308/392 (79%), Gaps = 1/392 (0%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             P   KK TNLE++E  L + RAAI++A T     +D DYVP GP+Y N  AFHRSYLEME
Sbjct  141   PKIKKKFTNLEKLEVKLGKARAAIKEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEME  200

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSL  642
             K  K+F+YEEGE P+FH    + I  +EG  I+Q+E SKFRT++PEKAHVFFLP S  S+
Sbjct  201   KELKVFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSI  260

Query  643   VHFVFVRDAH-EWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             VHF++ R++   W P+++T  DYIN +S KYPYWNRSLG DHFMLACHDW P +S   P+
Sbjct  261   VHFIYDRNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPE  320

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LFKNSIR +CNANTSEGFKP+ DVS PEI LP G M+GL+GGP PS RS+L F+AGG+HG
Sbjct  321   LFKNSIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHG  380

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR +++E WENKD ++++H+YLPK VSYYGM+R SK+C+CPSGYEVASPRMVEA+Y GC
Sbjct  381   PIRPILLEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGC  440

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVL+KDHY  PF+DVL+W +F+V++PV  IP+LKKIL  I   +Y+ +Q +G QVRRHF
Sbjct  441   VPVLLKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHF  500

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             EVN   KRYDVFHM+LHS+WLRRLN+ +H ++
Sbjct  501   EVNMFAKRYDVFHMILHSVWLRRLNMRLHGLE  532



>ref|XP_010325948.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 308/392 (79%), Gaps = 1/392 (0%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             P   KK TNLE++E  L + RAAI++A T     +D DYVP GP+Y N  AFHRSYLEME
Sbjct  142   PKIKKKFTNLEKLEVKLGKARAAIKEAATFGNQTDDSDYVPSGPMYWNAKAFHRSYLEME  201

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSL  642
             K  K+F+YEEGE P+FH    + I  +EG  I+Q+E SKFRT++PEKAHVFFLP S  S+
Sbjct  202   KELKVFVYEEGEQPIFHNGPCKSIYAMEGNFIYQMETSKFRTRDPEKAHVFFLPISVTSI  261

Query  643   VHFVFVRDAH-EWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             VHF++ R++   W P+++T  DYIN +S KYPYWNRSLG DHFMLACHDW P +S   P+
Sbjct  262   VHFIYDRNSRGHWDPMRQTVMDYINLVSGKYPYWNRSLGADHFMLACHDWGPELSKSVPE  321

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LFKNSIR +CNANTSEGFKP+ DVS PEI LP G M+GL+GGP PS RS+L F+AGG+HG
Sbjct  322   LFKNSIRALCNANTSEGFKPSKDVSFPEILLPGGTMNGLLGGPSPSRRSILAFFAGGLHG  381

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR +++E WENKD ++++H+YLPK VSYYGM+R SK+C+CPSGYEVASPRMVEA+Y GC
Sbjct  382   PIRPILLEHWENKDDDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEVASPRMVEALYTGC  441

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVL+KDHY  PF+DVL+W +F+V++PV  IP+LKKIL  I   +Y+ +Q +G QVRRHF
Sbjct  442   VPVLLKDHYVPPFSDVLNWKSFSVEVPVDRIPDLKKILSGISTRQYIRLQRRGKQVRRHF  501

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             EVN   KRYDVFHM+LHS+WLRRLN+ +H ++
Sbjct  502   EVNMFAKRYDVFHMILHSVWLRRLNMRLHGLE  533



>ref|XP_002528630.1| catalytic, putative [Ricinus communis]
 gb|EEF33733.1| catalytic, putative [Ricinus communis]
Length=574

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 308/388 (79%), Gaps = 2/388 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             K  TNLER+EAGL   RAAI++A+  N+  EDP+YVP GP+Y N   FHRSYLEMEK+FK
Sbjct  183   KAFTNLERLEAGLQNARAAIKEAKNGNQT-EDPEYVPIGPMYWNSKVFHRSYLEMEKQFK  241

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPPVFH    + I  +EG  IH++EI  +FRTK+PEKAHV+FLPFS   +V F
Sbjct  242   VFVYEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPEKAHVYFLPFSVAMMVQF  301

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T RDY+N ++ KYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  302   VYVRDSHDFGPIKRTVRDYVNLVAGKYPYWNRSLGADHFMLACHDWGPETSFSLPDLAKN  361

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSE F P  DVS PEI L  G   G IGGP PS RS+L F+AGG+HG IR 
Sbjct  362   SIRALCNANTSERFNPIKDVSFPEINLQTGTTKGFIGGPSPSKRSILAFFAGGLHGPIRP  421

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD ++++H YLPK VSYY M+RKSK+C+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  422   ILLEHWENKDNDMKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVVEALYTGCVPVL  481

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DVL+W +F+V++PV +IPNLK+IL SI   +Y+ MQ + +QVRRHFEVN 
Sbjct  482   ISDHYVPPFSDVLNWKSFSVEVPVSDIPNLKRILTSISSRQYIRMQRRVLQVRRHFEVNS  541

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKRYDVFHM+LHSIWLRRLN+++HD Q
Sbjct  542   PPKRYDVFHMILHSIWLRRLNVKIHDDQ  569



>gb|KEH24081.1| glycosyltransferase [Medicago truncatula]
Length=401

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/398 (62%), Positives = 316/398 (79%), Gaps = 2/398 (1%)
 Frame = +1

Query  265   QLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHR  444
             Q+    P+  +K + L+R EAGL + RAAIR+A+ ENR  +D DYVP GP+Y NP++FHR
Sbjct  5     QILLQKPNLPRKFSILDRTEAGLLQARAAIRKARNENRT-QDIDYVPTGPMYHNPNSFHR  63

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFL  621
             SYLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT++PEKAHVFFL
Sbjct  64    SYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDRFRTRDPEKAHVFFL  123

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   +V FV+VRD+H++ PI+KT  DYIN +S KYP+WNRSLG DHFML+CHDW P  
Sbjct  124   PFSVAKMVQFVYVRDSHDFSPIRKTITDYINVVSEKYPFWNRSLGADHFMLSCHDWGPET  183

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S   P L+KNSIR +CNANTSEGFKPA DVS+PE  L  G + G++GGP PS RSVL F+
Sbjct  184   SKSVPNLYKNSIRALCNANTSEGFKPAKDVSIPETNLQTGTIHGIVGGPSPSKRSVLAFF  243

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG +R V++E WE+KD ++++H+YLPK VSYY M+RKSK+C+CPSGYEVASPR+VE
Sbjct  244   AGGVHGPVRPVLLEHWEHKDEDLQVHKYLPKGVSYYDMLRKSKFCLCPSGYEVASPRVVE  303

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+Y GCVPVLI DHY  PF+DVL+W +F+V++ V +IPNLKKIL SI   +Y+ MQ +  
Sbjct  304   AIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILTSISPRQYIRMQRRVG  363

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             QVRRHFEV+ PP R+DVFHM+LHSIWLRRLN  +HD Q
Sbjct  364   QVRRHFEVHSPPTRFDVFHMILHSIWLRRLNFRLHDDQ  401



>ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=546

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/385 (65%), Positives = 312/385 (81%), Gaps = 2/385 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ T LERVEAGL R R+AIR+A+  NR   DPDY+P+GPIY N +AFHRSYLEMEK+ K
Sbjct  157   RQYTTLERVEAGLRRARSAIREAKIGNRT-PDPDYIPNGPIYWNVNAFHRSYLEMEKQLK  215

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             +++Y+EGEPP+FH    + I  +EG  IH++E+ S FRTK+PEKAH+FFLPFS   LV F
Sbjct  216   VYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSVAMLVRF  275

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H+  PI++T  DY+N +STKYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  276   VYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSIPYLHKN  335

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L  G+ D  IGGP PS+R++L F+AGG+HG IR 
Sbjct  336   SIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGLHGPIRP  395

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD +V++H+YLPK VSYY M+RKSKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  396   ILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYTGCVPVL  455

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DVL+W +F+V++PV+EIPNLK+IL+ I   +Y+ MQ +GIQ RRHFEVN 
Sbjct  456   ISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARRHFEVNS  515

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVH  1446
             PPKRYDVFHM+LHS+WLRRLN  VH
Sbjct  516   PPKRYDVFHMILHSLWLRRLNFRVH  540



>gb|EYU41561.1| hypothetical protein MIMGU_mgv1a004154mg [Erythranthe guttata]
Length=541

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/394 (63%), Positives = 314/394 (80%), Gaps = 3/394 (1%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             P   ++ +NL+ +EA + + R AIR A+ E+ ++ DPDYVP GPIY NP AFHRSYLEME
Sbjct  148   PGINRRFSNLQILEAKMQQSRTAIRDARKES-VIHDPDYVPSGPIYWNPSAFHRSYLEME  206

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSL  642
             K FK+F+YEEGE P+FH      I  +EG  I++LEISKFRT++PEKAHVFFLPFS  S+
Sbjct  207   KNFKVFVYEEGEHPIFHNGPCGSIYSMEGNFIYKLEISKFRTRDPEKAHVFFLPFSVTSI  266

Query  643   VHFVFVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             VHF+F +++ + W P+++T  DY+  ++ KYPYWNRSLG DHFML+CHDW P +S   P+
Sbjct  267   VHFIFDKNSRDHWLPMKQTVSDYVELVAAKYPYWNRSLGSDHFMLSCHDWGPELSKSLPE  326

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIR +CNANT+EGFKP+ DVS+PEI LP G  +GLIGGP PS R VLVF+AGG+HG
Sbjct  327   LFNNSIRALCNANTTEGFKPSKDVSIPEINLPGGRTNGLIGGPSPSRRPVLVFFAGGLHG  386

Query  1000  YIRQVMMETWEN-KDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
              IR  ++E WEN KD +V+IH+YLPKNVSY  ++RKSKYC+CPSGYEVASPRMVEA+Y G
Sbjct  387   PIRPALLEHWENSKDKDVQIHQYLPKNVSYSALMRKSKYCVCPSGYEVASPRMVEALYTG  446

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVL+KDHY  PF+DVL+W +FAV+IPV +IPNL+ ILL I   +Y+ MQ +G+ VRRH
Sbjct  447   CVPVLVKDHYVPPFSDVLNWKSFAVEIPVGDIPNLRNILLGISTRQYIRMQRRGVTVRRH  506

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
             FEVN  PKRYDVFHM+LHSIWLRRLN+ +H +++
Sbjct  507   FEVNLTPKRYDVFHMILHSIWLRRLNVRLHGVED  540



>ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=537

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/397 (63%), Positives = 311/397 (78%), Gaps = 2/397 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             LP   P   +K + L+R EAGL + RAAIR+A+  N+  +D DYVP GP+Y N +AFHRS
Sbjct  142   LPPERPKLQRKFSILDRTEAGLRQARAAIREARNGNQT-QDIDYVPVGPMYNNANAFHRS  200

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLP  624
             YLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT++PE+AHVFFLP
Sbjct  201   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEEAHVFFLP  260

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   LV FV+VRD+H++ PI+KT  DY+N I  +YPYWNRSLG DHF LACHDW P  S
Sbjct  261   FSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGPETS  320

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L KNSIRV+CNANTSEGFKP+ DVS PEI L  G+++G IGGP  S R +L F+A
Sbjct  321   RSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLAFFA  380

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR V++E WENKD ++++H+YLPK VSYY M+RKSK+C+CPSGYEVASPR+VEA
Sbjct  381   GGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEA  440

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI DHY  PF DVL+W +F+V++ VK+IP LK+ILLSI   +Y+ MQ +  Q
Sbjct  441   IYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRRVGQ  500

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             VRRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VHD Q
Sbjct  501   VRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHDDQ  537



>ref|XP_010248410.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=646

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/393 (64%), Positives = 313/393 (80%), Gaps = 4/393 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K  + LER+E+GLA++RAAIR+A  Q  NR   D DYVP GP+Y N  AFHRSYLEMEK+
Sbjct  255   KNHSQLERMESGLAKIRAAIREAAHQKGNRT-SDFDYVPEGPMYWNAQAFHRSYLEMEKQ  313

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLV  645
             FKIFIY+EGEPP+FH    + I  +EG  IHQ+E+ K FRT+NPE+AHVFFLPFS   +V
Sbjct  314   FKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAHVFFLPFSVTKMV  373

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+V ++H+  PI++T  DY+N I+ KYPYWNRSL  DHFML+CHDW P  S   P L+
Sbjct  374   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  433

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KN IRV+CNANTSEGF PA D S PEI L  G   GLIGGPPPS R +L F+AGG+HG I
Sbjct  434   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  493

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R +++E W+NKD +V+++EYLPK +SYY M++KSKYCICPSGYEVASPR+VEA+Y GCVP
Sbjct  494   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  553

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI DHY  PF+DVL+W +F+V++PV EIPNLK+ILLSI   +Y+ MQ +G++VRRHFEV
Sbjct  554   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRRGLKVRRHFEV  613

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             NFPPKR+DV+HM+LHS+WLRRLN+ +HD+Q  S
Sbjct  614   NFPPKRFDVYHMILHSVWLRRLNVRIHDLQLQS  646



>gb|KDP29231.1| hypothetical protein JCGZ_16620 [Jatropha curcas]
Length=452

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 304/385 (79%), Gaps = 1/385 (0%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             ++LER+EAGL   R+AI+ A+  N+ LEDP+YVP GP+Y N   FHRSYLEMEK+F++F+
Sbjct  63    SSLERLEAGLQNARSAIKDAKNGNQTLEDPEYVPTGPMYWNSKVFHRSYLEMEKQFRVFV  122

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             YEEGEPPVFH    + I  +EG  IH++EI  +FRTK+P+KAHV+FLPFS   +V FV+V
Sbjct  123   YEEGEPPVFHNGPCKSIYSMEGNFIHRMEIDDQFRTKDPDKAHVYFLPFSVTMMVRFVYV  182

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             RD+H++ PI++T  DY++ I+ KYP+WNRSLG DHFMLACHDW P  S   P L KNSIR
Sbjct  183   RDSHDFGPIRRTVGDYVSLIAGKYPFWNRSLGADHFMLACHDWGPETSFSVPYLGKNSIR  242

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
              +CNANTSE F P  DVS PEI L  G+  GLIGGP PS RS+L FYAGG+HG IR +++
Sbjct  243   ALCNANTSERFNPIKDVSFPEINLQTGSTKGLIGGPSPSKRSILAFYAGGLHGPIRPILL  302

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
               WENKD ++++H YLPK VSYY M+RKSK+C+CPSGYEVASPR+VEA Y GCVPVLI D
Sbjct  303   AHWENKDDDIKVHRYLPKGVSYYEMMRKSKFCLCPSGYEVASPRVVEAFYTGCVPVLISD  362

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++PV +IPNLK+IL SI   +Y+ MQ +  Q+RRHFEVN PPK
Sbjct  363   HYVPPFSDVLNWKSFSVEVPVSKIPNLKRILTSISPRQYIRMQRRVQQIRRHFEVNSPPK  422

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             RYDVFHM+LHSIWLRRLN+ +H+ Q
Sbjct  423   RYDVFHMILHSIWLRRLNVRIHNDQ  447



>gb|KHN02275.1| Putative glycosyltransferase [Glycine soja]
Length=537

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/397 (62%), Positives = 311/397 (78%), Gaps = 2/397 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             LP   P   +K + L+R EAGL + RAAIR+A+  N+  +D DYVP GP+Y N +AFHRS
Sbjct  142   LPPERPKLQRKFSILDRTEAGLRQARAAIREARNGNQT-QDIDYVPVGPMYNNANAFHRS  200

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLP  624
             YLEMEK+FK+F+YEEGEPPVFH    + I  +EG  +H +E++ +FRT++PE+AHVFFLP
Sbjct  201   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFVHAIEMNDQFRTRDPEEAHVFFLP  260

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   LV FV+VRD+H++ PI+KT  DY+N I  +YPYWNRSLG DHF LACHDW P  S
Sbjct  261   FSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIGGRYPYWNRSLGADHFYLACHDWGPETS  320

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L KNSIRV+CNANTSEGFKP+ DVS PEI L  G+++G IGGP  S R +L F+A
Sbjct  321   RSIPNLNKNSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASRRPLLAFFA  380

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR V++E WENKD ++++H+YLPK VSYY M+RKSK+C+CPSGYEVASPR+VEA
Sbjct  381   GGLHGPIRPVLLEHWENKDEDIQVHKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEA  440

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI DHY  PF DVL+W +F+V++ VK+IP LK+ILLSI   +Y+ MQ +  Q
Sbjct  441   IYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRQYIRMQRRVGQ  500

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             VRRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VHD Q
Sbjct  501   VRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHDDQ  537



>ref|XP_010039041.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/385 (64%), Positives = 310/385 (81%), Gaps = 2/385 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T+LER+EAGL R R+ IR+A+T N  +EDPDYVP GP+YRN +AFHRSYLEMEK+FKIF+
Sbjct  179   TDLERLEAGLRRARSGIREAKTGNP-MEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFV  237

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y+EG+PPVFH    + I   EG  IH +EI+K FRT +P KAHVFFLPFS   +V FV+V
Sbjct  238   YKEGDPPVFHNGPCKSIYAKEGNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYV  297

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             RD+H++ PI++T  DYI+ +++KYPYWNRSLG DHFMLACHDW P  S   P L +NSIR
Sbjct  298   RDSHDFGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPHLQRNSIR  357

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNANTSEGF P+ DVS PE+ L  G + GLIGGP PS+RS+L F+AGG+HG IR +++
Sbjct  358   VLCNANTSEGFDPSKDVSFPEVNLHTGAISGLIGGPSPSHRSILAFFAGGLHGPIRPILL  417

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + WENKD +V++H YLP+ VSYY M+R+SK+CICPSGYEVASPR+VEA+Y GCVPVLI D
Sbjct  418   QHWENKDEDVKVHRYLPRGVSYYDMMRRSKFCICPSGYEVASPRVVEAIYTGCVPVLISD  477

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++ V+EIPNLK IL SI   +Y+ MQ +  QVRRHFEV+ PPK
Sbjct  478   HYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPK  537

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             RYDVFHM+LHS+WLRRLN+ + D Q
Sbjct  538   RYDVFHMILHSVWLRRLNVGLSDNQ  562



>ref|XP_010039055.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
Length=562

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 312/385 (81%), Gaps = 2/385 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T+LER+EAGL R R+ IR+A+T N  +EDPDYVP GP+YRN +AFHRSYLEMEK+FKIF+
Sbjct  179   TDLERLEAGLRRARSGIREAKTGNP-MEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFV  237

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y+EG+PPVFH    + I  +EG  IH +EI+K FRT++P +AHVFFLPFS   +V FV+V
Sbjct  238   YKEGDPPVFHNGPCKSIYAMEGNFIHMVEINKRFRTEDPREAHVFFLPFSVAMMVQFVYV  297

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             RD+H++ PI++T  DYI+ +++KYPYWNRSLG DHFMLACHDW P  S   P L +NSIR
Sbjct  298   RDSHDFGPIKRTVIDYIDVVASKYPYWNRSLGADHFMLACHDWGPEASFAVPHLHRNSIR  357

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNANTSEGF P+ DVS PE+ L  G + GLIGGP PS+RS+L F+AGG+HG IR +++
Sbjct  358   VLCNANTSEGFDPSKDVSFPEVNLHTGAIGGLIGGPSPSHRSILAFFAGGLHGPIRPILL  417

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + WENKD +V++H YLP+ VSYY M+++SK+CICPSGYEVASPR+VEA+Y GCVPVLI D
Sbjct  418   QHWENKDEDVKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISD  477

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++ V+EIPNLK IL SI   +Y+ MQ +  QVRRHFEV+ PPK
Sbjct  478   HYVPPFSDVLNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPK  537

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             RYDVFHM+LHS+WLRRLN+ + D Q
Sbjct  538   RYDVFHMILHSVWLRRLNVGLSDNQ  562



>ref|XP_010243080.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nelumbo nucifera]
Length=598

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 311/393 (79%), Gaps = 4/393 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K  T LER+EAGLA++RAAIR+A  Q  N+   D DYVP GP+Y N  AFHRSYL MEK+
Sbjct  207   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  265

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLV  645
             FKIFIYEEGEPP+FH    + I  +EG  IHQ+E+ K FRT+NPE+A+ FFLPFS   +V
Sbjct  266   FKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLPFSVTQMV  325

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+V ++H+  PI++T  DY+N I+ KYPYWNRSL  DHFML+CHDW P  S   P L+
Sbjct  326   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  385

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KN IRV+CNANTSEGF PA D S PEI L  G   GLIGGPPPS R +L F+AGG+HG I
Sbjct  386   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  445

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R +++E W+NKD +V+++EYLPK +SYY M++KSKYCICPSGYEVASPR+VEA+Y GCVP
Sbjct  446   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  505

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI DHY  PF+DVL+W +F+V++PV EIPNLK+ILLSIP  +Y  MQ +G++VRRHFEV
Sbjct  506   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRRGLKVRRHFEV  565

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             NFPPKR+DV+HM+LHS+WLRRLN+ +HD++  S
Sbjct  566   NFPPKRFDVYHMILHSVWLRRLNVRIHDLRLQS  598



>ref|XP_010242926.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=530

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 309/393 (79%), Gaps = 4/393 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K  T LER+EAGLA++RAAIR+A  Q  N+   D DYVP GP+Y N  AFHRSYL MEK+
Sbjct  139   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  197

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLV  645
             FKIFIY+EGEPP+FH    + I  +EG  IHQ+E+ K FRT+NP++AH FFLPFS   +V
Sbjct  198   FKIFIYDEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPKEAHAFFLPFSVTKMV  257

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+V ++H+  PI++T  DY+N I+ KYPYWNRSL  DHFML+CHDW P  S   P L+
Sbjct  258   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  317

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KN IRV+CNANTSEGF PA D S PEI L  G   G IGGP PS R +L F+AGG+HG I
Sbjct  318   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGFIGGPSPSRRPILXFFAGGLHGPI  377

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R V++E W+NKD +V+++EYLPK +SYY M++KSKYCICPSGYEVASPR+VEA+Y GCVP
Sbjct  378   RPVLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  437

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI DHY  PF+DVL+W +F+V++PV EIPNLK+ILLSI   +Y+ MQ +G++VRRHFEV
Sbjct  438   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSISTRQYIRMQRRGLKVRRHFEV  497

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             NFPPKR+DV+HM+LHS+WLRRLN+ +HD+Q  S
Sbjct  498   NFPPKRFDVYHMILHSVWLRRLNVRIHDLQLQS  530



>ref|XP_010683939.1| PREDICTED: probable glycosyltransferase At5g03795 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 248/402 (62%), Positives = 315/402 (78%), Gaps = 8/402 (2%)
 Frame = +1

Query  277   SHPDAMKKL------TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAF  438
             +H   M+KL      T+L+R+E GL + RAAI++A+  NR  +DPD+ P GP+Y N +AF
Sbjct  136   THAPPMRKLELEKMATDLDRLEIGLQQSRAAIKEAKYTNRTYDDPDFKPLGPMYWNANAF  195

Query  439   HRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVF  615
             HRSYLEME+RFK+++YEEGEPP+FH    + I   EG  IH +EI+ +FRTK  ++AHVF
Sbjct  196   HRSYLEMERRFKVYVYEEGEPPLFHNGPCKSIYSTEGNFIHLMEINDQFRTKKLDEAHVF  255

Query  616   FLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAP  795
             FLPFS   +VHFV++RD+H++ PI++T RDYIN +STKYPYWNRSLG DHFML+CHDW P
Sbjct  256   FLPFSVVMMVHFVYLRDSHDFGPIRQTVRDYINVVSTKYPYWNRSLGADHFMLSCHDWGP  315

Query  796   TISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLV  975
               S   P L KNSIRV+CNANTSEGFKP  DVSLPEI L  G ++G +GGP PS RS+L 
Sbjct  316   ETSFSVPYLAKNSIRVLCNANTSEGFKPHKDVSLPEINLRTGAINGFVGGPSPSRRSILA  375

Query  976   FYAGGIHGYIRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPR  1152
             F+AGG+HG IR +++E W NK D +++I  YLPK VSYY M+R SK+CICPSGYEVASPR
Sbjct  376   FFAGGLHGPIRPILLEHWGNKDDKDLKIFTYLPKGVSYYDMLRNSKFCICPSGYEVASPR  435

Query  1153  MVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQE  1332
             +VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ VK+IPNLK IL +I  +KYL M  
Sbjct  436   VVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVKDIPNLKTILTNISTKKYLKMYR  495

Query  1333  KGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
             + +QVRRHFEV+ PPKRYD FHM+LHS+WLRRLN+ VHD+QE
Sbjct  496   RVLQVRRHFEVHAPPKRYDFFHMILHSVWLRRLNVHVHDLQE  537



>ref|XP_011094446.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=559

 Score =   531 bits (1367),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 308/390 (79%), Gaps = 2/390 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ +NLE +EA L + RAAIR AQ  N    DPDY+P GPIY NP  FHRSYLEMEK FK
Sbjct  171   RRFSNLEILEATLQQARAAIRDAQRGNPAY-DPDYIPTGPIYWNPSGFHRSYLEMEKHFK  229

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +F+YEEGE P+FH      I  +EG  I++LE SKFRT++PE+AHV+FLPFS  S+VHF+
Sbjct  230   VFVYEEGEQPIFHNGPCGSIYSMEGNFIYKLETSKFRTRDPERAHVYFLPFSVTSIVHFI  289

Query  655   FVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             + +  H+ W P+++T +DY++ ++ KYPYWNRS+G DH ML+CHDW P +S   P+LFKN
Sbjct  290   YDKRVHDHWLPMKQTVKDYVDLVAGKYPYWNRSIGSDHVMLSCHDWGPELSKSLPELFKN  349

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGF+P+ DVS+PEI LP G  +GLIGGP PS R +LVF+AGG+HG IR 
Sbjct  350   SIRALCNANTSEGFRPSKDVSIPEINLPGGRTNGLIGGPSPSKRPILVFFAGGLHGPIRP  409

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENK  +V++H YLPK+VSY  M+RKS++CICPSGYEVASPRMVEA+Y GCVPVL
Sbjct  410   ILLEHWENKGQDVQVHRYLPKDVSYSAMMRKSRFCICPSGYEVASPRMVEALYTGCVPVL  469

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             IKDHY  PF+DVL+W +F+V+I V +IPNLKKIL  I   +Y+ MQ +G+ VRRHFEVN 
Sbjct  470   IKDHYVPPFSDVLNWKSFSVEISVADIPNLKKILTGISMRQYIRMQRRGVAVRRHFEVNL  529

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
              PKRYDVFHM LHSIWLRRLNI +H ++++
Sbjct  530   SPKRYDVFHMTLHSIWLRRLNIRLHGVEDS  559



>ref|XP_010243073.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nelumbo nucifera]
Length=620

 Score =   532 bits (1371),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 311/393 (79%), Gaps = 4/393 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K  T LER+EAGLA++RAAIR+A  Q  N+   D DYVP GP+Y N  AFHRSYL MEK+
Sbjct  229   KNHTQLERLEAGLAKIRAAIREAAHQKGNQT-SDFDYVPEGPMYWNAQAFHRSYLVMEKQ  287

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLV  645
             FKIFIYEEGEPP+FH    + I  +EG  IHQ+E+ K FRT+NPE+A+ FFLPFS   +V
Sbjct  288   FKIFIYEEGEPPLFHDGPCRSIYSMEGNFIHQIEMDKRFRTRNPEEAYAFFLPFSVTQMV  347

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              FV+V ++H+  PI++T  DY+N I+ KYPYWNRSL  DHFML+CHDW P  S   P L+
Sbjct  348   RFVYVPNSHDIGPIKQTVIDYVNLIAGKYPYWNRSLAADHFMLSCHDWGPLTSSYVPHLY  407

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             KN IRV+CNANTSEGF PA D S PEI L  G   GLIGGPPPS R +L F+AGG+HG I
Sbjct  408   KNGIRVLCNANTSEGFNPAKDASFPEINLRTGETKGLIGGPPPSCRPILAFFAGGLHGPI  467

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R +++E W+NKD +V+++EYLPK +SYY M++KSKYCICPSGYEVASPR+VEA+Y GCVP
Sbjct  468   RPLLLEHWKNKDEDVKVYEYLPKGLSYYDMMKKSKYCICPSGYEVASPRIVEAIYAGCVP  527

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI DHY  PF+DVL+W +F+V++PV EIPNLK+ILLSIP  +Y  MQ +G++VRRHFEV
Sbjct  528   VLISDHYVPPFSDVLNWKSFSVEVPVSEIPNLKRILLSIPTRQYKRMQRRGLKVRRHFEV  587

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             NFPPKR+DV+HM+LHS+WLRRLN+ +HD++  S
Sbjct  588   NFPPKRFDVYHMILHSVWLRRLNVRIHDLRLQS  620



>gb|KEH24082.1| glycosyltransferase [Medicago truncatula]
Length=402

 Score =   522 bits (1344),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 241/392 (61%), Positives = 311/392 (79%), Gaps = 2/392 (1%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             P+   KL+NL+RVEA L + RAAIR+A    +  +D DYVP GP+Y  P+ FHRSYLEME
Sbjct  12    PNLAGKLSNLDRVEADLLQARAAIRKA-VNGKQTQDIDYVPTGPMYHKPNLFHRSYLEME  70

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSYS  639
             KRFK+F+YEEGEPPVFH    + I  +EGI I+Q+E++ KF TK+PEKAHVFFL +S   
Sbjct  71    KRFKVFVYEEGEPPVFHDGPCRDIYSMEGIFINQMEMNDKFITKDPEKAHVFFLSYSVAM  130

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+V+VRD+  +  ++ T +DYIN +S KYPYWNRS G DHF+LACHDW P +S+  P 
Sbjct  131   MVHYVYVRDSRAYDLLRITVKDYINVLSEKYPYWNRSHGADHFILACHDWGPEVSNAVPN  190

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             L+KNSIR  CNANTSEGFKP  DVS+PEI +  G +D L+GGP PS RS+L F+AGG+HG
Sbjct  191   LYKNSIRAFCNANTSEGFKPVKDVSIPEINVRTGIIDDLLGGPSPSKRSILAFFAGGLHG  250

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR V++E WE+KD ++++H+YLPK VSYY M+RKSK+C+CPSG+EVASPR+VEA+Y GC
Sbjct  251   DIRNVLLEHWEHKDEDIQVHKYLPKGVSYYAMLRKSKFCLCPSGWEVASPRVVEAIYTGC  310

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI DHY  PF+DVL+W +F+V++ V +IPNLKKIL +I   +Y+ MQ +  QVR+HF
Sbjct  311   VPVLISDHYVPPFSDVLNWKSFSVEVSVNDIPNLKKILSNISPRQYIRMQRRVGQVRKHF  370

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             EVN PPKR+DVFHM+LHSIWLRRLN+++HD Q
Sbjct  371   EVNSPPKRFDVFHMILHSIWLRRLNLKLHDDQ  402



>ref|XP_011101498.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=486

 Score =   525 bits (1351),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 250/391 (64%), Positives = 314/391 (80%), Gaps = 2/391 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             K+ ++LE VEA L +  AAIR+A  T     EDPDY+P+GP+Y N   FHRSYLEMEKR 
Sbjct  96    KRYSDLEMVEADLVQAPAAIREAIVTGGNQTEDPDYIPNGPMYWNSKVFHRSYLEMEKRL  155

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             KIFIYEEG+PPVFH+   +    IEGI +  +E+S+FRT +  KAH+FFLPFS   +   
Sbjct  156   KIFIYEEGDPPVFHFGPCKHTYAIEGIFMANMEVSRFRTFDHNKAHLFFLPFSVTMITQV  215

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             ++V ++HEW  ++ TA DYIN I+ K+PYWNR+LG DHFMLACHDW P IS   P L+KN
Sbjct  216   IYVPESHEWSQMKNTASDYINVIAQKHPYWNRTLGADHFMLACHDWGPEISFAIPNLYKN  275

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSE F P+ DVS+PEI+LP G   G+IGGPPPS R +LVFYAGG+HG IR 
Sbjct  276   SIRALCNANTSEQFNPSRDVSIPEIHLPGGGTRGMIGGPPPSKRPILVFYAGGVHGPIRP  335

Query  1012  VMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
             +++E WENK DP+V+I++YLP+NVSYYGM+RKS+YCICPSGYEVASPRMVE +YMGCVPV
Sbjct  336   ILLEHWENKSDPDVQIYKYLPQNVSYYGMMRKSRYCICPSGYEVASPRMVEGLYMGCVPV  395

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LIKD Y  PF+DVL+W+TFAV +PVK+IPNLK IL +IP +KY+ MQ++GIQ+RRHFEVN
Sbjct  396   LIKDGYVIPFSDVLNWETFAVIVPVKDIPNLKTILTAIPMKKYVQMQQRGIQMRRHFEVN  455

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
              PPKRYDVFHM+LHSIWLRRLN+ +H+ +++
Sbjct  456   SPPKRYDVFHMILHSIWLRRLNVRLHEHEDS  486



>ref|XP_004303053.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=549

 Score =   527 bits (1357),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 240/388 (62%), Positives = 307/388 (79%), Gaps = 2/388 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             K+ T+L R+E  L R R AIR+A+  N+   D DY+P+GP+Y N +AF RSYLEMEKRFK
Sbjct  163   KEYTHLGRLEGRLRRARVAIREAKFANKT-HDADYIPNGPMYWNANAFQRSYLEMEKRFK  221

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPP+FH    + I  +EG  IH++E++K FRT+NPE+AHV+FLP+S   LV F
Sbjct  222   VFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEVNKQFRTRNPEEAHVYFLPYSVTMLVRF  281

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T RDY+N ISTKYPYWNRSL  DHF +ACHDW P  S+  P L KN
Sbjct  282   VYVRDSHDFSPIRQTVRDYVNIISTKYPYWNRSLAADHFTVACHDWGPETSNSDPYLRKN  341

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSEGF P+ DVS PE+ L  G+  G +GGP P  RS+L F+AGG+HG IR 
Sbjct  342   SIRGLCNANTSEGFNPSKDVSFPEVNLQTGDTHGFLGGPSPRLRSILAFFAGGVHGPIRP  401

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD ++ +H+YLPK VSYY M++KSK+C+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  402   ILLEHWENKDKDMRVHQYLPKGVSYYDMMKKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  461

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DVL+W +F+V++ V +IPNLK IL SI   +YL MQ++ IQVR+HFEVN 
Sbjct  462   ISDHYVPPFSDVLNWKSFSVEVSVSDIPNLKNILTSISTRQYLRMQKRVIQVRKHFEVNS  521

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  522   PPKRFDVFHMILHSIWLRRLNVRVHDDQ  549



>ref|XP_003542567.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48212.1| Putative glycosyltransferase [Glycine soja]
Length=505

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 247/408 (61%), Positives = 317/408 (78%), Gaps = 5/408 (1%)
 Frame = +1

Query  244   GFSM-PFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGP  414
             GF++ P  +   SHP     +K + L++ EA LA+ RAAIR+A+  N+  +D DYVP GP
Sbjct  99    GFNLAPANESDESHPRQKRKRKFSFLDKTEAVLAQARAAIREAENWNQT-QDSDYVPVGP  157

Query  415   IYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTK  591
             +Y NP  FHRSYLEMEK+FK+F+YEEGE PVFH      I   EG  IH +E+++ FRT+
Sbjct  158   MYWNPKEFHRSYLEMEKQFKVFVYEEGELPVFHEGPCASIYSTEGSFIHAIEMNEHFRTR  217

Query  592   NPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFM  771
             +P+KAHVFFLPFS   +V +V++RD+H++ PI++T RDYIN I+ +YPYWNRSLG DHFM
Sbjct  218   DPKKAHVFFLPFSVVMMVRYVYIRDSHDFGPIKRTVRDYINVIAARYPYWNRSLGADHFM  277

Query  772   LACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPP  951
             L+CHDW P  S  +P L KNSIRV+CNANTSEGF P  DVS PEI L +G +DGL+GGP 
Sbjct  278   LSCHDWGPEASKFSPYLRKNSIRVLCNANTSEGFDPRKDVSFPEINLQRGPIDGLLGGPS  337

Query  952   PSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSG  1131
              S RS+L F+AGGIHG IR +++E WE KD ++++H+YLPK VSYYGM+RKSK+C+CPSG
Sbjct  338   ASQRSILAFFAGGIHGPIRPILLEHWEKKDEDIQVHQYLPKGVSYYGMLRKSKFCLCPSG  397

Query  1132  YEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQE  1311
             YEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W  F+V++ +KEIPNLK IL++I   
Sbjct  398   YEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKMFSVEVSMKEIPNLKDILMNISPR  457

Query  1312  KYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             KY+ MQ++  Q+RRHFEV+ PPKRYDVFHM+LHS+WLRRLN  V D Q
Sbjct  458   KYIRMQKRVRQIRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVLDDQ  505



>emb|CDP15333.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   521 bits (1342),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 299/393 (76%), Gaps = 1/393 (0%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             P +  K +NLE +EA LA  RAAI+ A+       + D+VP GP+Y N  AF RSYLEME
Sbjct  53    PRSKNKYSNLEILEASLAEARAAIKGARIGQEAPHE-DFVPKGPMYLNATAFRRSYLEME  111

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSL  642
             KRFK+FIYEEG PPVFH    +    IEG  I  LE+S  RT +P KAH+++LPFS   +
Sbjct  112   KRFKVFIYEEGGPPVFHVGPCKHTYAIEGYFIQALEVSPIRTTDPSKAHLYYLPFSVTRI  171

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
               F++V ++ EW  ++    DY+N IS KYPYWNRSLG DHFMLACHDW P +S   P L
Sbjct  172   TEFIYVPESREWGLMKSFVADYVNTISHKYPYWNRSLGADHFMLACHDWGPELSFAVPYL  231

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NSIR +CNANTSE F P+ DVS+PEI+LP G   G+IGGP PS R +LVFYAGGIHG 
Sbjct  232   YTNSIRALCNANTSERFAPSRDVSIPEIHLPLGTTKGMIGGPSPSKRPILVFYAGGIHGP  291

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++E WE+KD +V+IH+YLPK VSYYGM+RKS+YCICPSGYEVASPRMVEA+YMGCV
Sbjct  292   IRPILLEYWEDKDADVQIHQYLPKGVSYYGMMRKSRYCICPSGYEVASPRMVEALYMGCV  351

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLIK+ Y  PF+D+L+W  FAV IPV++IPNLK+IL++I   +Y+ MQ +GIQVRRHFE
Sbjct  352   PVLIKEGYVIPFSDILNWKAFAVVIPVQDIPNLKRILMAISPRQYIRMQRRGIQVRRHFE  411

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             +N PPKRYDVFHM+LHSIWLRRLNI V D  E+
Sbjct  412   INTPPKRYDVFHMILHSIWLRRLNIIVEDATES  444



>ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=534

 Score =   524 bits (1350),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 244/397 (61%), Positives = 309/397 (78%), Gaps = 2/397 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             +P   P   +KL+ L+R EAGL + RAAI +A+  N+  +D DYVP GP+Y N +AFHRS
Sbjct  139   VPPERPKLQRKLSILDRTEAGLIQARAAISEARNGNQT-QDKDYVPVGPMYNNANAFHRS  197

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLP  624
             YLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT++PEKAHVFFLP
Sbjct  198   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLP  257

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   LV FV+VRD+H++ PI+KT  DY+N I+ +YPYWNRSLG DHF LACHDW P  S
Sbjct  258   FSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETS  317

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L +NSIRV+CNANTSEGFKP+ DVS PEI L  G+++G IGGP  S R +L F+A
Sbjct  318   RSIPNLNENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFA  377

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR V++E WEN+D ++++H+YLPK VSYY M+RKS++C+CPSGYEVASPR+VEA
Sbjct  378   GGLHGPIRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEA  437

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI DHY  PF DVL+W +F+V++ VK+IP LK+ILLSI    Y+ MQ +   
Sbjct  438   IYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGL  497

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             VRRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VH  Q
Sbjct  498   VRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHHDQ  534



>gb|KHN18714.1| Putative glycosyltransferase [Glycine soja]
Length=546

 Score =   524 bits (1349),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 244/397 (61%), Positives = 309/397 (78%), Gaps = 2/397 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             +P   P   +KL+ L+R EAGL + RAAI +A+  N+  +D DYVP GP+Y N +AFHRS
Sbjct  151   VPPERPKLQRKLSILDRTEAGLIQARAAISEARNGNQT-QDKDYVPVGPMYNNANAFHRS  209

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLP  624
             YLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT++PEKAHVFFLP
Sbjct  210   YLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPEKAHVFFLP  269

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   LV FV+VRD+H++ PI+KT  DY+N I+ +YPYWNRSLG DHF LACHDW P  S
Sbjct  270   FSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYLACHDWGPETS  329

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L +NSIRV+CNANTSEGFKP+ DVS PEI L  G+++G IGGP  S R +L F+A
Sbjct  330   RSIPNLNENSIRVLCNANTSEGFKPSKDVSFPEINLQTGSINGFIGGPSASGRPLLAFFA  389

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR V++E WEN+D ++++H+YLPK VSYY M+RKS++C+CPSGYEVASPR+VEA
Sbjct  390   GGLHGPIRPVLLEHWENRDEDIQVHKYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEA  449

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI DHY  PF DVL+W +F+V++ VK+IP LK+ILLSI    Y+ MQ +   
Sbjct  450   IYTGCVPVLISDHYVPPFNDVLNWKSFSVEVSVKDIPRLKEILLSISPRHYIRMQRRVGL  509

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             VRRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VH  Q
Sbjct  510   VRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHHDQ  546



>ref|XP_004497579.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=518

 Score =   523 bits (1346),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 239/388 (62%), Positives = 305/388 (79%), Gaps = 3/388 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             +K + L+R EAGL + RAAIR+A   N+ L+DPDYVP GP+Y N  AFHRSYLEMEK+FK
Sbjct  133   RKFSILDRTEAGLLQARAAIREAT--NQTLQDPDYVPIGPMYWNAKAFHRSYLEMEKQFK  190

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPPVFH    + I  +EG  IH +E++ +FRT++P+KA VFFLPFS   LV F
Sbjct  191   VFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIEMNDQFRTRDPDKAQVFFLPFSVVMLVRF  250

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V++RD+ ++ PI+KT  DYIN I+ KYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  251   VYLRDSRDFGPIRKTVNDYINVIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLHKN  310

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSE F P+ DVS PEI L  G+++G IGGP  S R +L F+AGG+HGYIR 
Sbjct  311   SIRVLCNANTSEKFNPSKDVSFPEINLQTGSINGFIGGPSASKRPILAFFAGGLHGYIRS  370

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++++ WENKD ++ + +YLPK VSYY M+RKSK+C+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  371   ILLDHWENKDQDIMVQKYLPKGVSYYEMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVL  430

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I +HY  PF+DVL+W +F+V++ V++IPNLK IL+ I   +Y+ MQ +  Q+RRHFEV+ 
Sbjct  431   ISEHYVLPFSDVLNWKSFSVEVKVEDIPNLKDILMRISTTQYIRMQRRVGQIRRHFEVHS  490

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKR+DVFHM+LHS+WLRRLN  VHD Q
Sbjct  491   PPKRFDVFHMILHSVWLRRLNFRVHDDQ  518



>gb|EYU38594.1| hypothetical protein MIMGU_mgv1a021350mg [Erythranthe guttata]
Length=485

 Score =   520 bits (1339),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 249/403 (62%), Positives = 313/403 (78%), Gaps = 9/403 (2%)
 Frame = +1

Query  265   QLPSSHPDAMKKLT----NLERVEAGLARVRAAIRQAQ---TENRILEDPDYVPHGPIYR  423
             Q P  + D  +  T    +LE VEA LA+ R AI QA+    E R   DPDYVP GP+Y 
Sbjct  79    QKPVRNEDKYRNFTRTYSSLEMVEADLAQTRDAISQAKKGGNETRD-PDPDYVPDGPMYW  137

Query  424   NPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEK  603
             NP  FHRSYLEMEK+ K+F+YEEG+PPVFH+   +    IEGI I  +E+S+FRT + +K
Sbjct  138   NPKVFHRSYLEMEKKMKVFVYEEGDPPVFHFGPCKHTYAIEGIFISNMEVSRFRTMDQDK  197

Query  604   AHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACH  783
             AH+FFLPFS   +   ++V+D+HEW  ++  A DY+N I+ K+PYWNRSLG DHFMLACH
Sbjct  198   AHLFFLPFSVTMITQVIYVKDSHEWGLMKNAASDYVNVIAQKHPYWNRSLGADHFMLACH  257

Query  784   DWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNR  963
             DW P IS   P L+KN+IR +CNANTSE F P+ DVS+PEI+LP G   G+IGGPPPS R
Sbjct  258   DWGPEISFAVPNLYKNAIRALCNANTSERFDPSRDVSIPEIHLPGGTTQGIIGGPPPSKR  317

Query  964   SVLVFYAGGIHGYIRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEV  1140
              +LVFYAGG+HG IR +++E WENK DP+V+I+ YLPKN+SYYGM+RKS+YCICPSGYEV
Sbjct  318   PILVFYAGGVHGPIRPILLEHWENKTDPDVQIYRYLPKNMSYYGMMRKSRYCICPSGYEV  377

Query  1141  ASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYL  1320
             ASPRMVE +Y+GCVPVLIKD Y  PF+DVL+W+TFAV +PV++IPNLKKIL  I  ++Y+
Sbjct  378   ASPRMVEGLYLGCVPVLIKDSYVIPFSDVLNWETFAVIVPVRDIPNLKKILTGISSKEYM  437

Query  1321  SMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              MQ +G+Q+RRHFE+N PPKRYDVFHM+LHSIWLRRLNI +H+
Sbjct  438   KMQRRGVQMRRHFEINSPPKRYDVFHMILHSIWLRRLNIRLHE  480



>ref|XP_010098868.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB75956.1| putative glycosyltransferase [Morus notabilis]
Length=465

 Score =   519 bits (1337),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 238/388 (61%), Positives = 306/388 (79%), Gaps = 2/388 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ ++LER+EA L + R+AI +A+  N   +DP+YVP GP+Y N  AFHRSY+EMEK FK
Sbjct  79    REYSDLERLEARLMKARSAISEAKVGNET-QDPEYVPTGPMYWNSKAFHRSYIEMEKEFK  137

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPP+FH    + I  +EG  IH++E+ S+FRTK+P KAHVFFLPFS   LV +
Sbjct  138   VFVYEEGEPPLFHNGPCKSIYSMEGNFIHEIEMNSQFRTKDPNKAHVFFLPFSVTMLVRY  197

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T  DY+N +S K+P+WNRSL  DHFML+CHDW P  S     L +N
Sbjct  198   VYVRDSHDFHPIKQTVIDYVNVVSEKHPFWNRSLAADHFMLSCHDWGPEASRSNRFLHQN  257

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L  G  DGL+GGP  S R  L F+AGG+HG IR 
Sbjct  258   SIRVLCNANTSEGFNPSKDVSFPEINLLSGATDGLLGGPSASRRPNLAFFAGGVHGPIRP  317

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++E WENKD +++I +YLPK VSYY M+RKSKYCICPSGYEVASPR+VEA+Y GCVPVL
Sbjct  318   ILLEHWENKDEDMKIQQYLPKGVSYYDMLRKSKYCICPSGYEVASPRIVEAIYTGCVPVL  377

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DVL+W +F+V++PVK+IPNLK IL+SI   +Y+ MQ + ++VRRHFEVN 
Sbjct  378   ISDHYVPPFSDVLNWKSFSVEVPVKDIPNLKTILMSISPRQYIRMQRRVLKVRRHFEVNS  437

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             PPKR+DVFHM+LHS+WLRRLNI +HD Q
Sbjct  438   PPKRFDVFHMILHSVWLRRLNIRIHDDQ  465



>ref|XP_007162830.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
 gb|ESW34824.1| hypothetical protein PHAVU_001G184500g [Phaseolus vulgaris]
Length=537

 Score =   521 bits (1343),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 308/394 (78%), Gaps = 2/394 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             + +  P   +K + L+R EAGL + RAAIR+A+  N+  +D DYVP GP+Y N  AFHRS
Sbjct  137   VAAERPKLQRKFSILDRTEAGLVKARAAIREARNGNQT-QDADYVPIGPMYMNAKAFHRS  195

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLP  624
             +LEMEK+ K+++YEEGE PVFH    + I  +EG  IH +E++ KFRT++PEKAHVFFLP
Sbjct  196   FLEMEKQLKVYVYEEGEAPVFHNGPCKSIYSMEGNFIHGIEMNEKFRTRDPEKAHVFFLP  255

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   LV FV+VRD+H++ PI+KT  DY+N I+ +YPYWNRSLG DHF +ACHDW P  S
Sbjct  256   FSVAMLVQFVYVRDSHDFGPIKKTVTDYVNVIAGRYPYWNRSLGADHFYIACHDWGPETS  315

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L  NSIRV+CNANTSEGFKP+ DVSLPEI L  G+++GLIGGP  S R +L F+A
Sbjct  316   RSVPNLQDNSIRVLCNANTSEGFKPSKDVSLPEINLQSGSINGLIGGPSASKRPLLAFFA  375

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR +++E WENK  ++++H YLPK VSYY M+RKS++C+CPSGYEVASPR+VEA
Sbjct  376   GGLHGPIRPILLEHWENKQEDMQVHRYLPKGVSYYEMLRKSRFCLCPSGYEVASPRVVEA  435

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI DHY  PF+DVL+W +F+V++ V++IP LK ILLSI   +Y+ MQ + +Q
Sbjct  436   IYTGCVPVLISDHYVPPFSDVLNWKSFSVEVSVEDIPKLKDILLSISPTQYIRMQRRVVQ  495

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             VRRHFEV+ PPKR+DVFHM+LHS+WLRRLN +VH
Sbjct  496   VRRHFEVHSPPKRFDVFHMILHSVWLRRLNFKVH  529



>ref|XP_003541440.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
 gb|KHN48210.1| Putative glycosyltransferase [Glycine soja]
Length=491

 Score =   519 bits (1337),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 309/396 (78%), Gaps = 4/396 (1%)
 Frame = +1

Query  277   SHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSY  450
             SHP     +K + L+R E  LA+ RAAIR+A+  NR L D DYVP GP+Y N  AFHRSY
Sbjct  97    SHPRLKQKRKFSFLDRTEVVLAQARAAIREARNRNRTL-DSDYVPTGPMYWNAKAFHRSY  155

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPF  627
             LEMEK+FK+F+YEEGE PVFH    + I  +EG  IH +E++  FRTK+P+KAHVFFLPF
Sbjct  156   LEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPF  215

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   +V FV+ RD+ ++ PI+KT  DY+N I+T+YPYWNRSLG DHFMLACHDW P  S 
Sbjct  216   SVVMMVRFVYERDSRDFGPIKKTVIDYVNLIATRYPYWNRSLGADHFMLACHDWGPEASF  275

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAG  987
               P L KNSIRV+CNANTSEGFKPA DVS PEI L  G+++G +GGP  S RS+L F+AG
Sbjct  276   SLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFVGGPSASKRSILAFFAG  335

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
             G+HG IR +++E WENKD ++++H+YLPK VSYYGM+RKSK+C+CPSGYEVASPR+VEA+
Sbjct  336   GVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAI  395

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y GCVPVLI +HY  PF+DVL+W +F+V++ VK+IP LK IL+SI   +++ MQ +  Q+
Sbjct  396   YTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPILKDILMSISPRQHIRMQRRVGQI  455

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             RRHFEV+ PPKR+DVFHM+LHS+WLRRLN  V D Q
Sbjct  456   RRHFEVHSPPKRFDVFHMILHSVWLRRLNFRVRDDQ  491



>gb|AES60658.2| exostosin family protein [Medicago truncatula]
Length=488

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 313/414 (76%), Gaps = 6/414 (1%)
 Frame = +1

Query  226   THPWLRGFSMPFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDY  399
             + PWL   ++P  +   +HP     +K + L+R EAGL   RAAIR+A    +  +DPDY
Sbjct  77    SKPWLNS-TVPLNETYVAHPRLKQQRKFSILDRTEAGLLHARAAIREASYSTQT-QDPDY  134

Query  400   VPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-  576
             VP GP+Y N  AFHRSYLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ 
Sbjct  135   VPIGPMYWNAKAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELND  194

Query  577   KFRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLG  756
             +FRT++P+KAHV+FLPFS   LV FV++RD+ ++ PI+KT  DYIN I+ KYPYWNRSLG
Sbjct  195   QFRTRDPQKAHVYFLPFSVVMLVRFVYLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLG  254

Query  757   YDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGL  936
              DHFMLACHDW P  S   P L KNSIRV+CNANTSE F PA DVS PEI L  G+++G 
Sbjct  255   ADHFMLACHDWGPETSFSVPYLHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGF  314

Query  937   IGGPPPSNRSVLVFYAGGIHGYIRQVMMETWE-NKDPEVEIHEYLPKNVSYYGMVRKSKY  1113
             +GG   S R +L F+AGG+HG+IR +++E WE NKD ++ I +YLPK VSYY M+RKSK+
Sbjct  315   LGGLSASKRPILAFFAGGLHGHIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKF  374

Query  1114  CICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKIL  1293
             C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V+I V++IP LK IL
Sbjct  375   CLCPSGYEVASPRIVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDIL  434

Query  1294  LSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             + I   +Y+ MQ + +Q+RRHFEV+ PPKR+DVFHM+LHS+WLRRLN  VHD Q
Sbjct  435   MRISPTQYIRMQRRVVQIRRHFEVHSPPKRFDVFHMILHSVWLRRLNFRVHDDQ  488



>ref|XP_003590407.1| hypothetical protein MTR_1g061760 [Medicago truncatula]
Length=508

 Score =   515 bits (1327),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 313/414 (76%), Gaps = 6/414 (1%)
 Frame = +1

Query  226   THPWLRGFSMPFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDY  399
             + PWL   ++P  +   +HP     +K + L+R EAGL   RAAIR+A    +  +DPDY
Sbjct  97    SKPWLNS-TVPLNETYVAHPRLKQQRKFSILDRTEAGLLHARAAIREASYSTQT-QDPDY  154

Query  400   VPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-  576
             VP GP+Y N  AFHRSYLEMEK+FK+F+YEEGEPPVFH    + I  +EG  IH +E++ 
Sbjct  155   VPIGPMYWNAKAFHRSYLEMEKQFKVFVYEEGEPPVFHNGPCKSIYSMEGNFIHAIELND  214

Query  577   KFRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLG  756
             +FRT++P+KAHV+FLPFS   LV FV++RD+ ++ PI+KT  DYIN I+ KYPYWNRSLG
Sbjct  215   QFRTRDPQKAHVYFLPFSVVMLVRFVYLRDSRDFGPIRKTVTDYINVIAGKYPYWNRSLG  274

Query  757   YDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGL  936
              DHFMLACHDW P  S   P L KNSIRV+CNANTSE F PA DVS PEI L  G+++G 
Sbjct  275   ADHFMLACHDWGPETSFSVPYLHKNSIRVLCNANTSERFNPAKDVSFPEINLQTGSINGF  334

Query  937   IGGPPPSNRSVLVFYAGGIHGYIRQVMMETWE-NKDPEVEIHEYLPKNVSYYGMVRKSKY  1113
             +GG   S R +L F+AGG+HG+IR +++E WE NKD ++ I +YLPK VSYY M+RKSK+
Sbjct  335   LGGLSASKRPILAFFAGGLHGHIRAILLEHWENNKDQDMMIQKYLPKGVSYYEMLRKSKF  394

Query  1114  CICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKIL  1293
             C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V+I V++IP LK IL
Sbjct  395   CLCPSGYEVASPRIVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEISVEDIPKLKDIL  454

Query  1294  LSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             + I   +Y+ MQ + +Q+RRHFEV+ PPKR+DVFHM+LHS+WLRRLN  VHD Q
Sbjct  455   MRISPTQYIRMQRRVVQIRRHFEVHSPPKRFDVFHMILHSVWLRRLNFRVHDDQ  508



>ref|XP_009375632.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=543

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 229/355 (65%), Positives = 291/355 (82%), Gaps = 1/355 (0%)
 Frame = +1

Query  394   DYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI  573
             DY+P+GP+Y N +AFHRSYLEME++FK+F+Y EGEPP+FH    + I  +EG  IH++E+
Sbjct  189   DYIPNGPMYWNANAFHRSYLEMEEKFKVFVYGEGEPPLFHNGPCKSIYSMEGNFIHEIEV  248

Query  574   SK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRS  750
             +K FRT++PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYWNRS
Sbjct  249   NKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSEKYPYWNRS  308

Query  751   LGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMD  930
             LG DHFMLACHDW P  S+  P L KNSIR +CNANTSEGFKP+ DVS PEI L  G+  
Sbjct  309   LGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFKPSKDVSFPEINLQTGDTH  368

Query  931   GLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSK  1110
             G IGGP P  RS+L F+AGG+HG IR +++E WENKDP++ +H+YLPK VSYY M+R+S+
Sbjct  369   GFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSYYDMMRQSR  428

Query  1111  YCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKI  1290
             +C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W++F++++ V +IPNLKKI
Sbjct  429   FCLCPSGYEVASPRVVEAIYAGCVPVLISDHYVPPFSDVLNWNSFSIEVSVSDIPNLKKI  488

Query  1291  LLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             L SI   +YL MQ + +QVRRHFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  489   LTSISSRRYLRMQRRMLQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  543



>ref|XP_010247793.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=592

 Score =   517 bits (1332),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/389 (61%), Positives = 302/389 (78%), Gaps = 2/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENR-ILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             K+ + LER+EAGL+R R  IR+A  + R    D DYVP GP+Y N  AFHRSYLEMEK+F
Sbjct  203   KRRSKLERLEAGLSRARVTIREAAHQKRNQTPDLDYVPQGPMYWNAQAFHRSYLEMEKQF  262

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVH  648
             K+F+YEEGEPP+FH      I   EG  IHQ+E+ K FRT++PE+AHVFFLPFS   +V 
Sbjct  263   KVFVYEEGEPPLFHNGPCGSIYSSEGNFIHQMEMDKRFRTQHPEEAHVFFLPFSVAMMVR  322

Query  649   FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFK  828
             FV+VRD+H+  PI+ T  DY+N I+ KYPYWNRSL  DHFML+CHDW P  S   P L+ 
Sbjct  323   FVYVRDSHDIGPIKHTVTDYVNIIAGKYPYWNRSLAADHFMLSCHDWGPATSTYVPHLYN  382

Query  829   NSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIR  1008
             N IRV+CNANTSEGF PA D S PEI +    + GLIGGP PS+R  L F+AG +HG +R
Sbjct  383   NGIRVLCNANTSEGFNPAKDASFPEINMVTREIKGLIGGPSPSHRPTLAFFAGKLHGPVR  442

Query  1009  QVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
              V+ E W+NKD +V+++E LP+ +SYY M+RKSKYCICPSGYEVASPR+VEA+Y+GCVPV
Sbjct  443   PVLFEHWKNKDEDVQVYESLPRGLSYYDMMRKSKYCICPSGYEVASPRVVEALYVGCVPV  502

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI DHY  PF+D+L+W +F+V++PV EIPNLK+ILL+I  ++Y+ MQ +G+ VR+HFEVN
Sbjct  503   LISDHYVPPFSDILNWRSFSVEVPVNEIPNLKRILLNISSKQYIRMQRRGLLVRKHFEVN  562

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             FPPKR+DV+HM+LHS+WLRRLN+ +HD Q
Sbjct  563   FPPKRFDVYHMILHSVWLRRLNVRIHDEQ  591



>ref|XP_007202112.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
 gb|EMJ03311.1| hypothetical protein PRUPE_ppa006842mg [Prunus persica]
Length=393

 Score =   508 bits (1308),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 230/358 (64%), Positives = 290/358 (81%), Gaps = 1/358 (0%)
 Frame = +1

Query  385   EDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQ  564
             +D DY+P+GP+Y N +AF RSYLEMEKRFK+F+Y EGEPP+FH    + I  +EG  IH+
Sbjct  36    QDVDYIPNGPMYWNANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNFIHE  95

Query  565   LEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYW  741
             +E++K FRT++PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYW
Sbjct  96    IEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSGKYPYW  155

Query  742   NRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQG  921
             NRSLG DHFMLACHDW P  S+  P L KNSIRV+CNANTSEGF P+ DVS PEI L  G
Sbjct  156   NRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEINLQTG  215

Query  922   NMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVR  1101
             +  G +GGP P  RS+L F+AGG+HG IR V++E WENKD ++ +H+YLPK +SYY M+R
Sbjct  216   DTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISYYDMMR  275

Query  1102  KSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNL  1281
              SK+C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ V EIPNL
Sbjct  276   HSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVSEIPNL  335

Query  1282  KKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             K IL+SI  ++Y+ MQ + +QVRRHFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  336   KNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  393



>ref|XP_008359607.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=539

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 226/357 (63%), Positives = 288/357 (81%), Gaps = 1/357 (0%)
 Frame = +1

Query  388   DPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQL  567
             D DY+P+GP+Y N +AFH SYLEME++FK+F+Y EGEPP+FH    + I  +EG  IHQ+
Sbjct  183   DVDYIPNGPMYWNANAFHSSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSMEGNFIHQI  242

Query  568   EISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWN  744
             E++K FRT++PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYWN
Sbjct  243   EVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVSEKYPYWN  302

Query  745   RSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGN  924
             RSLG DHFMLACHDW P  S+  P L KNSIR +CNANTSEGF P+ DVS PEI L  G+
Sbjct  303   RSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEINLQTGD  362

Query  925   MDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRK  1104
               G +GGP P  RS L F+AGG+HG IR +++E WENKDP++ +H+YLPK VSYY M+R+
Sbjct  363   THGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGVSYYNMMRQ  422

Query  1105  SKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLK  1284
             S++C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+D+L+W +F+V++ V +IPNLK
Sbjct  423   SRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSVSDIPNLK  482

Query  1285  KILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             KIL SI   +Y+ MQ + +QVR+HFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  483   KILTSISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  539



>ref|XP_008392545.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=542

 Score =   511 bits (1316),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 227/358 (63%), Positives = 288/358 (80%), Gaps = 1/358 (0%)
 Frame = +1

Query  385   EDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQ  564
              D DY+P+GP+Y N +AFHRSYLEME+ FK+F+Y EGEPP+FH    + I  +EG  IH+
Sbjct  185   RDVDYIPNGPMYWNANAFHRSYLEMEEXFKVFVYGEGEPPLFHNGPCKSIYSMEGNFIHE  244

Query  565   LEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYW  741
             +E++K FRT++PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYW
Sbjct  245   IEVNKQFRTRDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRRTVRDYVNIVSEKYPYW  304

Query  742   NRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQG  921
             NRSLG DHFMLACHDW P  S+  P L KNSIR +CNANTSEGF P+ DVS PEI L  G
Sbjct  305   NRSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSKDVSFPEINLQTG  364

Query  922   NMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVR  1101
             +  G IGGP P  RS+L F+AGG+HG IR +++E WENKDP++ +H+YLPK VSYY M+R
Sbjct  365   DTHGFIGGPSPRLRSILGFFAGGVHGPIRPILLEHWENKDPDLRVHQYLPKGVSYYDMMR  424

Query  1102  KSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNL  1281
             +S++C+CPSGYEVASPR+VEA+Y GC+PVLI DHY  PF+DVL+W +F++++   +IPNL
Sbjct  425   QSRFCLCPSGYEVASPRVVEAIYTGCIPVLISDHYVPPFSDVLNWRSFSIEVSASDIPNL  484

Query  1282  KKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             KKIL SI   +YL MQ + +QVRRHFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  485   KKILTSISSRQYLRMQRRVLQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  542



>ref|XP_003537031.2| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=491

 Score =   509 bits (1310),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 238/392 (61%), Positives = 305/392 (78%), Gaps = 4/392 (1%)
 Frame = +1

Query  277   SHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSY  450
             SHP     +KL+ ++R E  LA+ RAAIR+A+ EN+  +D DYVP GP+Y N   FHRSY
Sbjct  97    SHPRQKQKRKLSFIDRNEVVLAQARAAIREAKNENQT-QDSDYVPIGPMYWNAKTFHRSY  155

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPF  627
             LEMEK+FK+F+YEEGE PVFH    + I  +EG  IH +E++  FRTK+P+KAHVFFLPF
Sbjct  156   LEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTKDPKKAHVFFLPF  215

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   +V FV+ RD+ ++ PI+KT  DYIN I+ +Y YWNRSLG DHFMLACHDW P  S 
Sbjct  216   SVVMMVRFVYQRDSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFMLACHDWGPEASL  275

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAG  987
               P L KNSIRV+CNANTSEGFKPA DVS PEI L  G+++G IGGP  S RS+L F+AG
Sbjct  276   SLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPSASKRSILAFFAG  335

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
             G+HG IR +++E WENKD ++++H+YLPK VSYY  +R SK+C+CPSGYEVASPR+VEA+
Sbjct  336   GVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSGYEVASPRVVEAI  395

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y GCVPVLI +HY  PF+DVL+W +F+V++ VK+IPNLK IL+SI   +Y+ MQ + IQ+
Sbjct  396   YTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPRQYIRMQRRVIQI  455

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +RHFEV+ PPKR+DVFHM+LHS+WLRRLN  +
Sbjct  456   QRHFEVHSPPKRFDVFHMILHSVWLRRLNFRM  487



>gb|KHN24379.1| Putative glycosyltransferase [Glycine soja]
Length=502

 Score =   508 bits (1307),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 239/403 (59%), Positives = 305/403 (76%), Gaps = 4/403 (1%)
 Frame = +1

Query  250   SMPFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYR  423
             S P  +   SHP     +K + L+R E  LA+ RA IR+A+  N + +D DYVP GP+Y 
Sbjct  91    SAPANESDESHPREKQKRKPSFLDRTEVVLAQARATIREAKNWN-LTQDSDYVPIGPMYW  149

Query  424   NPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPE  600
             N   FHRSYLEMEK+FK+F+YEEGE PVFH      I   EG  IH +E+++ FRT++P+
Sbjct  150   NAKEFHRSYLEMEKQFKVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPK  209

Query  601   KAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLAC  780
             KA+VFFLPFS   +V +V++R+++++ PI++T RDY+N I+T+YPYWNRSLG DHFML+C
Sbjct  210   KANVFFLPFSIAWMVRYVYIRNSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSC  269

Query  781   HDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN  960
             HDW P  S   P L KNSIRV+CNANTSEGF P  D S PEI L  G  D  IGGPP S 
Sbjct  270   HDWGPETSKSIPYLRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFIGGPPASK  329

Query  961   RSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEV  1140
             RS+L F+AGG HG IR +++E WENKD ++++H+YLPK VSYYGM+R SK+C+CPSGYEV
Sbjct  330   RSILAFFAGGNHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEV  389

Query  1141  ASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYL  1320
             ASPR+VEA+Y GCVPVLI +HY  PF+DVL+W  F+V++ VKEIPNLK IL SI   +Y+
Sbjct  390   ASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYI  449

Query  1321  SMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              MQ++  Q+RRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VHD
Sbjct  450   RMQKRVGQIRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHD  492



>ref|XP_008241335.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=541

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 229/358 (64%), Positives = 288/358 (80%), Gaps = 1/358 (0%)
 Frame = +1

Query  385   EDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQ  564
             +D DY+P+GP+Y   +AF RSYLEMEKRFK+F+Y EGEPP+FH    + I  +EG  IH+
Sbjct  184   QDVDYIPNGPMYWKANAFQRSYLEMEKRFKVFVYGEGEPPLFHNGPCKSIYSMEGNFIHE  243

Query  565   LEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYW  741
             +E++K FRT +PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYW
Sbjct  244   IEVNKQFRTHDPEKAHVYFLPFSVTMLVRFVYVRDSHDFGPIRQTVRDYVNIVSGKYPYW  303

Query  742   NRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQG  921
             NRSLG DHFMLACHDW P  S+  P L KNSIRV+CNANTSEGF P+ DVS PEI L  G
Sbjct  304   NRSLGADHFMLACHDWGPETSNSDPHLRKNSIRVLCNANTSEGFNPSKDVSFPEINLQTG  363

Query  922   NMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVR  1101
             +  G +GGP P  RS+L F+AGG+HG IR V++E WENKD ++ +H+YLPK +SYY M+R
Sbjct  364   DTHGFLGGPSPRLRSILAFFAGGVHGPIRPVLLEHWENKDEDLRVHQYLPKGISYYDMMR  423

Query  1102  KSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNL  1281
              SK+C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ V EIPNL
Sbjct  424   HSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKSFSVEVKVSEIPNL  483

Query  1282  KKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             K IL+SI  ++Y+ MQ + +QVRRHFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  484   KNILMSISTKQYIRMQRRVVQVRRHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  541



>ref|XP_003535253.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine 
max]
Length=523

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/403 (59%), Positives = 305/403 (76%), Gaps = 4/403 (1%)
 Frame = +1

Query  250   SMPFYQLPSSHP--DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYR  423
             S P  +   SHP     +K + L+R E  LA+ RA IR+A+  N + +D DYVP GP+Y 
Sbjct  112   SAPANESDESHPREKQKRKPSFLDRTEVVLAQARATIREAKNWN-LTQDSDYVPIGPMYW  170

Query  424   NPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPE  600
             N   FHRSYLEMEK+FK+F+YEEGE PVFH      I   EG  IH +E+++ FRT++P+
Sbjct  171   NAKEFHRSYLEMEKQFKVFVYEEGELPVFHDGPCSSIYSTEGSFIHAIEMNEHFRTRDPK  230

Query  601   KAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLAC  780
             KA+VFFLPFS   +V +V++R+++++ PI++T RDY+N I+T+YPYWNRSLG DHFML+C
Sbjct  231   KANVFFLPFSIAWMVRYVYIRNSYDFGPIKRTVRDYVNVIATRYPYWNRSLGADHFMLSC  290

Query  781   HDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN  960
             HDW P  S   P L KNSIRV+CNANTSEGF P  D S PEI L  G  D  +GGPP S 
Sbjct  291   HDWGPETSKSIPYLRKNSIRVLCNANTSEGFDPIKDASFPEINLQPGLKDSFVGGPPASK  350

Query  961   RSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEV  1140
             RS+L F+AGG HG IR +++E WENKD ++++H+YLPK VSYYGM+R SK+C+CPSGYEV
Sbjct  351   RSILAFFAGGNHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYGMLRNSKFCLCPSGYEV  410

Query  1141  ASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYL  1320
             ASPR+VEA+Y GCVPVLI +HY  PF+DVL+W  F+V++ VKEIPNLK IL SI   +Y+
Sbjct  411   ASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKMFSVNVSVKEIPNLKDILTSISPRQYI  470

Query  1321  SMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              MQ++  Q+RRHFEV+ PPKRYDVFHM+LHS+WLRRLN  VHD
Sbjct  471   RMQKRVGQIRRHFEVHSPPKRYDVFHMILHSVWLRRLNFRVHD  513



>gb|KCW48746.1| hypothetical protein EUGRSUZ_K02385, partial [Eucalyptus grandis]
Length=352

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 229/352 (65%), Positives = 286/352 (81%), Gaps = 1/352 (0%)
 Frame = +1

Query  382   LEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIH  561
             +EDPDYVP GP+YRN +AFHRSYLEMEK+FKIF+Y+EG+PPVFH    + I   EG  IH
Sbjct  1     MEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAKEGNFIH  60

Query  562   QLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPY  738
              +EI+K FRT +P KAHVFFLPFS   +V FV+VRD+H++ PI++T  DYI+ +++KYPY
Sbjct  61    MVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPY  120

Query  739   WNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQ  918
             WNRSLG DHFMLACHDW P  S   P L +NSIRV+CNANTSEGF P+ DVS PE+ L  
Sbjct  121   WNRSLGADHFMLACHDWGPEASFAVPHLQRNSIRVLCNANTSEGFDPSKDVSFPEVNLHT  180

Query  919   GNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMV  1098
             G + GLIGGP PS+RS+L F+AGG+HG IR ++++ WENKD +V++H YLP+ VSYY M+
Sbjct  181   GAISGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMM  240

Query  1099  RKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPN  1278
             R+SK+CICPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ V+EIPN
Sbjct  241   RRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPN  300

Query  1279  LKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             LK IL SI   +Y+ MQ +  QVRRHFEV+ PPKRYDVFHM+LHS+WLRRLN
Sbjct  301   LKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHSVWLRRLN  352



>ref|XP_009340969.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=542

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 224/357 (63%), Positives = 287/357 (80%), Gaps = 1/357 (0%)
 Frame = +1

Query  388   DPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQL  567
             D DY+P+GP+Y N +AFHRSYLEME++FK+F+Y EGEPP+FH    + I  +EG  IH++
Sbjct  186   DVDYIPNGPMYWNANAFHRSYLEMEEKFKVFVYAEGEPPLFHNGPCKSIYSMEGNFIHEI  245

Query  568   EISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWN  744
             E++K FRT++PEKAHV+FLPFS   LV FV+VRD+H++ PI++T RDY+N +S KYPYWN
Sbjct  246   EVNKQFRTQDPEKAHVYFLPFSVTMLVRFVYVRDSHDFSPIRQTVRDYVNIVSEKYPYWN  305

Query  745   RSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGN  924
             RSLG DHFMLACHDW P  S+  P L KNSIR +CNANTSEGF P+ DVS PEI L  G+
Sbjct  306   RSLGADHFMLACHDWGPETSNSNPHLRKNSIRALCNANTSEGFNPSRDVSFPEINLQTGD  365

Query  925   MDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRK  1104
               G +GGP P  RS L F+AGG+HG IR +++E WENKDP++ +H+YLPK  SYY M+R+
Sbjct  366   THGFLGGPSPRLRSNLAFFAGGVHGPIRPILLEHWENKDPDMRVHQYLPKGASYYDMMRQ  425

Query  1105  SKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLK  1284
             S++C+CPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+D+L+W +F+V++ V +IPNLK
Sbjct  426   SRFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDILNWKSFSVEVSVSDIPNLK  485

Query  1285  KILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             KIL  I   +Y+ MQ + +QVR+HFEVN PPKR+DVFHM+LHSIWLRRLN+ VHD Q
Sbjct  486   KILTRISSRQYVRMQRRVLQVRKHFEVNSPPKRFDVFHMILHSIWLRRLNVRVHDDQ  542



>ref|XP_006381337.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
 gb|ERP59134.1| hypothetical protein POPTR_0006s11930g [Populus trichocarpa]
Length=510

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 298/385 (77%), Gaps = 2/385 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T+LE++EAGL + R A+++A+   +  +DPDY P GP+Y N   FHRSYLEMEK+FK+F+
Sbjct  122   TSLEKLEAGLQKARVALKEAKN-GKQADDPDYAPAGPMYWNAEVFHRSYLEMEKQFKVFV  180

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y EGEPPVFH    + I  +EG  IH++EI   FRTK+P+KAHV+FLPFS   +V FV+ 
Sbjct  181   YGEGEPPVFHNGPCRSIYSMEGNFIHRMEIDGHFRTKDPDKAHVYFLPFSVAMMVRFVYE  240

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             R++ ++ PI++T  DYIN IS KYP+WNRSLG DHFMLACHDW P  S   P L K SIR
Sbjct  241   RESRDFGPIRRTVSDYINLISGKYPFWNRSLGADHFMLACHDWGPEASFSVPHLGKISIR  300

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
              +CNANTSE F P  DVSLPEI L  G++ G +GG  PS RS+L F+AG +HG IR V++
Sbjct  301   ALCNANTSEKFNPIKDVSLPEINLRTGSIKGFVGGLSPSKRSILAFFAGRLHGPIRPVVL  360

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             E WENKD ++++H+ LPK VSYY M+R SK+C+CPSGYEVASPR+VEA+Y GCVPVLI D
Sbjct  361   EHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGCVPVLISD  420

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++PV +IP+LKKIL SI   +Y+ MQ + +QVRRHFEVN PPK
Sbjct  421   HYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHFEVNSPPK  480

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             R+DVFHM+LHSIWLRRLN+ +HD Q
Sbjct  481   RFDVFHMILHSIWLRRLNVGIHDDQ  505



>ref|XP_006481931.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=555

 Score =   505 bits (1300),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 239/390 (61%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + +T LE++EAGL R R AI++A   N+  +DPD+VP GP+Y +  AFHRSYLEME++FK
Sbjct  164   RAVTKLEKLEAGLQRARVAIKEASIGNQT-QDPDFVPLGPMYWDSKAFHRSYLEMEQKFK  222

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPPVFH    + I  +EG  I+ +E++K FRTK  +KAHVFFLPFS   LV F
Sbjct  223   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  282

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T  DY+N I+ KYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  283   VYVRDSHDFGPIRRTVVDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  342

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSE F P  DVS PEI L  G + GLIGGP PS RS+L F+AGG+HG IR 
Sbjct  343   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  402

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V++E WENKD ++ +H+YLPK VSYY M+RKSKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  403   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  462

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I +HY  PF+DVL+W +F+V +  ++IPNLK IL SI   +Y+ M  + +QVRRHFE N 
Sbjct  463   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  522

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PPKR+DVFHM+LHSIWLRRLN+ + + Q  
Sbjct  523   PPKRFDVFHMILHSIWLRRLNVRIQNDQSA  552



>ref|XP_011018855.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018857.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011018858.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=513

 Score =   503 bits (1295),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/385 (60%), Positives = 299/385 (78%), Gaps = 2/385 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T+LE++EAGL + R A+++A+   +  +DPDYVP GP+Y N   FHRSYLEME++FK+F+
Sbjct  122   TSLEKLEAGLQKARVALKEAKN-GKQADDPDYVPAGPMYWNAKVFHRSYLEMEEQFKVFV  180

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             YEEGEPP+FH    + I  +EG  IH +EI+  FRTK+P+KAHV+FLPFS   +V FV+ 
Sbjct  181   YEEGEPPLFHNGPCRSIYSMEGNFIHMMEINGHFRTKDPDKAHVYFLPFSVAMMVRFVYE  240

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             R + ++ PI++T  DYIN IS KY +WNRSLG DHFMLACHDW P  S   P L K SIR
Sbjct  241   RQSRDFGPIRRTVSDYINLISRKYSFWNRSLGADHFMLACHDWGPEASFSVPHLGKISIR  300

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
              +CNANTSE F P  DVSLPEI L  G++ G +GG  PS R +L F+AG +HG IR V++
Sbjct  301   ALCNANTSEKFNPVKDVSLPEINLLTGSIKGFVGGLSPSKRLILAFFAGRLHGPIRPVVL  360

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             E WENKD ++++H+ LPK VSYY M+R SK+C+CPSGYEVASPR+VEA+Y GCVPVLI D
Sbjct  361   EHWENKDDDIKVHQQLPKGVSYYEMMRGSKFCLCPSGYEVASPRIVEALYAGCVPVLISD  420

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++PV +IP+LKKIL SI   +Y+ MQ + +QVRRHFEVN+PPK
Sbjct  421   HYVPPFSDVLNWKSFSVEVPVSDIPSLKKILTSISPRQYIRMQRRVLQVRRHFEVNYPPK  480

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             R+DVFHM+LHSIWLRRLNI +HD+Q
Sbjct  481   RFDVFHMILHSIWLRRLNIGIHDVQ  505



>ref|XP_006430348.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
 gb|ESR43588.1| hypothetical protein CICLE_v10011407mg [Citrus clementina]
Length=552

 Score =   504 bits (1299),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/390 (61%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + +T LE++EAGL R R AI++A   N+  +DPD+VP GP+Y +  AFHRSYLEME++FK
Sbjct  161   RAVTKLEKLEAGLQRARVAIKEASIGNQT-QDPDFVPLGPMYWDSKAFHRSYLEMEQKFK  219

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPPVFH    + I  +EG  I+ +E++K FRTK  +KAHVFFLPFS   LV F
Sbjct  220   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  279

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T  DY+N I+ KYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  280   VYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  339

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSE F P  DVS PEI L  G + GLIGGP PS RS+L F+AGG+HG IR 
Sbjct  340   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  399

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V++E WENKD ++ +H+YLPK VSYY M+RKSKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  400   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  459

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I +HY  PF+DVL+W +F+V +  ++IPNLK IL SI   +Y+ M  + +QVRRHFE N 
Sbjct  460   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  519

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PPKR+DVFHM+LHSIWLRRLN+ + + Q  
Sbjct  520   PPKRFDVFHMILHSIWLRRLNVRIQNDQSA  549



>gb|KDO60990.1| hypothetical protein CISIN_1g048582mg [Citrus sinensis]
Length=555

 Score =   504 bits (1299),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/390 (61%), Positives = 301/390 (77%), Gaps = 2/390 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + +T LE++EAGL R R AI++A   N+  +DPD+VP GP+Y +  AFHRSYLEME++FK
Sbjct  164   RAVTKLEKLEAGLQRARVAIKEASIGNQT-QDPDFVPLGPMYWDSKAFHRSYLEMEQKFK  222

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             +F+YEEGEPPVFH    + I  +EG  I+ +E++K FRTK  +KAHVFFLPFS   LV F
Sbjct  223   VFVYEEGEPPVFHDGPCKSIYSMEGNFIYTMEVNKQFRTKEADKAHVFFLPFSVVKLVRF  282

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+VRD+H++ PI++T  DY+N I+ KYPYWNRSLG DHFMLACHDW P  S   P L KN
Sbjct  283   VYVRDSHDFGPIRRTVIDYVNLIAGKYPYWNRSLGADHFMLACHDWGPETSFSVPYLGKN  342

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSE F P  DVS PEI L  G + GLIGGP PS RS+L F+AGG+HG IR 
Sbjct  343   SIRVLCNANTSEKFSPVKDVSFPEINLQTGGLTGLIGGPSPSRRSILAFFAGGVHGPIRP  402

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V++E WENKD ++ +H+YLPK VSYY M+RKSKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  403   VLLEHWENKDEDIRVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEAIYTGCVPVL  462

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I +HY  PF+DVL+W +F+V +  ++IPNLK IL SI   +Y+ M  + +QVRRHFE N 
Sbjct  463   ISEHYVPPFSDVLNWKSFSVALSTRDIPNLKSILTSISPRQYIRMHRRVVQVRRHFEFNS  522

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PPKR+DVFHM+LHSIWLRRLN+ + + Q  
Sbjct  523   PPKRFDVFHMILHSIWLRRLNVRIQNDQSA  552



>ref|XP_010039048.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Eucalyptus grandis]
Length=382

 Score =   497 bits (1280),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 296/376 (79%), Gaps = 7/376 (2%)
 Frame = +1

Query  331   LARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVF  510
             L   R+ IR+A+T N  +EDPDYVP GP+YRN +AFHRSYLEMEK+FKIF+Y+EG+PPVF
Sbjct  13    LVPARSGIREAKTGNP-MEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVF  71

Query  511   HYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPI  687
             H    + I   E   IH +EI+K FRT +P KAHVFFLPFS   +V FV+VRD+H++ PI
Sbjct  72    HNGPCKSIYATERNFIHMVEINKRFRTGDPRKAHVFFLPFSVAMMVQFVYVRDSHDFGPI  131

Query  688   QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSE  867
             ++T  DYI+ ++ KYPYWNRSLG DHFMLACHDW P      P+L +NSIRV+CNANTSE
Sbjct  132   KRTVIDYIDVVAGKYPYWNRSLGADHFMLACHDWGPV-----PRLHRNSIRVLCNANTSE  186

Query  868   GFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPE  1047
             GF P+ DVS PE+ L  G + GLIG   PS+RS+L F+AGG+HG IR ++++ WENKD +
Sbjct  187   GFDPSKDVSFPEVNLHTGAISGLIGEASPSHRSILAFFAGGLHGPIRPILLQHWENKDED  246

Query  1048  VEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADV  1227
             V++H YLP+ VSYY M+++SK+CICPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DV
Sbjct  247   VKVHRYLPRGVSYYDMMKRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDV  306

Query  1228  LDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVL  1407
             L+W +F+V++ V+EIPNLK IL SI   +Y+ MQ +  QVRRHFEV+ PPKRYDVFHM+L
Sbjct  307   LNWRSFSVEVTVREIPNLKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMIL  366

Query  1408  HSIWLRRLNIEVHDIQ  1455
             HS+WLRRLN+ + D Q
Sbjct  367   HSVWLRRLNVGLSDNQ  382



>gb|EPS64188.1| hypothetical protein M569_10593, partial [Genlisea aurea]
Length=383

 Score =   494 bits (1271),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 225/384 (59%), Positives = 295/384 (77%), Gaps = 3/384 (1%)
 Frame = +1

Query  307   NLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIY  486
             NL  +EA L R R +IR+++    I +DPDYVP+GP+Y +P AFHRSY EMEK F++F+Y
Sbjct  1     NLHILEAKLKRARNSIRESRNGTAI-DDPDYVPYGPVYHSPSAFHRSYKEMEKHFRVFVY  59

Query  487   EEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKNPEKAHVFFLPFSSYSLVHFVFVRD  666
              EGE P+FH      I   EG  I+ +E S FRT++PEKA VFFLP S  ++V FV+ R+
Sbjct  60    GEGEHPIFHNGPCGSIYSTEGNFIYTVEGSSFRTRDPEKASVFFLPLSVAAIVRFVYDRN  119

Query  667   A-HEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRV  843
             +  +W P+++T +DY++ ++ +YPYWNRSLG DH ML+CHDW P +S   P+LFKNSIR 
Sbjct  120   SGDQWGPMKRTVKDYVDLVAMRYPYWNRSLGSDHVMLSCHDWGPELSKSVPELFKNSIRA  179

Query  844   MCNANTSEGFKPAIDVSLPEIYLPQGN-MDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             +CNANT+EGFKPA DV++PEI LP G    GLIGG   S R++L F+AGG+HG +R +++
Sbjct  180   LCNANTTEGFKPAKDVAIPEINLPGGGRTKGLIGGLSASKRTILAFFAGGVHGPVRPILL  239

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             E WENKDP+V++++YLPK +SY   +RKS++CICPSGYEVASPR+VEA+Y GCVPVLI D
Sbjct  240   EHWENKDPDVQVYQYLPKRLSYSDQMRKSRFCICPSGYEVASPRIVEALYNGCVPVLIND  299

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF DVL+W  FAV++PV EIPNLKKIL +I   +Y+ ++ +G  VRRHFEVNFPPK
Sbjct  300   HYVPPFGDVLNWKAFAVEVPVGEIPNLKKILTAISTRQYIRLKRRGETVRRHFEVNFPPK  359

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDI  1452
             RYDVFHM LHSIWLRRLN+ +H +
Sbjct  360   RYDVFHMTLHSIWLRRLNLRLHGV  383



>ref|XP_007027562.1| Exostosin family protein [Theobroma cacao]
 gb|EOY08064.1| Exostosin family protein [Theobroma cacao]
Length=569

 Score =   499 bits (1285),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 229/383 (60%), Positives = 293/383 (77%), Gaps = 2/383 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+++EAGL R RAAI++A+    +L+DPDYVP GP+Y +  AFHRSYLEMEK+FKIF+
Sbjct  181   TKLDKLEAGLQRARAAIKEAKN-GSLLQDPDYVPIGPMYWDAKAFHRSYLEMEKQFKIFV  239

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y+EGEPPVFH    + I  +EG  IH++++ S F+TK+PEKAHVF+LPFS   +V FV++
Sbjct  240   YKEGEPPVFHDGPCKSIYSMEGNFIHKMDVDSNFQTKDPEKAHVFYLPFSVAKMVRFVYL  299

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             RD+ ++ PI++T  DY+N I+ KYPYWNRSLG DHFMLACHDW P  S   P L KNSIR
Sbjct  300   RDSRDFSPIRRTVVDYVNLIAEKYPYWNRSLGADHFMLACHDWGPEASFSLPYLQKNSIR  359

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
              +CNANTSE F P  DVS+PEI L  G + GLIGGP  S R +L F+AGG+HG IR +++
Sbjct  360   ALCNANTSEKFNPVKDVSIPEINLLTGKLTGLIGGPSASRRPILAFFAGGVHGPIRPILL  419

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             E WE KD ++ +H+YLPK V+YY M++ SKYCICPSGYEVASPR+VEA+Y GCVPVLI  
Sbjct  420   EHWEGKDEDIRVHKYLPKGVNYYEMMKNSKYCICPSGYEVASPRIVEALYNGCVPVLISK  479

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
              Y  PF+DVL W +F+V + V +IP LK+IL  I   +Y+ MQ + +QVRRHF  N PPK
Sbjct  480   SYVPPFSDVLRWKSFSVVVSVDDIPKLKEILTKISSRQYIRMQRRVLQVRRHFAFNSPPK  539

Query  1381  RYDVFHMVLHSIWLRRLNIEVHD  1449
             R+DVFHM+LHSIWLRRLN+ + D
Sbjct  540   RFDVFHMILHSIWLRRLNVRISD  562



>gb|KHG20191.1| hypothetical protein F383_08256 [Gossypium arboreum]
Length=575

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 228/395 (58%), Positives = 301/395 (76%), Gaps = 4/395 (1%)
 Frame = +1

Query  268   LPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             LP  H   ++  T L++VEAGL R R+AIR+A+  ++ L++ DYVP GP+Y +  AFHRS
Sbjct  177   LPLKHSRQVR--TKLDKVEAGLQRARSAIREAKNGSQ-LQESDYVPIGPMYWDAKAFHRS  233

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLP  624
             YLEMEK+FK+F+Y+EGEPPVFH    + I  +EG  I++L++ +KF+TK+P+KAHVF+LP
Sbjct  234   YLEMEKQFKVFVYKEGEPPVFHDGPCKSIYSMEGNFIYKLDVDTKFQTKDPQKAHVFYLP  293

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   +V FV+ RD+ ++ PI++T  DYIN ++ KYPYWNRS G DHFMLACHDW P  S
Sbjct  294   FSVAKMVRFVYSRDSRDFSPIRRTVVDYINLVAQKYPYWNRSHGADHFMLACHDWGPEAS  353

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L KNSIR +CNANTSE F P  DVS+PEI L    + GL+GGP  S R +L F+A
Sbjct  354   FSLPHLEKNSIRALCNANTSERFNPVKDVSIPEINLITDKLTGLMGGPSASQRQILAFFA  413

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR V++E WE+KD ++++H+YLP+ V+YY M+R SKYCICPSGYEVASPR+VEA
Sbjct  414   GGVHGPIRPVLLEHWEDKDEDIKVHKYLPRGVNYYDMMRNSKYCICPSGYEVASPRIVEA  473

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI   Y  PF+DVL W +F+V + V +IP LK+IL++I   +Y+ MQ + +Q
Sbjct  474   LYNGCVPVLISKSYVAPFSDVLRWKSFSVTVSVDDIPKLKEILMNISTRQYIRMQRRVLQ  533

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             VRRHFE N PPKRYDVFHM+LHS+WLRRLN+ + D
Sbjct  534   VRRHFEFNSPPKRYDVFHMILHSVWLRRLNVRITD  568



>gb|KHG04052.1| hypothetical protein F383_28592 [Gossypium arboreum]
Length=541

 Score =   496 bits (1276),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 295/383 (77%), Gaps = 2/383 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+++EA L R RAAI+ A+  +++L DP+YVP GP+Y +  AFHRSY+EMEK+FK+F+
Sbjct  153   TKLDKLEARLQRARAAIKDAKNSSQLL-DPEYVPIGPMYWDAKAFHRSYMEMEKQFKVFV  211

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y+EGEPPVFH    + I  +EG  I+Q+++ +KFRT +PEKAH F+LPFS   +V FV++
Sbjct  212   YKEGEPPVFHDGPCKSIYSMEGNFIYQMDVNTKFRTNDPEKAHAFYLPFSVAKMVQFVYL  271

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             RD+ ++ PI++T  DY+N +S KYPYWNRSLG DHFMLACHDW P  S   P L KNSIR
Sbjct  272   RDSRDFGPIRRTVIDYVNVVSEKYPYWNRSLGADHFMLACHDWGPEASFSNPYLGKNSIR  331

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
              +CNANTSE F P  DVS+PE+ L  G + GLIGGP  S R +L F+AGG+HG IR +++
Sbjct  332   ALCNANTSEKFNPVKDVSIPEMNLRTGKLTGLIGGPSASRRPILAFFAGGVHGPIRPILL  391

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             E WE KD E+++H+YLPK ++YY M+R SKYC+CPSGYEVASPR+VEA+Y GCVPVLI  
Sbjct  392   EHWEGKDDEIKVHKYLPKGINYYEMMRSSKYCLCPSGYEVASPRIVEALYNGCVPVLISK  451

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
              Y  PF+DVL W +F+V + V++IP LK+IL+ I   +Y+ MQ + +QVRRHFE + PPK
Sbjct  452   SYVPPFSDVLRWKSFSVVVSVEDIPRLKEILMKISSRQYIRMQRRVLQVRRHFEFHSPPK  511

Query  1381  RYDVFHMVLHSIWLRRLNIEVHD  1449
             R+DVFHM+LHSIWLRRLN+ V D
Sbjct  512   RFDVFHMILHSIWLRRLNVRVSD  534



>ref|XP_009413449.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   493 bits (1270),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 298/391 (76%), Gaps = 4/391 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K+ T L+R+E GL R RAAI++A     NR  L D DYVP GP+YRN +AFHRSYLEMEK
Sbjct  121   KRYTKLQRLELGLGRARAAIKKAFRNAGNRTALPDKDYVPQGPLYRNAYAFHRSYLEMEK  180

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FK+++YEEGEPP+FH    + I   EG  I+ +E+ S++RT+NP+ AHVFFLPFS   +
Sbjct  181   LFKVYVYEEGEPPLFHDGPCRSIYSSEGRFINSMEMDSRYRTRNPDLAHVFFLPFSVAKM  240

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V F++  ++ +  PI+KT  DYI+ ++ +YPYWNRSLG DHFML+CHDW P  S   P L
Sbjct  241   VKFIYKPESFDISPIKKTIADYIDVVAERYPYWNRSLGADHFMLSCHDWGPHSSKAVPNL  300

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NS+RV+CNANTSEGF P+ DVSLPEI +    M  ++GGP  S+R +L F+AGG HG 
Sbjct  301   YGNSVRVLCNANTSEGFDPSKDVSLPEINIKTDVMADMMGGPSASHRPILAFFAGGDHGP  360

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             +R +++E W++KDP+V++HEYLPK VSYY  +RKSKYC+CPSGYEVASPR+VEA+Y+GCV
Sbjct  361   VRPLLLEAWKDKDPDVQVHEYLPKGVSYYDTMRKSKYCLCPSGYEVASPRIVEAIYLGCV  420

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PV I DHY  PF+DVLDW  F+V I V++IPN+KKIL+ I   +Y+ +Q +G  V+RHF 
Sbjct  421   PVTINDHYVLPFSDVLDWKAFSVQISVEDIPNIKKILMGISPTQYIRLQRRGAMVQRHFV  480

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             VN PP+R+DVFHM+LHSIWLRRLNI +H  Q
Sbjct  481   VNSPPRRFDVFHMILHSIWLRRLNIRMHRPQ  511



>ref|XP_010543482.1| PREDICTED: probable glycosyltransferase At5g03795 [Tarenaya hassleriana]
Length=489

 Score =   492 bits (1266),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 303/393 (77%), Gaps = 4/393 (1%)
 Frame = +1

Query  283   PDAMKK--LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             P  +KK  L+N+E++EA L R RAAI+ A  E+  ++DPDYVP GP+Y N   FHRSYLE
Sbjct  98    PLTVKKRILSNMEKIEAELQRARAAIKGASFEDD-MDDPDYVPLGPMYWNAKVFHRSYLE  156

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK+FKIF+Y+EGEPP+FH    + I  +EG  I+Q+E  ++FRT +P++AH F+LP S 
Sbjct  157   MEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYQMETDTRFRTTDPDRAHAFYLPLSV  216

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V +V+ RD+H++ PI+KT RDYI+ +  KYPYWNRS+G DHF+L+CHDW P  S   
Sbjct  217   VKMVRYVYERDSHDFSPIRKTVRDYIDLVDGKYPYWNRSIGADHFILSCHDWGPEASFSH  276

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P+L +NSIR +CNANTSE FKP  DVS+PEI L  G + GL+GGP PS R +L F+AGG+
Sbjct  277   PQLGENSIRALCNANTSERFKPRKDVSIPEINLRTGTLTGLVGGPSPSRRPILAFFAGGV  336

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG +R ++++ WEN+D +V +H+YLPK  SY  M+R SK+CICPSGYEVASPR+VEA+Y 
Sbjct  337   HGPVRPILLKHWENRDEDVRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYS  396

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
             GCVPVLI + Y  PF+DVL+W +F+V +PV+EIPNLKKIL+ I   +Y+ M  + ++V+R
Sbjct  397   GCVPVLINEGYVPPFSDVLNWRSFSVVVPVEEIPNLKKILMGISPRQYIRMYRRVLKVQR  456

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             HF+VN PPKR+DVFHM+LHSIW+RRLN+ + +I
Sbjct  457   HFQVNSPPKRFDVFHMILHSIWVRRLNVRIREI  489



>gb|KCW48767.1| hypothetical protein EUGRSUZ_K02411, partial [Eucalyptus grandis]
Length=345

 Score =   484 bits (1247),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 281/345 (81%), Gaps = 1/345 (0%)
 Frame = +1

Query  382   LEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIH  561
             +EDPDYVP GP+YRN +AFHRSYLEMEK+FKIF+Y+EG+PPVFH    + I  +EG  IH
Sbjct  1     MEDPDYVPVGPMYRNANAFHRSYLEMEKQFKIFVYKEGDPPVFHNGPCKSIYAMEGNFIH  60

Query  562   QLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPY  738
              +EI+K FRT++P +AHVFFLPFS   +V FV+VRD+H++ PI++T  DYI+ +++KYPY
Sbjct  61    MVEINKRFRTEDPREAHVFFLPFSVAMMVQFVYVRDSHDFGPIKRTVIDYIDVVASKYPY  120

Query  739   WNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQ  918
             WNRSLG DHFMLACHDW P  S   P L +NSIRV+CNANTSEGF P+ DVS PE+ L  
Sbjct  121   WNRSLGADHFMLACHDWGPEASFAVPHLHRNSIRVLCNANTSEGFDPSKDVSFPEVNLHT  180

Query  919   GNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMV  1098
             G + GLIGGP PS+RS+L F+AGG+HG IR ++++ WENKD +V++H YLP+ VSYY M+
Sbjct  181   GAIGGLIGGPSPSHRSILAFFAGGLHGPIRPILLQHWENKDEDVKVHRYLPRGVSYYDMM  240

Query  1099  RKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPN  1278
             ++SK+CICPSGYEVASPR+VEA+Y GCVPVLI DHY  PF+DVL+W +F+V++ V+EIPN
Sbjct  241   KRSKFCICPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWRSFSVEVTVREIPN  300

Query  1279  LKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHS  1413
             LK IL SI   +Y+ MQ +  QVRRHFEV+ PPKRYDVFHM+LHS
Sbjct  301   LKTILASISSRQYIRMQRRVAQVRRHFEVHSPPKRYDVFHMILHS  345



>ref|XP_004156325.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
Length=516

 Score =   489 bits (1258),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 230/376 (61%), Positives = 293/376 (78%), Gaps = 2/376 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ T LER+EAGL R RAAIR+A+  N+  +DPD+VP GP+Y N  AFHRSYLEMEK  K
Sbjct  133   REYTKLERIEAGLRRARAAIREAKFLNQT-QDPDFVPSGPMYWNSKAFHRSYLEMEKEMK  191

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IF+YEEGEPP+FH    + I   EG  IH +E+ S+FRTK+P KAHVFFLP S   LV F
Sbjct  192   IFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRF  251

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+V D+H++ PI+ T  DYIN I TKYP+WNRSLG DHFML+CHDW P  S   P L+KN
Sbjct  252   VYVHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKN  311

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L  G++ G +GGP PS+R +L F+AGG+HG IR 
Sbjct  312   SIRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPILAFFAGGLHGPIRP  371

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++++ WEN+D ++++H+YLPK VSY  M+RKSK+C+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  372   ILIQQWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPVL  431

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DV++W +F+V++ V +IPNLK IL  I   +YL M  + ++VRRHFEVN 
Sbjct  432   ISDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVNS  491

Query  1372  PPKRYDVFHMVLHSIW  1419
             PPKRYDV+HM+LHS+W
Sbjct  492   PPKRYDVYHMILHSVW  507



>ref|XP_009122667.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
 emb|CDX70282.1| BnaA10g26310D [Brassica napus]
Length=501

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/390 (57%), Positives = 297/390 (76%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKK--LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             MKK  ++NLE++E  L + R AI+ A + N  L+DPDY P GP+Y N  AFHRSYLEMEK
Sbjct  113   MKKRVISNLEKIEFELQKARVAIKAA-SMNDPLDDPDYAPLGPMYWNAKAFHRSYLEMEK  171

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
             +FKIF+Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NPEKAH F+LP S   +
Sbjct  172   QFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETNTRFRTNNPEKAHAFYLPLSVVKM  231

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +V+ RD+H++ PI+KT RDYI+ +  KYPYWNRS+G DHF+L+CHDW P  S   P L
Sbjct  232   VRYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHL  291

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
              +NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG+HG 
Sbjct  292   GQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFAGGVHGP  351

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             +R V+++ WENKD ++ +H+YLPK  SY  M+R SK+CICPSGYEVASPR+VEA+Y GCV
Sbjct  352   VRPVLLQHWENKDSDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCV  411

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VRRHFE
Sbjct  412   PVLINSGYVPPFSDVLNWASFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFE  471

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             VN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  472   VNSPAKRFDVFHMILHSIWVRRLNVRIREV  501



>ref|XP_004143371.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 gb|KGN48221.1| hypothetical protein Csa_6G449280 [Cucumis sativus]
Length=516

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 293/376 (78%), Gaps = 2/376 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ T LER+EAGL R RAAIR+A+  N+  +DPD+VP GP+Y N  AFHRSYLEMEK  K
Sbjct  133   REYTKLERIEAGLRRARAAIREAKFLNQT-QDPDFVPSGPMYWNSKAFHRSYLEMEKEMK  191

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IF+YEEGEPP+FH    + I   EG  IH +E+ S+FRTK+P KAHVFFLP S   LV F
Sbjct  192   IFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRF  251

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+V D+H++ PI+ T  DYIN I TKYP+WNRSLG DHFML+CHDW P  S   P L+KN
Sbjct  252   VYVHDSHDFTPIRHTVVDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKN  311

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L  G++ G +GGP PS+R ++ F+AGG+HG IR 
Sbjct  312   SIRVLCNANTSEGFNPSKDVSFPEINLQTGHLTGFLGGPSPSHRPIMAFFAGGLHGPIRP  371

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++++ WEN+D ++++H+YLPK VSY  M+RKSK+C+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  372   ILIQRWENQDQDIQVHQYLPKGVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPVL  431

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DV++W +F+V++ V +IPNLK IL  I   +YL M  + ++VRRHFEVN 
Sbjct  432   ISDHYVPPFSDVINWKSFSVEVSVDDIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVNS  491

Query  1372  PPKRYDVFHMVLHSIW  1419
             PPKRYDV+HM+LHS+W
Sbjct  492   PPKRYDVYHMILHSVW  507



>emb|CDY42006.1| BnaC04g00840D [Brassica napus]
Length=506

 Score =   485 bits (1249),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 296/390 (76%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKK--LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             MKK  ++NL+++E  L + R AI+ A   N  L+DPDYVP GP+Y N  AFHRSYLEMEK
Sbjct  118   MKKRVISNLKKIEFELQKARVAIKAASI-NDPLDDPDYVPLGPMYWNAKAFHRSYLEMEK  176

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
             +FKIF+Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NPEKAH F+LP S   +
Sbjct  177   QFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPEKAHAFYLPLSVVKM  236

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +V+ RD+H++ PI+KT RDYI+ +  KYPYWNRS+G DHF+L+CHDW P  S   P L
Sbjct  237   VRYVYERDSHDFSPIRKTVRDYIDLVGDKYPYWNRSIGADHFILSCHDWGPEASFSHPHL  296

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
              +NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG+HG 
Sbjct  297   GQNSIRALCNANTSERFKPRKDVSIPEINLLTGSLKGLVGGPSPSSRPILAFFAGGVHGP  356

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             +R V+++ WENKD ++ +H+YLPK  SY   +R SK+CICPSGYEVASPR+VEA+Y GCV
Sbjct  357   VRPVLLQHWENKDSDIRVHKYLPKGTSYSDTMRNSKFCICPSGYEVASPRIVEALYSGCV  416

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VRRHFE
Sbjct  417   PVLINSGYVPPFSDVLNWPSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVRRHFE  476

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             VN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  477   VNSPAKRFDVFHMILHSIWVRRLNVRIREV  506



>ref|XP_008381668.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=526

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 220/391 (56%), Positives = 297/391 (76%), Gaps = 4/391 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEM  459
             ++K+ + LE++EA LA VRA+IR+A     +    EDPDYVP GPIYRN +AFHRSYL+M
Sbjct  132   SIKRYSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPRGPIYRNANAFHRSYLKM  191

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSY  636
             EK FKI++YEEGEPP+FH    + I   EG  IH++E+   +RT++P++A V+FLPFS  
Sbjct  192   EKHFKIYVYEEGEPPIFHNGPCKSIYSTEGRFIHEMEMENIYRTRDPDQALVYFLPFSVV  251

Query  637   SLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
              LV +++V D+H+  PI +   DY+N IS K+P+WNRSLG DHFML+CHDW P+ S   P
Sbjct  252   MLVQYLYVADSHDTQPIGRAVVDYVNVISDKHPFWNRSLGADHFMLSCHDWGPSTSAYVP  311

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
              L++NSIRV+CNANTSEGF P+ DVS PEI+L  G   GL+GG  PS RS+L F+AG +H
Sbjct  312   HLYQNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPSRRSILAFFAGRLH  371

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G+IR +++  W+ KD +V++++ LP  VSY  M++KS++C+CPSGYEVASPR+VEA+Y  
Sbjct  372   GHIRYLLLNEWKEKDQDVQVYDQLPNGVSYESMLKKSRFCLCPSGYEVASPRVVEAIYAE  431

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI D Y  PF+DVL+W +F+V + VK+IPN+K+IL+ I Q +YL MQ +  QV+RH
Sbjct  432   CVPVLISDSYVPPFSDVLEWKSFSVQVQVKDIPNIKRILMGISQSQYLRMQRRVKQVQRH  491

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             F VN P KR+DVFHM++HSIWLRRLNI + D
Sbjct  492   FVVNGPSKRFDVFHMIVHSIWLRRLNIRIED  522



>ref|XP_008462519.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=518

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 292/377 (77%), Gaps = 3/377 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++ T LER+EAGL R RAAIR+A+  N+  +DPD+VP GP+Y N  AFHRSYLEMEK  K
Sbjct  134   REYTKLERIEAGLRRARAAIREAKFLNQT-QDPDFVPSGPMYWNSKAFHRSYLEMEKEMK  192

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IF+YEEGEPP+FH    + I   EG  IH +E+ S+FRTK+P KAHVFFLP S   LV F
Sbjct  193   IFVYEEGEPPLFHNGPCKSIYSTEGNFIHAIEMDSQFRTKDPNKAHVFFLPLSVAMLVRF  252

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             V+V D+H++ PI+ T  DYIN I TKYP+WNRSLG DHFML+CHDW P  S   P L+KN
Sbjct  253   VYVHDSHDFTPIRHTVIDYINVIGTKYPFWNRSLGADHFMLSCHDWGPEASKSVPNLYKN  312

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L  G + G +GGP PS+R +L F+AGG+HG IR 
Sbjct  313   SIRVLCNANTSEGFNPSKDVSFPEINLQTGYLTGFLGGPSPSHRPILAFFAGGLHGPIRP  372

Query  1012  VMMETWENKDPEVEIHEYLPKN-VSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
             ++++ WEN+D ++++H+YLPK  VSY  M+RKSK+C+CPSGYEVASPR+VEA+Y GCVPV
Sbjct  373   ILIQQWENQDQDIQVHQYLPKGVVSYIDMMRKSKFCLCPSGYEVASPRIVEAIYTGCVPV  432

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI DHY  PF+DV++W +F+V++ V EIPNLK IL  I   +YL M  + ++VRRHFEVN
Sbjct  433   LISDHYVPPFSDVINWKSFSVEVSVDEIPNLKTILTGISTRQYLRMYRRVVKVRRHFEVN  492

Query  1369  FPPKRYDVFHMVLHSIW  1419
              PPKRYDV+HM+LHS+W
Sbjct  493   SPPKRYDVYHMILHSVW  509



>ref|XP_006447859.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
 gb|ESR61099.1| hypothetical protein CICLE_v10017948mg [Citrus clementina]
Length=524

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 229/397 (58%), Positives = 293/397 (74%), Gaps = 4/397 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             DA+KK   LERVEA L R R++IR+A   +    + +DPDYVP GPIYRN +AFHRSYL 
Sbjct  128   DAVKKYNKLERVEASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLL  187

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSS  633
             MEK FKI++YEEGEPP+FH    + I   EG  IH++E S  ++TK+PEKA V+FLPFS 
Sbjct  188   MEKLFKIYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSV  247

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V  ++V  AHE   I ++  DYI+ IS KYP+WNRSLG DHFML+CHDW P  S   
Sbjct  248   VMMVEHLYVPGAHEINAIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFV  307

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P LF+NSIRV+CNANTSEGF P  D SLPEI L  G + GLIGGP PS RS+L F+AG +
Sbjct  308   PHLFRNSIRVLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRL  367

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG+IR ++++ W+NKD +V++++ LP NVSY  M+RKSK+C+CPSGYEVASPR+VEA+Y 
Sbjct  368   HGHIRHLLLDNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYS  427

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI D +  PF+DVL+W+ F+V I VK+IP +K+IL  I Q +YL MQ +  QV+R
Sbjct  428   ECVPVLISDSFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQR  487

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             HF  N   KR+DVFHM +HS+WLRRLNI + D +  S
Sbjct  488   HFVANQSLKRFDVFHMTVHSVWLRRLNIHIRDFERPS  524



>ref|XP_006469477.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=524

 Score =   483 bits (1242),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 229/397 (58%), Positives = 293/397 (74%), Gaps = 4/397 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             DA+KK   LERVEA L R R++IR+A   +    + +DPDYVP GPIYRN +AFHRSYL 
Sbjct  128   DAVKKYNKLERVEASLVRARSSIREAALVRNLTSVHQDPDYVPRGPIYRNANAFHRSYLL  187

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSS  633
             MEK FKI++YEEGEPP+FH    + I   EG  IH++E S  ++TK+PEKA V+FLPFS 
Sbjct  188   MEKLFKIYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMERSNMYKTKDPEKALVYFLPFSV  247

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V  ++V  AHE   I ++  DYI+ IS KYP+WNRSLG DHFML+CHDW P  S   
Sbjct  248   VMMVAHLYVPGAHEINAIGRSIVDYISIISHKYPFWNRSLGADHFMLSCHDWGPRSSSFV  307

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P LF+NSIRV+CNANTSEGF P  D SLPEI L  G + GLIGGP PS RS+L F+AG +
Sbjct  308   PHLFRNSIRVLCNANTSEGFNPVKDASLPEINLLTGEVTGLIGGPSPSRRSILAFFAGRL  367

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG+IR ++++ W+NKD +V++++ LP NVSY  M+RKSK+C+CPSGYEVASPR+VEA+Y 
Sbjct  368   HGHIRHLLLDNWKNKDQDVQVYDKLPNNVSYNSMLRKSKFCLCPSGYEVASPRVVEAIYS  427

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI D +  PF+DVL+W+ F+V I VK+IP +K+IL  I Q +YL MQ +  QV+R
Sbjct  428   ECVPVLISDSFVPPFSDVLNWNAFSVQIDVKDIPKIKEILKGISQRQYLRMQRRVKQVQR  487

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQETS  1464
             HF  N   KR+DVFHM +HS+WLRRLNI + D +  S
Sbjct  488   HFVANQSLKRFDVFHMTVHSVWLRRLNIHIRDFERPS  524



>ref|XP_010252860.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
Length=517

 Score =   481 bits (1239),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/395 (57%), Positives = 293/395 (74%), Gaps = 8/395 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA------QTENRILEDPDYVPHGPIYRNPHAFHRSY  450
              +K+ + L R+EAGLAR RA+IR A      QT     +DPDYVP GPIYRN   FHRSY
Sbjct  123   GVKRYSKLMRLEAGLARARASIRMASAQSRNQTSTHDDDDPDYVPRGPIYRNAFVFHRSY  182

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLP  624
             LEMEK FKIF+YEEG+PP+FH    + I   EG  I+++E +   +RT++P++AHV+FLP
Sbjct  183   LEMEKIFKIFVYEEGDPPLFHNGPCRSIYSTEGRFINEMEKAGNHYRTRDPDEAHVYFLP  242

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   +V F++V D+HE   I +T  DYIN +S KYPYWNRSLG DHFML+CHDW P  S
Sbjct  243   FSVVMMVQFLYVPDSHEIDSIGRTVVDYINILSAKYPYWNRSLGADHFMLSCHDWGPRTS  302

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                 +LF NSIRV+CNANTSEGF P  D S PEI+L  G + GL+GG  PS R +L F+A
Sbjct  303   AYVRELFDNSIRVLCNANTSEGFNPLKDASFPEIHLRTGEITGLLGGLSPSRRPLLAFFA  362

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             G +HG IR ++++ W+++D +V++++ LP  +SY  M++KSKYC+CPSGYEVASPR+VEA
Sbjct  363   GRLHGNIRLLLLQEWKDRDKDVQVYDELPDGMSYNEMLKKSKYCLCPSGYEVASPRIVEA  422

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y  CVPVLI DHY  PF+DVL+W++F+V I V +IPN+K IL SI Q +Y+ MQ +  Q
Sbjct  423   IYAECVPVLISDHYVPPFSDVLNWNSFSVQIAVSDIPNIKTILSSISQTQYIRMQRRVKQ  482

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             V+RHF VN PP+R+DVFHM+LHSIWLRRLNI + D
Sbjct  483   VQRHFVVNGPPQRFDVFHMILHSIWLRRLNIHIRD  517



>emb|CBI30213.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   474 bits (1220),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 216/331 (65%), Positives = 269/331 (81%), Gaps = 1/331 (0%)
 Frame = +1

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK+ K+++Y+EGEPP+FH    + I  +EG  IH++E+ S FRTK+PEKAH+FFLPFS 
Sbjct  1     MEKQLKVYVYDEGEPPLFHNGPCKSIYSMEGNFIHKMEMDSHFRTKDPEKAHLFFLPFSV  60

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               LV FV+VRD+H+  PI++T  DY+N +STKYPYWNRSLG DHFMLACHDW P  S   
Sbjct  61    AMLVRFVYVRDSHDLGPIKQTVIDYVNVVSTKYPYWNRSLGADHFMLACHDWGPETSFSI  120

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P L KNSIRV+CNANTSEGF P+ DVS PEI L  G+ D  IGGP PS+R++L F+AGG+
Sbjct  121   PYLHKNSIRVLCNANTSEGFNPSKDVSFPEINLLTGSTDSFIGGPSPSHRTLLAFFAGGL  180

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR +++E WENKD +V++H+YLPK VSYY M+RKSKYC+CPSGYEVASPR+VEA+Y 
Sbjct  181   HGPIRPILLEHWENKDEDVKVHKYLPKGVSYYEMMRKSKYCLCPSGYEVASPRVVEALYT  240

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
             GCVPVLI DHY  PF+DVL+W +F+V++PV+EIPNLK+IL+ I   +Y+ MQ +GIQ RR
Sbjct  241   GCVPVLISDHYVPPFSDVLNWKSFSVEVPVREIPNLKRILMDISPRQYIRMQRRGIQARR  300

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             HFEVN PPKRYDVFHM+LHS+WLRRLN  VH
Sbjct  301   HFEVNSPPKRYDVFHMILHSLWLRRLNFRVH  331



>ref|XP_009622709.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
tomentosiformis]
Length=524

 Score =   478 bits (1230),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 293/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LERVEA LA+ R++IR+A     ++   +DPDYVP GP+Y N ++FHRSYLEME
Sbjct  135   VKMYSRLERVEAILAKARSSIREAARNGSMISSHQDPDYVPQGPMYHNANSFHRSYLEME  194

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYS  639
             K FK ++YEEGEPP+FH    + I   EG  IH++E   F RTK+P++A V+FLPFS   
Sbjct  195   KNFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTKDPDEAMVYFLPFSVVV  254

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+++V  AH+   I  T  DY+  IS+++ +WNRSLG DHFML+CHDW P  +   P 
Sbjct  255   MVHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPRSTSYVPH  314

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  DVSLPEI+L  G++ GLIGGP PS RS+L F+AGG+HG
Sbjct  315   LFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLIGGPSPSTRSILAFFAGGLHG  374

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  +++ W+ KD +V ++E LP++ SY  M++KSK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  375   NIRHHLLKQWKGKDEDVLVYEKLPRSKSYESMLKKSKFCLCPSGYEVASPRVVEAIYAEC  434

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W +F+V + VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  435   IPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHF  494

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N PPKR+D+FHM +HSIWLRRLNI VH+
Sbjct  495   VINGPPKRFDLFHMTVHSIWLRRLNIRVHE  524



>ref|XP_002524591.1| catalytic, putative [Ricinus communis]
 gb|EEF37799.1| catalytic, putative [Ricinus communis]
Length=507

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 219/392 (56%), Positives = 297/392 (76%), Gaps = 4/392 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA-QTEN--RILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+ + LE++EA LARVR++IR+A Q  N   + +DPDYVP GP+YRN +AFHRSYLEME
Sbjct  115   VKRYSRLEKLEASLARVRSSIREAAQVRNLSSVHDDPDYVPQGPVYRNANAFHRSYLEME  174

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K+FKI++YEEG PP++H    + I   EG  IH+LE  K +RT +P++A V+FLPFS   
Sbjct  175   KQFKIYVYEEGGPPMYHDGPCKSIYSSEGRFIHELEKGKLYRTLDPDEALVYFLPFSVVM  234

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +V +++V D+HE   I +   DYI+ IS K+P+WNRSLG DHFML+CHDW P  S   P 
Sbjct  235   MVEYLYVPDSHETNAIGRAIVDYIHVISNKHPFWNRSLGADHFMLSCHDWGPRASSYVPH  294

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF +SIRV+CNANTSEGF P+ D S PEI+L  G + GL+GG  PS RS+L F+AG +HG
Sbjct  295   LFNSSIRVLCNANTSEGFNPSKDASFPEIHLKTGEISGLLGGVSPSRRSILAFFAGRLHG  354

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IRQ+++E W+NKD +V++++ +P  VSY  M++ S++C+CPSGYEVASPR+VEA+Y  C
Sbjct  355   HIRQILLEQWKNKDEDVQVYDQMPNGVSYESMLKTSRFCLCPSGYEVASPRIVEAIYTEC  414

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI D+Y  PF+DVL+W  F+V I V++IP +K+IL+ I Q +YL MQ +  QV+RHF
Sbjct  415   VPVLISDNYVPPFSDVLNWKAFSVQIQVRDIPKIKEILMGISQRQYLRMQRRLKQVQRHF  474

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
              VN PPKR+D+FHM +HSIWLRRLNI + D+ 
Sbjct  475   VVNGPPKRFDMFHMTIHSIWLRRLNIHIQDLS  506



>ref|XP_009782027.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X4 
[Nicotiana sylvestris]
Length=523

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 292/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LERVEA LA+ R++IR+A     ++   +DPDYVP GP+Y N ++FHRSYLEME
Sbjct  134   LKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEME  193

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYS  639
             K FK ++YEEGEPP+FH    + I   EG  IH++E   F RT++P++A V+FLPFS   
Sbjct  194   KSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVV  253

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+++V  AH+   I  T  DY+  IS+++ +WNRSLG DHFML+CHDW P  +   P 
Sbjct  254   MVHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPH  313

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  DVSLPEI+L  G++ GL+GGP PS RS+L F+AGG+HG
Sbjct  314   LFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHG  373

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  ++E W+ KD EV ++E LP+  SY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  374   NIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAEC  433

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W +F+V + VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  434   IPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHF  493

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N PPKR+D+FHM++HSIWLRRLNI VH+
Sbjct  494   MINGPPKRFDLFHMIVHSIWLRRLNIRVHE  523



>gb|KEH35655.1| exostosin family protein [Medicago truncatula]
Length=495

 Score =   476 bits (1225),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 292/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K + LE++E+ LA+ R +I++A   Q      +D DYVP GPIYRNP+AFHRSYLEMEK 
Sbjct  106   KYSKLEKIESKLAKARYSIKEASKVQNLTSTHQDQDYVPQGPIYRNPNAFHRSYLEMEKV  165

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYSLV  645
             FKIF+YEEGEPP+FH   S+ I   EGI I+++E  ++ RT +P +A V+FLPFS   +V
Sbjct  166   FKIFVYEEGEPPLFHNGLSKDIYSTEGIFINEMEKGRYYRTNDPNEAFVYFLPFSVVMMV  225

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              +++V  +++  PI  T +DYI+ IS KYP+WN+SLG+DHFML+CHDW P  S     LF
Sbjct  226   EYLYVGGSNDKTPIGVTVKDYIHVISHKYPFWNQSLGHDHFMLSCHDWGPDASAYEDNLF  285

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
              NSIRV+CNANTSEGFKPA D S PE++L +G +  L+GG  PS R++L F+AG +HGYI
Sbjct  286   NNSIRVLCNANTSEGFKPAKDASFPEMFLKKGEITNLVGGYSPSRRTILAFFAGHLHGYI  345

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R ++++TW+NKD +V+++E LP   SY+  +R SK+C+CPSGYEVASPR+VEA++  CVP
Sbjct  346   RYLLLDTWKNKDQDVQVYEELPDEDSYHTKLRSSKFCLCPSGYEVASPRIVEAIFAECVP  405

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI D Y  PF+DVL+W  F+V I VK+IPN+K IL+ I Q +YL MQ +  QV+RHF  
Sbjct  406   VLISDSYVPPFSDVLNWKAFSVQIDVKDIPNIKNILMGISQRQYLKMQRRVKQVQRHFVP  465

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             N PPKR+DVFHM +HSIWLRRLN+ +HD Q
Sbjct  466   NEPPKRFDVFHMTIHSIWLRRLNVRIHDDQ  495



>ref|XP_002320538.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
 gb|EEE98853.2| hypothetical protein POPTR_0014s16920g [Populus trichocarpa]
Length=452

 Score =   474 bits (1220),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 290/390 (74%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+ + LE++EA LA++R++IR+A   +    I EDPDYVP GPIYRN +AFHRSYLEME
Sbjct  63    VKRHSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEME  122

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K FKI+IY+EG+PP+FH    + I   EG  IH+LE  K F T +P++A V+FLPFS   
Sbjct  123   KLFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDEALVYFLPFSVVM  182

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             LV +++V  +HE   I  T  DYIN I+ KYP+WNRSLG DHF+L+CHDW P  S   P 
Sbjct  183   LVQYLYVPGSHEIDAIGNTVVDYINVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPH  242

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  D S PEI+L  G + GL+GGP PS RS+L F+AG +HG
Sbjct  243   LFNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHG  302

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IR++++E W++KD +V++H+ L   +SY  M++ S++C+CPSGYEVASPR+VEA+Y  C
Sbjct  303   HIRRLLLEQWKDKDQDVQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAEC  362

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI D Y  PF+DVL+W  F++ + VK+IP +K IL+ I Q +YL MQ +  QV+RHF
Sbjct  363   VPVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKIKDILMGISQRQYLRMQRRVKQVQRHF  422

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              VN  PKR+DVFHM +HSIWLRRLNI +HD
Sbjct  423   VVNGIPKRFDVFHMTIHSIWLRRLNIRIHD  452



>ref|XP_009782026.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X3 
[Nicotiana sylvestris]
Length=524

 Score =   476 bits (1225),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 292/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LERVEA LA+ R++IR+A     ++   +DPDYVP GP+Y N ++FHRSYLEME
Sbjct  135   LKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEME  194

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYS  639
             K FK ++YEEGEPP+FH    + I   EG  IH++E   F RT++P++A V+FLPFS   
Sbjct  195   KSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVV  254

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+++V  AH+   I  T  DY+  IS+++ +WNRSLG DHFML+CHDW P  +   P 
Sbjct  255   MVHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPH  314

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  DVSLPEI+L  G++ GL+GGP PS RS+L F+AGG+HG
Sbjct  315   LFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHG  374

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  ++E W+ KD EV ++E LP+  SY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  375   NIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAEC  434

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W +F+V + VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  435   IPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHF  494

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N PPKR+D+FHM++HSIWLRRLNI VH+
Sbjct  495   MINGPPKRFDLFHMIVHSIWLRRLNIRVHE  524



>ref|XP_009782025.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=549

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 292/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LERVEA LA+ R++IR+A     ++   +DPDYVP GP+Y N ++FHRSYLEME
Sbjct  160   LKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEME  219

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYS  639
             K FK ++YEEGEPP+FH    + I   EG  IH++E   F RT++P++A V+FLPFS   
Sbjct  220   KSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVV  279

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+++V  AH+   I  T  DY+  IS+++ +WNRSLG DHFML+CHDW P  +   P 
Sbjct  280   MVHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPH  339

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  DVSLPEI+L  G++ GL+GGP PS RS+L F+AGG+HG
Sbjct  340   LFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHG  399

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  ++E W+ KD EV ++E LP+  SY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  400   NIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAEC  459

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W +F+V + VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  460   IPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHF  519

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N PPKR+D+FHM++HSIWLRRLNI VH+
Sbjct  520   MINGPPKRFDLFHMIVHSIWLRRLNIRVHE  549



>ref|XP_009782024.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana sylvestris]
Length=553

 Score =   477 bits (1227),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 292/390 (75%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LERVEA LA+ R++IR+A     ++   +DPDYVP GP+Y N ++FHRSYLEME
Sbjct  164   LKMYSRLERVEAILAKSRSSIREAARNGSMISNHQDPDYVPQGPMYHNANSFHRSYLEME  223

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYS  639
             K FK ++YEEGEPP+FH    + I   EG  IH++E   F RT++P++A V+FLPFS   
Sbjct  224   KSFKAYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMEKGNFYRTEDPDEAMVYFLPFSVVV  283

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +VH+++V  AH+   I  T  DY+  IS+++ +WNRSLG DHFML+CHDW P  +   P 
Sbjct  284   MVHYLYVPGAHDMHTIGTTVADYVKVISSRHTFWNRSLGADHFMLSCHDWGPHSTSYVPH  343

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  DVSLPEI+L  G++ GL+GGP PS RS+L F+AGG+HG
Sbjct  344   LFNNSIRVLCNANTSEGFNPIKDVSLPEIHLKTGDIKGLVGGPSPSTRSILAFFAGGLHG  403

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  ++E W+ KD EV ++E LP+  SY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  404   NIRHHLLEQWKGKDEEVLVYEKLPRGKSYESMLKNSKFCLCPSGYEVASPRIVEAIYAEC  463

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W +F+V + VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  464   IPVLISDSYVPPFSDVLNWKSFSVTVAVKDIPNIKKILMSISQSQYLRMHRRVKQVQRHF  523

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N PPKR+D+FHM++HSIWLRRLNI VH+
Sbjct  524   MINGPPKRFDLFHMIVHSIWLRRLNIRVHE  553



>ref|XP_007027565.1| Exostosin family protein, putative [Theobroma cacao]
 gb|EOY08067.1| Exostosin family protein, putative [Theobroma cacao]
Length=546

 Score =   476 bits (1224),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 293/386 (76%), Gaps = 9/386 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+R+E GL + RAAI++A   ++ L+DPDY+P GPIYRN   FHRSYLEMEK+FKI++
Sbjct  159   TKLDRLEDGLRKARAAIKKAMNGSQ-LQDPDYIPDGPIYRNAKFFHRSYLEMEKKFKIYV  217

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y+EGE P+FH    + +  +EG  I+++E++K FRT NPEKAHVF+LP+S   +V + +V
Sbjct  218   YKEGELPLFHDGPCRLLYTMEGQFINKMEVNKKFRTYNPEKAHVFYLPYSVTRMVQYNWV  277

Query  661   RDAHEWPPIQKTAR---DYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             R      P+++      DY+N I+ KYP+WNRSLG DHFML+CHDW P  S   P L KN
Sbjct  278   RGT----PMKRLGGIVLDYVNVIAGKYPFWNRSLGADHFMLSCHDWGPATSFYVPDLVKN  333

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR +CNANTSE F P  DVS+PEI L    ++GLIGGP PS R++L F+AGG HG++R 
Sbjct  334   SIRALCNANTSERFNPMKDVSIPEISLKSSRLEGLIGGPSPSQRTILAFFAGGNHGFVRP  393

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++   WE KDP + +H YLP+ V YY ++R+SKYC+CPSGYEVASPR+VEA+Y GCVPVL
Sbjct  394   ILFRHWEKKDPAIRVHNYLPRRVPYYDLMRQSKYCLCPSGYEVASPRVVEALYNGCVPVL  453

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I   Y  PF+DVL+W  F+V + +++IPNLKKIL+SIP+ +Y+ MQ++ +QVRRHFE++ 
Sbjct  454   ISKSYVPPFSDVLNWKMFSVMVSLEDIPNLKKILMSIPERQYIKMQKRVVQVRRHFELHV  513

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              PKR+DVFHM+LHSIWLRRLN++V +
Sbjct  514   TPKRFDVFHMILHSIWLRRLNVKVSN  539



>ref|XP_006845223.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
 gb|ERN06898.1| hypothetical protein AMTR_s00005p00255230 [Amborella trichopoda]
Length=384

 Score =   469 bits (1207),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 218/382 (57%), Positives = 293/382 (77%), Gaps = 5/382 (1%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQTENRI---LEDPD-YVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             ++EAGL++ RAAIR+A   +R    +EDPD Y P G IYRN +AFHRSYLEMEKRFKIF+
Sbjct  2     KLEAGLSKARAAIREATLSHRNRTPIEDPDDYAPKGGIYRNSYAFHRSYLEMEKRFKIFV  61

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             YEEGEPP+ H    + I   EGI IH++ + ++FRT++ E+AHV FLPFS  +++ FV+ 
Sbjct  62    YEEGEPPLVHNGPCKSIYSSEGIFIHEMVLGNRFRTRSQERAHVHFLPFSVVAMIQFVYT  121

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
               + +  P++    DYI+ IS KY YWN+SLG DHFML+CHDW P  S   P L KNSIR
Sbjct  122   PSSFDLYPVKNLVADYIDVISKKYHYWNQSLGADHFMLSCHDWGPHTSAANPLLNKNSIR  181

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNAN+SE F P  DV LPEI +P G+++G++GG  PS R++L F+AGG+HG+IR +++
Sbjct  182   VLCNANSSEDFYPQRDVPLPEINIPSGSIEGMLGGLRPSARTILAFFAGGVHGWIRSILL  241

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + W+NKDP+++  EYLP ++SY+ M+RKSK+C+CPSGYEVASPR+VEA+Y  CVPV+I D
Sbjct  242   QHWKNKDPDIQAFEYLPHDLSYWDMLRKSKFCLCPSGYEVASPRLVEAIYAECVPVIISD  301

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             HY  PF+DVL+W +F+V++ V EI  LK+IL  I  EKY+ MQ +  QV+RHF VN PPK
Sbjct  302   HYVLPFSDVLNWASFSVEVKVGEIERLKEILEGISMEKYVRMQRRVKQVQRHFVVNEPPK  361

Query  1381  RYDVFHMVLHSIWLRRLNIEVH  1446
             RYDVFHMV+HS+WLRRLN+++H
Sbjct  362   RYDVFHMVIHSVWLRRLNLKLH  383



>emb|CBI28483.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   470 bits (1210),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 291/389 (75%), Gaps = 4/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K+ + LER+EAGLAR R++IR+A     +    EDPDYVP GPIYRN +AFHRSYLEMEK
Sbjct  28    KRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPIYRNANAFHRSYLEMEK  87

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FKI++YEEGEPP+FH    + I   EG  IH++E  S +RT +P++A ++FLPFS   +
Sbjct  88    LFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTDPDQALLYFLPFSVVMM  147

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +++V D+HE   I+KT  DYIN IS  +P+WNRSLG DHFML+CHDW P  S   P L
Sbjct  148   VQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFMLSCHDWGPRASTSVPYL  207

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NSIRV+CNANTSEGF P+ DVS PEI+L  G M G +GG  PS R +L F+AG +HG+
Sbjct  208   YNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSPSRRPILGFFAGRLHGH  267

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++E W++KD ++++++ LP  +SY  M++KS++C+CPSGYEVASPR+VEA+Y  CV
Sbjct  268   IRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGYEVASPRVVEAIYAECV  327

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI D+Y  PF DVL+W +FAV + V++I N+K+IL+ I Q +YL M  +  QV+RHF 
Sbjct  328   PVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQYLRMYRRVKQVQRHFM  387

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             VN  P+R+DVFHM +HSIWLRRLNI + D
Sbjct  388   VNAAPQRFDVFHMTIHSIWLRRLNIRIQD  416



>gb|KHN45704.1| Putative glycosyltransferase [Glycine soja]
Length=348

 Score =   467 bits (1201),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/344 (62%), Positives = 272/344 (79%), Gaps = 1/344 (0%)
 Frame = +1

Query  415   IYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTK  591
             +Y N   FHRSYLEMEK+FK+F+YEEGE PVFH    + I  +EG  IH +E++  FRTK
Sbjct  1     MYWNAKTFHRSYLEMEKQFKVFVYEEGETPVFHNGPCKSIYSMEGNFIHAIEMNDHFRTK  60

Query  592   NPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFM  771
             +P+KAHVFFLPFS   +V FV+ RD+ ++ PI+KT  DYIN I+ +Y YWNRSLG DHFM
Sbjct  61    DPKKAHVFFLPFSVVMMVRFVYQRDSRDFGPIRKTVIDYINLIAARYSYWNRSLGADHFM  120

Query  772   LACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPP  951
             LACHDW P  S   P L KNSIRV+CNANTSEGFKPA DVS PEI L  G+++G IGGP 
Sbjct  121   LACHDWGPEASLSLPYLHKNSIRVLCNANTSEGFKPAKDVSFPEINLQTGSINGFIGGPS  180

Query  952   PSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSG  1131
              S RS+L F+AGG+HG IR +++E WENKD ++++H+YLPK VSYY  +R SK+C+CPSG
Sbjct  181   ASKRSILAFFAGGVHGPIRPILLEHWENKDEDIQVHKYLPKGVSYYDKLRNSKFCLCPSG  240

Query  1132  YEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQE  1311
             YEVASPR+VEA+Y GCVPVLI +HY  PF+DVL+W +F+V++ VK+IPNLK IL+SI   
Sbjct  241   YEVASPRVVEAIYTGCVPVLISEHYVPPFSDVLNWKSFSVELSVKDIPNLKDILMSISPR  300

Query  1312  KYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +Y+ MQ + IQ++RHFEV+ PPKR+DVFHM+LHS+WLRRLN  +
Sbjct  301   QYIRMQRRVIQIQRHFEVHSPPKRFDVFHMILHSVWLRRLNFRM  344



>ref|XP_007049438.1| Catalytic, putative [Theobroma cacao]
 gb|EOX93595.1| Catalytic, putative [Theobroma cacao]
Length=545

 Score =   473 bits (1218),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 296/401 (74%), Gaps = 5/401 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHR  444
             +S    +K+ + LER+EA LAR R++I++A   +    I ++ DYVPHGPIYRN +AFHR
Sbjct  145   TSTTRVVKRYSKLERLEANLARARSSIKEAALVRNLTSIHQNHDYVPHGPIYRNSNAFHR  204

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFL  621
             SYLEMEK FKI++Y+EGEPP+FH    + I   EG  IH+LE  KF RT++P++A V+FL
Sbjct  205   SYLEMEKLFKIYVYQEGEPPIFHNGPCRSIYSSEGRFIHELEKGKFYRTQDPDEALVYFL  264

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   LVH+++  +  +   I +   DYI+ I++K+PYWNRSLG DH ML+CHDW P  
Sbjct  265   PFSVVMLVHYLYDPETFDTDAIGRAVVDYIDVIASKHPYWNRSLGADHVMLSCHDWGPRA  324

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S   P L+  SIRV+CNANTSEGF PA D S PEI L  G+++GL+GGP PS RS+L F+
Sbjct  325   SSYVPHLYHKSIRVLCNANTSEGFNPAKDASFPEINLLTGDVEGLLGGPSPSRRSILAFF  384

Query  982   AGGIHGYIRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             AG +HGYIR +++  W++K DP+V++ + LPK VSY   ++ S++C+CPSGYEVASPR+V
Sbjct  385   AGRLHGYIRYLLLNEWKDKRDPDVQVFDQLPKGVSYMSKLKNSRFCLCPSGYEVASPRIV  444

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y  CVPVLI D Y  PF+DVL+W++F+V +  K+IPN+KKIL+SI Q +YL MQ + 
Sbjct  445   EAIYAECVPVLISDSYVPPFSDVLNWNSFSVQVAAKDIPNIKKILMSISQRRYLRMQRRV  504

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
              QV+RHF VN  PKRYDVFHM+ HSIWLRRLNI V D   +
Sbjct  505   KQVQRHFVVNATPKRYDVFHMITHSIWLRRLNIHVQDFDHS  545



>ref|XP_007137813.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
 gb|ESW09807.1| hypothetical protein PHAVU_009G157700g [Phaseolus vulgaris]
Length=501

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 217/388 (56%), Positives = 292/388 (75%), Gaps = 5/388 (1%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K + L R+E  LA+ R +IR+A   +     L+DPDYVP GPIYRN +AFHRSYLEMEK 
Sbjct  112   KHSKLRRIEKNLAKARYSIREASKIRNLTSTLQDPDYVPQGPIYRNANAFHRSYLEMEKV  171

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLV  645
             FK+F+YEEGEPP+FH   S+ I   EG  I+++E  + +RT +P++A VF+LPFS   LV
Sbjct  172   FKVFVYEEGEPPLFHNGLSKDIYATEGRFINEMEKGRHYRTYDPDEAFVFYLPFSVVMLV  231

Query  646   HFVFVRDA-HEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
              +V+ R + +   P+    +DYI  IS K+P+WNRSLG+DHFML+CHDW P +S     L
Sbjct  232   EYVYDRGSNYNLDPLGLVVKDYIQTISYKHPFWNRSLGHDHFMLSCHDWGPIVSSYVDLL  291

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + N+IRV+CNANTSEGFKPA DVS PEI L +G + GL+GG PPS R++L F+AG +HGY
Sbjct  292   YNNAIRVLCNANTSEGFKPAKDVSFPEIKLMRGEVTGLVGGYPPSQRTILAFFAGHLHGY  351

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++ TW+NKD +V+++E +P+ +SYY  +R SK+C+CPSGYEVASPR+VEA++  CV
Sbjct  352   IRYLLLHTWKNKDQDVQVYEEIPEGISYYTKLRSSKFCLCPSGYEVASPRIVEAIFAECV  411

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI D Y  PF+DVL+W++F+V + VKEIPN+KKIL+ I + +YL MQ +  QV+RHF 
Sbjct  412   PVLISDSYVPPFSDVLNWNSFSVQVAVKEIPNIKKILMGISERQYLRMQRRVKQVQRHFM  471

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
              N PP+RYD+FHM +HSIWLRRLNI + 
Sbjct  472   PNEPPERYDMFHMTVHSIWLRRLNIHIQ  499



>ref|XP_011009812.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Populus euphratica]
Length=510

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 288/390 (74%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+ + LE++EA LA++R++IR+A   +    I EDPDYVP GPIYRN +AFHRSYLEME
Sbjct  121   VKRHSKLEKMEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEME  180

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K FKI+IY+EG+PP+FH    + I   EG  IH+LE  K F T +P+KA V+FLPFS   
Sbjct  181   KLFKIYIYKEGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVM  240

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             LV +++V  +HE   I  T  DYI  I+ KYP+WNRSLG DHF+L+CHDW P  S   P 
Sbjct  241   LVQYLYVPGSHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPH  300

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P  D S PEI+L  G + GL+GGP PS RS+L F+AG +HG
Sbjct  301   LFNNSIRVLCNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHG  360

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IR++++E W++KD ++++H+ L   +SY  M++ S++C+CPSGYEVASPR+VEA+Y  C
Sbjct  361   HIRRLLLEQWKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAEC  420

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI D Y  PF+DVL+W  F++ + VK+IP LK IL+ I Q +YL MQ +  QV+RHF
Sbjct  421   VPVLISDGYVPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHF  480

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              VN  PKR+D FHM +HSIWLRRLNI +HD
Sbjct  481   VVNGLPKRFDEFHMTIHSIWLRRLNIRIHD  510



>ref|XP_004292405.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=526

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/399 (55%), Positives = 293/399 (73%), Gaps = 4/399 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHR  444
             +S    +K+ + LE++EA LA VRA+IR+A     +    EDPDYVP GPIYRN +AFHR
Sbjct  128   ASETITIKRYSRLEKLEASLAGVRASIREAARVRNLTSTHEDPDYVPQGPIYRNANAFHR  187

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFL  621
             SYLEME+ FKI++Y+EG+PP+FH    + I   EG+ IH++E+ + +RTKNP+ A V+FL
Sbjct  188   SYLEMERLFKIYVYQEGDPPIFHNGPCKSIYSTEGMFIHEMEMDNTYRTKNPDDALVYFL  247

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   LV +++  ++H    I +   DY+N IS K+P+WNRSLG DHFML+CHDW P  
Sbjct  248   PFSVVMLVQYLYEAESHSTESIGRAVVDYVNVISDKHPFWNRSLGADHFMLSCHDWGPRT  307

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S   P+L+  SIRV+CNANTSEGF P+ DVS PEI+L  G   GL+GG  PS RSVL F+
Sbjct  308   SSYVPQLYHKSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETKGLLGGLSPSRRSVLAFF  367

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AG +HG+IR +++  W+ KD +V++++ LP  VSY  M+++SK+C+CPSGYEVASPR+VE
Sbjct  368   AGRLHGHIRCLLLNEWKEKDQDVQVYDQLPNGVSYESMLKQSKFCLCPSGYEVASPRIVE  427

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+Y  CVPVLI D+Y  PF+DVL+W TF+V + VK+IPN+K IL+ I Q +YL M  +  
Sbjct  428   AIYAECVPVLISDNYVPPFSDVLEWKTFSVQVQVKDIPNIKTILMGISQSQYLRMHRRVK  487

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
              V+RHF VN P KRYDVF+M++HSIWLRRLNI + D  E
Sbjct  488   LVQRHFVVNGPSKRYDVFNMIVHSIWLRRLNIRIEDQLE  526



>ref|XP_002264076.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=484

 Score =   469 bits (1208),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 296/405 (73%), Gaps = 7/405 (2%)
 Frame = +1

Query  256   PFYQLPSSHPDAM---KKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPI  417
             P++Q P          K+ + LER+EAGLAR R++IR+A     +    EDPDYVP GPI
Sbjct  80    PYFQPPLEKKQETWKDKRYSKLERLEAGLARARSSIREAARNGSLKSTHEDPDYVPQGPI  139

Query  418   YRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKN  594
             YRN +AFHRSYLEMEK FKI++YEEGEPP+FH    + I   EG  IH++E  S +RT +
Sbjct  140   YRNANAFHRSYLEMEKLFKIYVYEEGEPPMFHNGPCKSIYSTEGRFIHEMEKGSVYRTTD  199

Query  595   PEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFML  774
             P++A ++FLPFS   +V +++V D+HE   I+KT  DYIN IS  +P+WNRSLG DHFML
Sbjct  200   PDQALLYFLPFSVVMMVQYLYVPDSHEIHAIEKTVIDYINLISHNHPFWNRSLGADHFML  259

Query  775   ACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPP  954
             +CHDW P  S   P L+ NSIRV+CNANTSEGF P+ DVS PEI+L  G M G +GG  P
Sbjct  260   SCHDWGPRASTSVPYLYNNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGEMSGPLGGLSP  319

Query  955   SNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGY  1134
             S R +L F+AG +HG+IR +++E W++KD ++++++ LP  +SY  M++KS++C+CPSGY
Sbjct  320   SRRPILGFFAGRLHGHIRYLLLEQWKDKDKDLQVYDQLPNGLSYDSMLKKSRFCLCPSGY  379

Query  1135  EVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEK  1314
             EVASPR+VEA+Y  CVPVLI D+Y  PF DVL+W +FAV + V++I N+K+IL+ I Q +
Sbjct  380   EVASPRVVEAIYAECVPVLISDNYVPPFNDVLNWKSFAVQVQVRDIANIKRILMGISQTQ  439

Query  1315  YLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             YL M  +  QV+RHF VN  P+R+DVFHM +HSIWLRRLNI + D
Sbjct  440   YLRMYRRVKQVQRHFMVNAAPQRFDVFHMTIHSIWLRRLNIRIQD  484



>ref|XP_008237734.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=415

 Score =   465 bits (1196),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/397 (54%), Positives = 290/397 (73%), Gaps = 5/397 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHR  444
             +S    +K+ + LE++EA LA VRA+IR+A     +    EDPDYVP GPIYRN +AFHR
Sbjct  16    TSASTTIKRYSRLEKLEANLAGVRASIREAARVRNLTSTHEDPDYVPKGPIYRNANAFHR  75

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFF  618
             SYLEME+ FKI++YEEG+PP+FH    + I   EG  IH++E+    +RT++P++A V+F
Sbjct  76    SYLEMERLFKIYVYEEGDPPIFHNGPCKSIYSTEGRFIHEMEMDNNIYRTRDPDEALVYF  135

Query  619   LPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
             LPFS   LV +++  D+H    I +   DY+N IS K+P+WNRSLG DHFML+CHDW P 
Sbjct  136   LPFSVVMLVQYLYAADSHNTDSIGRAVIDYVNVISDKHPFWNRSLGADHFMLSCHDWGPR  195

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
              S   P L+  SIRV+CNANTSEGF P+ D S PEI+L  G + GL+GG  PS RS+L F
Sbjct  196   TSSYVPHLYHKSIRVLCNANTSEGFNPSKDASFPEIHLRTGEIKGLLGGLSPSRRSILAF  255

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG+IR +++  W+ KD +V++++ LP  VSY  M++KS++C+CPSGYEVA+PR+V
Sbjct  256   FAGRLHGHIRYLLLNEWKEKDQDVQVYDQLPHGVSYESMLKKSRFCLCPSGYEVANPRVV  315

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y  C+PVLI D Y  PF+DVLDW +F+V I VK+IPN+K IL+ I Q +YL M  + 
Sbjct  316   EAIYAECIPVLISDSYVPPFSDVLDWKSFSVQIQVKDIPNIKTILMGISQSQYLRMHRRV  375

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              QV+RHF VN P KR+DVF+M++HSIWLRRLNI + +
Sbjct  376   KQVQRHFVVNGPSKRFDVFNMIVHSIWLRRLNIHIEN  412



>ref|XP_011009813.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Populus euphratica]
Length=381

 Score =   462 bits (1188),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 216/381 (57%), Positives = 281/381 (74%), Gaps = 4/381 (1%)
 Frame = +1

Query  319   VEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYE  489
             +EA LA++R++IR+A   +    I EDPDYVP GPIYRN +AFHRSYLEMEK FKI+IY+
Sbjct  1     MEANLAKIRSSIREAARVRNLTSIYEDPDYVPKGPIYRNANAFHRSYLEMEKLFKIYIYK  60

Query  490   EGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRD  666
             EG+PP+FH    + I   EG  IH+LE  K F T +P+KA V+FLPFS   LV +++V  
Sbjct  61    EGDPPMFHDGPCKSIYSSEGRFIHELEKGKSFTTTDPDKALVYFLPFSVVMLVQYLYVPG  120

Query  667   AHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVM  846
             +HE   I  T  DYI  I+ KYP+WNRSLG DHF+L+CHDW P  S   P LF NSIRV+
Sbjct  121   SHEIDAIGNTVVDYIKVIADKYPFWNRSLGADHFILSCHDWGPRTSSYVPHLFNNSIRVL  180

Query  847   CNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMET  1026
             CNANTSEGF P  D S PEI+L  G + GL+GGP PS RS+L F+AG +HG+IR++++E 
Sbjct  181   CNANTSEGFNPKKDASFPEIHLRTGEITGLVGGPSPSRRSILAFFAGRLHGHIRRLLLEQ  240

Query  1027  WENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHY  1206
             W++KD ++++H+ L   +SY  M++ S++C+CPSGYEVASPR+VEA+Y  CVPVLI D Y
Sbjct  241   WKDKDQDMQVHDQLRNGMSYDSMLKNSRFCLCPSGYEVASPRIVEAIYAECVPVLISDGY  300

Query  1207  AKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRY  1386
               PF+DVL+W  F++ + VK+IP LK IL+ I Q +YL MQ +  QV+RHF VN  PKR+
Sbjct  301   VPPFSDVLNWKAFSIQVQVKDIPKLKDILMGISQRQYLRMQRRVKQVQRHFVVNGLPKRF  360

Query  1387  DVFHMVLHSIWLRRLNIEVHD  1449
             D FHM +HSIWLRRLNI +HD
Sbjct  361   DEFHMTIHSIWLRRLNIRIHD  381



>ref|XP_004503012.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=488

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 217/393 (55%), Positives = 289/393 (74%), Gaps = 4/393 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEM  459
                K T LER+E+ L + R +I++A     +    +D DYVPHGPIYRN  AFHRSYLEM
Sbjct  96    GTNKYTQLERIESKLVKARYSIKEASKVRNLTSTHQDQDYVPHGPIYRNAKAFHRSYLEM  155

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSY  636
             EK FKIF+YEEGEPP+FH   S+ I   EG  I+++E  ++ RT +P++A V+FLPFS  
Sbjct  156   EKIFKIFVYEEGEPPMFHNGLSKNIYSTEGRFINEMEKWRYYRTNDPDEAFVYFLPFSVV  215

Query  637   SLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
              +V +++V  +++   I  + +DYI+ IS KYP+WN+SLG+DHFML+CHDW P  S    
Sbjct  216   MMVEYLYVHGSNDRSSIGLSVQDYIHIISHKYPFWNQSLGHDHFMLSCHDWGPIASAYVD  275

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
              LF NSIRV+CNAN SEGFKP+ DVS PE+ L  G + GL+GG PPS R+ L F+AG +H
Sbjct  276   NLFNNSIRVLCNANISEGFKPSKDVSFPEMNLKTGEVTGLVGGYPPSQRTTLAFFAGHLH  335

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G+IR +++ TW+NKD +V++++ LP   SY   +R SK+C+CPSGYEVASPR+VEA++  
Sbjct  336   GHIRYLLLNTWKNKDQDVQVYDELPHEDSYNTKLRSSKFCLCPSGYEVASPRIVEAIFAE  395

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI D+Y  PF+DVL+W +F+V I VKEIPN+KKIL+ I Q +YL MQ +  QV+RH
Sbjct  396   CVPVLISDNYVPPFSDVLNWKSFSVQIDVKEIPNIKKILMGISQRQYLKMQGRVKQVQRH  455

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             F  N PP+R+DVFHM +HSIWLRRLNI +HD Q
Sbjct  456   FVPNEPPERFDVFHMTIHSIWLRRLNIRIHDNQ  488



>ref|XP_008394205.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=519

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 285/387 (74%), Gaps = 5/387 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + L++VEA L R R++IR+A   + +    +DPDYVP GPIYRNP+AFHRSYLEMEK FK
Sbjct  132   SQLDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKVFK  191

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FH    + I   EG  IH++E  K +RTK+P KA V+FLPFS  ++V +
Sbjct  192   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKMYRTKDPHKALVYFLPFSVVNMVQY  251

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ +  +   +++   DYIN IS K+P+WNRSLG DHFML+CHDW PT +   P LF N
Sbjct  252   IYMPETFDRSGMKRAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLFHN  311

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P  D S PEI L    M G IGG PPS RS L F+AG +HG+IR 
Sbjct  312   SIRVLCNANTSEGFNPLKDASFPEINLKTSEMPG-IGGRPPSKRSTLAFFAGRLHGHIRY  370

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V++++ LP+ VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  371   LLLNEWKGKDQDVQVYDQLPRRVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVPVL  430

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVL+W +F+V IPVK I ++K IL +I   +YL MQ +  QV+RHF VN 
Sbjct  431   ISDGYVPPFSDVLNWKSFSVQIPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  490

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             PPKRYDVFHM++HSIWLRRLNI + D+
Sbjct  491   PPKRYDVFHMIVHSIWLRRLNIRIQDV  517



>dbj|BAB08605.1| unnamed protein product [Arabidopsis thaliana]
Length=408

 Score =   461 bits (1187),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 292/394 (74%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             S  P   + L+NLE++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  16    SLEPKKRRVLSNLEKIEFKLQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  74

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAHVF+LPFS
Sbjct  75    EMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFS  134

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +V+ R++ ++ PI+ T +DYIN +  KYPYWNRS+G DHF+L+CHDW P  S  
Sbjct  135   VVKMVRYVYERNSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFS  194

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG
Sbjct  195   HPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGG  254

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V+++ WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  255   VHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  314

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VR
Sbjct  315   SGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVR  374

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+++ ++
Sbjct  375   RHFEVNSPAKRFDVFHMILHSIWVRRLNVKIREV  408



>ref|XP_006354423.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=511

 Score =   464 bits (1193),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 216/390 (55%), Positives = 288/390 (74%), Gaps = 4/390 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRILE---DPDYVPHGPIYRNPHAFHRSYLEME  462
             +K  + LER+EA LA+ R++IR+A     ++    DPDYVP GP+Y N +AFHRSYLEME
Sbjct  122   LKMYSKLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNANAFHRSYLEME  181

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYS  639
             K FK+++YEEGEPP+FH    + I   EG  IH++E  S +RTKNP++A V+FLPFS   
Sbjct  182   KNFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEALVYFLPFSVVV  241

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +V ++FV  AH+   I +T  DY+  IS ++ +WNRS G DHFML+CHDW P ++   P 
Sbjct  242   MVQYLFVPGAHDMHVIGRTVADYVKVISERHSFWNRSRGADHFMLSCHDWGPHLTSYVPH  301

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF  SIRV+CNANTSEGF P  DVSLPEI L  G++ GLIGGP PS RS+L F+AGG+HG
Sbjct  302   LFNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSRRSILAFFAGGLHG  361

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR  ++E W+ KD +V +++ LP + SY  M++ S++C+CPSGYEVASPR+VEA+Y  C
Sbjct  362   NIRHHLLEQWKGKDEDVLVYDKLPNDKSYETMLKNSRFCLCPSGYEVASPRIVEAIYAEC  421

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVL+W+ F+V I VK+IPN+KKIL+SI Q +YL M  +  QV+RHF
Sbjct  422   IPVLISDSYVPPFSDVLNWNAFSVTIGVKDIPNIKKILISISQSQYLRMHRRVKQVQRHF  481

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N  PKR+D+FHM++HSIWLRRLNI V +
Sbjct  482   VINGSPKRFDLFHMIVHSIWLRRLNIRVQE  511



>ref|XP_009379540.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=540

 Score =   464 bits (1195),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 284/387 (73%), Gaps = 5/387 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + L++VEA L R R+AIR+A   + +    +DPDYVP GPIY NP+AFHRSYLEMEK FK
Sbjct  153   SQLDKVEASLGRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMEKVFK  212

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FH    +GI   EG  IH++E  KF RTK+P KA V+FLPFS  ++V +
Sbjct  213   IYVYEEGEVPIFHEGPCRGIYSSEGRFIHEMEKGKFYRTKDPHKALVYFLPFSVVTMVQY  272

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ +  +   ++    DYIN IS K+P+WNRS G DHFML+CHDW P  +   P LF N
Sbjct  273   IYMPETFDRNGMKLAVVDYINLISYKHPFWNRSHGADHFMLSCHDWGPFTTSFVPDLFHN  332

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ D SLPEI L    M G IGG PPS RS L FYAGG+HG+IR 
Sbjct  333   SIRVVCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGLHGHIRY  391

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V +++ LP+ +SY  M + SK+C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  392   LLLNEWKGKDQDVLVYDKLPQGMSYENMFKSSKFCLCPSGYEVASPRVVEAIYAECVPVL  451

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVL+W++F+V +PVK I ++K IL +I   +YL MQ +  QV+RHF VN 
Sbjct  452   ISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  511

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             PPKRYDVFHM++HS+WLRRLNI + DI
Sbjct  512   PPKRYDVFHMIVHSVWLRRLNIRIQDI  538



>gb|KCW89058.1| hypothetical protein EUGRSUZ_A01384 [Eucalyptus grandis]
Length=559

 Score =   465 bits (1196),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 296/427 (69%), Gaps = 23/427 (5%)
 Frame = +1

Query  238   LRGFSMPFYQLPSSHP-----------------DAMKKLTNLERVEAGLARVRAAIRQA-  363
             L  F+ PFYQ P + P                  A+K+ +  ER+EA L++ R+AIR+A 
Sbjct  131   LGSFACPFYQAPENEPPTEQPEPDETVTVEEPARAVKRYSRFERLEASLSQARSAIREAA  190

Query  364   --QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGIL  537
               +    +  D DYVP GPIYRN +AFHRSYLEMEK FKI++Y+EGEPP+FH    + I 
Sbjct  191   LVRNLTSVHADADYVPRGPIYRNANAFHRSYLEMEKLFKIYVYQEGEPPMFHDGPCKSIY  250

Query  538   GIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYI  711
               EG  IH++E   + +RT +P++A V+FLPFS   LV +++   +HE   I     DYI
Sbjct  251   STEGRFIHEMERGHNMYRTTDPDEALVYFLPFSVVMLVQYLYEPGSHETHAIGHAVVDYI  310

Query  712   NGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDV  891
             + I+ K+P+WNRSLG DHFML+CHDW P  S   P LF  SIRV+CNANTSEGF P  D 
Sbjct  311   DVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSYVPNLFSKSIRVLCNANTSEGFDPFKDA  370

Query  892   SLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENK-DPEVEIHEYL  1068
             SLPEI L  G + GL+GGP PS R  L F+AG +HG+IR ++++ W++K DP+V +++ L
Sbjct  371   SLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGRLHGHIRHLLLQEWKDKEDPDVRVYDEL  430

Query  1069  PKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFA  1248
             P+ VSY  M+R+S+YC+CPSGYEVASPR+VEA+Y  CVPVLI D Y  PF+DVL+W  F+
Sbjct  431   PRGVSYESMLRQSRYCLCPSGYEVASPRIVEAIYAECVPVLISDSYVPPFSDVLNWKAFS  490

Query  1249  VDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRR  1428
             V + VK+IPN+KK+L++I   +YL MQ +  QV+RHF  N PP+RYDVFHM +HSIWLRR
Sbjct  491   VQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQVQRHFVANGPPRRYDVFHMTVHSIWLRR  550

Query  1429  LNIEVHD  1449
             LNI + D
Sbjct  551   LNIRITD  557



>ref|XP_010068733.1| PREDICTED: probable glycosyltransferase At5g03795 [Eucalyptus 
grandis]
 gb|KCW89056.1| hypothetical protein EUGRSUZ_A01382 [Eucalyptus grandis]
Length=496

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/393 (55%), Positives = 287/393 (73%), Gaps = 6/393 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEM  459
             A+K+ +  ER+EA L+R R+AIR+A   +    +  D DY+P GPIYRN +AFHRSYLEM
Sbjct  102   AVKRYSRFERLEASLSRARSAIREAALVRNLTSVHADADYIPQGPIYRNANAFHRSYLEM  161

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
             EK FKI++Y+EGEPP+FH    + I   EG  IH++E   + +RT  P++A V+FLPFS 
Sbjct  162   EKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTGPDEALVYFLPFSV  221

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               LVH+++   +HE   I +   DYI+ I+ K+P+WNRSLG DHFML+CHDW P  S   
Sbjct  222   VMLVHYLYEPGSHETHAIGRAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSYV  281

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P LF  SIRV+CNANTSEGF P  D SLPEI L  G + GL+GGP PS R  L F+AG +
Sbjct  282   PNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGHL  341

Query  994   HGYIRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             HG+IR ++++ W++K DP+V +++ LP+ VSY  M+R+S+YC+CPSGYEVASPR+VEA+Y
Sbjct  342   HGHIRYLLLQEWKDKEDPDVRVYDKLPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAIY  401

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
               CVPVLI D Y  PF+DVL+W  F+V + VK+IPN+KKIL++I   +YL MQ +  QV+
Sbjct  402   AECVPVLISDGYVPPFSDVLNWKAFSVQVQVKDIPNIKKILMAISPSQYLRMQRRVKQVQ  461

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             RHF  N PP+RYDVFHM +HSIWLRRLNI + D
Sbjct  462   RHFVANGPPRRYDVFHMTVHSIWLRRLNIRITD  494



>ref|XP_010490872.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=521

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 213/393 (54%), Positives = 290/393 (74%), Gaps = 2/393 (1%)
 Frame = +1

Query  277   SHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             S P   + L+NL+++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYLE
Sbjct  130   SEPKKRRVLSNLQKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKIFHRSYLE  188

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAH F+LPFS 
Sbjct  189   MEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNNPDKAHAFYLPFSV  248

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V FV+ R++ ++ PI+ T RDYIN +  KYPYWNRS+G DHFML+CHDW P  S   
Sbjct  249   VKMVRFVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFMLSCHDWGPEASFSH  308

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG+
Sbjct  309   PHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGV  368

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG +R V++E WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y 
Sbjct  369   HGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALYS  428

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
             GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL +I   +YL M  + ++VRR
Sbjct  429   GCVPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVRR  488

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             HFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  489   HFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  521



>ref|NP_001031828.1| Exostosin family protein [Arabidopsis thaliana]
 sp|Q9FFN2.2|GLYT3_ARATH RecName: Full=Probable glycosyltransferase At5g03795 [Arabidopsis 
thaliana]
 gb|AED90655.1| Exostosin family protein [Arabidopsis thaliana]
Length=518

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 292/394 (74%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             S  P   + L+NLE++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  126   SLEPKKRRVLSNLEKIEFKLQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  184

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAHVF+LPFS
Sbjct  185   EMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEIETDTRFRTNNPDKAHVFYLPFS  244

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +V+ R++ ++ PI+ T +DYIN +  KYPYWNRS+G DHF+L+CHDW P  S  
Sbjct  245   VVKMVRYVYERNSRDFSPIRNTVKDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFS  304

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG
Sbjct  305   HPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGG  364

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V+++ WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  365   VHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  424

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VR
Sbjct  425   SGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVR  484

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+++ ++
Sbjct  485   RHFEVNSPAKRFDVFHMILHSIWVRRLNVKIREV  518



>ref|XP_002320537.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
 gb|EEE98852.2| hypothetical protein POPTR_0014s16900g [Populus trichocarpa]
Length=461

 Score =   460 bits (1183),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 279/384 (73%), Gaps = 5/384 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRIL----EDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
               LERVEAGLA  RA IR+A  +N       +D DY+P G IYRN  AFHRSYL MEK F
Sbjct  75    AKLERVEAGLAMARALIREAAEDNNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLMEKLF  134

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVH  648
             KIF+YEEGEPP+FHY   + I  +EG+ +  +E  +KFRT NP++AHV+FLPFS   ++ 
Sbjct  135   KIFVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVMIIE  194

Query  649   FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFK  828
              +F     +   +++T  DY+  IS KY YWNRSLG DHFML+CHDW P  +    +L+ 
Sbjct  195   HLFHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYVRQLYY  254

Query  829   NSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIR  1008
             NSIRV+CNANTSE F P  D S PEI L  G + GL GG PPSNR+VL F+AG +HG +R
Sbjct  255   NSIRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKMHGKLR  314

Query  1009  QVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
               +++ W  KD +V+++E LP+ +SY+ M++KSKYCICPSG+EVASPR+ EA+Y  CVPV
Sbjct  315   PALLQHWMGKDKDVQVYETLPQGISYHEMMKKSKYCICPSGHEVASPRIAEAIYAECVPV  374

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI  HY  PF+DVL+WD+F + +PV EIPNLK IL  IP+++YL MQE+  QV+RHF VN
Sbjct  375   LISQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVRQVQRHFVVN  434

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIE  1440
              PP+RYDVFHM++HSIWLRRLN+ 
Sbjct  435   NPPRRYDVFHMIIHSIWLRRLNVR  458



>ref|XP_006398838.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
 gb|ESQ40291.1| hypothetical protein EUTSA_v10016080mg [Eutrema salsugineum]
Length=517

 Score =   462 bits (1188),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 291/394 (74%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             SS     + ++NLE++E  L + R AI+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  125   SSEQIKKRVMSNLEKIEFELQKARVAIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  183

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKIF+Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAH F+LP S
Sbjct  184   EMEKQFKIFVYKEGEPPLFHDGPCKSIYSMEGNFIYEMETDTRFRTNNPDKAHAFYLPLS  243

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +V+V ++H++ PI+KT RDYI+ +S KY YWNRS+G DHF+L+CHDW P  S  
Sbjct  244   VVKMVRYVYVSNSHDFSPIRKTVRDYIDLVSDKYSYWNRSIGADHFILSCHDWGPEASFS  303

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L +NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG
Sbjct  304   HPHLGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGG  363

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V+++ WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  364   VHGPVRPVLLQHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  423

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VR
Sbjct  424   SGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVR  483

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  484   RHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  517



>gb|KFK24839.1| hypothetical protein AALP_AA8G031400 [Arabis alpina]
Length=498

 Score =   461 bits (1186),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 292/385 (76%), Gaps = 2/385 (1%)
 Frame = +1

Query  301   LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             L+NLE+VE  L + RAAI+ A + +  ++DPDYVP GP+Y N   FHRSYLEMEK+FKIF
Sbjct  115   LSNLEKVEFELQKARAAIK-ASSIDDPVDDPDYVPLGPMYWNAKVFHRSYLEMEKQFKIF  173

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVF  657
             +Y+EGEPP+FH    + I  +EG  I+++E +  FRT NP+KAH F+LP S   +V FV+
Sbjct  174   VYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTHFRTNNPDKAHAFYLPLSVVKMVRFVY  233

Query  658   VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSI  837
              R++ ++ PI+ T RDYI  +S +YPYWNRS+G DHF+L+CHDW P  S   P L +NSI
Sbjct  234   DRNSRDFGPIRNTVRDYIELVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQNSI  293

Query  838   RVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVM  1017
             R +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG+HG +R ++
Sbjct  294   RALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGGVHGPVRPIL  353

Query  1018  METWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIK  1197
             +E WENKD ++ +H+YLPK  SY  M+R SK+CICPSGYEVASPR+VEA+Y GCVPVLI 
Sbjct  354   LEHWENKDNDIRVHKYLPKGTSYSDMMRNSKFCICPSGYEVASPRIVEALYSGCVPVLIN  413

Query  1198  DHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPP  1377
               Y  PF+DVL+W +F+V + V+EIPNLK IL SI   +YL M  + ++VRRHFEVN P 
Sbjct  414   SGYVPPFSDVLNWKSFSVIVSVEEIPNLKTILTSISPRQYLRMYRRVLKVRRHFEVNSPA  473

Query  1378  KRYDVFHMVLHSIWLRRLNIEVHDI  1452
             KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  474   KRFDVFHMILHSIWVRRLNVRIREV  498



>ref|XP_008794078.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=552

 Score =   462 bits (1190),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 217/395 (55%), Positives = 296/395 (75%), Gaps = 5/395 (1%)
 Frame = +1

Query  271   PSSHPDAMKKLTNLERVEAGLARVRAAIRQA-QTENRI-LEDPDYVPHGPIYRNPHAFHR  444
             P++   A +K T LER+E GLAR RAAI++A +  NR  L D DYVP GP+YRN +AFH+
Sbjct  157   PNNTRRARRKDTKLERLELGLARARAAIKEAVRNPNRTALVDKDYVPKGPVYRNAYAFHK  216

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFL  621
             SYLEMEK FK+++Y+EGEPP+FH    + I   EG  I+ +++ S+ RT++P++AHVFFL
Sbjct  217   SYLEMEKLFKVYVYQEGEPPIFHDGPCKSIYSTEGFFINSMDMESRLRTRDPDRAHVFFL  276

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   +V +++ RD H+  P+++T  DYIN IS KYPYWNRSLG DHFML+CHDW P  
Sbjct  277   PFSVVRMVQYIYPRDHHDMKPLRRTVLDYINVISGKYPYWNRSLGADHFMLSCHDWGPYA  336

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S G P+LF NSIRV+CNANTSE F  + DV+LPE+ +    +   +GGP  S R +L F+
Sbjct  337   SGGHPQLFFNSIRVLCNANTSEWFNASRDVTLPEMNVRSHVVK--VGGPSASGRPILAFF  394

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG HG IR ++++ W++ D +V++HEYLPK VSY  +++KSK+C+CPSGYEVASPR++E
Sbjct  395   AGGNHGPIRPLLLKHWKDIDGDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIME  454

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+Y  CVPV I  HY  PF+DVL+W  F+V + V++IPNLK IL+SI   +Y+ MQ +  
Sbjct  455   AIYYECVPVTINAHYVLPFSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVR  514

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
              V+RHF +N PP+R+D++HM+LHSIWLRRLNI +H
Sbjct  515   TVQRHFMINGPPRRFDLYHMLLHSIWLRRLNIRIH  549



>ref|XP_004305861.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   459 bits (1182),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 218/391 (56%), Positives = 282/391 (72%), Gaps = 3/391 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRI--LEDPDYVPHGPIYRNPHAFHRSYLEM  459
             D  K   NLER+EAGLA  R  IR+A T N+   LED DYVP+G IYRN +AFHRSYL M
Sbjct  75    DNEKGDVNLERIEAGLATARELIREATTLNQTSPLEDADYVPNGDIYRNAYAFHRSYLLM  134

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSY  636
             E  F+ F+YEEGEPP+FH    + I  +EG+ +  +E  +KFRT +PE+AHV+FLPFS  
Sbjct  135   ESLFRTFVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTSDPEEAHVYFLPFSVV  194

Query  637   SLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
              ++ ++F     +   +Q+T  DY+  IS KYP+WNRSLG DH ML+CHDW P  +    
Sbjct  195   MIIEYLFHPVIRDKAVLQRTVVDYVRVISNKYPFWNRSLGADHVMLSCHDWGPRATWYVR  254

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
             +L+  +IRV+CNANTSE F P  D S PEI L  G + GLIGG PPS RSVL F+AG +H
Sbjct  255   QLYFVAIRVLCNANTSEHFNPKKDASFPEINLVTGEITGLIGGLPPSKRSVLAFFAGRMH  314

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G IR ++ + W+ KD  + ++E LPKN SY  M+++SKYCICPSG+EVASPR+VEA+Y  
Sbjct  315   GRIRPLLFQHWKEKDENLLVYEKLPKNASYQDMLKQSKYCICPSGHEVASPRIVEAIYAE  374

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI  HY  PF+DVLDW++F++ + V EIP LK+IL+ IP+EKY  MQE+  QV+ H
Sbjct  375   CVPVLISQHYVLPFSDVLDWESFSIQVSVSEIPQLKEILMRIPEEKYRRMQERVKQVQMH  434

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             F VN PPKRYDVFHM++HSIWLRRLN+ ++ 
Sbjct  435   FVVNNPPKRYDVFHMIIHSIWLRRLNVRIYS  465



>ref|XP_006287392.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
 gb|EOA20290.1| hypothetical protein CARUB_v10000598mg, partial [Capsella rubella]
Length=562

 Score =   463 bits (1191),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 291/394 (74%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             SS P   + L+NLE++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  170   SSEPKKRRVLSNLEKIELELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  228

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAH F+LPFS
Sbjct  229   EMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFS  288

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +V+ R++ ++ PI+ T RDYIN +  KYPYWNRS+G DHF+L+CHDW P  S  
Sbjct  289   VVKMVRYVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFS  348

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG
Sbjct  349   HPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSSRPILAFFAGG  408

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V+++ WE+KD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  409   VHGPVRPVLLDHWEDKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  468

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL SI   +YL M  + ++VR
Sbjct  469   SGCVPVLINSGYVPPFSDVLNWKSFSVIVSVEDIPNLKTILTSISPRQYLRMYRRVLKVR  528

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  529   RHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  562



>ref|XP_002873114.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49373.1| hypothetical protein ARALYDRAFT_487158 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 290/394 (74%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             S  P   + L+NLE++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  127   SLEPKKRRVLSNLEKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  185

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT NP+KAH F+LPFS
Sbjct  186   EMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETDTRFRTNNPDKAHAFYLPFS  245

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +V+ R++ ++ PI+ T RDYIN +  KYPYWNRS+G DHF+L+CHDW P  S  
Sbjct  246   VVKMVRYVYERNSRDFSPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFS  305

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS+R +L F+AGG
Sbjct  306   HPHLGHNSIRALCNANTSEKFKPRKDVSIPEINLRTGSLTGLVGGPSPSSRPILAFFAGG  365

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V++E WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  366   VHGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  425

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL +I   +YL M  + ++VR
Sbjct  426   SGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTAISPRQYLRMYRRVLKVR  485

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  486   RHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  519



>ref|XP_008227726.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=542

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/391 (55%), Positives = 286/391 (73%), Gaps = 5/391 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA-QTENRIL--EDPDYVPHGPIYRNPHAFHRSYLEME  462
             M   + LE++EA L R R++IR+A    N+I   +DPDYVP GPIYRNP+AFHRSYLEME
Sbjct  151   MSGSSQLEKLEASLGRARSSIREAANVRNKISTHQDPDYVPRGPIYRNPNAFHRSYLEME  210

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
               FKI++YEEGE P+FH    + I   EG  IH++E    +RT++P+KA V+FLPFS   
Sbjct  211   NLFKIYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVAR  270

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +V +++V D+ +   ++    DY+N I+ K+P+WNRSLG DHFML+CHDW P  +   P 
Sbjct  271   MVRYMYVPDSKDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWGPFTTSFVPL  330

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF NSIRV+CNANTSEGF P+ D S PEI L    M GL GG PPS+RS L F+AGG+HG
Sbjct  331   LFHNSIRVLCNANTSEGFNPSKDSSFPEINLKTSEMSGL-GGQPPSSRSTLAFFAGGLHG  389

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IR +++  W+ KD +V ++E LP+ VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  390   HIRSLLLNEWKGKDRDVRVYEKLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAEC  449

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVLDW TF+V +PVK I ++K IL+SI   +YL  Q +  +V+RHF
Sbjct  450   IPVLISDGYIPPFSDVLDWKTFSVQVPVKNISDIKNILMSISSRQYLRTQRRVKEVQRHF  509

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
              VN PPKRYDVFHM++HSIWLRRLNI + D+
Sbjct  510   LVNGPPKRYDVFHMIVHSIWLRRLNIRIQDL  540



>ref|XP_008459522.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=514

 Score =   461 bits (1185),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 285/389 (73%), Gaps = 4/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTEN--RILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K  + L+++E  L R RAAIR+A Q  N   I  DPDYVP GPIYRNP+AFHRSYLEME+
Sbjct  126   KGYSKLKKLEEKLGRARAAIRKASQLHNLTSIHHDPDYVPTGPIYRNPNAFHRSYLEMER  185

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKN-PEKAHVFFLPFSSYSL  642
               KI++Y+EGEPP+FH    + I   EG  IH++E     T N P++A ++FLPFS  +L
Sbjct  186   LLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYFLPFSVVNL  245

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +++V ++HE   I +   DYIN IS K+P+W+RSLG DHFML+CHDW P  +   P L
Sbjct  246   VQYLYVPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHDWGPRTTSYVPLL  305

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNAN SEGF P+ D S PEI+L  G +DGLIGG  PS RSVL F+AG +HG+
Sbjct  306   FNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRSVLAFFAGRLHGH  365

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR ++++ W+ KD +V ++E LP  +SY  M++KS++C+CPSGYEVASPR+VEA+Y  CV
Sbjct  366   IRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVASPRVVEAIYAECV  425

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI + Y  PF+DVL+W +F+V I VK+IPN+KKIL  I Q +YL MQ +  QV+RHF 
Sbjct  426   PVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRMQRRVKQVQRHFA  485

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             +N  PKR+D FHM+LHSIWLRRLNI + D
Sbjct  486   LNGTPKRFDAFHMILHSIWLRRLNIHIQD  514



>ref|XP_010923285.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=522

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/387 (55%), Positives = 288/387 (74%), Gaps = 5/387 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQ-AQTENR-ILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             +K   LER+E GLAR RAAIR+  Q  NR  L D DYVP GP YRN +AFHRSYLEMEK 
Sbjct  135   RKDIKLERLELGLARARAAIREDVQNSNRPALADKDYVPIGPAYRNAYAFHRSYLEMEKL  194

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLV  645
              K+++Y EGEPP+FH      I   EG+ I+ +++ ++ RT++P++AHVFFLPFS   +V
Sbjct  195   LKVYVYGEGEPPIFHDGPCLSIYSTEGLFINSMDMENRLRTRDPDRAHVFFLPFSVVRMV  254

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
               ++ RD  +  P+++T RDYI+ IS KYPYWNRSLG DHFML+CHDW P  S G   LF
Sbjct  255   QHIYQRDRRDMSPLRRTVRDYIDVISRKYPYWNRSLGADHFMLSCHDWGPYASGGHSHLF  314

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
              NSIRV+CNANTSEGF P  DVSLPE+ +    ++  +GGP  S R +L F+AGG HG +
Sbjct  315   FNSIRVLCNANTSEGFNPLKDVSLPEMNMRSAVVN--VGGPSASGRPILAFFAGGNHGPV  372

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R V+++ W++KD ++++HEYLP+ VSY  +++KSK+C+CPSGYEVASPR++EA+Y+ CVP
Sbjct  373   RPVLIKHWKDKDKDIQVHEYLPQGVSYIDLMKKSKFCLCPSGYEVASPRIMEAIYLECVP  432

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             V I DHY  P +DVL+W  F+V + V++IPNLK IL+SI   +Y+ MQ +   V+RHF +
Sbjct  433   VTINDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQRHFML  492

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             N PPKR+D++HM+LHS+WLRRLN+ +H
Sbjct  493   NSPPKRFDLYHMLLHSVWLRRLNVHIH  519



>emb|CDP08577.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 211/389 (54%), Positives = 284/389 (73%), Gaps = 4/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K+   LER+E  L++ R +IR+A     ++   ED DYVPHGP+Y N + FHRSYLEMEK
Sbjct  121   KRYNKLERLETMLSKARYSIREAAKNGSMISTHEDADYVPHGPMYINANGFHRSYLEMEK  180

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYSL  642
              FK+++Y+EGEPP+FH    + I   EG  IH++E   F RTKNP+ A V+FLPFS  ++
Sbjct  181   SFKVYVYQEGEPPMFHDGLCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAM  240

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +++    H+   I  T  DYI  IS K+P+WNRSLG DHFML+CHDW P  +   P+L
Sbjct  241   VQYLYEPGGHDRQAIGHTLADYIGLISGKHPFWNRSLGADHFMLSCHDWGPYSTSYVPQL  300

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNANTSEGF P  DVSLPEI+L  G + GLIG P PS R +L F+AG +HG+
Sbjct  301   FNNSIRVLCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGCPSPSRRPILAFFAGRLHGH  360

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++E W+ KD  +++++ LP  VSY  M+RKSK+C+CPSGYEVASPR+VEA+Y  C+
Sbjct  361   IRYLLLEQWKEKDQGIQVYDSLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECI  420

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             P+LI D YA PF+DVL+W +F+V++ VK+I N+KKIL SI Q +Y  M  +  QV+RHF 
Sbjct  421   PILISDSYAPPFSDVLNWKSFSVEVAVKDILNIKKILTSISQTQYRRMHRRLKQVQRHFV  480

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             +N PPKR+D+FH ++HSIWL+RLNI++ D
Sbjct  481   INGPPKRFDLFHTIMHSIWLQRLNIQIKD  509



>ref|XP_011009816.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
Length=480

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 278/382 (73%), Gaps = 5/382 (1%)
 Frame = +1

Query  310   LERVEAGLARVRAAIRQAQTENRIL----EDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             LERVEAGLA  RA IR+A  ++       +D DY+P G IYRN  AFHRSYL MEK FKI
Sbjct  96    LERVEAGLAMARALIREAAEDSNCTSSLHDDLDYIPRGYIYRNACAFHRSYLLMEKLFKI  155

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             F+YEEGEPP+FHY   + I  +EG+ +  +E  +KFRT NP++AHV+FLPFS   ++  +
Sbjct  156   FVYEEGEPPLFHYGTCKDIYSMEGVFLSLMETNTKFRTSNPDEAHVYFLPFSVVMIIEHL  215

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++T  DY+  IS KY YWNRSLG DHFML+CHDW P  +    +L+ NS
Sbjct  216   FHPIIRDKAVLERTVSDYVRIISHKYLYWNRSLGADHFMLSCHDWGPRATWYVRQLYYNS  275

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNANTSE F P  D S PEI L  G + GL GG PPSNR+VL F+AG +HG +R  
Sbjct  276   IRVLCNANTSEYFNPKKDASFPEINLKTGEITGLTGGLPPSNRTVLAFFAGKMHGKLRPA  335

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             +++ W  KD +V+++E LP+ +SY+ M+ KSKYCICPSG+EVASPR+ EA+Y  CVPVLI
Sbjct  336   LLQHWMGKDKDVQVYETLPQGISYHEMMTKSKYCICPSGHEVASPRIAEAIYAECVPVLI  395

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
               HY  PF+DVL+WD+F + +PV EIPNLK IL  IP+++YL MQE+  QV+RHF VN P
Sbjct  396   SQHYIFPFSDVLNWDSFTIQVPVTEIPNLKNILEGIPEDQYLRMQERVKQVQRHFVVNNP  455

Query  1375  PKRYDVFHMVLHSIWLRRLNIE  1440
             P+RYDVFHM++HSIWLRRLN+ 
Sbjct  456   PRRYDVFHMIIHSIWLRRLNVR  477



>ref|XP_010423660.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=514

 Score =   460 bits (1183),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 289/394 (73%), Gaps = 2/394 (1%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             SS P   + L+NLE++E  L + RA+I+ A  ++ + +       GP+Y N   FHRSYL
Sbjct  122   SSEPKKRRVLSNLEKIEFELQKARASIKAASMDDPVDDPDYVP-LGPMYWNAKVFHRSYL  180

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFS  630
             EMEK+FKI++Y+EGEPP+FH    + I  +EG  I+++E  ++FRT  P+KAH F+LPFS
Sbjct  181   EMEKQFKIYVYKEGEPPLFHDGPCKSIYSMEGSFIYEMETNTRFRTNKPDKAHAFYLPFS  240

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V FV+ R++ ++ PI+ T RDYIN +  KYPYWNRS+G DHF+L+CHDW P  S  
Sbjct  241   VVKMVRFVYERNSRDFGPIRNTVRDYINLVGDKYPYWNRSIGADHFILSCHDWGPEASFS  300

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P L  NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GG  PS+R +L F+AGG
Sbjct  301   HPHLGHNSIRALCNANTSERFKPRKDVSIPEINLRTGSLTGLVGGRSPSSRPILAFFAGG  360

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG +R V++E WENKD ++ +H+YLP+  SY  M+R SK+CICPSGYEVASPR+VEA+Y
Sbjct  361   VHGPVRPVLLEHWENKDNDIRVHKYLPRGTSYSDMMRNSKFCICPSGYEVASPRIVEALY  420

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI   Y  PF+DVL+W +F+V + V++IPNLK IL +I   +YL M  + ++VR
Sbjct  421   SGCVPVLINSGYVPPFSDVLNWKSFSVVVSVEDIPNLKTILTAISPRQYLRMYRRVLKVR  480

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             RHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  481   RHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  514



>gb|KGN52623.1| hypothetical protein Csa_5G647450 [Cucumis sativus]
Length=510

 Score =   459 bits (1182),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 216/389 (56%), Positives = 287/389 (74%), Gaps = 4/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTEN--RILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++ + L+++E  L R RAAIR+A Q  N   I  DPDYVP GPIYRNP+AFHRSY+EMEK
Sbjct  122   ERYSKLKKLEEKLGRARAAIREASQIHNLTSIHHDPDYVPTGPIYRNPNAFHRSYIEMEK  181

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKN-PEKAHVFFLPFSSYSL  642
               KI++Y+EGEPP+FH    + I   EG  IH++E     T N P++A ++FLPFS  +L
Sbjct  182   LLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYFLPFSVVNL  241

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +++V ++HE   I     DYIN IS K+P+W+RSLG DHFML+CHDW P  +   P L
Sbjct  242   VQYLYVPNSHEVNAIGTAITDYINVISNKHPFWDRSLGADHFMLSCHDWGPRTTSFVPLL  301

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNAN SEGF+P+ D S PEI+L  G +DGL+GG  PS RSVL F+AG +HG+
Sbjct  302   FNNSIRVLCNANVSEGFRPSKDASFPEIHLRTGEIDGLLGGLSPSRRSVLAFFAGRLHGH  361

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR ++++ W+ KD +V +++ LP  +SY  M++KS++C+CPSGYEVASPR+VEA+Y  CV
Sbjct  362   IRYLLLQEWKEKDEDVLVYDELPSGISYDSMLKKSRFCLCPSGYEVASPRVVEAIYAECV  421

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI + Y  PF+DVL+W++FAV I VK+IPN+KKIL  I Q +YL MQ +  QV+RHF 
Sbjct  422   PVLISESYVPPFSDVLNWNSFAVQIQVKDIPNIKKILNGISQTQYLRMQRRVKQVQRHFV  481

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             +N  PKR+D FHM+LHSIWLRRLNI + D
Sbjct  482   LNGTPKRFDAFHMILHSIWLRRLNIHIQD  510



>gb|KHN09672.1| Putative glycosyltransferase, partial [Glycine soja]
Length=399

 Score =   455 bits (1171),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 216/389 (56%), Positives = 290/389 (75%), Gaps = 6/389 (2%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQAQ---TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K T L  +EA LA+ R +IR+A         L+DPDYVP G IYRN +AFHRSYLEMEK 
Sbjct  11    KYTKLGSIEARLAKARYSIREASKIPNFTPTLQDPDYVPQGSIYRNANAFHRSYLEMEKV  70

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYSLV  645
             FKIF+YEEGEPP+FH   S+ I   EG  IH++E  ++ RT +P++A V++LPFS   LV
Sbjct  71    FKIFVYEEGEPPLFHNGLSKDIYATEGRFIHEMEKGRYYRTYDPDEAFVYYLPFSVVMLV  130

Query  646   HFVFVRDA-HEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
              +V+ R + +   P+    +DYI  I+ K+P+WNRSLG+DH ML+CHDW P +S     L
Sbjct  131   EYVYDRGSNYNLDPLGLVVKDYIQIIAHKHPFWNRSLGHDHVMLSCHDWGPLVSSYVDHL  190

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + N+IRV+CNANTSEGFKPA DVS PEI L +G + GL GG PPS R++L F+AG +HGY
Sbjct  191   YNNAIRVLCNANTSEGFKPAKDVSFPEIKLIKGEVKGL-GGYPPSQRTILAFFAGHLHGY  249

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++ TW+NKD +++I+E LP+ +SYY  +R SK+C+CPSGYEVASPR+VEA++  CV
Sbjct  250   IRYLLLSTWKNKDQDMQIYEELPEGISYYTKLRSSKFCLCPSGYEVASPRVVEAIFAECV  309

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI D Y  PF+DVL+W++F+V + VK+IPN+K+IL+ I +++YL M ++  QV+RHF 
Sbjct  310   PVLISDSYVPPFSDVLNWNSFSVQVNVKDIPNIKRILMEISEKQYLRMHKRVKQVQRHFV  369

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              N PPKRYD+FHM +HSIWLRRLNI + D
Sbjct  370   PNEPPKRYDMFHMTVHSIWLRRLNINIQD  398



>gb|EMT30821.1| Exostosin-2 [Aegilops tauschii]
Length=537

 Score =   460 bits (1183),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 215/385 (56%), Positives = 282/385 (73%), Gaps = 4/385 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LERVE GLA+ R  IR+A   + +   L D DYVP GP+YRN +AFHRSYLEMEK FK
Sbjct  150   VKLERVELGLAKARLVIREAIRNKDKRPPLTDRDYVPVGPVYRNAYAFHRSYLEMEKLFK  209

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             +++YEEGEPPVFH    + I   EG  I  +E+ ++ RT++PE AHVFFLPFS   +V  
Sbjct  210   VYVYEEGEPPVFHDGPCRSIYSSEGRFIFAMEMENRMRTRDPELAHVFFLPFSVVKMVKM  269

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             ++  ++H+  P+++T  DYI+ +STKYPYWNRSLG DHFML+CHDW P +S     LF N
Sbjct  270   IYEPNSHDMEPLRRTLSDYIDVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSADGHLFSN  329

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVSLPEI L    +D  +GGP  S R +L F+AGG HG +R 
Sbjct  330   SIRVLCNANTSEGFNPSKDVSLPEITLRTDIVDNQVGGPSASRRPILAFFAGGDHGPVRP  389

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V++ EYLP+ VSY  ++R+SK+C+CPSGYEVASPR+VEA+Y+ CVPV+
Sbjct  390   LLLRHWKGKDADVQVSEYLPRGVSYINVMRRSKFCLCPSGYEVASPRVVEAIYLECVPVV  449

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVL+W  F+V + V +IPNLK IL ++   +Y+ MQ     VRRHF VN 
Sbjct  450   IGDDYVLPFSDVLNWPAFSVRVAVADIPNLKTILAAVSPRQYIRMQRGVRPVRRHFMVNG  509

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVH  1446
             PP+R+DVFHM+LHSIWLRRLN+ +H
Sbjct  510   PPRRFDVFHMILHSIWLRRLNVRLH  534



>ref|XP_010048370.1| PREDICTED: probable glycosyltransferase At3g07620 [Eucalyptus 
grandis]
Length=521

 Score =   459 bits (1180),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 215/393 (55%), Positives = 286/393 (73%), Gaps = 6/393 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEM  459
             A+K+ +  ER+EA L++ R+AIR+A   +    +  D DYVP GPIYRN +AFHRSYLEM
Sbjct  127   AVKRYSRFERLEASLSQARSAIREAALVRNLTSVHADADYVPRGPIYRNANAFHRSYLEM  186

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
             EK FKI++Y+EGEPP+FH    + I   EG  IH++E   + +RT +P++A V+FLPFS 
Sbjct  187   EKLFKIYVYQEGEPPMFHDGPCKSIYSTEGRFIHEMERGHNMYRTTDPDEALVYFLPFSV  246

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               LV +++   +HE   I     DYI+ I+ K+P+WNRSLG DHFML+CHDW P  S   
Sbjct  247   VMLVQYLYEPGSHETHAIGHAVVDYIDVIAAKHPFWNRSLGADHFMLSCHDWGPRTSSYV  306

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P LF  SIRV+CNANTSEGF P  D SLPEI L  G + GL+GGP PS R  L F+AG +
Sbjct  307   PNLFSKSIRVLCNANTSEGFDPFKDASLPEINLKTGEIFGLLGGPSPSRRGTLAFFAGRL  366

Query  994   HGYIRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             HG+IR ++++ W++K DP+V +++ LP+ VSY  M+R+S+YC+CPSGYEVASPR+VEA+Y
Sbjct  367   HGHIRHLLLQEWKDKEDPDVRVYDELPRGVSYESMLRQSRYCLCPSGYEVASPRIVEAIY  426

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
               CVPVLI D Y  PF+DVL+W  F+V + VK+IPN+KK+L++I   +YL MQ +  QV+
Sbjct  427   AECVPVLISDSYVPPFSDVLNWKAFSVQVQVKDIPNIKKLLMAISPSQYLRMQRRVKQVQ  486

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             RHF  N PP+RYDVFHM +HSIWLRRLNI + D
Sbjct  487   RHFVANGPPRRYDVFHMTVHSIWLRRLNIRITD  519



>ref|XP_010657501.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Vitis vinifera]
Length=410

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 282/387 (73%), Gaps = 10/387 (3%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDP---DYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LERVEAGLAR RA IR+  T    +  P   DYVP G IYRN  AFHRSYL MEK FK
Sbjct  27    AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  86

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IFIY+EGEPP+FH    + I  IEG+    +E  + FRT++P++AHV+FLPFS   ++H 
Sbjct  87    IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  146

Query  652   VF---VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             +F   VRD +    ++    DY+  IS KY YWNRSLG DHFML+CHDW P  +   P+L
Sbjct  147   LFDPIVRDKYV---MKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQL  203

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NSIR++CNANTSE F P  D S+PEI L  G   GL GG PPS R++L F+AGG+HG 
Sbjct  204   YYNSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGR  263

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR  +++ W+ KD +V+++E LP+ +SY  +++KSKYCICPSG+EVASPR+VEA+Y  CV
Sbjct  264   IRPALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECV  323

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI  HY  PF+DVLDW +F++ + V EIPNLKKILL IPQ++Y+ MQE+  QV++HF 
Sbjct  324   PVLISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFV  383

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             VN PPKR+DVFHM++HSIWLRRLN+ +
Sbjct  384   VNNPPKRFDVFHMIIHSIWLRRLNVAI  410



>ref|XP_009379539.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=521

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 213/387 (55%), Positives = 284/387 (73%), Gaps = 5/387 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + L++VEA L R R++IR+A   + +    +DPDYVP GPIYRNP+AFHRSYLEMEK FK
Sbjct  134   SKLDKVEASLGRARSSIREAALVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKVFK  193

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FH    + I   EG  IH++E  + +RTK P KA V+FLPFS  ++V +
Sbjct  194   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGQLYRTKAPHKALVYFLPFSVVNMVQY  253

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ + ++   ++    DYIN IS K+P+WNRSLG DHFML+CHDW PT +   P LF N
Sbjct  254   IYMPETYDRSGMKLAVVDYINLISHKHPFWNRSLGADHFMLSCHDWGPTTTSFVPDLFHN  313

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ D S PEI L    M GL GG PPS R  L F+AG +HG+IR 
Sbjct  314   SIRVLCNANTSEGFDPSKDASFPEINLKTSEMPGL-GGQPPSKRYTLAFFAGRLHGHIRY  372

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V++++ LP+ VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  373   LLLNEWKGKDQDVQVYDQLPQGVSYENMLKSSKFCLCPSGYEVASPRVVEAIYAECVPVL  432

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVL+W +F+V +PVK I ++K IL +I   +YL MQ +  QV+RHF VN 
Sbjct  433   ISDGYVPPFSDVLNWKSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  492

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             PPKR+DVFHM++HSIWLRRLNI + D+
Sbjct  493   PPKRFDVFHMIVHSIWLRRLNIRIQDV  519



>ref|XP_002264111.3| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Vitis vinifera]
Length=454

 Score =   455 bits (1170),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 282/387 (73%), Gaps = 10/387 (3%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDP---DYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LERVEAGLAR RA IR+  T    +  P   DYVP G IYRN  AFHRSYL MEK FK
Sbjct  71    AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  130

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IFIY+EGEPP+FH    + I  IEG+    +E  + FRT++P++AHV+FLPFS   ++H 
Sbjct  131   IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  190

Query  652   VF---VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             +F   VRD +    ++    DY+  IS KY YWNRSLG DHFML+CHDW P  +   P+L
Sbjct  191   LFDPIVRDKYV---MKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQL  247

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NSIR++CNANTSE F P  D S+PEI L  G   GL GG PPS R++L F+AGG+HG 
Sbjct  248   YYNSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGR  307

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR  +++ W+ KD +V+++E LP+ +SY  +++KSKYCICPSG+EVASPR+VEA+Y  CV
Sbjct  308   IRPALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECV  367

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI  HY  PF+DVLDW +F++ + V EIPNLKKILL IPQ++Y+ MQE+  QV++HF 
Sbjct  368   PVLISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFV  427

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             VN PPKR+DVFHM++HSIWLRRLN+ +
Sbjct  428   VNNPPKRFDVFHMIIHSIWLRRLNVAI  454



>ref|XP_004239536.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=535

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/393 (54%), Positives = 289/393 (74%), Gaps = 5/393 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILE---DPDYVPHGPIYRNPHAFHRSYLE  456
             + +K    LER+EA LA+ R++IR+A     ++    DPDYVP GP+Y N ++FHRSYLE
Sbjct  143   EVLKMYRRLERLEAILAKSRSSIREAARNGSMISNHHDPDYVPQGPMYHNANSFHRSYLE  202

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK FK+++YEEGEPP+FH    + I   EG  IH++E  S +RTKNP++A V+FLPFS 
Sbjct  203   MEKNFKVYVYEEGEPPIFHNGPCRSIYSTEGRFIHEMERGSLYRTKNPDEALVYFLPFSV  262

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V ++FV  AH+   + +T  DY+  IS ++ +WNRSLG DHFML+CHDW P ++   
Sbjct  263   VVMVQYLFVPGAHDMHALGRTVADYVKVISERHSFWNRSLGADHFMLSCHDWGPHLTSYV  322

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P LF  SIRV+CNANTSEGF P  DVSLPEI L  G++ GLIGGP PS RS+L F+AGG+
Sbjct  323   PHLFNTSIRVLCNANTSEGFNPLKDVSLPEINLKTGDIKGLIGGPSPSRRSILAFFAGGL  382

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR  ++E W+ KD ++ ++E LP + SY  M++ S++C+CPSGYEVASPR+VEA+Y 
Sbjct  383   HGNIRHHLLEQWKGKDEDMLVYEKLPNDKSYETMLKNSRFCLCPSGYEVASPRVVEAIYA  442

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              C+PVLI D+Y  PF+DVL+W+ F+V I VK+IPN+KKIL+SI Q +YL M  +  QV+R
Sbjct  443   ECIPVLISDNYVPPFSDVLNWNAFSVTIGVKDIPNIKKILMSISQSQYLRMHRRVKQVQR  502

Query  1354  HFEVN-FPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             HF +N   PKR+D+ +M++HSIWLRRLNI V +
Sbjct  503   HFVINDGSPKRFDLLNMIVHSIWLRRLNIRVQE  535



>ref|XP_004243882.1| PREDICTED: probable glycosyltransferase At5g03795 [Solanum lycopersicum]
Length=508

 Score =   455 bits (1171),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 216/389 (56%), Positives = 286/389 (74%), Gaps = 5/389 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+   LERVEA LA+ R++IR+A     ++   EDPDYVP GPIYRN +AFHRSYLEME
Sbjct  120   VKRYNRLERVEAILAKARSSIREAARNGSMISNHEDPDYVPQGPIYRNTNAFHRSYLEME  179

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K+FKI++YEEGE P+FH    + I   EG  I+++E    +RTKNP++A V+FLPFS   
Sbjct  180   KKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKNPDEALVYFLPFSVVV  239

Query  640   LVHFVFVRDAHEWP-PIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
             +V +++V    +    I +T  DYI+ IS+++ +WN SLG DHFML+CHDW P  +   P
Sbjct  240   MVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTSYVP  299

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
              LF NSIRV+CNANT+EGF P  DVSLPEI L   +  G+IGGP PS RS+L F+AGG+H
Sbjct  300   HLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSILAFFAGGLH  359

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G IR  +M+ W+ KD +V ++E LP   SY  M++ SK+C+CPSGYEVASPR+VEA+Y  
Sbjct  360   GAIRNNLMQQWKGKDQDVLVYEELPSGESYESMLKNSKFCLCPSGYEVASPRVVEAIYAE  419

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI D Y  PF+DVL+W+ F+V + V++IPN+KKIL+SI Q +YL MQ +  QV+RH
Sbjct  420   CVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQRRVKQVQRH  479

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             F +N P KR+D+FHM++HSIWLRRLNI V
Sbjct  480   FVMNGPSKRFDLFHMIVHSIWLRRLNIRV  508



>ref|XP_008227680.1| PREDICTED: probable glycosyltransferase At5g03795 [Prunus mume]
Length=505

 Score =   454 bits (1168),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 283/387 (73%), Gaps = 5/387 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + L+++EA L R R++IR+A   + +    +DPDYVP GPIYRNP+AFHRSYLEMEK FK
Sbjct  118   SQLDKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKLFK  177

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FH    + I   EG  IH++E    +RT++P+KA V+FLPFS   +V +
Sbjct  178   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGNMYRTRDPDKALVYFLPFSVVRMVQY  237

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ D+++   ++    DY+N I+ K+ +WNRSLG DHFML+CHDWAP  +   P LF  
Sbjct  238   MYMPDSNDRHGMKLAIIDYVNLIAQKHSFWNRSLGADHFMLSCHDWAPLTTSFVPLLFHK  297

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIR++CNANTSEGF P+ D S PEI L    M GL GG  PS RS L F+AG +HG+IR 
Sbjct  298   SIRILCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAFFAGRLHGHIRS  356

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V++++ LP  VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  C+PVL
Sbjct  357   LLLNEWKGKDQDVQVYDKLPPGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAECIPVL  416

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVLDW +F+V +PVK I N+K IL+SI   +YL MQ +  QV+RHF VN 
Sbjct  417   ISDGYIPPFSDVLDWKSFSVQVPVKNISNIKNILMSISSGQYLRMQRRVKQVQRHFLVNG  476

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             PPKRYDVFHM++HSIWLRRLNI + D+
Sbjct  477   PPKRYDVFHMIVHSIWLRRLNIRIQDL  503



>ref|XP_009379541.1| PREDICTED: probable glycosyltransferase At5g03795 [Pyrus x bretschneideri]
Length=536

 Score =   454 bits (1169),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 214/387 (55%), Positives = 281/387 (73%), Gaps = 5/387 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             + L++VEA L+R R+AIR+A   + +    +DPDYVP GPIY NP+AFHRSYLEME  FK
Sbjct  149   SQLDKVEASLSRARSAIREAAKVRNKTSTHQDPDYVPRGPIYHNPNAFHRSYLEMENVFK  208

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FH    + I   EG  IH++E  K +RTK+P KA V+FLPFS  ++V +
Sbjct  209   IYVYEEGEVPIFHDGPCRSIYSSEGRFIHEMEKGKLYRTKDPHKALVYFLPFSVVNMVQY  268

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ +  +   ++    DYIN IS K+P+WNRS G DHFML+CHDW P  +   P LF N
Sbjct  269   IYMPETFDLSGMKLAVVDYINLISHKHPFWNRSHGADHFMLSCHDWGPLTTSFVPDLFHN  328

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRVMCNANTSEGF P+ D SLPEI L    M G IGG PPS RS L FYAGG HG+IR 
Sbjct  329   SIRVMCNANTSEGFNPSKDASLPEINLKTSEMSG-IGGQPPSKRSTLAFYAGGQHGHIRY  387

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ K+ +V +++ LP+ +SY  M +  K+C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  388   LLLNEWKGKEQDVLVYDKLPQGMSYENMFKSGKFCLCPSGYEVASPRVVEAIYAECVPVL  447

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVL+W++F+V +PVK I ++K IL +I   +YL MQ +  QV+RHF VN 
Sbjct  448   ISDGYVPPFSDVLNWNSFSVQVPVKNISDIKTILTAISSRQYLRMQRRVKQVQRHFLVNG  507

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             PPKRYDVFHM+++SIWLRRLNI + DI
Sbjct  508   PPKRYDVFHMLVYSIWLRRLNIRIQDI  534



>ref|XP_006357695.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=492

 Score =   453 bits (1165),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 287/389 (74%), Gaps = 5/389 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+   LER+EA LA+ R++IR+A     ++   +DPDYVP GPIYRN +AFHRSYLEME
Sbjct  104   VKRYNRLERLEAILAKARSSIREAARNGSMISNHQDPDYVPQGPIYRNTNAFHRSYLEME  163

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K+FKI++YEEGE P+FH    + I   EG  I+++E    +RTK+PE+A V+FLPFS   
Sbjct  164   KKFKIYVYEEGELPIFHNGPCRSIYSTEGRFIYEMEKGNMYRTKDPEEALVYFLPFSVVV  223

Query  640   LVHFVFVRDAHEWP-PIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
             +V +++V    +    I +T  DYI+ IS+++ +WN SLG DHFML+CHDW P  +   P
Sbjct  224   MVRYLYVSGGPDSRHVIGRTVADYIHVISSRHSFWNTSLGADHFMLSCHDWGPHTTSYVP  283

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
              LF NSIRV+CNANT+EGF P  DVSLPEI L   +  G+IGGP PS RS L F+AGG+H
Sbjct  284   HLFNNSIRVLCNANTTEGFNPQKDVSLPEINLKTDDTIGIIGGPSPSRRSTLAFFAGGLH  343

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G IR  +M+ W+ KD +V ++E LP   SY  M++ SK+C+CPSGYEVASPR+VEA+Y  
Sbjct  344   GAIRNNLMQQWKGKDQDVLVYEELPPGKSYETMLKNSKFCLCPSGYEVASPRVVEAIYAE  403

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI D Y  PF+DVL+W+ F+V + V++IPN+KKIL+SI Q +YL MQ++  QV+RH
Sbjct  404   CVPVLISDGYVPPFSDVLNWNAFSVKVAVEDIPNIKKILMSISQTQYLRMQKRVKQVQRH  463

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             F +N PPKR+D+FHM++HSIWLRRLNI V
Sbjct  464   FVMNGPPKRFDLFHMIVHSIWLRRLNIRV  492



>ref|XP_010246563.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795 [Nelumbo nucifera]
Length=494

 Score =   453 bits (1165),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 208/386 (54%), Positives = 281/386 (73%), Gaps = 5/386 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA-QTENRILED-PDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             + L+R+EA LAR RA IR+A Q +   L+   DY+P G IY N H FHRSYLEMEK FKI
Sbjct  110   SKLQRLEANLARARALIRKASQNQTSPLQSGEDYIPQGTIYHNAHEFHRSYLEMEKLFKI  169

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSLVHF  651
             F+YE+G+PP+FH    +GI   EG  IHQ+EI+K   RT++P +A V+FLP S    V  
Sbjct  170   FVYEDGDPPLFHNGPCKGIYSTEGRFIHQIEINKQFLRTRDPARALVYFLPISIARSVQL  229

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             ++V D+ +  PI++    Y+N I+ KYPYWNRSLG DHF+ +CHDW P IS   P L +N
Sbjct  230   LYVPDSRDIGPIKRXCH-YVNAIAAKYPYWNRSLGADHFLFSCHDWGPLISAYIPYLHQN  288

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ DVS PEI L +G++   +GG PP  R +L F+AG  HG++R 
Sbjct  289   SIRVLCNANTSEGFNPSRDVSFPEINLRRGDISAFLGGLPPQARQILAFFAGKQHGHVRL  348

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             ++ E W++KD E++++E+LP+ +SY  M+R+S YC+CPSGYEVASPR+ EA+Y  CVPVL
Sbjct  349   LLFEHWKDKDEELQVYEHLPRGISYREMMRRSNYCLCPSGYEVASPRVAEAIYAECVPVL  408

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I DHY  PF+DVL+W +F+V + V++IPNLK IL+   + +Y+ MQ +  QV++HF VN 
Sbjct  409   ISDHYVPPFSDVLNWKSFSVQVQVRDIPNLKSILMGTSEAQYIRMQARVKQVQKHFIVND  468

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             PP R+D FHM +HSIWLRRLN+ +HD
Sbjct  469   PPTRFDAFHMTIHSIWLRRLNVHIHD  494



>ref|XP_008796633.1| PREDICTED: probable glycosyltransferase At5g03795 [Phoenix dactylifera]
Length=499

 Score =   451 bits (1159),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 287/387 (74%), Gaps = 5/387 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQ-AQTENR-ILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             +K T LER+E GLAR RAAIR+  Q  NR  L D DYVP GP YRN +AFHRSYLEMEK 
Sbjct  112   RKDTKLERLELGLARARAAIREAVQNSNRPALADKDYVPKGPAYRNSYAFHRSYLEMEKL  171

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLV  645
              K+++YEEGEPP+FH      I   EG+ I+ +++ S+ RT++P++AHVFFLPFS   +V
Sbjct  172   LKVYVYEEGEPPIFHDGPCLSIYSTEGLFINDMDMESRLRTRDPDRAHVFFLPFSVVRMV  231

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
               ++ RD  +  P+++T   YIN IS KYPYWNRSLG DHFML+CHDW P  S G   LF
Sbjct  232   QHIYQRDRRDMSPLRRTVLAYINDISGKYPYWNRSLGADHFMLSCHDWGPYASGGHSHLF  291

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
              NSIRV+CNAN SEGF P  DVSLPE+ +    +D  +GGP  S R +L F+AGG HG +
Sbjct  292   LNSIRVLCNANMSEGFNPLKDVSLPEMNMRSAVVD--VGGPSASGRPILAFFAGGNHGPV  349

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R V+++ W++KD ++++HEYLPK VSY  ++RKSK+C+CPSGYEVASPR++EA+Y+ CVP
Sbjct  350   RPVLLKHWKDKDKDMQVHEYLPKGVSYVDLMRKSKFCLCPSGYEVASPRIMEAIYLECVP  409

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             V I DHY  P +DVL+W  F+V + V++IPNLK IL+SI   +Y+ MQ +   V+RHF +
Sbjct  410   VTINDHYVLPLSDVLNWKAFSVQVSVEDIPNLKNILMSISPRQYIRMQRRVKIVQRHFML  469

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             N PPKR+D++HM+LHSIWLRRLN+ +H
Sbjct  470   NGPPKRFDLYHMLLHSIWLRRLNVRIH  496



>emb|CBI28482.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   455 bits (1171),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 282/387 (73%), Gaps = 10/387 (3%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDP---DYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LERVEAGLAR RA IR+  T    +  P   DYVP G IYRN  AFHRSYL MEK FK
Sbjct  251   AELERVEAGLARARALIREGTTNWSSISAPVGADYVPQGDIYRNATAFHRSYLLMEKLFK  310

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IFIY+EGEPP+FH    + I  IEG+    +E  + FRT++P++AHV+FLPFS   ++H 
Sbjct  311   IFIYKEGEPPLFHNGPCKSIYSIEGVFFSLMEGDTHFRTQDPDEAHVYFLPFSVVMIIHH  370

Query  652   VF---VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             +F   VRD +    ++    DY+  IS KY YWNRSLG DHFML+CHDW P  +   P+L
Sbjct  371   LFDPIVRDKY---VMKHVVSDYVKVISQKYRYWNRSLGADHFMLSCHDWGPRATWYVPQL  427

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             + NSIR++CNANTSE F P  D S+PEI L  G   GL GG PPS R++L F+AGG+HG 
Sbjct  428   YYNSIRLLCNANTSECFNPRKDASIPEINLIDGETIGLTGGLPPSKRTILAFFAGGLHGR  487

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR  +++ W+ KD +V+++E LP+ +SY  +++KSKYCICPSG+EVASPR+VEA+Y  CV
Sbjct  488   IRPALLQHWKEKDEQVQVYETLPEGLSYPDLMKKSKYCICPSGHEVASPRIVEAIYAECV  547

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             PVLI  HY  PF+DVLDW +F++ + V EIPNLKKILL IPQ++Y+ MQE+  QV++HF 
Sbjct  548   PVLISQHYVLPFSDVLDWGSFSIQVSVNEIPNLKKILLGIPQDRYIRMQERVKQVQQHFV  607

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             VN PPKR+DVFHM++HSIWLRRLN+ +
Sbjct  608   VNNPPKRFDVFHMIIHSIWLRRLNVAI  634



>emb|CDY11270.1| BnaA03g01060D [Brassica napus]
Length=389

 Score =   446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 207/388 (53%), Positives = 287/388 (74%), Gaps = 3/388 (1%)
 Frame = +1

Query  295   KKLTN-LERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             K++T  ++++E  L + R AI+ A  ++ + +       GP+Y N   FHRSYLEMEK+F
Sbjct  3     KRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVPI-GPMYWNAKVFHRSYLEMEKQF  61

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLPFSSYSLVH  648
             KIF+Y+EG+PP+FH    + I  +EG  I+++E  + FRT NP+KAH F+LP S   +V 
Sbjct  62    KIFVYKEGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLPLSVVKMVR  121

Query  649   FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFK  828
             +V+ RD+H++ PI++T RDYI+ +S +YPYWNRS+G DHF+L+CHDW P  S   P L +
Sbjct  122   YVYQRDSHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEASFSHPHLGQ  181

Query  829   NSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIR  1008
             NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS R +L F+AGG+HG +R
Sbjct  182   NSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFAGGVHGPVR  241

Query  1009  QVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
              V+++ WENKD ++ +H+YLPK  SY  M+R SK+C+CPSGYEVASPR+VEA+Y GCVPV
Sbjct  242   PVLLQHWENKDKDISVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEALYSGCVPV  301

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI   Y  PF+DVL+W +F+V + V++IP LK IL SI   +YL M  + ++VRRHFEVN
Sbjct  302   LINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLKVRRHFEVN  361

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
              P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  362   SPAKRFDVFHMILHSIWVRRLNVRIREV  389



>ref|XP_004289488.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/397 (53%), Positives = 279/397 (70%), Gaps = 18/397 (5%)
 Frame = +1

Query  310   LERVEAGLARVRAAIRQAQTENRIL----------------EDPDYVPHGPIYRNPHAFH  441
             L+++E  L++ R++IR+A   +  L                +DPDYVPHG IYRN  AFH
Sbjct  3     LDKLEESLSKARSSIREAAATSLALKNKINSTSKSVQLVHDQDPDYVPHGRIYRNAQAFH  62

Query  442   RSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFF  618
             RSYL MEK FKI++YEEGE P+FH    + I   EG  IH++E  K +RTK+P++A V+F
Sbjct  63    RSYLLMEKLFKIYVYEEGEVPLFHAGPCKSIYSSEGRFIHEMEKGKLYRTKDPDEADVYF  122

Query  619   LPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
             +P S  +LV +++V    +  PI++   DYI  I+ ++P+WNRSLG DHFML+CHDW P 
Sbjct  123   IPVSVTNLVEYLYVHGTPDRDPIKRAFIDYIKVIADRHPFWNRSLGADHFMLSCHDWGPV  182

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
              S   P  F NSIRV+CNANTSEGF P+ D S PEI L  G +  L GGPPPS R+VL F
Sbjct  183   TSSSVPDFFHNSIRVLCNANTSEGFNPSKDASFPEINLLTGEISSL-GGPPPSTRTVLAF  241

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG+IR +++  W+ KD +V+++E LPK VSY   ++ SK+C+CPSGYEVASPR+V
Sbjct  242   FAGRLHGHIRYLLLNEWKGKDEDVQVYEVLPKKVSYENKLKSSKFCLCPSGYEVASPRVV  301

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y  CVPVLI D Y  PF+DVL+W +F+V IPV+ I ++K IL+ I   +YL MQ   
Sbjct  302   EAIYAECVPVLISDAYVPPFSDVLNWRSFSVQIPVQNISDIKNILMGISHRQYLRMQRNV  361

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              QV+RHF VN PPKRYDVFHM++HSIWLRRLNI VHD
Sbjct  362   KQVQRHFVVNGPPKRYDVFHMIVHSIWLRRLNIRVHD  398



>ref|XP_007145275.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
 gb|ESW17269.1| hypothetical protein PHAVU_007G225300g [Phaseolus vulgaris]
Length=490

 Score =   449 bits (1156),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/385 (57%), Positives = 284/385 (74%), Gaps = 8/385 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+ +E GLA+ RAAIR+A+       D DYVP GP+Y N  AFHRSYLEMEK+FK+F 
Sbjct  108   TILDNIEIGLAQARAAIREARNGTGT-PDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFS  166

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y EGEPPVFH +  +    +EG  +H +E++  FRTK+PE+AHVFFLP   Y      + 
Sbjct  167   YGEGEPPVFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPRVGYG-----YE  221

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
               + +  P++KTA DY++ I+ +YPYWNRSLG DHF LACHD     S   P   KNSIR
Sbjct  222   GVSQDLSPVKKTATDYVSVIAARYPYWNRSLGADHFTLACHDMCRGTSLSLPTPHKNSIR  281

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNANTSEGFKPA DVS PEI L   ++   IGG   S RS+L F+AGG+HG I  V++
Sbjct  282   VLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLL  340

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + WENKD +++I +YLPK +SY+ M+RKSK+C+CPSGYE ASPR+VEA+Y GCVPV I +
Sbjct  341   KHWENKDEDIQILKYLPKGISYHEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISE  400

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             H   PF+DVL+W +F+V++ VK+IPNLK+IL+SIP ++Y+ MQ +  Q+ RHFEV+ PPK
Sbjct  401   HSVPPFSDVLNWKSFSVEVSVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPK  460

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             R+DVFHM+LHS+WLRRLN+EVH  Q
Sbjct  461   RFDVFHMILHSVWLRRLNLEVHHDQ  485



>ref|XP_007216463.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
 gb|EMJ17662.1| hypothetical protein PRUPE_ppa024503mg [Prunus persica]
Length=482

 Score =   448 bits (1153),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 210/393 (53%), Positives = 285/393 (73%), Gaps = 3/393 (1%)
 Frame = +1

Query  277   SHPDAMKKLTNLERVEAGLARVRAAIRQAQTE--NRILEDPDYVPHGPIYRNPHAFHRSY  450
             S  D  K   NLER+EAGLA  RA IR+A ++     LED DYVP G IYRN +AFHRS+
Sbjct  89    SKTDKRKGDVNLERLEAGLATARALIREATSKFNQTALEDADYVPQGDIYRNAYAFHRSH  148

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPF  627
             L ME  FKI++YEEGEPP+FH    + I  +EG+ +  +E  +KFRT +P+KAHV+FLPF
Sbjct  149   LLMESLFKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPF  208

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   ++ ++F     +   +++T  DY+  +S KYP+WNRSLG DH ML+CHDW P  + 
Sbjct  209   SVVMIIEYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATW  268

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAG  987
                +L+  +IRV+CNANTSE F P  D S PEI L  G++ GL+GG PPS R+ L F+AG
Sbjct  269   YVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLPPSERTTLAFFAG  328

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
              +HG IR ++ + W+ KD ++ ++E LP+ VSY+ M++KSKYCICPSG+EVASPR+ EA+
Sbjct  329   RMHGRIRPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAI  388

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y  CVPVLI  HY  PF+DVL+W+ F+V + V EIP+LK+IL+ IP+E+Y  MQ++  QV
Sbjct  389   YAECVPVLISQHYVLPFSDVLNWEFFSVQVSVSEIPHLKEILMGIPEEQYRRMQKRVKQV  448

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             +RHF VN PPKR+DVFHM++HSIWLRRLN+ ++
Sbjct  449   QRHFVVNSPPKRFDVFHMIIHSIWLRRLNVRIY  481



>emb|CDX80888.1| BnaC03g01420D [Brassica napus]
Length=515

 Score =   449 bits (1154),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 288/396 (73%), Gaps = 4/396 (1%)
 Frame = +1

Query  274   SSHPDAMKK--LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             ++  + MKK     ++++E  L + R AI+ A  ++ + +       GP+Y N   FHRS
Sbjct  121   TASSELMKKRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVPI-GPMYWNAKVFHRS  179

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLP  624
             YLEMEK+FKIF+Y EG+PP+FH    + I  +EG  I+++E  + FRT NP+KAH F+LP
Sbjct  180   YLEMEKQFKIFVYREGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLP  239

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
              S   +V +V+ RD+H++ PI++T RDYI+ +S +YPYWNRS+G DHF+L+CHDW P  S
Sbjct  240   LSVVKMVRYVYQRDSHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEAS  299

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L +NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS R +L F+A
Sbjct  300   FSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSVRPILAFFA  359

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG +R V+++ WENKD ++ +H+YLPK  SY  M+R SK+C+CPSGYEVASPR+VEA
Sbjct  360   GGVHGPVRPVLLQHWENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVASPRIVEA  419

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI   Y  PF+DVL+W +F+V + V++IP LK IL SI   +YL M  + ++
Sbjct  420   LYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLK  479

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             VRRHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  480   VRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  515



>ref|XP_009130782.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
Length=518

 Score =   447 bits (1151),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 288/396 (73%), Gaps = 4/396 (1%)
 Frame = +1

Query  274   SSHPDAMKK--LTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRS  447
             ++  + MKK     ++++E  L + R AI+ A  ++ + +       GP+Y N   FHRS
Sbjct  124   TASSELMKKRVTKKIDKIEFELQKARVAIKAASMDDPVDDPDYVPI-GPMYWNAKVFHRS  182

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE-ISKFRTKNPEKAHVFFLP  624
             YLEMEK+FKIF+Y+EG+PP+FH    + I  +EG  I+++E  + FRT NP+KAH F+LP
Sbjct  183   YLEMEKQFKIFVYKEGDPPLFHDGPCKSIYSMEGNFIYEMERDTHFRTNNPDKAHAFYLP  242

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
              S   +V +V+ RD+H++ PI++T RDYI+ +S +YPYWNRS+G DHF+L+CHDW P  S
Sbjct  243   LSVVKMVRYVYQRDSHDFGPIRRTVRDYIDLVSDRYPYWNRSIGADHFILSCHDWGPEAS  302

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L +NSIR +CNANTSE FKP  DVS+PEI L  G++ GL+GGP PS R +L F+A
Sbjct  303   FSHPHLGQNSIRALCNANTSERFKPRKDVSIPEINLRTGSLKGLVGGPSPSIRPILAFFA  362

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG +R V+++ WENKD ++ +H+YLPK  SY  M+R SK+C+CPSGYEVA PR+VEA
Sbjct  363   GGVHGPVRPVLLQHWENKDNDIRVHKYLPKGTSYPDMMRSSKFCLCPSGYEVAGPRIVEA  422

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI   Y  PF+DVL+W +F+V + V++IP LK IL SI   +YL M  + ++
Sbjct  423   LYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPKLKTILTSISPRQYLKMYRRVLK  482

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
             VRRHFEVN P KR+DVFHM+LHSIW+RRLN+ + ++
Sbjct  483   VRRHFEVNSPAKRFDVFHMILHSIWVRRLNVRIREV  518



>ref|XP_011085648.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum]
Length=438

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 209/397 (53%), Positives = 279/397 (70%), Gaps = 13/397 (3%)
 Frame = +1

Query  292   MKKLTN--LERVEAGLARVRAAIRQAQTENRILEDPD----------YVPHGPIYRNPHA  435
             +KKL    L++ EA LA+ R +IR       +    D          Y+P GP+YRNP A
Sbjct  39    LKKLEQDRLKKAEAVLAKARFSIRDVAQSKLVNSTSDQEHDDDDDDDYIPQGPVYRNPTA  98

Query  436   FHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHV  612
             F RSY EMEK FKI++YEEGE P+FH+   + I   EG  I++LE   F RT +P +AHV
Sbjct  99    FLRSYQEMEKVFKIYVYEEGERPIFHHGPCRSIYSTEGNFIYELERGSFYRTNDPREAHV  158

Query  613   FFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWA  792
             FFLPFS   LV +++   + +   I     DY+  IS +YP+WN SLG DHFML+CHDW 
Sbjct  159   FFLPFSVVGLVQYLYEAGSRDRKAIAGVVADYVQTISFRYPFWNSSLGADHFMLSCHDWG  218

Query  793   PTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVL  972
             P  +   PKLF NSIRV+CNANTSEGF P  DVSLPEI L  G+M GL+GG PPS R +L
Sbjct  219   PYSTKSVPKLFSNSIRVLCNANTSEGFNPLKDVSLPEINLNTGDMSGLLGGSPPSQRPIL  278

Query  973   VFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPR  1152
              F+AG +HG+IR+++++ W+ KD +V++++ LP+N+SY  M+R SK+C+CPSGYEVASPR
Sbjct  279   AFFAGRLHGHIRRILLKQWKGKDHDVQVYDELPRNISYESMLRNSKFCLCPSGYEVASPR  338

Query  1153  MVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQE  1332
             +VEA+Y  CVPVLI   Y  P +DVL W+ FAV +  ++IPN+KKIL+ IP+EKYL M +
Sbjct  339   VVEAIYAECVPVLISKGYVPPLSDVLKWEEFAVAVAEEDIPNVKKILMGIPKEKYLRMHK  398

Query  1333  KGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +  +V+RHF +N PPKR+D+FHM+LHSIWLRRLN+ +
Sbjct  399   RLREVQRHFVMNGPPKRFDLFHMILHSIWLRRLNVRI  435



>ref|XP_008227724.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=520

 Score =   447 bits (1149),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 213/390 (55%), Positives = 283/390 (73%), Gaps = 5/390 (1%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             ++LE++EA L R R++IR+A   + +    +DPDYVP GPIYRNP+AFHRSYLEMEK FK
Sbjct  132   SHLEKLEASLGRARSSIREAAKVRNKTSTHQDPDYVPRGPIYRNPNAFHRSYLEMEKLFK  191

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEG+ P+FH      +   EG  IH++E  K +RT +P +A V+FLPFS   +V F
Sbjct  192   IYVYEEGQVPIFHDGPCFHMYLTEGRFIHEMENGKLYRTTDPNQALVYFLPFSVVRMVQF  251

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +++ D ++   ++    DYIN I+ K+P+WNRSLG DHFML+CHDW P  +   P LF  
Sbjct  252   LYLPDTYDRNGLKLAVIDYINLIAHKHPFWNRSLGADHFMLSCHDWGPFTTAFVPHLFHK  311

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNANTSEGF P+ D SLPEI L    +  L GG PPS RS L F+AGG+HG+IR 
Sbjct  312   SIRVLCNANTSEGFNPSKDASLPEIKLLTPEIPRL-GGQPPSKRSTLAFFAGGLHGHIRY  370

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             +++  W+ KD +V ++E +P  VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  CVPVL
Sbjct  371   LLLNEWKGKDQDVLVYEKVPHGVSYEEMMKSSKFCLCPSGYEVASPRVVEAIYAECVPVL  430

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I D Y  PF+DVLDW +F+V +PVK I ++K IL+SI   +YL MQ +  QV+RHF +N 
Sbjct  431   ISDGYIPPFSDVLDWKSFSVQVPVKNISDMKNILMSISNRQYLRMQRRLKQVQRHFLMNG  490

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEVHDIQET  1461
             PPKRYDVFHM++HSIWLRRLNI + D+  T
Sbjct  491   PPKRYDVFHMIVHSIWLRRLNIRIQDLLST  520



>ref|XP_004955715.1| PREDICTED: probable glycosyltransferase At5g03795-like [Setaria 
italica]
Length=567

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 210/390 (54%), Positives = 281/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++   LER+E GLA+ R+AI +     +NR  L D DYVP GPIYRN +AFH+SYLEMEK
Sbjct  174   RRDVKLERLELGLAKARSAIMEGIRNKDNRPPLADKDYVPMGPIYRNAYAFHKSYLEMEK  233

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FK+++YEEGEPPVFH    + I   EG  I+ +E+ S+ RT++P+ AH FFLPFS   +
Sbjct  234   LFKVYVYEEGEPPVFHDGPCRSIYSTEGRFIYSMEMESRLRTRDPDLAHAFFLPFSVVKM  293

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V  ++  ++H+  P+++T  DYI  +STKYPYWNRSLG DHFML+CHDW P +S     L
Sbjct  294   VKMIYEPNSHDMGPLKRTVSDYIGVLSTKYPYWNRSLGADHFMLSCHDWGPYVSSANGHL  353

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNANTSEGF P+ DVSLPEI L    +D  +GGP  S R +L F+AGG HG 
Sbjct  354   FGNSIRVLCNANTSEGFNPSKDVSLPEINLRSDVVDRQVGGPSASRRPILAFFAGGNHGP  413

Query  1003  IRQVMMETWENK-DPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +R  ++  W+ K DP+V++ EYLP+ VSY  M+R+S++C+CP GYEVASPR+ EA+Y+ C
Sbjct  414   VRPALLAHWKGKGDPDVQVSEYLPRGVSYTDMMRRSRFCLCPGGYEVASPRLAEAIYLEC  473

Query  1180  VPVLIKD-HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             VPV+I D  YA PFADVL+WD FAV +P  +IP L+++L ++   +Y+ MQ +   VRRH
Sbjct  474   VPVVIDDGEYALPFADVLNWDAFAVRLPTADIPRLREVLSAVSPRQYIRMQRRVRAVRRH  533

Query  1357  FEV-NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             F V    P+RYD FHM+LHS+WLRRLN+ +
Sbjct  534   FMVHGGAPRRYDAFHMILHSVWLRRLNVRI  563



>ref|XP_008229804.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=482

 Score =   444 bits (1142),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/392 (53%), Positives = 283/392 (72%), Gaps = 3/392 (1%)
 Frame = +1

Query  277   SHPDAMKKLTNLERVEAGLARVRAAIRQAQTE--NRILEDPDYVPHGPIYRNPHAFHRSY  450
             S  D  K   NLE++EAGLA  RA IR+A ++  +  LED DYVP G IYRN +AFHRS+
Sbjct  89    SKTDKQKGDVNLEKLEAGLATARALIREATSKFNHTALEDADYVPQGDIYRNAYAFHRSH  148

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPF  627
             L ME  FKI++YEEGEPP+FH    + I  +EG+ +  +E  +KFRT +P+KAHV+FLPF
Sbjct  149   LLMESLFKIYVYEEGEPPIFHNGPCKNIYSMEGLFLSFMETDTKFRTLDPDKAHVYFLPF  208

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   ++ ++F     +   +++T  DY+  +S KYP+WNRSLG DH ML+CHDW P  + 
Sbjct  209   SVVMIIEYLFHPIIRDKAVLERTVVDYVRVVSNKYPFWNRSLGADHVMLSCHDWGPRATW  268

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAG  987
                +L+  +IRV+CNANTSE F P  D S PEI L  G++ GL+GG  PS R+ L F+AG
Sbjct  269   YVKQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGDITGLVGGLSPSERTTLAFFAG  328

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
              +HG IR ++ + W+ KD ++ ++E LP+ VSY+ M++KSKYCICPSG+EVASPR+ EA+
Sbjct  329   RMHGRIRPLLFQHWKEKDKDLLVYETLPEGVSYHDMLKKSKYCICPSGHEVASPRIAEAI  388

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y  CVPVLI  HY  PF+DVL+W++F+V + V EIP LK+IL+ IP+E+Y  MQ++  QV
Sbjct  389   YAECVPVLISQHYVLPFSDVLNWESFSVQVSVTEIPQLKEILMGIPEEQYRRMQKRVKQV  448

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +RHF VN  PKR+DVFHM++HSIWLRRLN+ +
Sbjct  449   QRHFVVNSSPKRFDVFHMIIHSIWLRRLNVRI  480



>ref|XP_009759830.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=483

 Score =   442 bits (1138),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 209/389 (54%), Positives = 276/389 (71%), Gaps = 5/389 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA----QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             KK  N+E++EAGL+  RA IR+      T     ED DYVP G IYRNPHAFHRSYL ME
Sbjct  94    KKDENMEKIEAGLSSARALIRETLLINGTNESPYEDADYVPQGNIYRNPHAFHRSYLLME  153

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K FKIF+Y+EGEPP+FHY   + I  +EG+ I+ +E +  F+T NP+KAHV+FLPFS   
Sbjct  154   KLFKIFVYKEGEPPLFHYGPCKNIYSMEGMFINLMEANNHFQTLNPDKAHVYFLPFSVVM  213

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             ++  +F     +   +++  RDY+  +STKYPYWNRSLG DHFML+ HDW P  +    +
Sbjct  214   ILEHLFDPIIRDKAVLERILRDYVRTVSTKYPYWNRSLGADHFMLSSHDWGPRATWYVHQ  273

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             ++  SIRV+CNANTSE F P  DV LPEI L  GN++GL+   P SN+++L F+AG  HG
Sbjct  274   MYFTSIRVLCNANTSEFFNPRKDVPLPEINLLTGNINGLVEALPKSNKTILGFFAGRSHG  333

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR ++   WE KD ++ ++  +P  +SY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  334   RIRPILFRHWEEKDEDIRVYSKIPPELSYDEMMKSSKFCLCPSGYEVASPRIVEAIYANC  393

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI  +Y  PF+DVLDWD F++ + V E+PNLK ILL I +E+Y  M E   QV+RHF
Sbjct  394   VPVLISQNYVLPFSDVLDWDKFSIQVSVSELPNLKNILLGISEERYEKMVEGVRQVQRHF  453

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
              +N PPKRYDVFHM++HSIWLRRLN+ +H
Sbjct  454   VINDPPKRYDVFHMIIHSIWLRRLNVRIH  482



>gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas]
Length=742

 Score =   451 bits (1161),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 214/387 (55%), Positives = 281/387 (73%), Gaps = 4/387 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             + +K+ + LE++EA LARVR +IR+A   +    + +D DYVP GPIYRN +AFHRSYLE
Sbjct  332   EVVKRYSKLEKMEANLARVRVSIREAARIRNLTSLHQDEDYVPQGPIYRNANAFHRSYLE  391

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSS  633
             MEK FKI++YEEGE P+FH    + I   EG  IH+LE  K +RT++PE+A V+FLPFS 
Sbjct  392   MEKLFKIYVYEEGETPLFHDGPCKSIYSSEGTFIHELEKGKSYRTRDPEEALVYFLPFSV  451

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V +++V ++HE   I +   DYIN IS KYP+WNRSLG DHFML+CHDW P  S   
Sbjct  452   VMMVEYLYVPNSHEIEAIGRVVVDYINVISNKYPFWNRSLGADHFMLSCHDWGPRTSSYV  511

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +LFKNSIRV+CNANTSEGF P+ D S PEI+L  G + GLIGG  PS RS+L F+AG +
Sbjct  512   SQLFKNSIRVLCNANTSEGFNPSKDASFPEIHLKTGEITGLIGGSSPSRRSILAFFAGRL  571

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR++++E W+NKD +V++ E LPKNVSY  M++KS++C+CPSGYEVASPR+VEA+Y 
Sbjct  572   HGDIRRLLLEKWKNKDKDVQVFEQLPKNVSYESMLKKSRFCLCPSGYEVASPRVVEAIYS  631

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI D Y  PF+DVL+W  F+V + VK+IP +K+IL+ I Q +YL MQ +  QV+R
Sbjct  632   ECVPVLISDSYVPPFSDVLNWKAFSVQVEVKDIPKIKEILMGISQRQYLRMQRRVKQVQR  691

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             HF VN PPKR +       +  L R N
Sbjct  692   HFVVNGPPKRTNQLTADRSTTELLRNN  718


 Score =   209 bits (533),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 145/230 (63%), Gaps = 2/230 (1%)
 Frame = +1

Query  301  LTNLERVEAGLARVRAAIRQAQTENRILEDPDYV-PHGPIYRNPHAFHRSYLEMEKRFKI  477
            L  +E++EA L+  RA IR+A  ++      D     G IYRN  AFHRSY+ MEK FKI
Sbjct  9    LKRVEKLEATLSIARALIREAALDHNCKSSRDGDGDDGNIYRNFCAFHRSYMLMEKLFKI  68

Query  478  FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFV  654
            F+YEEGEPP+FHY   + I   EG+ +  +E  +KFRT NP +A  +FLPFS   ++  +
Sbjct  69   FVYEEGEPPLFHYGPCKNIYSTEGLFLSLMETNTKFRTFNPHEAVAYFLPFSVVMIIEHL  128

Query  655  FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
            F     +   +++T  DY+  IS  +P+WN S G DHFML+CHDW P  +    +L+ NS
Sbjct  129  FHPVIRDKAVLERTIVDYVRIISHNHPFWNTSHGADHFMLSCHDWGPRATWYERQLYFNS  188

Query  835  IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
            IRV+CNANTSE F P  D SLP I L  G   GL+GG  PSNR++L F+A
Sbjct  189  IRVLCNANTSEYFNPKKDASLPAINLITGETTGLVGGLSPSNRTILAFFA  238



>gb|AGV54221.1| glycosyltransferase [Phaseolus vulgaris]
Length=490

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 282/385 (73%), Gaps = 8/385 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+ +E GLA+ RAAIR+A+       D DYVP GP+Y N  AFHRSYLEMEK+FK+F 
Sbjct  108   TILDNIEIGLAQARAAIREARNGTGT-PDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFS  166

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y EGEPP FH +  +    +EG  +H +E++  FRTK+PE+AHVFFLP   Y     V+ 
Sbjct  167   YGEGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPKGGY-----VYE  221

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
               + ++ P++KTA DY++ I+ +YPY NR+L   HF LACHD     S   P   KNSIR
Sbjct  222   GISQDFGPVKKTATDYVSAIAARYPYGNRNLEAKHFTLACHDMCRGTSLSLPTPHKNSIR  281

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNANTSEGFKPA DVS PEI L   ++   IGG   S RS+L F+AGG+HG I  V++
Sbjct  282   VLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSASKRSILTFFAGGVHGPIAPVLL  340

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + WENKD +++I +YLPK +SYY M+RKSK+C+CPSGYE ASPR+VEA+Y GCVPV I +
Sbjct  341   KHWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFISE  400

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             H   PF+DVL+W +F+V+I VK+IPNLK+IL+SIP ++Y+ MQ +  Q+ RHFEV+ PPK
Sbjct  401   HSVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPK  460

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             R+DVFHM+LHS+WLRRLN+EVH  Q
Sbjct  461   RFDVFHMILHSVWLRRLNLEVHHDQ  485



>ref|XP_008342266.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=476

 Score =   441 bits (1133),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 279/390 (72%), Gaps = 4/390 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             D  K   NL+++EAGLA  RA I +A         L+D DY+P G IYRN +AFHRSYL 
Sbjct  87    DWQKGDENLKKLEAGLAAARALIGEAIKNLNHTTPLKDADYIPKGDIYRNAYAFHRSYLL  146

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK FKI++YEEGE P+FH    + I  +EG+ +  +E  +KFRT+ PE AHV+FLPFS 
Sbjct  147   MEKMFKIYVYEEGELPIFHNGPCKNIYSMEGLFLSFMETDTKFRTREPENAHVYFLPFSV  206

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V ++F     +   +++T  DY+  IS +YPYWNRSLG DH ML+CHDW P  +   
Sbjct  207   VMIVEYLFHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYV  266

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +L+  +IRV+CNANTSE F P  D S PEI L  G + GLIGG  PS R++L F+AG +
Sbjct  267   KQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRM  326

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR  + E W+ KD ++ ++E LP+ +SY+ M++KSKYCICPSG+EVASPR+VEA+Y 
Sbjct  327   HGRIRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYA  386

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI  HY  PF+DVL+WD+F+V + V EIP LK+IL+ IP+E+Y  MQE+  QV+R
Sbjct  387   DCVPVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMGIPEEQYRRMQERVKQVQR  446

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF VN PPKRYDVFHM++HSIWLRRLN+++
Sbjct  447   HFVVNNPPKRYDVFHMIIHSIWLRRLNVQI  476



>ref|XP_002524592.1| catalytic, putative [Ricinus communis]
 gb|EEF37800.1| catalytic, putative [Ricinus communis]
Length=388

 Score =   436 bits (1121),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 279/386 (72%), Gaps = 5/386 (1%)
 Frame = +1

Query  301   LTNLERVEAGLARVRAAIRQA----QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             +  LER+EAGLA  RA I++A    Q    + +D DYVPHG IYRN  AFHRSYL MEK 
Sbjct  1     MEKLERLEAGLAMARALIKEASSLDQNYTSLHKDIDYVPHGDIYRNSCAFHRSYLLMEKL  60

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLV  645
             FKIF+YEEGEPP+ HY   + I  +EG+ +  +E  +KFRT NP++A VFFLPFS   ++
Sbjct  61    FKIFVYEEGEPPLLHYGPCKNIYSMEGLFLSLMETDTKFRTLNPDEAQVFFLPFSVVMII  120

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
               +F     +   +++T  DY+  IS KY YWNRSLG DHFML+CHDW P  +    +L+
Sbjct  121   EHLFHPIIRDKAVLERTVVDYVRIISHKYTYWNRSLGADHFMLSCHDWGPRATWYERQLY  180

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
              NSIRV+CNANTSE F P  D S PEI L  G +  L GG PPSNR++L F++G +HG +
Sbjct  181   FNSIRVLCNANTSEYFNPKKDASFPEINLITGEIADLTGGLPPSNRTILAFFSGKMHGKL  240

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R ++ + W+ KD +V ++E  P+ +SY  M++KS+YCICPSG+EVASPR+VEA+Y  CVP
Sbjct  241   RPLLFQHWKEKDKDVLVYETFPEGLSYQEMMKKSRYCICPSGHEVASPRIVEAIYAECVP  300

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI  +Y  PF+DVL+W++F++ + V +I NLK ILL IP+++YL M+E+  QV++HF +
Sbjct  301   VLISQNYVFPFSDVLNWESFSIQVSVSDISNLKNILLGIPEDQYLRMRERVKQVQQHFLI  360

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             N PPKRYDVFHM++HSIWLRRLN+++
Sbjct  361   NNPPKRYDVFHMIIHSIWLRRLNVKL  386



>ref|NP_001059081.1| Os07g0188700 [Oryza sativa Japonica Group]
 dbj|BAC83913.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAD31848.1| putative pectin-glucuronyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF20995.1| Os07g0188700 [Oryza sativa Japonica Group]
 gb|EAZ38963.1| hypothetical protein OsJ_23384 [Oryza sativa Japonica Group]
 dbj|BAG93622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 288/391 (74%), Gaps = 8/391 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++   LE +E GLA+ RA IR+A    +N+  L D DYVP GP+YRN +AFHRSYLEMEK
Sbjct  211   RRDVKLELLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEMEK  270

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FK+F+YEEGEPPVFH    + I   EG  I+ +E+ ++ RT++P++AHVFFLPFS   +
Sbjct  271   VFKVFVYEEGEPPVFHDGPCRSIYSTEGRFIYAMEMENRMRTRDPDQAHVFFLPFSVVKM  330

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V  ++  ++H+  P+++T  DYIN +STKYP+WNRSLG DHFML+CHDW P +S     L
Sbjct  331   VKMIYEPNSHDMDPLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSANGHL  390

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNANTSEGF P+ DVSLPEI L    +D  +GGP  S+R +L F+AGG HG 
Sbjct  391   FSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVVDRQVGGPSASHRPILAFFAGGDHGP  450

Query  1003  IRQVMMETW-ENKDPEVEIHEYLPK--NVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             +R ++++ W + +D ++++ EYLP+   +SY  M+R+S++C+CPSGYEVASPR+VEA+Y+
Sbjct  451   VRPLLLQHWGKGQDADIQVSEYLPRRHGMSYTDMMRRSRFCLCPSGYEVASPRVVEAIYL  510

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPV+I D Y  PFADVL+W  F+V + V +IP LK+IL ++   +Y+ MQ +   VRR
Sbjct  511   ECVPVVIGDDYTLPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVRAVRR  570

Query  1354  HFEV-NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF V +  P+R+DVFHM+LHSIWLRRLN+ V
Sbjct  571   HFMVSDGAPRRFDVFHMILHSIWLRRLNVRV  601



>gb|AGZ15405.1| limonene cyclase-like protein [Phaseolus vulgaris]
Length=491

 Score =   439 bits (1130),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 279/385 (72%), Gaps = 8/385 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFI  483
             T L+ +E GLA+ RAAIR+A+       D DYVP GP+Y N  AFHRSYLEMEK+FK+F 
Sbjct  109   TILDNIEIGLAQARAAIREARNGTGT-PDSDYVPKGPMYWNAKAFHRSYLEMEKQFKVFS  167

Query  484   YEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             Y EGEPP FH +  +    +EG  +H +E++  FRTK+PE+AHVFFLP   Y      + 
Sbjct  168   YGEGEPPNFHNAPCKSKYSMEGNFMHAIEMNNHFRTKDPEEAHVFFLPKGGYG-----YE  222

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
             R + +  P++KTA DY+N I+ +Y YWNRSLG D F LACHD     S   P   KNS R
Sbjct  223   RVSQDLSPVKKTATDYVNVIAARYLYWNRSLGADPFTLACHDMCRGKSFSLPYPHKNSFR  282

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNANTSEGFKPA DVS PEI L   ++   IGG     RS+L F+AGG+HG I  V+ 
Sbjct  283   VLCNANTSEGFKPAKDVSFPEINLKISSIR-FIGGQSAFKRSILTFFAGGVHGPIAPVLF  341

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + WENKD +++I +YLPK +SYY M+RKSK+C+CPSGYE ASPR+VEA+Y GCVPV I +
Sbjct  342   KHWENKDEDIQILKYLPKGISYYEMMRKSKFCLCPSGYEGASPRVVEAIYTGCVPVFIFE  401

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             H   PF+DVL+W +F+V+I VK+IPNLK+IL+SIP ++Y+ MQ +  Q+ RHFEV+ PPK
Sbjct  402   HSVPPFSDVLNWKSFSVEISVKDIPNLKEILMSIPPKQYIRMQRRVEQIGRHFEVHSPPK  461

Query  1381  RYDVFHMVLHSIWLRRLNIEVHDIQ  1455
             R+DVFHM+LHS+WLRRLN+EVH  Q
Sbjct  462   RFDVFHMILHSVWLRRLNLEVHHDQ  486



>ref|XP_007213348.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
 gb|EMJ14547.1| hypothetical protein PRUPE_ppa1027150mg, partial [Prunus persica]
Length=389

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 277/391 (71%), Gaps = 21/391 (5%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             M+    L+R+EA L R R++IR+A   + +    +D DYVP GPIYRNP+AFHRSYLEME
Sbjct  14    MRSSGQLDRLEASLGRARSSIREAAKVRNKTSTHQDADYVPRGPIYRNPNAFHRSYLEME  73

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K FKI++YEEG+                G  IH++E    +RT++P KA V+FLPFS   
Sbjct  74    KLFKIYVYEEGD----------------GRFIHEMEKGNMYRTRDPNKALVYFLPFSVVR  117

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +V ++++ ++++   ++    DY+N I+ K+P+WNRSLG DHFML+CHDWAP  +   P 
Sbjct  118   MVQYLYMPNSNDRHGMKLAIIDYVNLIAQKHPFWNRSLGADHFMLSCHDWAPFTTSFVPL  177

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF  SIRV+CNANTSEGF P+ D S PEI L    M GL GG  PS RS L F+AG +HG
Sbjct  178   LFHKSIRVLCNANTSEGFNPSKDASFPEINLKTSEMSGL-GGQSPSTRSTLAFFAGRLHG  236

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IR +++  W+ KD +V++++ LP+ VSY  M++ SK+C+CPSGYEVASPR+VEA+Y  C
Sbjct  237   HIRSLLLNEWKGKDQDVQVYDQLPRGVSYEKMLKGSKFCLCPSGYEVASPRVVEAIYAEC  296

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             +PVLI D Y  PF+DVLDW +F+V +PVK I ++K IL+SI   +YL MQ +  QV+RHF
Sbjct  297   IPVLISDGYIPPFSDVLDWKSFSVQVPVKNISDIKNILMSISSRQYLRMQRRVKQVQRHF  356

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHDI  1452
              VN PPKRYDVFHM++HSIWLRRLNI + D+
Sbjct  357   LVNGPPKRYDVFHMIVHSIWLRRLNIRIQDL  387



>gb|EAZ03045.1| hypothetical protein OsI_25187 [Oryza sativa Indica Group]
Length=601

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 211/391 (54%), Positives = 287/391 (73%), Gaps = 8/391 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++   LER+E GLA+ RA IR+A    +N+  L D DYVP GP+YRN +AFHRSYLEMEK
Sbjct  206   RRDVKLERLELGLAKARATIREAIQNKDNKPPLTDKDYVPVGPVYRNAYAFHRSYLEMEK  265

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FK+F+YEEGEPPVFH      I   EG  I+ +E+ ++ RT++P +AHVFFLPFS   +
Sbjct  266   VFKVFVYEEGEPPVFHDGPCHSIYSTEGRFIYAMEMENRMRTRDPNQAHVFFLPFSVVKM  325

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V  ++  ++H+  P+++T  DYIN +STKYP+WNRSLG DHFML+CHDW P +S     L
Sbjct  326   VKMIYEPNSHDMDPLRRTISDYINVVSTKYPHWNRSLGADHFMLSCHDWGPYVSSANGHL  385

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
             F NSIRV+CNANTSEGF P+ DVSLPEI L    +   +GGP  S+R +L F+AGG HG 
Sbjct  386   FSNSIRVLCNANTSEGFDPSRDVSLPEINLRSDVVARQVGGPSASHRPILAFFAGGDHGP  445

Query  1003  IRQVMMETW-ENKDPEVEIHEYLPK--NVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             +R ++++ W + +D ++++ EYLP+  ++SY  M+R+S++C+CPSGYEVASPR+VEA+Y+
Sbjct  446   VRPLLLQHWGKGQDADIQVSEYLPRRHSMSYTDMMRRSRFCLCPSGYEVASPRVVEAIYL  505

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPV+I D YA PFADVL+W  F+V + V +IP LK+IL ++   +Y+ MQ +   VRR
Sbjct  506   ECVPVVIGDDYALPFADVLNWAAFSVRVAVGDIPRLKEILAAVSPRQYIRMQRRVRAVRR  565

Query  1354  HFEV-NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF V +  P R+DVFHM+LHSIWLRRLN+ V
Sbjct  566   HFMVSDGAPWRFDVFHMILHSIWLRRLNVRV  596



>ref|XP_003555678.1| PREDICTED: probable glycosyltransferase At3g07620-like [Glycine 
max]
Length=493

 Score =   438 bits (1126),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 277/384 (72%), Gaps = 6/384 (2%)
 Frame = +1

Query  310   LERVEAGLARVRAAIRQA---QTENRILED--PDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             LE+VEA LA+ RA I++A   +T   +L+D   DY+P G IYRN  AFHRSY  MEK FK
Sbjct  109   LEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKVFK  168

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IF+YEEGEPP+FHY   + I  +EGI I+ LEI S+FRT+NP++AHV+FLPFS   ++  
Sbjct  169   IFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMILEH  228

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +F     +   +++T  DY++ IS KY YWNRS G DHFML+CHDW P  +    +L+  
Sbjct  229   LFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVKELYFI  288

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             +IRV+CNAN SE F P  D S PEI L  G   GLIGG PP NR++L F+AG +HG IR 
Sbjct  289   AIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMHGRIRP  348

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V+ + WE KD +V ++E LP  V Y+  ++KSKYCICPSG+EVASPR+VEA+Y  CVPV+
Sbjct  349   VLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQCVPVI  408

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I   Y  PF+DVL+WD+F+V I V ++P LK+ILL I ++KY+ +QE   QV+RHF VN 
Sbjct  409   ISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRHFVVNN  468

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEV  1443
             PPKRYDVFHM++HSIWLRRLN+ V
Sbjct  469   PPKRYDVFHMIIHSIWLRRLNVRV  492



>gb|KHN15414.1| Putative glycosyltransferase [Glycine soja]
Length=493

 Score =   437 bits (1125),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 277/384 (72%), Gaps = 6/384 (2%)
 Frame = +1

Query  310   LERVEAGLARVRAAIRQA---QTENRILED--PDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
             LE+VEA LA+ RA I++A   +T   +L+D   DY+P G IYRN  AFHRSY  MEK FK
Sbjct  109   LEKVEASLAKARALIKEALLLRTNATVLQDDTSDYIPEGDIYRNAVAFHRSYQLMEKVFK  168

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             IF+YEEGEPP+FHY   + I  +EGI I+ LEI S+FRT+NP++AHV+FLPFS   ++  
Sbjct  169   IFVYEEGEPPLFHYGPCKNIYSMEGIFINSLEINSQFRTQNPDEAHVYFLPFSVVMILEH  228

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +F     +   +++T  DY++ IS KY YWNRS G DHFML+CHDW P  +    +L+  
Sbjct  229   LFHPVIRDKAVLERTIGDYVHIISHKYKYWNRSYGADHFMLSCHDWGPRATWYVKELYFI  288

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             +IRV+CNAN SE F P  D S PEI L  G   GLIGG PP NR++L F+AG +HG IR 
Sbjct  289   AIRVLCNANISEHFNPKKDASFPEINLVNGETRGLIGGYPPCNRTILAFFAGQMHGRIRP  348

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V+ + WE KD +V ++E LP  V Y+  ++KSKYCICPSG+EVASPR+VEA+Y  CVPV+
Sbjct  349   VLFQHWEGKDKDVLVYEKLPDGVPYHETMKKSKYCICPSGFEVASPRIVEAIYAQCVPVI  408

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I   Y  PF+DVL+WD+F+V I V ++P LK+ILL I ++KY+ +QE   QV+RHF VN 
Sbjct  409   ISQQYVLPFSDVLNWDSFSVQILVSDVPKLKEILLGISEDKYMRLQEGVKQVQRHFVVNN  468

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEV  1443
             PPKRYDVFHM++HSIWLRRLN+ V
Sbjct  469   PPKRYDVFHMIIHSIWLRRLNVRV  492



>ref|XP_009361503.1| PREDICTED: probable glycosyltransferase At3g07620 [Pyrus x bretschneideri]
Length=512

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/390 (54%), Positives = 280/390 (72%), Gaps = 4/390 (1%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA-QTENRI--LEDPDYVPHGPIYRNPHAFHRSYLE  456
             D  K   NL+++EAGLA  RA I +A +  N    L+D DY+P G IYRN +AFHRSYL 
Sbjct  123   DWQKGDENLKKLEAGLAAARALIGEAIKNPNHTTPLKDADYIPKGDIYRNAYAFHRSYLL  182

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK FKI++YEEGE P+FH    + I   EG+ +  +E  +KFRT+ PE AHV+FLPFS 
Sbjct  183   MEKMFKIYVYEEGELPIFHNGPCKNIYSTEGLFLSFIETDTKFRTREPENAHVYFLPFSV  242

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V ++F     +   +++T  DY+  IS +YPYWNRSLG DH ML+CHDW P  +   
Sbjct  243   VMIVEYLFHPIIRDKAVLERTVVDYVRIISNRYPYWNRSLGADHVMLSCHDWGPRATWYV  302

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +L+  +IRV+CNANTSE F P  D S PEI L  G + GLIGG  PS R++L F+AG +
Sbjct  303   KQLYFVAIRVLCNANTSEHFNPKKDASFPEINLETGEITGLIGGLHPSKRTILAFFAGRM  362

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR  + E W+ KD ++ ++E LP+ +SY+ M++KSKYCICPSG+EVASPR+VEA+Y 
Sbjct  363   HGRIRPFLFEHWKGKDRDLLVYEKLPEELSYHDMLKKSKYCICPSGHEVASPRIVEAIYA  422

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI  HY  PF+DVL+WD+F+V + V EIP LK+IL+ IP+E+Y  MQE+  QV+R
Sbjct  423   ECVPVLISQHYVLPFSDVLNWDSFSVQVSVSEIPKLKEILMEIPEEQYRRMQERVKQVQR  482

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF VN PPKR+D+FHM++HSIWLRRLN+++
Sbjct  483   HFVVNNPPKRFDIFHMIIHSIWLRRLNVQI  512



>emb|CDP15733.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   435 bits (1118),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 274/389 (70%), Gaps = 21/389 (5%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             K+   LER+E  L++ R +IR+A     ++   ED DY PHGP+Y N + FHRS+LEMEK
Sbjct  121   KRYNKLERLETILSKARYSIREAAKNGSMISTHEDADYAPHGPMYINANGFHRSHLEMEK  180

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKF-RTKNPEKAHVFFLPFSSYSL  642
              FK+++YEEGEPP+FH    + I   EG  IH++E   F RTKNP+ A V+FLPFS  ++
Sbjct  181   SFKVYVYEEGEPPMFHDGPCKSIYSTEGRFIHEMEKGNFYRTKNPDDALVYFLPFSVVAM  240

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
             V +++    H+   I  T  DYI  IS K+P+WN+S G DHFML+CHDW           
Sbjct  241   VQYLYEPGGHDRQAIGHTLADYIGLISGKHPFWNQSFGADHFMLSCHDW-----------  289

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGY  1002
                   ++CNANTSEGF P  DVSLPEI+L  G + GLIGGP PS R +L F+AG +HG+
Sbjct  290   ------ILCNANTSEGFNPLKDVSLPEIHLRTGEITGLIGGPSPSRRPILAFFAGRLHGH  343

Query  1003  IRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCV  1182
             IR +++E W+ KD ++++++ LP  VSY  M+RKSK+C+CPSGYEVASPR+VEA+Y  C+
Sbjct  344   IRYLLLEQWKEKDQDIQVYDNLPAGVSYESMLRKSKFCLCPSGYEVASPRVVEAIYAECI  403

Query  1183  PVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFE  1362
             P+LI D Y  PF+DVL+W +F+V++ VK+IPN+KKIL SI Q +Y+ M  +  QV+RHF 
Sbjct  404   PILISDSYVPPFSDVLNWKSFSVEVAVKDIPNIKKILTSISQTQYIRMHRRLKQVQRHFV  463

Query  1363  VNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             +N PPKR+D+FHM+LHSIWLRRLNI   D
Sbjct  464   INGPPKRFDLFHMILHSIWLRRLNIGYKD  492



>ref|XP_010933454.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=524

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 290/395 (73%), Gaps = 5/395 (1%)
 Frame = +1

Query  271   PSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTE-NRI-LEDPDYVPHGPIYRNPHAFHR  444
             P++   A  K T LER+E GLAR RAAIR+A    NR  L D DYVP GP+YRN +AFH+
Sbjct  129   PNNTRRARIKDTKLERLEFGLARARAAIREAARNPNRTALVDKDYVPIGPVYRNAYAFHK  188

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFL  621
             SYLEMEK FK+F+YEEGEPP+FH    + I   EG  I+ +++ S+ RT++P++AHVFFL
Sbjct  189   SYLEMEKLFKVFVYEEGEPPIFHDGPCRSIYSTEGFFINNMDMESRLRTRDPDRAHVFFL  248

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   +V +++ RD H+  P++KT  DYIN IS KYP+WNRSLG DHFML+CHDW P  
Sbjct  249   PFSVVRMVQYIYPRDHHDMRPLRKTVLDYINLISGKYPFWNRSLGADHFMLSCHDWGPYA  308

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S G   LF NSIRV+CNANTSE F  + DVSLPE+ +    +   +GGP  S R +L F+
Sbjct  309   SGGHHHLFVNSIRVLCNANTSEWFNASRDVSLPEMNVRSDVIK--VGGPSASGRPILAFF  366

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG HG +R V+++ W+ KD +V++HEYLPK VSY  +++KSK+C+CPSGYEVASPR++E
Sbjct  367   AGGNHGPVRPVLLKHWKGKDNDVQVHEYLPKGVSYVDLMKKSKFCLCPSGYEVASPRIME  426

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+Y  CVPV I  +Y  P +DVL+W  F+V + V++IP LK IL+SI   +Y+ MQ +  
Sbjct  427   AIYYECVPVTINANYVLPLSDVLNWKAFSVQVSVEDIPKLKNILMSISPRQYIRMQRRVK  486

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
              V+RHF +N PP+R+D++HM+LHSIWLRRLNI +H
Sbjct  487   TVQRHFMMNGPPQRFDLYHMLLHSIWLRRLNIRIH  521



>ref|XP_004502077.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cicer 
arietinum]
Length=465

 Score =   432 bits (1111),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 214/390 (55%), Positives = 279/390 (72%), Gaps = 5/390 (1%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQAQ---TENRILEDP-DYVPHGPIYRNPHAFHRSYLE  456
             +M+   NLE+VEA LA+ RA+I+QA     +   LED  DY+P G IYRN  AFHRSY  
Sbjct  75    SMQGGRNLEKVEASLAKARASIKQALLRINDTLPLEDSHDYIPQGDIYRNAFAFHRSYYL  134

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK FKIF+YEEGEPP+FHY   + I  +EGI I+ LE  ++FRT+NP++AHV+FLPFS 
Sbjct  135   MEKLFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLESNTQFRTQNPDEAHVYFLPFSV  194

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               ++  +F     +   + +T  DY++ IS KY YWNRS G DHFML+CHDW P  +   
Sbjct  195   VMILEHLFHPVIRDKAVLGRTIGDYVHIISHKYTYWNRSYGADHFMLSCHDWGPRATWYV  254

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +L+  +IRV+CNAN SE F P  D S PEI L  G   GLIGG P  NR++L F+AG +
Sbjct  255   KELYFIAIRVLCNANISEHFNPKKDASFPEINLVTGETTGLIGGYPQWNRTILAFFAGQM  314

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR ++ + W+NKD ++ ++E LP+NVSY+  ++ SKYCICPSGYEVASPR+VEA+Y 
Sbjct  315   HGRIRPMLFQHWKNKDKDMLVYEKLPENVSYHETMKMSKYCICPSGYEVASPRIVEAIYA  374

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPV+I  +Y  PF+DVLDWD F+V I V EIP LK+ILL I +EKY+ + E   +V+R
Sbjct  375   ECVPVIISQNYVLPFSDVLDWDCFSVQIQVSEIPKLKEILLGISEEKYVRLYEGVKKVQR  434

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF +N PPKRYDVFHM++HSIWLRRLN+ V
Sbjct  435   HFVMNNPPKRYDVFHMIVHSIWLRRLNVIV  464



>gb|KEH35171.1| exostosin family protein [Medicago truncatula]
Length=447

 Score =   430 bits (1105),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/393 (54%), Positives = 276/393 (70%), Gaps = 8/393 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA--QTENRILEDP-----DYVPHGPIYRNPHAFHRS  447
             +M++  NLE+VE  LA+ RA I+QA  +T + +L  P     D+VP G IYRN  AFHRS
Sbjct  54    SMQEDRNLEKVEGSLAKARALIKQALLRTNDTVLALPLEDSHDFVPQGDIYRNAFAFHRS  113

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLP  624
             Y  MEK FKIF+YEEGEPP+FHY   + I  +EGI I+ LE +  FRT+NP +AH +FLP
Sbjct  114   YHLMEKLFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTRNPNEAHAYFLP  173

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS   ++  +F     +   + +T  DY++ IS KY YWNRS G DHFML+CHDW P  +
Sbjct  174   FSVVMILEHLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRAT  233

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                 +L+  +IRV+CNAN SE F P  D S PEI L  G   GL+GG P  NR++L F+A
Sbjct  234   WYVKELYFIAIRVLCNANISEHFNPKKDASFPEINLVTGETAGLLGGYPTWNRTILAFFA  293

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             G +HG IR V+ + W+NKD +V ++E LP+ +SY+  ++ SKYCICPSG+EVASPR+VEA
Sbjct  294   GKMHGKIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEA  353

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y  CVP++I   Y  PF+DVLDWD+F+V I V EIP LK ILL I +EKY+ +QE   Q
Sbjct  354   IYAECVPIIISQQYVLPFSDVLDWDSFSVKIEVSEIPKLKDILLGISEEKYMKLQEGVKQ  413

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             V+RHF VN PPKRYDVFHM++HSIWLRRLN+ V
Sbjct  414   VQRHFVVNNPPKRYDVFHMIIHSIWLRRLNVVV  446



>ref|XP_004288781.1| PREDICTED: probable glycosyltransferase At5g20260-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 206/389 (53%), Positives = 287/389 (74%), Gaps = 10/389 (3%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA-QTENRILE-DPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             T+LER+E  LA+ RA+I +A Q++N   E +  ++P G IY+NP+AFH+S+LEM KRFK+
Sbjct  93    TSLERIEEDLAKARASILEAIQSKNYSSEKEESFIPRGSIYKNPYAFHQSHLEMMKRFKM  152

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             + YEEGE P+ H+     I GIEG  I ++E   S FR  +P++AH+FFLPFS  ++V +
Sbjct  153   WSYEEGEQPLVHFGPMNNIYGIEGHFIDEIEREGSPFRATHPDEAHMFFLPFSVANIVQY  212

Query  652   VFV-----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
             V++     +D H    +Q+ A DYI  ++ KYPYWNRS G DHFM +CHDWAP IS G P
Sbjct  213   VYLPITKKQDYHR-DRLQQIAMDYIGVVAHKYPYWNRSKGADHFMASCHDWAPEISVGKP  271

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
             +LF+N IRV+CNANTSEGF+P  DV LPEI++P G +     G  P+NR +L F+AG +H
Sbjct  272   ELFRNFIRVLCNANTSEGFQPKRDVPLPEIFVPTGKLGPPNLGQAPNNRQILAFFAGRVH  331

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             G IR +++E W++KD EV +HE LPK ++Y  ++ +SK+C+CPSG+EVASPR+VEA+Y G
Sbjct  332   GPIRPILLEHWKDKDNEVRVHEKLPKGMNYTKLMGQSKFCLCPSGFEVASPRVVEALYAG  391

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPVLI D+Y+ PF+DVLDW  F++ +PV +IP +K IL +IP E+YL MQ + ++V+RH
Sbjct  392   CVPVLISDNYSLPFSDVLDWSQFSIQVPVAKIPEIKTILQAIPNEEYLKMQRRVLKVQRH  451

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             F +N P K +DV HMVLHS+WLRRLN ++
Sbjct  452   FVLNKPAKPFDVIHMVLHSVWLRRLNFKI  480



>emb|CDP15735.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   428 bits (1100),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 277/384 (72%), Gaps = 4/384 (1%)
 Frame = +1

Query  307   NLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
              +E++EA LAR RA IR+A    ++   L + DY+P G IYR+P  FHRSY  ME  F+I
Sbjct  27    KMEKIEASLARARALIREAIVNGSQQLPLHEADYIPQGEIYRSPSVFHRSYQLMESLFRI  86

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             F+YE+GEPP+FHY   + I  +EGI +  +E  ++FRT NP++AHV+FLPFS   ++  +
Sbjct  87    FVYEDGEPPLFHYGPCRDIYSLEGIFLGLIEKNTRFRTYNPDEAHVYFLPFSVVKILEHL  146

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F   + +   +++   DY+  +STKYPYWNRSLG DH ML+CHDW P  +    +L+  S
Sbjct  147   FDPISRDKAVLERVIGDYVRIVSTKYPYWNRSLGADHLMLSCHDWGPRATWYVHQLYFTS  206

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IR +CNANTSE F P  DVS PEI L  G++  + GG  PSNR++L F+AGG HG IR  
Sbjct  207   IRALCNANTSEFFNPRKDVSFPEINLQTGDIAIVTGGLSPSNRTILAFFAGGYHGRIRPA  266

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             + + W+NKD +++++E LP N+SY+ M++KSKYC+CPSG+EVASPR+VEA+Y  CVPVLI
Sbjct  267   LFQHWKNKDSDIQVYEKLPGNLSYHEMMKKSKYCLCPSGHEVASPRIVEAIYAECVPVLI  326

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
                Y  PF+DVLDW++F++ + V E+PNLKKIL+ I + K+  + E   QV+RHF +N P
Sbjct  327   SQDYILPFSDVLDWNSFSIQVSVSELPNLKKILMGISEGKHRKLHEAVKQVQRHFMINDP  386

Query  1375  PKRYDVFHMVLHSIWLRRLNIEVH  1446
             PK+YDVFHM++HSIWLRRLN++++
Sbjct  387   PKKYDVFHMIIHSIWLRRLNVKIY  410



>ref|XP_008337560.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=390

 Score =   427 bits (1098),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 266/363 (73%), Gaps = 4/363 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRIL---EDPDYVPHGPIYRNPHAFHRSYLEME  462
             +K+ + LE++EA LA VR +IR+A     +    EDPDYVPHGPIYRN +AFHRSYLEME
Sbjct  24    IKRYSRLEKLEANLAGVRXSIREAARVRNLTSTHEDPDYVPHGPIYRNANAFHRSYLEME  83

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYS  639
             K FKIF+Y EGEPP+FH    + I   EG  IH++E+   +RT++P++A V+FLPFS   
Sbjct  84    KHFKIFVYGEGEPPIFHNGPCKSIYSTEGRSIHEMEMENVYRTRDPDEALVYFLPFSVVM  143

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             LV +++V D+H+  PI +   DY+N IS K+P+WNRSLG DHFM +CH W P+ S   P 
Sbjct  144   LVQYLYVADSHDTZPIGRAVIDYVNVISDKHPFWNRSLGADHFMJSCHHWGPSTSAYVPN  203

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             L+ NSIRV+CNANTSEGF P+ DVS PEI+L  G  +GL+GG  PS RS+L F+AG + G
Sbjct  204   LYHNSIRVLCNANTSEGFNPSKDVSFPEIHLRTGETEGLLGGLSPSXRSILAFFAGRLSG  263

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             +IR +++  W+ KD +V++++  P  VSY  M++K+++C+CPSGYEVASPR+VEA+Y  C
Sbjct  264   HIRYLLLNEWKEKDQDVQVYDQFPNGVSYESMLKKNRFCLCPSGYEVASPRVVEAIYAEC  323

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI D Y  PF+DVL+W +F+V + VK+IPN+K+IL  I Q +YL MQ    QV+RHF
Sbjct  324   VPVLISDSYVPPFSDVLEWKSFSVQVKVKDIPNIKRILKGISQSQYLRMQRXVKQVQRHF  383

Query  1360  EVN  1368
              VN
Sbjct  384   VVN  386



>gb|AES71688.2| exostosin family protein [Medicago truncatula]
Length=445

 Score =   428 bits (1101),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 278/391 (71%), Gaps = 6/391 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA--QTENRI--LEDP-DYVPHGPIYRNPHAFHRSYL  453
             +M+   NLE+VE  LA+ RA I+QA  +T + +  LED  DYVP G IYRN  AFHRSY 
Sbjct  54    SMQGDKNLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQ  113

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFS  630
              MEK FKIF+YEEGEPP+FHY   + I  +EGI I+ LE +  FRT+NP +AHV+FLPFS
Sbjct  114   LMEKLFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFS  173

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                ++  +F     +   + +T  DY++ IS KY YWNRS G DHFML+CHDW P  +  
Sbjct  174   VVMILEHLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWY  233

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
               +L+  +IRV+CNAN SE F P  D S PEI L  G   GL+GG P  NR++L F+AG 
Sbjct  234   VKELYFIAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQ  293

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             ++G IR V+ + W+NKD +V ++E LP+ +SY+  ++ SKYCICPSG+EVASPR+VEA+Y
Sbjct  294   MNGRIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIY  353

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
               CVP+LI   Y  PF+DVL+WD+F+V I V EIP LK+ILL I +EKY+ +QE   QV+
Sbjct  354   AECVPILISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQ  413

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             RHF VN PPK+YDVFHM++HSIWLRRLN+ V
Sbjct  414   RHFVVNNPPKKYDVFHMIIHSIWLRRLNVLV  444



>ref|XP_003601437.1| hypothetical protein MTR_3g080690 [Medicago truncatula]
Length=450

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 278/391 (71%), Gaps = 6/391 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA--QTENRI--LEDP-DYVPHGPIYRNPHAFHRSYL  453
             +M+   NLE+VE  LA+ RA I+QA  +T + +  LED  DYVP G IYRN  AFHRSY 
Sbjct  59    SMQGDKNLEKVEGSLAKARALIKQALLRTNDTVVPLEDSHDYVPQGHIYRNAFAFHRSYQ  118

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFS  630
              MEK FKIF+YEEGEPP+FHY   + I  +EGI I+ LE +  FRT+NP +AHV+FLPFS
Sbjct  119   LMEKLFKIFVYEEGEPPLFHYGPCKNIYSMEGIFINLLENNTLFRTQNPNEAHVYFLPFS  178

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                ++  +F     +   + +T  DY++ IS KY YWNRS G DHFML+CHDW P  +  
Sbjct  179   VVMILEHLFHPVIRDKAVLGRTIGDYVHIISHKYAYWNRSYGADHFMLSCHDWGPRATWY  238

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
               +L+  +IRV+CNAN SE F P  D S PEI L  G   GL+GG P  NR++L F+AG 
Sbjct  239   VKELYFIAIRVLCNANISEHFNPKKDASFPEINLVSGETTGLLGGYPTWNRTILAFFAGQ  298

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             ++G IR V+ + W+NKD +V ++E LP+ +SY+  ++ SKYCICPSG+EVASPR+VEA+Y
Sbjct  299   MNGRIRPVLFQHWKNKDKDVLVYEKLPEKISYHETMKMSKYCICPSGWEVASPRIVEAIY  358

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
               CVP+LI   Y  PF+DVL+WD+F+V I V EIP LK+ILL I +EKY+ +QE   QV+
Sbjct  359   AECVPILISQQYVLPFSDVLNWDSFSVQIEVSEIPKLKEILLGISEEKYMRLQEGVKQVQ  418

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             RHF VN PPK+YDVFHM++HSIWLRRLN+ V
Sbjct  419   RHFVVNNPPKKYDVFHMIIHSIWLRRLNVLV  449



>ref|XP_010228257.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Brachypodium distachyon]
Length=547

 Score =   431 bits (1108),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 280/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++   L R+E GLA+ R+ I +A    +NR  L D DYVP GP+YRN +AFHRSYLEMEK
Sbjct  154   ERDAKLHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEK  213

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FKI++Y+EGEPP++H      I   EG  IH +E+ ++ RT +P  AHVFFLPFS   +
Sbjct  214   LFKIYVYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKM  273

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
                ++V  +H   P+++T  DYI+ +STK+PYWNRS G DHFML+CHDW P +S     L
Sbjct  274   EKTIYVPGSHTMEPLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNL  333

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEI-YLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             F NSIRV+CNANTSEGF P+ DVSLPEI +L     D  IGGP  S R +L F+AGG HG
Sbjct  334   FSNSIRVLCNANTSEGFIPSKDVSLPEINHLNDFKKD--IGGPSASGRPILAFFAGGNHG  391

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              +R ++++ W+ KDP+V++ EYLP  VSY   +R+SK+C+CPSG+EVASPR+ EA+Y+ C
Sbjct  392   PVRPLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVEC  451

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPV+I D Y  PF+DVL W  F++ + V++IP++K+IL ++   +Y+ MQ +   VRRHF
Sbjct  452   VPVVIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHF  511

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N  P+RYDVFHM+LHSIWLRRLN+ +H+
Sbjct  512   MLNGVPQRYDVFHMILHSIWLRRLNVRIHE  541



>ref|XP_010683539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=496

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/391 (54%), Positives = 282/391 (72%), Gaps = 7/391 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA----QTENRILEDP-DYVPHGPIYRNPHAFHRSYLEM  459
             KK   +E +E  L R R+ I++A     T N  +ED  DYVPHG IY+N  AFHRSYL M
Sbjct  104   KKDQKVEIIEVTLGRARSLIKEAIQSRNTSNLFVEDQVDYVPHGNIYKNAFAFHRSYLLM  163

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSY  636
             EK FKI+IYEEGEPP+FHY   + I  +EGI I+ LE + +FR K+P++A V+FLPFS  
Sbjct  164   EKMFKIYIYEEGEPPLFHYGPCKNIYSMEGIFINLLEKNNQFRAKDPDEAQVYFLPFSVV  223

Query  637   SLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
              ++  +F     +   +++T  DY++ IS KYPYWNRSLG DHFML+CHDW P  +   P
Sbjct  224   MILQHLFDPIIRDKAVLERTILDYVSVISHKYPYWNRSLGADHFMLSCHDWGPRATWYHP  283

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLI-GGPPPSNRSVLVFYAGGI  993
              L+ +SIR +CNANTSE F P  D S+PEI L  G    L+ G  PPS R++L F+AG +
Sbjct  284   LLYFHSIRALCNANTSENFNPRKDASIPEINLKTGEFAALLHGSLPPSERTILAFFAGRM  343

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG+IR  ++  W++KD +++++E LPK +SY  M+++SKYC+CPSG+EVASPR+VEA+Y 
Sbjct  344   HGHIRPALLTYWKDKDKDLQVYEELPKEISYGEMMKRSKYCLCPSGFEVASPRIVEAIYA  403

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPVLI  +Y  PF+DVLDW +F+V + V EIPNLKKIL+ IP +KYL MQE   QV+R
Sbjct  404   ECVPVLISQNYILPFSDVLDWSSFSVQVSVSEIPNLKKILMEIPYDKYLQMQEGVKQVQR  463

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             HF +N PPKR+DVFHM++HSIWLRRLN+ +H
Sbjct  464   HFVMNDPPKRFDVFHMIIHSIWLRRLNVRIH  494



>ref|XP_010228256.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Brachypodium distachyon]
Length=548

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 280/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA--QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++   L R+E GLA+ R+ I +A    +NR  L D DYVP GP+YRN +AFHRSYLEMEK
Sbjct  155   ERDAKLHRLELGLAKARSTIMEASHNKDNRPPLTDKDYVPVGPVYRNANAFHRSYLEMEK  214

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSL  642
              FKI++Y+EGEPP++H      I   EG  IH +E+ ++ RT +P  AHVFFLPFS   +
Sbjct  215   LFKIYVYDEGEPPIYHDGPCHNIYSTEGRFIHAMEMENRMRTTDPGLAHVFFLPFSIAKM  274

Query  643   VHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKL  822
                ++V  +H   P+++T  DYI+ +STK+PYWNRS G DHFML+CHDW P +S     L
Sbjct  275   EKTIYVPGSHTMEPLRRTVFDYIDVLSTKHPYWNRSQGADHFMLSCHDWGPYVSSVDGNL  334

Query  823   FKNSIRVMCNANTSEGFKPAIDVSLPEI-YLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             F NSIRV+CNANTSEGF P+ DVSLPEI +L     D  IGGP  S R +L F+AGG HG
Sbjct  335   FSNSIRVLCNANTSEGFIPSKDVSLPEINHLNDFKKD--IGGPSASGRPILAFFAGGNHG  392

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              +R ++++ W+ KDP+V++ EYLP  VSY   +R+SK+C+CPSG+EVASPR+ EA+Y+ C
Sbjct  393   PVRPLLLKHWKGKDPDVQVSEYLPAGVSYVETMRRSKFCLCPSGFEVASPRVAEAIYVEC  452

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPV+I D Y  PF+DVL W  F++ + V++IP++K+IL ++   +Y+ MQ +   VRRHF
Sbjct  453   VPVVIADDYVLPFSDVLSWPAFSLRVAVRDIPDIKRILSAVSPRRYIRMQRRVRAVRRHF  512

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +N  P+RYDVFHM+LHSIWLRRLN+ +H+
Sbjct  513   MLNGVPQRYDVFHMILHSIWLRRLNVRIHE  542



>ref|XP_008242868.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=404

 Score =   426 bits (1095),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/394 (53%), Positives = 281/394 (71%), Gaps = 8/394 (2%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAFHRSYLEM  459
              A K  T+LE++E  LA+ RAAI +A + +N   E  + +VP G IY+NP+AFH+S++EM
Sbjct  9     SATKGRTSLEKIEEDLAKARAAILEAIRFKNYTSEKTETFVPRGTIYKNPYAFHQSHIEM  68

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
              KRFK++ Y+EGE P+ H+     I GIEG  I ++E   S FR  +P++AH FFLP S 
Sbjct  69    VKRFKVWSYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSV  128

Query  634   YSLVHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+V++    +  +    +Q+   DYI  ++ KYPYWNRS G DHFM +CHDWAP +
Sbjct  129   ANIVHYVYMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEV  188

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S G P+LF N IRV+CNANTSEGF+P  DVSLPEIYLP G +     G  P+NR +L F+
Sbjct  189   SVGKPELFTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFF  248

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AG +HG IR ++++ W+ KD EV++HE LPK ++Y  ++ +SKYC+CPSG+EVASPR+VE
Sbjct  249   AGRVHGPIRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVE  308

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A Y GCVPVLI D+YA PF DVL+W  F+V IPV  IP +K IL SIP EKYL MQ++  
Sbjct  309   AFYAGCVPVLISDNYALPFGDVLNWSQFSVQIPVARIPEIKTILESIPYEKYLKMQKRVS  368

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +V RHF +N P K +DV HMVLHS+WLRRLN ++
Sbjct  369   RVHRHFVLNRPSKSFDVIHMVLHSVWLRRLNFKL  402



>ref|XP_010418150.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=423

 Score =   426 bits (1094),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 275/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  RA IR+AQ     T +  L D DY+PHG IYRNP+AFHRSYL MEK FKI+
Sbjct  40    KVEAELATARALIREAQLNSNATSSSPLGDKDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  99

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  100   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  159

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DYI  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  160   FDPVVRDKAVLERVIADYIQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  219

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G ++ L GG  P++R+ L F+AG  HG IR V
Sbjct  220   IRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPTSRTTLAFFAGKSHGKIRPV  279

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  280   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  339

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+++Y+ + E   +V+RH  VN P
Sbjct  340   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILVNDP  399

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  400   PKRYDVFNMIIHSIWLRRLNVKL  422



>ref|XP_008794982.1| PREDICTED: probable glycosyltransferase At5g20260 [Phoenix dactylifera]
Length=498

 Score =   427 bits (1098),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 199/398 (50%), Positives = 278/398 (70%), Gaps = 5/398 (1%)
 Frame = +1

Query  265   QLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDP--DYVPHGPIYRNPHAF  438
             Q P +    + K   +  +E GLAR R +IR A            D++P G +YRN HAF
Sbjct  99    QAPPNDTARLSKRVKVGIIEEGLARARNSIRHAALARNYTTSKVEDFIPRGAVYRNAHAF  158

Query  439   HRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHV  612
             H+SY+EMEKRFK++ Y+EGEPP+ H      I  IEG  I ++E  K  FR ++P++AHV
Sbjct  159   HQSYIEMEKRFKVWTYKEGEPPIIHGGPGASINAIEGHFISEIEDKKNPFRARHPDEAHV  218

Query  613   FFLPFSSYSLVHFVFVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDW  789
             FFLPFS  ++V +V+     + W P+++   DYI  +S K+PYWNRSLG DHFM++CHDW
Sbjct  219   FFLPFSVVNIVQYVYKPKVSDYWGPLKRLIADYIGVVSEKHPYWNRSLGADHFMVSCHDW  278

Query  790   APTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSV  969
             AP +S    +L++NSIRV+CNANTSEGFK   DV+LPE++LP G +   +     ++R++
Sbjct  279   APHLSDANLQLYENSIRVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLTDRTI  338

Query  970   LVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASP  1149
             L F+AGG HGYIR+++   W  KD E+ +HEYLPK ++Y  ++ K+K+C+CPSGYEVASP
Sbjct  339   LAFFAGGSHGYIREILFHHWRGKDQEILVHEYLPKGLNYAALMSKTKFCLCPSGYEVASP  398

Query  1150  RMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQ  1329
             R+VE+++MGCVPV+I  +Y  PF DVLDW  F+V IPV++IP +K IL  I + +Y  +Q
Sbjct  399   RIVESIFMGCVPVIISVNYPPPFGDVLDWSKFSVQIPVEKIPEIKTILRGISERRYRILQ  458

Query  1330  EKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              + +QV+RHF +N P KR+DV HMVLHSIWLRRLN+ +
Sbjct  459   MRVLQVQRHFVLNRPAKRFDVIHMVLHSIWLRRLNLRL  496



>ref|XP_006299448.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
 gb|EOA32346.1| hypothetical protein CARUB_v10015613mg [Capsella rubella]
Length=462

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 276/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  RA IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL MEK FKI+
Sbjct  79    KVEAELAMARALIREAQVNSNSTSSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKIFKIY  138

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  139   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  198

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  199   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  258

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G ++ L GG  P++R+ L F+AG  HG IR V
Sbjct  259   IRVLCNANISEYFNPEKDAPFPEINLVTGEINNLTGGLDPTSRTTLAFFAGKSHGKIRPV  318

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  319   LLNNWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  378

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP +K+IL++IP+++Y+ + E   +V+RH  VN P
Sbjct  379   SENYVLPFSDVLNWEKFSVSVSVKEIPEMKRILMNIPEDRYMRLYEGVKKVKRHILVNDP  438

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  439   PKRYDVFNMIIHSIWLRRLNVKL  461



>ref|XP_011100587.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=548

 Score =   428 bits (1101),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 271/375 (72%), Gaps = 6/375 (2%)
 Frame = +1

Query  313   ERVEAGLARVRAAIRQAQTENR-----ILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             E+VEA LA+ R +IR+A   N           DYVP GPIY N +AF+RSY EMEK FKI
Sbjct  162   EKVEAILAKARYSIREAARNNNRSFISSSSGSDYVPQGPIYFNANAFYRSYTEMEKVFKI  221

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFV  654
             ++YEEGE P+FH    + I   EG  IH++E  + +RT++ E+AHV+F+PFS  ++V ++
Sbjct  222   YVYEEGEAPIFHGGPCRSIYTTEGRFIHEMERGELYRTRDAEEAHVYFMPFSVVAMVQYL  281

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             +   A +   +  T  DY++ I+  +P+WNRSLG DHFML+CHDW P  S   P LF NS
Sbjct  282   YEPGAVDMDAMGNTLADYVHTIAHNHPFWNRSLGADHFMLSCHDWGPYTSSYVPLLFNNS  341

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNANTSEGF P  D +LPEI L  G + GL+GGPPPS RS+L F+AGG+HG IR +
Sbjct  342   IRVLCNANTSEGFNPIKDATLPEINLKFGEITGLLGGPPPSERSILAFFAGGLHGDIRHI  401

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             +++ W+ KDP++ ++E LP NVSY  M++ SK+C+CPSGYEVASPR+VEA+Y  CVPVLI
Sbjct  402   LLDHWKEKDPDIRVYEKLPPNVSYEAMLKNSKFCLCPSGYEVASPRIVEAIYSECVPVLI  461

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              DHY  PF+DVL+W  F++ + V++IPN+K IL+ I + KYL MQ +  QV+RHF +N  
Sbjct  462   SDHYVPPFSDVLNWKKFSIVVGVEDIPNIKTILMGISRAKYLKMQMRVKQVQRHFVLNGT  521

Query  1375  PKRYDVFHMVLHSIW  1419
             PKR+D+FHM++HS+W
Sbjct  522   PKRFDLFHMIVHSVW  536



>gb|KCW74795.1| hypothetical protein EUGRSUZ_E03530 [Eucalyptus grandis]
Length=470

 Score =   425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/408 (49%), Positives = 294/408 (72%), Gaps = 9/408 (2%)
 Frame = +1

Query  247   FSMPFYQLPSSHPDA-MKKLTNLERVEAGLARVRAAIRQAQTENRILEDPD--YVPHGPI  417
              S   Y+  S H  + +KK ++L+R+E  LA+ RAAIR+A      + + +  ++P G +
Sbjct  62    LSTSTYKSSSRHNTSRIKKKSSLDRIEDDLAQARAAIRKAIRSRSYVSNKEETFIPRGNV  121

Query  418   YRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTK  591
             YRN +AFH+S++EM KRFKI+ Y EG+ P+ HY   +G+ GIEG  I ++E  +  FR +
Sbjct  122   YRNHYAFHQSHIEMMKRFKIWTYREGDLPLVHYGPMRGLYGIEGQFIDEMEDKQNPFRAR  181

Query  592   NPEKAHVFFLPFSSYSLVHFVF----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGY  759
              P++AH FFLPFS  +++++V+        +    +Q+ A DYI+ ++ +Y YWNRS G 
Sbjct  182   RPDEAHAFFLPFSVANVINYVYKPILSMSDYSRERLQRFAGDYISVVADRYRYWNRSGGA  241

Query  760   DHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLI  939
             DHFM +CHDW P IS    +LFKN IRV+CNANTSEGF+P IDVS+ E+YL +G +    
Sbjct  242   DHFMASCHDWGPDISSANRELFKNFIRVLCNANTSEGFRPEIDVSMAEVYLTRGKLGPPR  301

Query  940   GGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCI  1119
              G  PSNR++L F+AGG HG+IR++++E W++KD +V++HEYLPK   Y  ++ KSK+C+
Sbjct  302   LGLDPSNRTILAFFAGGAHGFIRELLLEHWKDKDADVQVHEYLPKGQHYTQLMGKSKFCL  361

Query  1120  CPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLS  1299
             CPSG+EVASPR+VE++Y GCVPV+IKD Y  PF+DVL+W  F++ IPVK+I ++K IL +
Sbjct  362   CPSGFEVASPRIVESIYAGCVPVIIKDDYWLPFSDVLNWSKFSIQIPVKKIKDIKTILQA  421

Query  1300  IPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             IP +KY+ +Q++ ++V RHFE++ P K +DV HM+LHS+WLRRLN+++
Sbjct  422   IPNQKYVKLQKRVVKVTRHFELHRPAKPFDVIHMILHSVWLRRLNLKL  469



>ref|NP_187419.1| putative glycosyltransferase [Arabidopsis thaliana]
 sp|Q9SSE8.1|GLYT1_ARATH RecName: Full=Probable glycosyltransferase At3g07620 [Arabidopsis 
thaliana]
 gb|AAF13080.1|AC009176_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE74576.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=470

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 274/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  R  IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL MEK FKI+
Sbjct  87    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  146

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  207   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  266

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G+++ L GG  P +R+ L F+AG  HG IR V
Sbjct  267   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  326

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  327   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  386

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+E+Y+ + E   +V+RH  VN P
Sbjct  387   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  446

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  447   PKRYDVFNMIIHSIWLRRLNVKL  469



>gb|AHL38775.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=459

 Score =   425 bits (1092),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 274/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  R  IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL MEK FKI+
Sbjct  76    KVEAELATARVLIREAQLNYSSTTSSPLGDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  195

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  196   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G+++ L GG  P +R+ L F+AG  HG IR V
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLLTGDINNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVLI  375

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+E+Y+ + E   +V+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKRHILVNDP  435

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  436   PKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_010489710.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=459

 Score =   424 bits (1091),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/383 (53%), Positives = 273/383 (71%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             RVEA LA  RA IR+AQ     T +  L D +Y+PHG IYRNP+AFHRSYL MEK FKI+
Sbjct  76    RVEAELATARALIREAQLNSNSTSSSPLGDEEYIPHGDIYRNPYAFHRSYLLMEKIFKIY  135

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHVFFLPFS   ++H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVFFLPFSVVMILHHL  195

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  196   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G +  L GG  P +R+ L F+AG  HG IR V
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLLTGEIKNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  375

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+++YL + E   +V+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYLRLYEGVKKVKRHILVNDP  435

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  436   PKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_010107365.1| putative glycosyltransferase [Morus notabilis]
 gb|EXC15616.1| putative glycosyltransferase [Morus notabilis]
Length=468

 Score =   425 bits (1092),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 268/385 (70%), Gaps = 6/385 (2%)
 Frame = +1

Query  307   NLERVEAGLARVRAAIRQA-----QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
              L ++EA LA  RA IR+A     QT+   LED DYVP G +Y+N +AFH SYL ME+ F
Sbjct  82    KLAKLEADLATARALIREATKKVNQTKKSFLEDADYVPQGEVYKNAYAFHWSYLLMERVF  141

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-KFRTKNPEKAHVFFLPFSSYSLVH  648
             +IF+YEEGEPP+FH    + I   EG+ +  +E    FRT +P++AHV+FLPFS   +V 
Sbjct  142   RIFVYEEGEPPIFHNGPCKSIYSTEGMFLSFMETDIHFRTWDPDEAHVYFLPFSVVMMVK  201

Query  649   FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFK  828
             ++F     +   +Q+T  DY+  IS KYP+WNRSLG DHFML+CHDW P  +   P+L+ 
Sbjct  202   YLFDPIIRDKAVLQRTVVDYVQTISHKYPHWNRSLGADHFMLSCHDWGPRATWYVPQLYY  261

Query  829   NSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIR  1008
             NSIRV+CNANTSE F P  D S PEI L  G +  L GG P S+R  L F+AG  HG IR
Sbjct  262   NSIRVLCNANTSEHFNPKKDASFPEINLKTGQISSLTGGSPLSDRKTLAFFAGQRHGRIR  321

Query  1009  QVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
             QV+   W+ KD +V+++E LPK +SY  M+R S++C+CPSG+EVASPR+VEA+Y  CVPV
Sbjct  322   QVLFHHWKEKDRDVKVYETLPKEISYEKMLRTSRFCLCPSGHEVASPRVVEAIYAECVPV  381

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI   Y  PF+DVL+W++FAV + V+EIP LK+ILL I   +Y +++     V+RHF +N
Sbjct  382   LISQQYVPPFSDVLNWESFAVSVSVEEIPKLKEILLGISLVQYENLRRNVKLVQRHFVLN  441

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIEV  1443
              PPK YDVFHM+LHSIWLRRLN+ +
Sbjct  442   DPPKGYDVFHMILHSIWLRRLNVRI  466



>ref|XP_009124266.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=460

 Score =   424 bits (1091),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/384 (53%), Positives = 274/384 (71%), Gaps = 7/384 (2%)
 Frame = +1

Query  313   ERVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             ++VEA LA  RA IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL MEK FKI
Sbjct  76    KKVEAELATARALIREAQLNPNSTTSSPLRDEDYVPHGEIYRNPYAFHRSYLLMEKMFKI  135

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHF  651
             ++YEEG+PP+FHY   + I  +EG+L++ +E  +  +RT++P+KAHV+FLPFS   ++H 
Sbjct  136   YVYEEGDPPIFHYGLCKDIYSMEGLLLNFMENDVLTYRTRDPDKAHVYFLPFSVVMILHH  195

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF N
Sbjct  196   LFDPVVRDKAVLERVIVDYVQIISEKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFN  255

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             SIRV+CNAN SE F P  D   PEI L  G ++ L GG  P +R+ L F+AG  HG IR 
Sbjct  256   SIRVLCNANISEYFNPEKDAPFPEINLQTGEINNLTGGLDPMSRTTLAFFAGQSHGKIRP  315

Query  1012  VMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVL  1191
             V++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVL
Sbjct  316   VLLNHWKEKDKDILVYEDLPGELDYKEMMRKSRFCICPSGHEVASPRVPEAIYSGCVPVL  375

Query  1192  IKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNF  1371
             I ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+++Y  + E   QV+RH  VN 
Sbjct  376   ISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYKKLYEGVKQVQRHILVND  435

Query  1372  PPKRYDVFHMVLHSIWLRRLNIEV  1443
             PPKRYDVF+M++HSIWLRRLN+++
Sbjct  436   PPKRYDVFNMIIHSIWLRRLNVKL  459



>ref|XP_010464397.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=474

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 274/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  RA IR+AQ     T +  L D DY+PHG IYRNP+AFHRSYL MEK FKI+
Sbjct  91    KVEAELATARALIREAQLNSHATSSSPLGDEDYIPHGDIYRNPYAFHRSYLLMEKIFKIY  150

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  151   VYEEGDPPIFHYGICKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  210

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  211   FDPVVRDKAVLERVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  270

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G ++ L GG  P +R+ L F+AG  HG IR V
Sbjct  271   IRVLCNANISEYFNPEKDAPFPEINLMTGEINNLTGGLDPISRTTLAFFAGKSHGKIRPV  330

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  M+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  331   LLNHWKEKDKDILVYENLPDGLDYTEMMRKSRFCICPSGHEVASPRIPEAIYSGCVPVLI  390

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+++Y+ + E   +V+RH  VN P
Sbjct  391   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYMRLYEGVKKVKRHILVNDP  450

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  451   PKRYDVFNMIIHSIWLRRLNVKL  473



>ref|XP_006407816.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
 gb|ESQ49269.1| hypothetical protein EUTSA_v10020696mg [Eutrema salsugineum]
Length=459

 Score =   422 bits (1084),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 273/383 (71%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  RA IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL MEK FKI+
Sbjct  76    KVEAELATARALIREAQLNPNSTTSSPLRDEDYVPHGDIYRNPYAFHRSYLLMEKMFKIY  135

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  I  +RT++P++AHV+FLPFS   ++H +
Sbjct  136   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDILNYRTRDPDRAHVYFLPFSVVMILHHL  195

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  196   FDPVVRDKAVLERVIVDYVRIISNKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  255

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI LP G ++ L GG  P +R+ L F+AG  HG IR V
Sbjct  256   IRVLCNANISEYFNPEKDAPFPEINLPTGEINNLTGGLDPISRTTLAFFAGKSHGKIRPV  315

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP  + Y  ++R+S++CICPSG+EVASPR+ EA+Y  CVPVLI
Sbjct  316   LLNHWKEKDKDILVYENLPDGLDYKDLMRRSRFCICPSGHEVASPRIPEAIYSECVPVLI  375

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+++Y+ + E   +V+RH  VN P
Sbjct  376   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEDRYIRLHEGVKKVKRHILVNDP  435

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  436   PKRYDVFNMIIHSIWLRRLNVKL  458



>ref|XP_008457132.1| PREDICTED: probable glycosyltransferase At3g42180 [Cucumis melo]
Length=459

 Score =   422 bits (1084),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 276/393 (70%), Gaps = 18/393 (5%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILEDPD--YVPHGPIYRNPHAFHRSYLEMEKR  468
             KK  NL+ +EA LA  RA+IR+A        +    Y+P GPIYRNP+AFH+S++EM KR
Sbjct  67    KKKMNLKMIEASLAEARASIRKAVLWKNFTSEKKETYIPRGPIYRNPYAFHQSHIEMVKR  126

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSL  642
             FK++ Y EGE P+FH      I  IEG  I +L+ SK  FR  +P++AHVF LP S  ++
Sbjct  127   FKVWSYREGEQPLFHDGPLNSIYAIEGQFIDELDCSKSPFRASHPDQAHVFLLPLSITNI  186

Query  643   VHFVF---------VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAP  795
             +HF++          RD      + +   DYI  ++ +YPYWNRS G DHF+++CHDWAP
Sbjct  187   IHFIYRPITSPTDYSRDR-----MHRVTTDYIRVVANRYPYWNRSHGADHFVVSCHDWAP  241

Query  796   TISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLV  975
              IS   P+LFKN IRV+CNAN +EGF+P ID+ LPEI +  G +     G PP  R +L 
Sbjct  242   EISDANPQLFKNFIRVVCNANITEGFRPNIDIPLPEINIHPGTLGPPDLGQPPERRPILA  301

Query  976   FYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRM  1155
             F+AGG HGYIR+++++ W+ KD EV++HEYLPK  +Y  ++ +SK+C+CPSGYEVASPR+
Sbjct  302   FFAGGAHGYIRKILIKHWKEKDNEVQVHEYLPKTQNYTKLIGESKFCLCPSGYEVASPRV  361

Query  1156  VEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEK  1335
             VEA+Y GCVPV+I D+Y+ PF+DVLDW  F+V+IPV+ IP +K IL +I +EKYL M + 
Sbjct  362   VEAIYGGCVPVIISDNYSLPFSDVLDWSRFSVEIPVQRIPEIKTILKAISEEKYLKMYKG  421

Query  1336  GIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
              I+V+RHF++N P K +DV HM+LHS+WLRRLN
Sbjct  422   VIKVKRHFKINRPAKPFDVMHMLLHSLWLRRLN  454



>ref|XP_010552074.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
Length=477

 Score =   422 bits (1086),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 271/381 (71%), Gaps = 5/381 (1%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQTE---NRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIY  486
             +VE  LA  RA IR+A +    +  L D DYVPHG IYRNP+AFHRSYL MEK FKI++Y
Sbjct  96    KVEKQLASARALIREALSNPNSSSPLMDKDYVPHGEIYRNPYAFHRSYLLMEKLFKIYVY  155

Query  487   EEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFVFV  660
             EEGEPP+FHY   + I  +EG+ ++ +E  + ++RT +P++AHV+FLPFS   ++  +F 
Sbjct  156   EEGEPPMFHYGLCKNIYSMEGLFLNFMENDVVRYRTLDPDEAHVYFLPFSVVMILQHLFD  215

Query  661   RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIR  840
                 +   +++   DYI  +STKYPYWN S G+DHFML+CHDW    S    KLF NSIR
Sbjct  216   PVFRDKGVLERVIVDYIRVVSTKYPYWNTSDGFDHFMLSCHDWGHRASWYVKKLFFNSIR  275

Query  841   VMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMM  1020
             V+CNAN SE F P  D   PEI L  G +  L GG  P NR+ L F+AG +HG IR V++
Sbjct  276   VLCNANMSEYFNPVKDAPFPEINLVTGEITDLTGGLDPVNRTTLAFFAGKLHGKIRPVLL  335

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
               W+ KD ++ ++E LP  + Y GM+RKS++CICPSG+EVASPR+ EA+Y GCVPVLI +
Sbjct  336   NHWKEKDRDILVYENLPDELDYTGMMRKSRFCICPSGHEVASPRIPEAIYAGCVPVLISE  395

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
             +Y  PF+DVL+WD F+V + VKEIP LK+ILL IP+++Y  + E    V+RHF VN PPK
Sbjct  396   YYVLPFSDVLEWDKFSVWVSVKEIPELKRILLGIPEDRYRRLYEGVKNVQRHFLVNDPPK  455

Query  1381  RYDVFHMVLHSIWLRRLNIEV  1443
             RYDVF+M++HS+WLRRLN+++
Sbjct  456   RYDVFNMIIHSVWLRRLNVKL  476



>ref|XP_010241628.1| PREDICTED: probable glycosyltransferase At5g20260 [Nelumbo nucifera]
Length=482

 Score =   422 bits (1085),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 200/390 (51%), Positives = 278/390 (71%), Gaps = 7/390 (2%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             ++K ++L RVE  LAR RAAI QA   +   R  ED ++V  G IYRNP+AF++S+ EM 
Sbjct  92    VRKKSSLNRVEESLARARAAILQAARSRNNTRPKED-EFVSKGSIYRNPYAFYQSHNEMV  150

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSY  636
             KRFK+++Y EGEPP+ H      I   EG  I ++E   S F  ++P++AH FFLPFS  
Sbjct  151   KRFKVWVYREGEPPLVHNGPLNNIYSSEGQFIDEMESGHSPFAARHPDEAHAFFLPFSIA  210

Query  637   SLVHFVFV-RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
             + V +++    ++   P+Q    DYI  +S KYPYWNRS G DHFM++CHDWAP +S   
Sbjct  211   NAVQYLYKPLTSYARDPLQHVVEDYIGVVSNKYPYWNRSHGADHFMVSCHDWAPDVSTAH  270

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
             P+LFK+ IRV+CNAN +EGF+P ID +LPE+  P G +     G  PS R++L F+AGG 
Sbjct  271   PELFKHFIRVICNANITEGFRPGIDAALPELNTPFGTLGRPSFGQAPSKRTLLAFFAGGA  330

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HGYIR+V++E W++KD +V++HEYLPK ++Y  ++ ++K+C+CPSGYEVASPR+VEA+  
Sbjct  331   HGYIRKVLLEHWKDKDKDVQVHEYLPKGMNYAKLMGQAKFCLCPSGYEVASPRIVEAIQA  390

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
             GC+P +I D Y  PF+DVLDW  F+V IPV+ IP++KKIL  + Q +YL MQ+K  QVRR
Sbjct  391   GCIPTIISDGYWLPFSDVLDWSQFSVQIPVERIPDIKKILQGVSQNRYLQMQKKVRQVRR  450

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF +N P +R+DV HM+LHS+WLRRLN+ +
Sbjct  451   HFVLNRPAQRFDVIHMILHSVWLRRLNLRL  480



>ref|XP_002884661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   422 bits (1084),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 199/383 (52%), Positives = 274/383 (72%), Gaps = 7/383 (2%)
 Frame = +1

Query  316   RVEAGLARVRAAIRQAQ-----TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIF  480
             +VEA LA  RA IR+AQ     T +  L D DYVPHG IYRNP+AFHRSYL ME+ FKI+
Sbjct  87    KVEAELATARALIREAQLNSNSTASSPLGDEDYVPHGDIYRNPYAFHRSYLLMERMFKIY  146

Query  481   IYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             +YEEG+PP+FHY   + I  +EG+ ++ +E  + K+RT++P+KAHV+FLPFS   ++H +
Sbjct  147   VYEEGDPPIFHYGLCKDIYSMEGLFLNFMENDVLKYRTRDPDKAHVYFLPFSVVMILHHL  206

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   ++    DY+  IS KYPYWN S G+DHFML+CHDW    +    KLF NS
Sbjct  207   FDPVVRDKAVLESVIADYVQIISKKYPYWNTSDGFDHFMLSCHDWGHRATWYVKKLFFNS  266

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             IRV+CNAN SE F P  D   PEI L  G ++ L GG  P +R  L F+AG  HG IR V
Sbjct  267   IRVLCNANISEYFNPEKDAPFPEINLLTGEINNLTGGLDPISRKTLAFFAGKSHGKIRPV  326

Query  1015  MMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLI  1194
             ++  W+ KD ++ ++E LP++++Y  M+RK+++CICPSG+EVASPR+ EA+Y GCVPVLI
Sbjct  327   LLNHWKEKDKDILVYENLPEDLNYTEMMRKTRFCICPSGHEVASPRIPEAIYSGCVPVLI  386

Query  1195  KDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFP  1374
              ++Y  PF+DVL+W+ F+V + VKEIP LK+IL+ IP+E+Y+ + E   +V+ H  VN P
Sbjct  387   SENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRLYEGVKKVKMHILVNDP  446

Query  1375  PKRYDVFHMVLHSIWLRRLNIEV  1443
             PKRYDVF+M++HSIWLRRLN+++
Sbjct  447   PKRYDVFNMIIHSIWLRRLNVKL  469



>ref|XP_006483712.1| PREDICTED: probable glycosyltransferase At5g25310-like [Citrus 
sinensis]
 gb|KDO61790.1| hypothetical protein CISIN_1g011702mg [Citrus sinensis]
Length=479

 Score =   422 bits (1084),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 192/394 (49%), Positives = 278/394 (71%), Gaps = 8/394 (2%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILE----DPDYVPHGPIYRNPHAFHRSYL  453
              + + L+  E+++ GLAR RA+IR+A +   +        D+VP   IYRNP AF++SY+
Sbjct  85    SSARVLSKYEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQSYV  144

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPF  627
             EMEKRFK+++Y EGE P+ HY   + I  IEG  + ++E    +FRT +P +AHV++LPF
Sbjct  145   EMEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYLPF  204

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   +V +++    ++  P+++   DY+  +S+KYP+WNR+ G DHFMLACHDW P +S 
Sbjct  205   SVAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHVSK  264

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFY  981
             G   L+ NSIRV+CNANTSEGF P  DV+LPEI+L  G +   +  PPP N  R  L F+
Sbjct  265   GNSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLAFF  324

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG IR ++++ W+  D ++ + EYLPK+  YY  + KSK+C+CPSGYEVASPR+VE
Sbjct  325   AGGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRIVE  384

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             ++Y  CVPV++  +Y  PF+DVL W+ F++ + V EIP LK++L+++P+EKY  ++E   
Sbjct  385   SIYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKENLK  444

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              VRRHFE+N P KR+DVFHM+LHSIWLRRLN+ +
Sbjct  445   AVRRHFELNHPAKRFDVFHMILHSIWLRRLNMRL  478



>ref|XP_006856555.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
 gb|ERN18022.1| hypothetical protein AMTR_s00046p00174470 [Amborella trichopoda]
Length=543

 Score =   424 bits (1089),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 269/378 (71%), Gaps = 3/378 (1%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQ--TENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             +K  +L+R++A LAR R++I++A     +       +VP G  YRNP+AF++SYLEMEK 
Sbjct  156   EKQRSLQRLDAQLARARSSIKRAARFCNDSCYGGDSFVPKGAAYRNPYAFYQSYLEMEKT  215

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLV  645
              K++IY+EGEPP+ H    + I  +EG  IH+ +  ++F   +PE AH+ F+P S   LV
Sbjct  216   LKVWIYKEGEPPLVHDGPCKSIYSMEGQFIHEFDSGNRFVASSPEHAHLHFIPLSITKLV  275

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
             H ++    +   P+ +   DYI+ IS KYP+WNR+ G DHF L+CHDWAP  S   P+L 
Sbjct  276   HHLYPPKTYGRGPLHRVVSDYISIISRKYPFWNRTQGSDHFYLSCHDWAPDASEANPELN  335

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYI  1005
             +NSIRV+CNANTSEGF P  DVS+PEI+L  G +DGLIGGP PS RS+L F+AG  HGYI
Sbjct  336   RNSIRVLCNANTSEGFDPRKDVSMPEIHLKTGRLDGLIGGPSPSRRSILAFFAGAQHGYI  395

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R +++  W++KD +V++HEYLPK  SY   ++++K+C+CPSGYEVASPR+VEA+Y GCVP
Sbjct  396   RSLLLRQWKDKDSQVQVHEYLPKGQSYSKQMQRAKFCLCPSGYEVASPRVVEAIYSGCVP  455

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             V+I   Y  PF+DVLDW  F+V IPV +IP++K IL  I Q +YL +  + +QV+RHF V
Sbjct  456   VIISSSYVLPFSDVLDWRKFSVHIPVSKIPDIKTILERISQRRYLQLYRRVLQVQRHFVV  515

Query  1366  NFPPKRYDVFHMVLHSIW  1419
             N P KR+DV HM+LHSIW
Sbjct  516   NRPAKRFDVIHMILHSIW  533



>ref|XP_010059401.1| PREDICTED: probable glycosyltransferase At3g42180 [Eucalyptus 
grandis]
Length=475

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 294/413 (71%), Gaps = 14/413 (3%)
 Frame = +1

Query  247   FSMPFYQLPSSHPDA-MKKLTNLERVEAGLARVRAAIRQAQTENRILEDPD--YVPHGPI  417
              S   Y+  S H  + +KK ++L+R+E  LA+ RAAIR+A      + + +  ++P G +
Sbjct  62    LSTSTYKSSSRHNTSRIKKKSSLDRIEDDLAQARAAIRKAIRSRSYVSNKEETFIPRGNV  121

Query  418   YRNPHAFH-----RSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-  579
             YRN +AFH     RS++EM KRFKI+ Y EG+ P+ HY   +G+ GIEG  I ++E  + 
Sbjct  122   YRNHYAFHQLKVFRSHIEMMKRFKIWTYREGDLPLVHYGPMRGLYGIEGQFIDEMEDKQN  181

Query  580   -FRTKNPEKAHVFFLPFSSYSLVHFVF----VRDAHEWPPIQKTARDYINGISTKYPYWN  744
              FR + P++AH FFLPFS  +++++V+        +    +Q+ A DYI+ ++ +Y YWN
Sbjct  182   PFRARRPDEAHAFFLPFSVANVINYVYKPILSMSDYSRERLQRFAGDYISVVADRYRYWN  241

Query  745   RSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGN  924
             RS G DHFM +CHDW P IS    +LFKN IRV+CNANTSEGF+P IDVS+ E+YL +G 
Sbjct  242   RSGGADHFMASCHDWGPDISSANRELFKNFIRVLCNANTSEGFRPEIDVSMAEVYLTRGK  301

Query  925   MDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRK  1104
             +     G  PSNR++L F+AGG HG+IR++++E W++KD +V++HEYLPK   Y  ++ K
Sbjct  302   LGPPRLGLDPSNRTILAFFAGGAHGFIRELLLEHWKDKDADVQVHEYLPKGQHYTQLMGK  361

Query  1105  SKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLK  1284
             SK+C+CPSG+EVASPR+VE++Y GCVPV+IKD Y  PF+DVL+W  F++ IPVK+I ++K
Sbjct  362   SKFCLCPSGFEVASPRIVESIYAGCVPVIIKDDYWLPFSDVLNWSKFSIQIPVKKIKDIK  421

Query  1285  KILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              IL +IP +KY+ +Q++ ++V RHFE++ P K +DV HM+LHS+WLRRLN+++
Sbjct  422   TILQAIPNQKYVKLQKRVVKVTRHFELHRPAKPFDVIHMILHSVWLRRLNLKL  474



>ref|XP_010905483.1| PREDICTED: probable glycosyltransferase At5g20260 [Elaeis guineensis]
Length=461

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 276/389 (71%), Gaps = 5/389 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRILEDP--DYVPHGPIYRNPHAFHRSYLEMEK  465
             + K   +  +E GLAR R AIR A        +    ++P G +YRN +AFH+SY+EMEK
Sbjct  71    LSKRVKVGIIEEGLARARNAIRHAAIARNYSSEKVEKFIPRGAVYRNAYAFHQSYIEMEK  130

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYS  639
             RFK++ Y+EGEPP+ H      I  IEG  I ++E  K  FR  +P++AHVFFLPFS  +
Sbjct  131   RFKVWTYKEGEPPIIHEGPGASIYAIEGHFISEIEDEKNPFRAHHPDEAHVFFLPFSVVN  190

Query  640   LVHFVFVRDAHE-WPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTP  816
             +V +V+  +  + W P+++   DYI  IS KYPYWNRSLG DHFM++CHDWAP +S    
Sbjct  191   IVQYVYKPNVSDYWKPLKRLIADYIGVISEKYPYWNRSLGVDHFMVSCHDWAPHLSDANL  250

Query  817   KLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIH  996
             +L++NSIRV+CNANTSEGFK   DV+LPE++LP G +   +     + R++L F++GG H
Sbjct  251   QLYRNSIRVICNANTSEGFKLGKDVTLPEVHLPDGLLSQPVRHRSLAERTILAFFSGGSH  310

Query  997   GYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMG  1176
             GYIR++++  W+ KD E+  +EYLPK ++Y  ++RK+K+C+CPSGYEVASPR+VE+++MG
Sbjct  311   GYIREILLHHWKGKDHEILAYEYLPKGLNYAELMRKTKFCLCPSGYEVASPRIVESIFMG  370

Query  1177  CVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRH  1356
             CVPV+I  +Y  PF DVLDW  F+V IPV++IP +K +L  I + +Y  +Q + +QV+RH
Sbjct  371   CVPVIISVNYPPPFGDVLDWSKFSVQIPVEKIPEIKTLLKGISERRYRILQSRVLQVQRH  430

Query  1357  FEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             F +N P KR+DV HMVLHSIWLRRLN+ +
Sbjct  431   FVLNRPAKRFDVIHMVLHSIWLRRLNVRL  459



>ref|XP_006450385.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
 gb|ESR63625.1| hypothetical protein CICLE_v10008151mg [Citrus clementina]
Length=479

 Score =   421 bits (1082),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/394 (49%), Positives = 278/394 (71%), Gaps = 8/394 (2%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILE----DPDYVPHGPIYRNPHAFHRSYL  453
              + + L+  E+++ GLAR RA+IR+A +   +        D+VP   IYRNP AF++SY+
Sbjct  85    SSARVLSKNEQLKQGLARARASIRKAASTRNVTSIIKNGVDFVPSAAIYRNPGAFYQSYV  144

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPF  627
             EMEKRFK+++Y EGE P+ HY   + I  IEG  + ++E    +FRT +P +AHV++LPF
Sbjct  145   EMEKRFKVYVYREGELPITHYGPCKDIYTIEGRFMSEIEHGAKRFRTSDPHRAHVYYLPF  204

Query  628   SSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             S   +V +++    ++  P+++   DY+  +S+KYP+WNR+ G DHFMLACHDW P +S 
Sbjct  205   SVAWMVKYLYKPLTYDLTPLKQFVADYVKVVSSKYPFWNRTCGADHFMLACHDWGPHVSK  264

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFY  981
             G   L+ NSIRV+CNANTSEGF P  DV+LPEI+L  G +   +  PPP N  R  L F+
Sbjct  265   GNSHLYNNSIRVLCNANTSEGFNPQKDVTLPEIHLYGGYVSPKLLSPPPFNAPRPYLAFF  324

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG IR ++++ W+  D ++ + EYLPK+  YY  + KSK+C+CPSGYEVASPR+VE
Sbjct  325   AGGLHGTIRSILLQHWKGHDKDLIVFEYLPKDQDYYSFMLKSKFCLCPSGYEVASPRIVE  384

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             ++Y  CVPV++  +Y  PF+DVL W+ F++ + V EIP LK++L+++P+EKY  ++E   
Sbjct  385   SIYAQCVPVILSQNYVLPFSDVLRWEAFSIQVDVSEIPRLKEVLMAVPEEKYKRLKENLK  444

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              VRRHFE+N P KR+DVFHM+LHSIWLRRLN+ +
Sbjct  445   AVRRHFELNHPAKRFDVFHMILHSIWLRRLNMRL  478



>ref|XP_007204886.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
 gb|EMJ06085.1| hypothetical protein PRUPE_ppa017740mg, partial [Prunus persica]
Length=392

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/388 (52%), Positives = 276/388 (71%), Gaps = 8/388 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPD--YVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             T+LE++E  LA+ RAAI +A    +   +    +VP G IY+NP+AFH+S++EM KRFK+
Sbjct  3     TSLEKIEEDLAKARAAILEAIRFKKYTSEKTETFVPRGTIYKNPYAFHQSHIEMVKRFKV  62

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             + Y+EGE P+ H+     I GIEG  I ++E   S FR  +P++AH FFLP S  ++VH+
Sbjct  63    WSYKEGEQPLVHFGPVNNIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPVSVANIVHY  122

Query  652   VFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             V++    +  +    +Q+   DYI  ++ KYPYWNRS G DHFM +CHDWAP +S G P+
Sbjct  123   VYMPITRKQDYYRDRLQRVVMDYIGVVANKYPYWNRSNGADHFMASCHDWAPEVSVGKPE  182

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LF N IRV+CNANTSEGF+P  DVSLPEIYLP G +     G  P+NR +L F+AG +HG
Sbjct  183   LFTNFIRVLCNANTSEGFQPKRDVSLPEIYLPYGRLGPPSLGQAPNNRPILAFFAGRVHG  242

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR ++++ W+ KD EV++HE LPK ++Y  ++ +SKYC+CPSG+EVASPR+VEA Y GC
Sbjct  243   PIRPMLLDYWKGKDDEVQVHEKLPKGLNYTKLMGQSKYCLCPSGFEVASPRVVEAFYAGC  302

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPVLI D+Y  PF+DVL+W  F+V IPV  IP +K IL SIP EKYL MQ++  +V RHF
Sbjct  303   VPVLISDNYTLPFSDVLNWSQFSVQIPVARIPEIKTILQSIPYEKYLKMQKRVSRVHRHF  362

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              +N P K +DV HMVLHS+WLRRL+ ++
Sbjct  363   VLNRPSKPFDVIHMVLHSVWLRRLDYKL  390



>ref|XP_007013571.1| Exostosin family protein [Theobroma cacao]
 gb|EOY31190.1| Exostosin family protein [Theobroma cacao]
Length=476

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/424 (51%), Positives = 287/424 (68%), Gaps = 24/424 (6%)
 Frame = +1

Query  229   HPWLRGF-SMPFYQLPSSHPDAMKKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-Y  399
             H  L GF S   Y+        +KK +N ER+E  LAR RAAI +A Q +N   E  D +
Sbjct  56    HVSLDGFLSTSMYKSSKHKAAIIKKKSNSERIEEDLARTRAAILKAVQLQNFTSEKEDIF  115

Query  400   VPHGPIYRNPHAFHR-----SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQ  564
             VP G IYRN +AF++     S+ EM KRFK++ Y EGE P+ H      I  IEG  I +
Sbjct  116   VPRGSIYRNANAFYQLSTFMSHTEMIKRFKVWTYREGEIPLVHNGPLNDIYAIEGQFIDE  175

Query  565   LEISK--FRTKNPEKAHVFFLPFSSYSLVHFVF--VRDAHEWPP--IQKTARDYINGIST  726
             +E     FR ++P++AHVFFLP S   ++H+V+  +    E+    +Q+   DYIN +++
Sbjct  176   MESKNNPFRARHPDEAHVFFLPISVTGVIHYVYKPITSVKEYSRDRLQRLVLDYINTVAS  235

Query  727   KYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEI  906
             K+PYWNRS G DHFM++CHDWAP +S   P+LFKN IRV+CNANTSEGF+P IDVSLPEI
Sbjct  236   KHPYWNRSNGADHFMVSCHDWAPEVSQANPELFKNFIRVLCNANTSEGFRPKIDVSLPEI  295

Query  907   YLPQGNMDGLIGGPP-----PSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLP  1071
             YLP G +     GPP     P+NR +L F+AG  HGYIR++++E W++KD EV++H  LP
Sbjct  296   YLPFGKL-----GPPNLSQGPNNRPILAFFAGSAHGYIRKILLEQWKDKDNEVQVHSRLP  350

Query  1072  KNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAV  1251
               V+Y  M+ +SK+C+CPSG+EVASPR +EA+Y GC+PV+I  +Y  PF+DVL W  F+V
Sbjct  351   TGVNYTKMMGQSKFCLCPSGFEVASPREIEAIYAGCIPVVISANYTLPFSDVLKWSQFSV  410

Query  1252  DIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRL  1431
              IPV++IP +K IL  IP  KYL M E+  +VRRHFE+N P K +DV HMVLHS+WLRRL
Sbjct  411   QIPVEKIPEIKTILQGIPNRKYLMMHERVKRVRRHFELNRPAKPFDVIHMVLHSVWLRRL  470

Query  1432  NIEV  1443
             N  +
Sbjct  471   NFRL  474



>gb|EYU20246.1| hypothetical protein MIMGU_mgv1a006806mg [Erythranthe guttata]
Length=430

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/398 (49%), Positives = 277/398 (70%), Gaps = 18/398 (5%)
 Frame = +1

Query  274   SSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYL  453
             S+H    K   NLE++E GLAR RAAI +A  +N       ++P G IYRNP+AFH+SY 
Sbjct  41    STHKQVHKN-GNLEKLEQGLARARAAINKAGRKN-----ASFIPSGSIYRNPYAFHQSYT  94

Query  454   EMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS--KFRTKNPEKAHVFFLPF  627
             EME+RFK++ Y+EGEPP+FH    +GI  +EG +I  LE S  +F   +P +AH FFLP 
Sbjct  95    EMERRFKVWTYKEGEPPLFHMGRMKGIYSMEGHMIDALEDSHNQFVAADPAEAHAFFLPV  154

Query  628   SSYSLVHFVFV-RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
                 ++HF++  R  +    + +   DY+  ++ KYP+WNRS G DHF LACHDW P +S
Sbjct  155   GVAEIIHFLYTPRINYNRNHLHRVVADYVTVVANKYPFWNRSSGADHFFLACHDWGPDVS  214

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPP-----PSNRSV  969
                P+L+KN IR +CNAN SEGF+P  DVSLPEI +P G    L  GPP     P+NR++
Sbjct  215   SANPELYKNFIRGLCNANVSEGFRPNRDVSLPEINVPPG----LALGPPDLNKSPNNRTI  270

Query  970   LVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASP  1149
             L F++GG HG++R+ +   W+ +D E+++HEYLPKN +Y+ ++ +SKYC+CPSGYEVASP
Sbjct  271   LAFFSGGAHGHVREKLFRHWKERDDEIQVHEYLPKNENYFELMSRSKYCLCPSGYEVASP  330

Query  1150  RMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQ  1329
             R++E+M+ GCVPV++ D YA PF+DVLDW  F+V +PV+ I  +KKIL  IP + YL  Q
Sbjct  331   RLIESMHAGCVPVIVSDGYALPFSDVLDWRRFSVHVPVERIAEIKKILKGIPMDVYLRKQ  390

Query  1330  EKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             ++ ++V+RHF  N P + YD+ HM+LHS+WLRRLN+ +
Sbjct  391   KQVLKVKRHFVFNRPSQPYDLMHMILHSLWLRRLNVRL  428



>ref|XP_009417384.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   416 bits (1070),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 265/365 (73%), Gaps = 4/365 (1%)
 Frame = +1

Query  337   RVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPV  507
             R RAAI++A    +    L D DYVP GP YR+ +AFHRSYLEMEK FK+++YEEGEPP+
Sbjct  2     RARAAIKEAFRNHSNVSPLFDKDYVPQGPSYRDAYAFHRSYLEMEKLFKVYVYEEGEPPL  61

Query  508   FHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPP  684
             FH    + I   EG  IH +++   FRT++P+ AHVFFLPFS   +V  ++   + +  P
Sbjct  62    FHDGPCRSIYSSEGRFIHGIDMDTWFRTRDPDLAHVFFLPFSVVKMVKLIYKPKSFDISP  121

Query  685   IQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTS  864
             I +T  DYI+ I+ +YPYWNRSLG DHFML+CHDW P  S     L+ +SIRV+CNANTS
Sbjct  122   ITRTIADYISVIAERYPYWNRSLGADHFMLSCHDWGPHASEAHSHLYGDSIRVLCNANTS  181

Query  865   EGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDP  1044
             EGF P  DVSLPEI L    M  ++GGP  S R VL F+AGG HG +R ++++ W+ +DP
Sbjct  182   EGFDPRKDVSLPEINLKTDVMADMMGGPSASRRPVLAFFAGGDHGPVRPLLLQAWKGRDP  241

Query  1045  EVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFAD  1224
              V++HEYLP+ VSYY M+R+S++C+CPSGYEVASPR+VEA+Y+GCVPV I   Y  PF+D
Sbjct  242   SVQVHEYLPRGVSYYAMMRRSRFCLCPSGYEVASPRVVEAIYLGCVPVTISHRYVLPFSD  301

Query  1225  VLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMV  1404
             VL+W  F+V +  ++IP+LK+IL +I   +Y+ MQ +   VRRHFEVN PP+R+DVFHM+
Sbjct  302   VLNWKAFSVQVSPEDIPDLKRILTAISPRQYIRMQRRVRMVRRHFEVNSPPRRFDVFHMI  361

Query  1405  LHSIW  1419
             LHS+W
Sbjct  362   LHSVW  366



>ref|XP_011085421.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Sesamum indicum]
Length=410

 Score =   417 bits (1072),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 197/387 (51%), Positives = 279/387 (72%), Gaps = 9/387 (2%)
 Frame = +1

Query  307   NLERVEAGLARVRAAIRQAQTENR----ILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
              +ER+EAGL++ RA I+ A  ++R    + +D DYVP G IYRN + F RSY+ MEK FK
Sbjct  25    KMERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYVFQRSYMLMEKMFK  84

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHF  651
             I++YEEGE P+FHY  S+ I   EGI +  +E  ++FRT + ++AHV+FLPFS   ++  
Sbjct  85    IYVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHVYFLPFSVVMILQH  144

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             +F     +   +++   DY++ +STKYPYWNRSLG DHFML+CHDW P  +     L+  
Sbjct  145   LFDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWGPRATWYEHHLYFT  204

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQ  1011
             S+RV+CNANTSE F P  D+S PEI L  G++ GL  G   SNR++L F+AG +HG IR 
Sbjct  205   SMRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGS--SNRTILAFFAGRLHGRIRP  262

Query  1012  VMMETWENKDPEVEIHEYLPKN--VSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             V+ + W++KD +V+++E LP+N  +SY  M+ +SKYC+CPSGYEVASPR+VEA+Y  CVP
Sbjct  263   VLFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVASPRIVEAIYAECVP  322

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             VLI ++Y  PF+DVLDWD F++ + V+E+P LK+IL+ I +++Y ++     QV+RHF V
Sbjct  323   VLISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKALHRGVRQVQRHFVV  382

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEVH  1446
             N PPKRYDVFHM++HS+WLRRLN+ ++
Sbjct  383   NDPPKRYDVFHMMIHSLWLRRLNLRIN  409



>ref|XP_004292977.1| PREDICTED: probable glycosyltransferase At5g25310-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   419 bits (1078),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 282/407 (69%), Gaps = 17/407 (4%)
 Frame = +1

Query  265   QLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDP--------DYVPHGPIY  420
             Q P       K+ +   ++E GLAR R++IR A   +    DP        D V HG +Y
Sbjct  93    QTPPREAAKRKRRSGRSKMEEGLARARSSIRTAAAAS---GDPNRSSPPQNDVVSHGVVY  149

Query  421   RNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS----KFRT  588
             RNP AFH+SYLEME++FK+++Y EG+ P+ H    + I  IEG  IH++E      +FRT
Sbjct  150   RNPRAFHQSYLEMERKFKVYVYSEGDLPITHDGPCKDIYSIEGRFIHEMETGAKAGRFRT  209

Query  589   KNPEKAHVFFLPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHF  768
             KNP++AHV+F+PFS   +V +++   +++  P+++   DY+  +S KYP+WNR+ G DHF
Sbjct  210   KNPKEAHVYFMPFSVTWMVKYLYKPLSYDLRPLREYVSDYVRLVSEKYPFWNRTSGADHF  269

Query  769   MLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGP  948
             MLACHDWAP  S G P L+  SIRV+CNANTSEGF+P  DVSLPEI+L  G +   +  P
Sbjct  270   MLACHDWAPHASAGNPFLYNTSIRVLCNANTSEGFRPQKDVSLPEIHLYGGYVSSKLISP  329

Query  949   PPSN--RSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCIC  1122
             PP+N  R  L F+AGG+HG IR ++++ W+ +D  + + EYLPK + Y  M+ +SK+C+C
Sbjct  330   PPTNTPRPYLAFFAGGLHGPIRPILLDYWKGRDESLRVFEYLPKTLDYNSMMLESKFCLC  389

Query  1123  PSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSI  1302
             PSG+EVASPR+VEA+Y  CVPV+I +HYA PF+DVL W+ F++ + V EI  LK+IL ++
Sbjct  390   PSGHEVASPRIVEAIYAECVPVIISEHYALPFSDVLRWEAFSIKVEVSEIKRLKEILEAV  449

Query  1303  PQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             P+EKY  +++    VR+HFE+N P KR+DVFHM++HS+WLRR+N+ V
Sbjct  450   PEEKYRWLKKNLKVVRKHFELNHPAKRFDVFHMIMHSVWLRRINLRV  496



>ref|XP_009346171.1| PREDICTED: probable glycosyltransferase At5g11130 [Pyrus x bretschneideri]
 ref|XP_009346172.1| PREDICTED: probable glycosyltransferase At5g11130 [Pyrus x bretschneideri]
Length=393

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 276/388 (71%), Gaps = 6/388 (2%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             K    E++E G+AR RAAIR+A         ++ D+VP G +Y NP++FH+S++EMEKRF
Sbjct  4     KKNQFEKIEDGMARTRAAIREAARSRSYTSYKNEDFVPRGSVYINPYSFHQSHIEMEKRF  63

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK---FRTKNPEKAHVFFLPFSSYSL  642
             +I+ Y+EGEPP+FH      I  IEG  + ++E+S    F  K+P++A  FFLP S  ++
Sbjct  64    RIWSYKEGEPPLFHQGPMNDIYSIEGQFMDEVELSGNSPFVAKDPDEAIAFFLPISVVNI  123

Query  643   VHFVFV-RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             V +V+    ++    +Q    DYI  IS KYPYWNRS G DHF+++CHDWAP IS G PK
Sbjct  124   VRYVYRPYTSYSRVRLQNIVEDYIRIISKKYPYWNRSNGADHFLVSCHDWAPDISAGHPK  183

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             + KN IRV+CNAN SEGF+P  DV LPEI +P G +   +   PP NRS+  F+AGG HG
Sbjct  184   ILKNLIRVLCNANCSEGFQPVRDVPLPEIKIPFGKLGSPLLTHPPKNRSIFAFFAGGDHG  243

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              +R+++ + W+NKD E+++H+YLPK ++Y  ++ ++K+C+CPSGYEVASPR+VEA+Y GC
Sbjct  244   DVRKILFKHWKNKDKEIQVHDYLPKTLNYTHIMAQTKFCMCPSGYEVASPRVVEAIYAGC  303

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPV+I D YA PF+DVLDW  F+V +PV  IP LK+IL S+ + +Y+  Q++ +QV+RHF
Sbjct  304   VPVIISDSYALPFSDVLDWSKFSVHVPVARIPELKEILQSVSEHEYVRKQKRVMQVQRHF  363

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              +N P K +D+ HMV+HS+W+RRLN+ +
Sbjct  364   VINRPAKPFDMLHMVMHSVWIRRLNLRL  391



>ref|XP_008242869.1| PREDICTED: probable glycosyltransferase At3g42180 [Prunus mume]
Length=407

 Score =   416 bits (1068),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/388 (52%), Positives = 276/388 (71%), Gaps = 8/388 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAFHRSYLEMEKR  468
             K  T+LER+E  LA+ RAAIR+A Q+ N   E  + ++P G IY+NP+AFH+S++EM K 
Sbjct  9     KNKTSLERIEEDLAQARAAIREAIQSRNYKSERTETFIPRGSIYKNPYAFHQSHIEMRKM  68

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSL  642
             FK++ Y+EGE P+ H      I GIEG  I ++E   S FR  +P++AH FFLP S  ++
Sbjct  69    FKVWSYKEGELPLVHIGPMTNIYGIEGHFIDEIEREESPFRATHPDQAHTFFLPVSVANI  128

Query  643   VHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
             V +V++    +  +    +Q+   DYI  ++ KYPYWNRS G DHFM +CHDW P IS G
Sbjct  129   VEYVYLPITRKQDYYRDRLQRIVVDYIGVVARKYPYWNRSHGADHFMASCHDWGPEISVG  188

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P+LFKN IRV+CNANTSEGF+P  DV LPEIY+P   +     G PP+NR +L F+AG 
Sbjct  189   QPELFKNFIRVLCNANTSEGFQPRRDVPLPEIYVPSRKLGPPYFGQPPNNRPILAFFAGR  248

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG IR ++++ W++KD EV++HE LP + +Y  ++ KSKYC+CPSG+EVASPR+VEA Y
Sbjct  249   VHGSIRPILLDNWKDKDDEVQVHEKLPLDQNYTKLMGKSKYCLCPSGFEVASPRVVEAFY  308

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI D+Y  PF+DVL+W  F++ IPV +IP +K IL  IP EKYL MQ++  +V+
Sbjct  309   AGCVPVLISDNYTLPFSDVLNWSQFSIQIPVAKIPEIKTILQGIPYEKYLRMQKRVSKVK  368

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             RHF +N P + +DV HMVLHS+WLRRLN
Sbjct  369   RHFVLNRPSQPFDVIHMVLHSVWLRRLN  396



>ref|XP_006600735.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
[Glycine max]
Length=499

 Score =   418 bits (1075),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/399 (50%), Positives = 285/399 (71%), Gaps = 18/399 (5%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA------QTENRILEDPDYVPHGPIYRNPHAFHRSY  450
              + K  +LE++E GLAR RA+I+++       + NR+    ++VP G IY NPHAFH+S+
Sbjct  99    TIMKYPSLEKIEEGLARARASIQESIRSRNYTSANRV----NFVPKGSIYLNPHAFHQSH  154

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFF  618
              EM KRFK+++YEEGE P+ H   +  I  IEG  I +++     S FR ++P++A VFF
Sbjct  155   EEMLKRFKVWVYEEGEQPLVHDGPANDIYSIEGQFIDEIDNDAKWSHFRAEHPDQAQVFF  214

Query  619   LPFSSYSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHD  786
             LPFS  ++VH+V+  +R   ++ PI  Q+   DYI  I+ KYPYWNRS G DHF+L+CHD
Sbjct  215   LPFSIANVVHYVYKPIRKHSDYEPIRLQRLVEDYIGVIANKYPYWNRSEGADHFLLSCHD  274

Query  787   WAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRS  966
             W P +S+G PKLFKN IRV+CNANTSEGF P  DVS+PE+YLP+G +     G  P++RS
Sbjct  275   WGPKVSYGNPKLFKNFIRVLCNANTSEGFLPNKDVSIPEVYLPKGKLGPPNLGQRPNDRS  334

Query  967   VLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVAS  1146
             +L F+AG  HG IR++++  W+ KD ++++HEYLPK  +Y  ++ +SK+C+CPSGYEVAS
Sbjct  335   ILAFFAGREHGDIRKILLNHWKGKDNDIQVHEYLPKGKNYTQLMGQSKFCLCPSGYEVAS  394

Query  1147  PRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSM  1326
             PR+VEA++ GCVPVLI   Y+ PF DVL+W  F+V+IPV++I  +K IL SI + +YL +
Sbjct  395   PRVVEAIHAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKISEIKTILQSISRNRYLRL  454

Query  1327  QEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
                 ++VRRHF +N P K +D+ HM+LHSIWLRRLN+ +
Sbjct  455   HMNVLRVRRHFMLNRPAKPFDLMHMILHSIWLRRLNLRL  493



>ref|XP_006856564.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
 gb|ERN18031.1| hypothetical protein AMTR_s00046p00183980 [Amborella trichopoda]
Length=462

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/381 (51%), Positives = 275/381 (72%), Gaps = 6/381 (2%)
 Frame = +1

Query  319   VEAGLARVRAAIRQAQTE--NRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEE  492
             +EAGLAR R AI+ A +   + ++ DP + P   I+RNP AFHRSYLEME R KIF+Y+E
Sbjct  81    IEAGLARARKAIKDAASNPNSSLINDPLFSPDPQIFRNPAAFHRSYLEMENRLKIFVYKE  140

Query  493   GEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSLVHFVFVRD  666
             GEPP+ H    + I  IEG  IH+LE+  S F TK PE+AH++FLP S   +V +++   
Sbjct  141   GEPPLVHDGPCKNIYTIEGRFIHELELGTSSFLTKKPEQAHLYFLPLSVTQMVTYLYKPL  200

Query  667   AHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVM  846
             +++  P+++   DY++ IS+++P+WN SLG DHF L+CHDWAP +S     L+  SIRV+
Sbjct  201   SYDLTPLKRFVSDYVSLISSRHPFWNASLGADHFFLSCHDWAPHVSRSNHNLYNTSIRVL  260

Query  847   CNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGP--PPSNRSVLVFYAGGIHGYIRQVMM  1020
             CNANTSEGF P+ D+SLPEI L  G +   +  P  P   R +L F+AGG+HG IR +++
Sbjct  261   CNANTSEGFNPSKDISLPEINLRTGELPAQLLTPADPRHPRPILAFFAGGLHGPIRPLLL  320

Query  1021  ETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKD  1200
             + W++KDP++++++YLPK ++YY ++ KSKYC+CPSGYEVASPR+VEA++ GCVPVLI +
Sbjct  321   QQWQSKDPDIKVYQYLPKGLNYYDLMSKSKYCLCPSGYEVASPRVVEAIHSGCVPVLISN  380

Query  1201  HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPK  1380
              Y  PF+DVL W+ F V + + EIP +K+IL  IP+ +Y  ++E   +VRRHF +N P +
Sbjct  381   SYVLPFSDVLRWEAFTVSLSLSEIPRVKEILEGIPEGEYQRLRENLGRVRRHFVLNQPAQ  440

Query  1381  RYDVFHMVLHSIWLRRLNIEV  1443
             R DVFHMV+HS+WLRRLN+ +
Sbjct  441   RLDVFHMVMHSLWLRRLNLRM  461



>ref|XP_003550809.2| PREDICTED: probable glycosyltransferase At3g42180-like [Glycine 
max]
Length=460

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/393 (50%), Positives = 278/393 (71%), Gaps = 10/393 (3%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             KK T+ + VE GLA+ RA+IR+A   +  +   +   ++P G IYRNPHAFH+S++EM K
Sbjct  64    KKRTSFDVVEEGLAKARASIREAILYRNHSNSGKQEHFIPKGSIYRNPHAFHQSHMEMVK  123

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK---FRTKNPEKAHVFFLPFSSY  636
             RFK+++YEEGE P+ HY     I  IEG  I +++ SK   F+ +NP++AH FFLP S  
Sbjct  124   RFKVWVYEEGEQPLVHYGPVNDIYAIEGQFIDEIDNSKRSPFKARNPDEAHAFFLPLSVV  183

Query  637   SLVHFVF----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             ++VH+V+     ++ +    +Q+   DYI  ++ KYPYWNRS G DHF+L+CHDWAP IS
Sbjct  184   NVVHYVYKPYMSQNDYSRDRLQRLVEDYIGVVADKYPYWNRSNGADHFLLSCHDWAPEIS  243

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
             H  P LFKN IRV+CNAN SEGF+P  DVS+PE+YLP G +     G  P NR++L F++
Sbjct  244   HANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLPVGKLGPPNLGQHPMNRTILAFFS  303

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG HG IR+++++ W++KD  V++HEYLPK  +Y  ++  SK+C+CPSGYEVASPR+VEA
Sbjct  304   GGAHGDIRKLLLKHWKDKDNHVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRVVEA  363

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +  GCVPV+I ++Y+ PF+DVL+W  F++ I V+ I ++K IL ++ Q+KY  +     +
Sbjct  364   INAGCVPVIISENYSLPFSDVLNWSQFSIQISVENISDIKTILQNVTQKKYKKLHRNVRR  423

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             V+RHF +N P K +D+ HM+LHSIWLRRLN  V
Sbjct  424   VQRHFVMNRPAKPFDLMHMILHSIWLRRLNFRV  456



>ref|XP_010250234.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X2 
[Nelumbo nucifera]
Length=483

 Score =   418 bits (1074),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/403 (50%), Positives = 281/403 (70%), Gaps = 16/403 (4%)
 Frame = +1

Query  244   GFSMPFYQL-PSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENR--ILEDPDYVPHGP  414
             G  +P ++  P++  D   K  +L+++E GLAR RAAI QA   +    L + +++P G 
Sbjct  73    GSPVPSFEFSPTTVTDTRIKKGSLDKIEEGLARARAAILQAVRSHNCTTLTEDEFIPRGS  132

Query  415   IYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRT  588
             IYRNP AFH+S++EMEKRFK+++Y+EGEPP+ H      I   EG  I +++   S F  
Sbjct  133   IYRNPFAFHQSHIEMEKRFKVWVYKEGEPPLVHDGPLNNIYSTEGQFIDEMDNGHSPFLA  192

Query  589   KNPEKAHVFFLPFSSYSLVHFVF------VRDAHEWPPIQKTARDYINGISTKYPYWNRS  750
             ++P++AH FFLP S  ++V F++       RD      +Q    DYI  IS+KYPYWN S
Sbjct  193   RHPDEAHAFFLPLSVVNVVRFIYKPVTSYARDR-----LQHVVEDYIGVISSKYPYWNIS  247

Query  751   LGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMD  930
              G DHFM++CHDWAP +S   P+LFK+ IRV+CNAN +EGF+P ID SLPEI  P G + 
Sbjct  248   QGADHFMVSCHDWAPDVSDANPELFKHFIRVLCNANITEGFRPGIDASLPEINTPFGTLG  307

Query  931   GLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSK  1110
                 G  P  R++L F+AGG HGYIR+V+++ W++KD +V++HEYLPK ++Y  ++ +SK
Sbjct  308   QPNFGQAPHKRTLLAFFAGGAHGYIRRVLLQQWKDKDKDVQVHEYLPKGMNYTRLMGQSK  367

Query  1111  YCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKI  1290
             +C+CPSGYEVASPR+VEA+Y GCVP +I D+Y  PF+DVLDW  F+V IPV++IP +K I
Sbjct  368   FCLCPSGYEVASPRIVEAIYAGCVPAIISDNYWLPFSDVLDWSQFSVQIPVEKIPEIKTI  427

Query  1291  LLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIW  1419
             L  I Q+KYL MQ+K  +V+RHF +N P +R+DV HM+LHS+W
Sbjct  428   LQGISQDKYLKMQKKVRRVQRHFVLNRPAQRFDVIHMILHSVW  470



>ref|XP_003550810.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X1 [Glycine max]
Length=496

 Score =   418 bits (1074),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 286/393 (73%), Gaps = 10/393 (3%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K LT+LE++E GLA+ RA+I++              +VP G IYRNPHAF +S++EM KR
Sbjct  101   KDLTSLEKIEEGLAQARASIQEYILSRNYTSQRRESFVPKGSIYRNPHAFLQSHIEMVKR  160

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFSSY  636
             FK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+AHVFFLPFS  
Sbjct  161   FKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEAHVFFLPFSIA  220

Query  637   SLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             ++VH+V+  +    ++ P+  Q    DYI+ I  KYPYWNRS G DHF+L+CHDWAP +S
Sbjct  221   NVVHYVYKPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFLLSCHDWAPKVS  280

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
             +G P+LF++ IR +CNANTSEGF P  DVS+PE+YLP G +     G  P++R++L F+A
Sbjct  281   NGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPPSLGQHPNSRTILAFFA  340

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR+++++ W++KD EV +HEYLPK+ +Y  ++ +SK+C+CPSG+EVASPR+VEA
Sbjct  341   GGVHGEIRKILLKHWKDKDNEVRVHEYLPKSQNYTKLMGQSKFCLCPSGHEVASPRVVEA  400

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             ++ GCVPV+I D+Y+ PF+DVL W  F+V + V++IP +K IL SI ++KYL +    ++
Sbjct  401   IHAGCVPVIICDNYSLPFSDVLHWSQFSVKVSVQKIPEIKSILQSISRKKYLRLHMNVLR  460

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             VRRHF +N P K +D+ HM+LHSIWLRRLNI++
Sbjct  461   VRRHFMINRPAKPFDMMHMILHSIWLRRLNIKL  493



>ref|XP_006594253.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X1 [Glycine max]
Length=487

 Score =   417 bits (1073),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 198/395 (50%), Positives = 288/395 (73%), Gaps = 11/395 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAF-HRSYLEME  462
             ++ LT+LE++E  LA+ RA+I+++  + N   +  + +VP G IYRNPHAF HRS++EM 
Sbjct  90    IQDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLHRSHIEMV  149

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFS  630
             KRFK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+AHVFFLP S
Sbjct  150   KRFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPIS  209

Query  631   SYSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
               ++VH+V+  +    ++ P+  Q    DYI  I  KYPYWNRS+G DHF+L+CHDW P 
Sbjct  210   IANVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPK  269

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
             +S+G P+LF+  IR +CNANTSEGF P  DVS+PE+YLP G +     G  P++R+ L F
Sbjct  270   VSYGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAF  329

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AGG+HG IR+++++ W++KD EV +HEYLPK   Y  ++ +SK+C+CPSG+EVASPR+V
Sbjct  330   FAGGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVV  389

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA++ GCVPV+I D+Y+ PF+DVL+W  F+V+IPV++IP +K IL SI + KYL +    
Sbjct  390   EAIHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNV  449

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             ++VRRHF +N P K +D+ HM+LHSIWLRRLNI++
Sbjct  450   LRVRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  484



>ref|XP_010250233.1| PREDICTED: probable glycosyltransferase At5g20260 isoform X1 
[Nelumbo nucifera]
Length=484

 Score =   417 bits (1071),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/404 (50%), Positives = 283/404 (70%), Gaps = 17/404 (4%)
 Frame = +1

Query  244   GFSMPFYQL-PSSHPDA-MKKLTNLERVEAGLARVRAAIRQAQTENR--ILEDPDYVPHG  411
             G  +P ++  P++  D  +KK  +L+++E GLAR RAAI QA   +    L + +++P G
Sbjct  73    GSPVPSFEFSPTTVTDTRIKKKGSLDKIEEGLARARAAILQAVRSHNCTTLTEDEFIPRG  132

Query  412   PIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFR  585
              IYRNP AFH+S++EMEKRFK+++Y+EGEPP+ H      I   EG  I +++   S F 
Sbjct  133   SIYRNPFAFHQSHIEMEKRFKVWVYKEGEPPLVHDGPLNNIYSTEGQFIDEMDNGHSPFL  192

Query  586   TKNPEKAHVFFLPFSSYSLVHFVF------VRDAHEWPPIQKTARDYINGISTKYPYWNR  747
              ++P++AH FFLP S  ++V F++       RD      +Q    DYI  IS+KYPYWN 
Sbjct  193   ARHPDEAHAFFLPLSVVNVVRFIYKPVTSYARDR-----LQHVVEDYIGVISSKYPYWNI  247

Query  748   SLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNM  927
             S G DHFM++CHDWAP +S   P+LFK+ IRV+CNAN +EGF+P ID SLPEI  P G +
Sbjct  248   SQGADHFMVSCHDWAPDVSDANPELFKHFIRVLCNANITEGFRPGIDASLPEINTPFGTL  307

Query  928   DGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKS  1107
                  G  P  R++L F+AGG HGYIR+V+++ W++KD +V++HEYLPK ++Y  ++ +S
Sbjct  308   GQPNFGQAPHKRTLLAFFAGGAHGYIRRVLLQQWKDKDKDVQVHEYLPKGMNYTRLMGQS  367

Query  1108  KYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKK  1287
             K+C+CPSGYEVASPR+VEA+Y GCVP +I D+Y  PF+DVLDW  F+V IPV++IP +K 
Sbjct  368   KFCLCPSGYEVASPRIVEAIYAGCVPAIISDNYWLPFSDVLDWSQFSVQIPVEKIPEIKT  427

Query  1288  ILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIW  1419
             IL  I Q+KYL MQ+K  +V+RHF +N P +R+DV HM+LHS+W
Sbjct  428   ILQGISQDKYLKMQKKVRRVQRHFVLNRPAQRFDVIHMILHSVW  471



>gb|KGN60712.1| hypothetical protein Csa_2G008045 [Cucumis sativus]
Length=460

 Score =   416 bits (1069),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 274/390 (70%), Gaps = 18/390 (5%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILEDPD--YVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             T+L+ +EA LA  RA+IR+A        +    Y+P GPIYRNP+AFH+S++EM KRFK+
Sbjct  71    TSLKMIEASLAEARASIRKAVLWKNFTSEKKETYIPRGPIYRNPYAFHQSHIEMVKRFKV  130

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSLVHF  651
             + Y EGE P+FH      I  IEG  I +L+ SK  FR  +P++AHVF LP S  +++HF
Sbjct  131   WSYREGEQPLFHDGPLNSIYAIEGQFIDELDCSKSPFRASHPDEAHVFLLPLSITNIIHF  190

Query  652   VFV---------RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             ++          RD      + +   DYI  ++ +YPYWNRS G DHF+++CHDWAP IS
Sbjct  191   IYRPITSPADYNRDR-----MHRVTTDYIRVVANRYPYWNRSNGADHFVVSCHDWAPEIS  245

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P+LFKN IRV+CNAN +EGF+P ID+ LPEI +  G +     G PP  R +L F+A
Sbjct  246   DANPQLFKNFIRVVCNANITEGFRPNIDIPLPEINIHPGTLGPPDLGQPPERRPILAFFA  305

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG HGYIR+++++ W+ KD EV++HEYLPK  +Y  ++ +SK+C+CPSGYEVASPR+VEA
Sbjct  306   GGAHGYIRKILIKHWKEKDNEVQVHEYLPKTQNYTKLIGESKFCLCPSGYEVASPRVVEA  365

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPV+I D+Y+ PF+DVLDW  F+V IPV+ IP +K IL +I +EKYL + +  I+
Sbjct  366   IYGGCVPVIISDNYSLPFSDVLDWSRFSVQIPVQRIPEIKTILKAISEEKYLKLYKGVIK  425

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             V+RHF++N P K +DV HM+LHS+WLRRLN
Sbjct  426   VKRHFKINRPAKPFDVIHMLLHSLWLRRLN  455



>ref|XP_006600734.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X2 [Glycine max]
Length=495

 Score =   417 bits (1072),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 287/394 (73%), Gaps = 10/394 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++ LT+LE++E GLA+ RA+I++              +VP G IYRNPHAF +S++EM K
Sbjct  99    IQDLTSLEKIEEGLAQARASIQEYILSRNYTSQRRESFVPKGSIYRNPHAFLQSHIEMVK  158

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFSS  633
             RFK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+AHVFFLPFS 
Sbjct  159   RFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEAHVFFLPFSI  218

Query  634   YSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+V+  +    ++ P+  Q    DYI+ I  KYPYWNRS G DHF+L+CHDWAP +
Sbjct  219   ANVVHYVYKPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFLLSCHDWAPKV  278

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S+G P+LF++ IR +CNANTSEGF P  DVS+PE+YLP G +     G  P++R++L F+
Sbjct  279   SNGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPPSLGQHPNSRTILAFF  338

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG IR+++++ W++KD EV +HEYLPK+ +Y  ++ +SK+C+CPSG+EVASPR+VE
Sbjct  339   AGGVHGEIRKILLKHWKDKDNEVRVHEYLPKSQNYTKLMGQSKFCLCPSGHEVASPRVVE  398

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A++ GCVPV+I D+Y+ PF+DVL W  F+V + V++IP +K IL SI ++KYL +    +
Sbjct  399   AIHAGCVPVIICDNYSLPFSDVLHWSQFSVKVSVQKIPEIKSILQSISRKKYLRLHMNVL  458

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VRRHF +N P K +D+ HM+LHSIWLRRLNI++
Sbjct  459   RVRRHFMINRPAKPFDMMHMILHSIWLRRLNIKL  492



>gb|KHN47102.1| Xylogalacturonan beta-1,3-xylosyltransferase [Glycine soja]
Length=486

 Score =   417 bits (1071),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 287/394 (73%), Gaps = 10/394 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAFHRSYLEMEK  465
             ++ LT+LE++E  LA+ RA+I+++  + N   +  + +VP G IYRNPHAF +S++EM K
Sbjct  90    IQDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVK  149

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFSS  633
             RFK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+AHVFFLP S 
Sbjct  150   RFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISI  209

Query  634   YSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+V+  +    ++ P+  Q    DYI  I  KYPYWNRS+G DHF+L+CHDW P +
Sbjct  210   ANVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKV  269

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S+G P+LF+  IR +CNANTSEGF P  DVS+PE+YLP G +     G  P++R+ L F+
Sbjct  270   SYGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFF  329

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG IR+++++ W++KD EV +HEYLPK   Y  ++ +SK+C+CPSG+EVASPR+VE
Sbjct  330   AGGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVE  389

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A++ GCVPV+I D+Y+ PF+DVL+W  F+V+IPV++IP +K IL SI + KYL +    +
Sbjct  390   AIHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVL  449

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VRRHF +N P K +D+ HM+LHSIWLRRLNI++
Sbjct  450   RVRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  483



>ref|XP_006594254.1| PREDICTED: xylogalacturonan beta-1,3-xylosyltransferase-like 
isoform X2 [Glycine max]
Length=486

 Score =   417 bits (1071),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/394 (50%), Positives = 287/394 (73%), Gaps = 10/394 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAFHRSYLEMEK  465
             ++ LT+LE++E  LA+ RA+I+++  + N   +  + +VP G IYRNPHAF +S++EM K
Sbjct  90    IQDLTSLEKIEESLAQARASIQESILSRNYTSQRREIFVPKGSIYRNPHAFLQSHIEMVK  149

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFSS  633
             RFK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+AHVFFLP S 
Sbjct  150   RFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEMDNNGKWSQFRARHPEEAHVFFLPISI  209

Query  634   YSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+V+  +    ++ P+  Q    DYI  I  KYPYWNRS+G DHF+L+CHDW P +
Sbjct  210   ANVVHYVYKPILKQSDYEPVRLQHLVEDYIGVIQDKYPYWNRSIGADHFLLSCHDWGPKV  269

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S+G P+LF+  IR +CNANTSEGF P  DVS+PE+YLP G +     G  P++R+ L F+
Sbjct  270   SYGNPELFQTFIRALCNANTSEGFHPNRDVSIPEVYLPVGKLGPASLGQHPNSRTTLAFF  329

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG+HG IR+++++ W++KD EV +HEYLPK   Y  ++ +SK+C+CPSG+EVASPR+VE
Sbjct  330   AGGVHGEIRKILLKHWKDKDNEVLVHEYLPKGQDYTKLMGQSKFCLCPSGHEVASPRVVE  389

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A++ GCVPV+I D+Y+ PF+DVL+W  F+V+IPV++IP +K IL SI + KYL +    +
Sbjct  390   AIHAGCVPVIICDNYSLPFSDVLNWSQFSVEIPVEKIPEIKSILQSISRNKYLRLHMNVL  449

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VRRHF +N P K +D+ HM+LHSIWLRRLNI++
Sbjct  450   RVRRHFMINRPTKPFDMMHMILHSIWLRRLNIKL  483



>gb|KHN47103.1| Putative glycosyltransferase [Glycine soja]
Length=468

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 281/394 (71%), Gaps = 10/394 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +KK T+ + VE GLA+ RA+IR+A   +  +   +  D++P G IYRNPHAFH+S++EM 
Sbjct  71    IKKRTSFDVVEEGLAKARASIREAILSRNHSNSGKQEDFIPKGSIYRNPHAFHQSHIEMV  130

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK---FRTKNPEKAHVFFLPFSS  633
             KRFK+++YEEG+ P+ HY     I  IEG  I +++ SK   F+ KNP++AH FFLPFS 
Sbjct  131   KRFKVWVYEEGDQPLVHYGPVNDIYAIEGQFIDEMDNSKRSPFKAKNPDEAHAFFLPFSV  190

Query  634   YSLVHFVF----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+V+     ++ +    +Q+   DYI  ++ KYPYWNRS G DHF+L+CHDWAP I
Sbjct  191   VNVVHYVYKPYMSQNDYRRDRLQRLVEDYIVVVADKYPYWNRSNGADHFLLSCHDWAPEI  250

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             SH  P LFKN IRV+CNAN SEGF+P  DVS+PE+YL  G +     G  P NR++L F+
Sbjct  251   SHANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLSVGKLGPPNLGQHPMNRTILAFF  310

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             +GG HG IR+++++ W++KD +V++HEYLPK  +Y  ++  SK+C+CPSGYEVASPR+VE
Sbjct  311   SGGAHGDIRKLLLKHWKDKDNQVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRVVE  370

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+   CVPV+I ++Y+ PF+DVL+W  F++ I V+ IP++K IL ++ Q+KY  +     
Sbjct  371   AINAVCVPVIISENYSLPFSDVLNWSQFSIQISVENIPDIKTILQNVTQKKYKKLYRNVR  430

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VRRHF ++ P K +D+ HM++HSIWLRRLN  +
Sbjct  431   RVRRHFVMHRPAKPFDLMHMIIHSIWLRRLNFRL  464



>ref|XP_011085420.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Sesamum indicum]
Length=513

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 279/386 (72%), Gaps = 9/386 (2%)
 Frame = +1

Query  310   LERVEAGLARVRAAIRQAQTENR----ILEDPDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             +ER+EAGL++ RA I+ A  ++R    + +D DYVP G IYRN + F RSY+ MEK FKI
Sbjct  129   MERIEAGLSKARAFIKDAILKSRYSPPLAQDTDYVPRGDIYRNAYVFQRSYMLMEKMFKI  188

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSSYSLVHFV  654
             ++YEEGE P+FHY  S+ I   EGI +  +E  ++FRT + ++AHV+FLPFS   ++  +
Sbjct  189   YVYEEGEAPLFHYGPSKDIYSTEGIFLGLIESNTQFRTYDADEAHVYFLPFSVVMILQHL  248

Query  655   FVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNS  834
             F     +   +++   DY++ +STKYPYWNRSLG DHFML+CHDW P  +     L+  S
Sbjct  249   FDPVTRDKGVLERVVGDYVHIVSTKYPYWNRSLGADHFMLSCHDWGPRATWYEHHLYFTS  308

Query  835   IRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQV  1014
             +RV+CNANTSE F P  D+S PEI L  G++ GL  G   SNR++L F+AG +HG IR V
Sbjct  309   MRVLCNANTSEFFNPRKDISFPEINLRTGDLTGLTSGS--SNRTILAFFAGRLHGRIRPV  366

Query  1015  MMETWENKDPEVEIHEYLPKN--VSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPV  1188
             + + W++KD +V+++E LP+N  +SY  M+ +SKYC+CPSGYEVASPR+VEA+Y  CVPV
Sbjct  367   LFQHWKDKDSDVKVYERLPENSPLSYKEMMERSKYCLCPSGYEVASPRIVEAIYAECVPV  426

Query  1189  LIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVN  1368
             LI ++Y  PF+DVLDWD F++ + V+E+P LK+IL+ I +++Y ++     QV+RHF VN
Sbjct  427   LISENYVLPFSDVLDWDKFSIKVSVRELPELKRILMGIGEDEYKALHRGVRQVQRHFVVN  486

Query  1369  FPPKRYDVFHMVLHSIWLRRLNIEVH  1446
              PPKRYDVFHM++HS+WLRRLN+ ++
Sbjct  487   DPPKRYDVFHMMIHSLWLRRLNLRIN  512



>ref|XP_008336982.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   412 bits (1060),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/397 (51%), Positives = 282/397 (71%), Gaps = 10/397 (3%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYRNPHAFHRSYLEM  459
             +  K  T+L+ +E GLA+ RAAI +A    +    ++  ++P G IY+NP+AFH+S++EM
Sbjct  9     NLTKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEM  68

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
              KRFK++ Y+EGE P+ H+     I GIEG  I ++E   S FR  +P++AH FFLPFS 
Sbjct  69    MKRFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSV  128

Query  634   YSLVHFVFV-----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
              ++V +V +     +D H    +Q+   DYI+ ++ KYPYWNRS G DHFM +CHDWAP 
Sbjct  129   ANVVRYVHMPITRKQDYHR-DRLQRVVTDYISVVADKYPYWNRSNGADHFMASCHDWAPE  187

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
             +S   P+LFKN IRV+CNANTSEGF    DVSLP IYLP+GN+D    G  P +R +L F
Sbjct  188   VSIENPELFKNFIRVLCNANTSEGFXLKRDVSLPXIYLPKGNLDPPNLGQAPKSRPILAF  247

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG +R ++++ W++KD EV+++E LPK ++Y   + +SK+C+CPSG+EVASPR+V
Sbjct  248   FAGRVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIV  307

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y GCVPVLI D+Y   F+DVLDW  F+V IPV +IP +K IL +IP +KYL MQ++ 
Sbjct  308   EAIYAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRV  367

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +VRRHF +N P K +DV HMVLHS+WLRRLN ++ +
Sbjct  368   YRVRRHFVLNXPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>ref|XP_006856554.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
 gb|ERN18021.1| hypothetical protein AMTR_s00046p00173940 [Amborella trichopoda]
Length=505

 Score =   416 bits (1070),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/382 (52%), Positives = 264/382 (69%), Gaps = 3/382 (1%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQAQ--TENRILEDPDYVPHGPIYRNPHAFHRSYLE  456
             P   +K    ERVEA L R RA+I++A     +    D   VP G +YRNPHAF++SY++
Sbjct  114   PTMREKQGGFERVEAQLVRARASIKRAAKFCNDSCYGDDPLVPKGAVYRNPHAFYQSYID  173

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI-SKFRTKNPEKAHVFFLPFSS  633
             MEK  KI+IY+EGEPP+ HY   + I  IEG  IH+ E  ++F T +PE AH+ F+P S 
Sbjct  174   MEKTLKIWIYKEGEPPLAHYGPLKYIYSIEGQFIHEFESRNQFITSDPEIAHLHFIPLSV  233

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V  ++  + +   P+ +T  DY+  IS KYP+WNR+ G DHF+L+CHDWAP    G 
Sbjct  234   TKMVQTLYPPNGYGSGPLHRTVSDYVKVISCKYPFWNRTRGADHFILSCHDWAPDALKGN  293

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
               L  NSIRV CNANTSEGF    DVS+PEI+L    +D LIGGP PS R+VL F+AGG 
Sbjct  294   RDLQHNSIRVFCNANTSEGFDRRRDVSMPEIHLKGWEIDDLIGGPSPSRRTVLAFFAGGE  353

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HGYIR V++E W++KD EV +HEYLPK  SY  +++++K+C+CPSG+EVASPR+VEA+Y 
Sbjct  354   HGYIRSVLLEHWKDKDSEVRVHEYLPKGKSYSKLMKQAKFCLCPSGWEVASPRIVEAIYS  413

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
             GCVPV I   Y  PF+DVLDW  F+V+IPV  IP +K IL  I Q +YL +Q + +QV+ 
Sbjct  414   GCVPVTISASYILPFSDVLDWSKFSVNIPVSRIPEIKTILKGISQRRYLQLQRRVLQVQH  473

Query  1354  HFEVNFPPKRYDVFHMVLHSIW  1419
             HF +N P KR+DV HM+LHSIW
Sbjct  474   HFVLNRPAKRFDVIHMILHSIW  495



>ref|XP_008336981.1| PREDICTED: probable glycosyltransferase At3g42180 [Malus domestica]
Length=404

 Score =   412 bits (1059),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 279/395 (71%), Gaps = 11/395 (3%)
 Frame = +1

Query  280   HPDAM-KKLTNLERVEAGLARVRAAIRQA-QTENRILE-DPDYVPHGPIYRNPHAFHRSY  450
             H D + K  T+LER+E  LA+ RAAIR+A Q+ N   E +  +VP G IY+N +AFH+S+
Sbjct  6     HRDNLTKNKTSLERIEEDLAKARAAIREAIQSRNYTSEREETFVPRGSIYKNSYAFHQSH  65

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLP  624
             +EM KRFK++ Y+EGE P+ H    + I GIEG  I ++E   S FR  +P++AH FFLP
Sbjct  66    IEMRKRFKVWTYKEGELPLIHMGPMKDIYGIEGHFIDEIEREESPFRAMHPDEAHTFFLP  125

Query  625   FSSYSLVHFVF-----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDW  789
             FS  ++V +V+     ++D H    +Q+   DYI  ++TKY YWNRS G DHFM +CHDW
Sbjct  126   FSVANIVEYVYLPITRIQDYH-LDRLQRVVIDYIGIVATKYRYWNRSDGADHFMASCHDW  184

Query  790   APTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSV  969
             AP IS G  KL KN IRV+CNANTSEGFKP  DVS+PE+Y+    +     G  P+NR +
Sbjct  185   APRISLGHSKLLKNFIRVLCNANTSEGFKPQRDVSMPEVYVLPRELGPPDLGQAPNNRQI  244

Query  970   LVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASP  1149
             L F+AG +HG IR V++  W++KD EV++HE LP++ +Y  ++ +SKYC+CPSG+EVASP
Sbjct  245   LAFFAGRVHGPIRTVLLHYWKDKDDEVQVHEKLPQDQNYTKLMGQSKYCLCPSGFEVASP  304

Query  1150  RMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQ  1329
             R VEA++ GCVPVLI D+Y  PF DVLDW  F+V IPV +IP +K IL +IP E YL MQ
Sbjct  305   RAVEAIHAGCVPVLISDNYTLPFNDVLDWSQFSVQIPVAKIPEIKTILRAIPYENYLKMQ  364

Query  1330  EKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             ++  +V+RHF +N P + +DV HM+LHS+WLRRLN
Sbjct  365   KRVSKVKRHFVLNRPSEPFDVIHMILHSVWLRRLN  399



>gb|KHG09514.1| hypothetical protein F383_01906 [Gossypium arboreum]
Length=484

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 272/389 (70%), Gaps = 10/389 (3%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRI-----LEDPDYVPHGPIYRNPHAFHRSYLEM  459
             KKL+  + +E GLAR RA+IR A     +     + D D VP G +YRNP  F++SY+EM
Sbjct  89    KKLSKEQVLEQGLARARASIRSAAIARIVRTAFFMNDND-VPVGDVYRNPSTFYQSYVEM  147

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSS  633
             E+RFK+++Y EGE P+ H    + +  IEG  IH++E    +FRT +P++AHV+F+PFS 
Sbjct  148   ERRFKVYVYSEGELPIVHDGPCKNLYTIEGRFIHEMEHGAKRFRTNDPQRAHVYFMPFSV  207

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V +++   + +  P++    DY+  IS KYP+WNR+ G DHFMLACHDW P  S G 
Sbjct  208   AWMVKYIYTPLSFDITPLKHFVSDYVKVISIKYPFWNRTHGADHFMLACHDWGPHASQGN  267

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFYAG  987
               L+ NSIRV+CNAN SEGF P  DVSLPEI L  G +   +  PPP N  R    F+AG
Sbjct  268   SLLYNNSIRVLCNANISEGFNPQKDVSLPEISLIGGYLSHKLIHPPPPNTSRPYFAFFAG  327

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
             G+HG IR  +++ W+ +D +++++EYLPKN  YY  + +SK+C+CPSGYEVASPR+VEA+
Sbjct  328   GLHGPIRPYLLQHWKGRDNDMQVYEYLPKNKDYYSYMLESKFCLCPSGYEVASPRIVEAI  387

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y GCVPV++ D+Y  PF+DVL W+ F+V +   +IP LK+IL +IP+EKY  +QE  I V
Sbjct  388   YSGCVPVILSDNYVLPFSDVLQWEAFSVQVETTKIPRLKEILSAIPEEKYRKLQEGVIVV  447

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             RRHF +N PPKR+DVFHM+LHSIW+RR+N
Sbjct  448   RRHFMLNRPPKRFDVFHMILHSIWVRRIN  476



>ref|XP_007013568.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31187.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/393 (51%), Positives = 275/393 (70%), Gaps = 15/393 (4%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTENRI-LEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             KK ++LERVE GL + R AIR+A +++N    ++  Y+P G IYRNP+AFH+S++EMEKR
Sbjct  94    KKKSSLERVEDGLTKAREAIREAIRSQNYTSYKEETYIPRGTIYRNPYAFHQSHIEMEKR  153

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSL  642
             FK+++Y EGEPP+ H      I GIEG  I ++E  K  F  ++P++AH F +P S   +
Sbjct  154   FKVWVYREGEPPLVHGGPVNNIYGIEGQFIEEMESEKNHFLARHPDEAHAFLIPVSVAKI  213

Query  643   VHFVFV-RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +  +++    +    +Q+   DY+  I+ KYPYWNRS G DHF+++CHDWAP I    P+
Sbjct  214   IKLLYMPLITYSRDQLQRVVTDYVGVIADKYPYWNRSNGADHFLVSCHDWAPDIGDANPE  273

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPP-----PSNRSVLVFYA  984
             LFKN IRV+CNANTSE ++P  DVS+PEI +P+G +     GPP     P  RS+L F+A
Sbjct  274   LFKNFIRVLCNANTSEKYRPQRDVSMPEIIIPKGEL-----GPPLLDLSPRERSILAFFA  328

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG HG IR+V++E W++KD EV +HEYLP N  Y+ ++ +SK+C+CPSGYEVASPR+  A
Sbjct  329   GGAHGSIRKVLLEHWKDKDNEVRVHEYLPSNTDYFKLMGESKFCLCPSGYEVASPRVATA  388

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             + +GCVPV+I D+YA PF+DVLDW  F+V IP K IP +K IL  I   KYL MQ++  Q
Sbjct  389   ISVGCVPVIISDYYALPFSDVLDWSKFSVYIPSKRIPEIKTILKGISDRKYLKMQKRVRQ  448

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             V+RHF +N P   +DV HM+LHS+WLRRLN  +
Sbjct  449   VQRHFVLNRPALPFDVIHMLLHSVWLRRLNFRL  481



>ref|XP_002515489.1| catalytic, putative [Ricinus communis]
 gb|EEF46938.1| catalytic, putative [Ricinus communis]
Length=481

 Score =   414 bits (1065),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 279/388 (72%), Gaps = 5/388 (1%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKRF  471
             + KL+  E +E GLAR RA+IR+A T    +   D V    IYRNP AF++SY+EME+RF
Sbjct  94    ISKLSREEELEQGLARARASIRKAVTFGSDVNRSDVV-RNVIYRNPAAFYQSYMEMERRF  152

Query  472   KIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLV  645
             K+++Y EG+PP+ H    + I  IEG  IH++E    ++RT++P++AHV+F+PFS   +V
Sbjct  153   KVYVYSEGDPPIVHDGPCKDIYTIEGRFIHEMEHGARRYRTRDPKRAHVYFMPFSVTWMV  212

Query  646   HFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLF  825
              +++    ++  P+++   DY+  +STKYP+WNR+ G DHFMLACHDW P  S G   L+
Sbjct  213   KYLYKPLTYDHSPLRQFVADYVRVLSTKYPFWNRTHGADHFMLACHDWGPHASRGDHLLY  272

Query  826   KNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFYAGGIHG  999
               SIRV+CNANTSEGF P  DVSLPEI+L  GN+   +  PPP+N  R  L F+AGG+HG
Sbjct  273   NTSIRVLCNANTSEGFNPRKDVSLPEIHLYGGNVPPQLLSPPPANTTRPHLAFFAGGLHG  332

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
              IR ++++ W++++ ++ + EYLPK++ YY  + +SK+C+CPSG+EVASPR+VE++Y  C
Sbjct  333   PIRPLLLKHWKDRESDLRVFEYLPKHLDYYSFMLRSKFCLCPSGHEVASPRIVESIYAEC  392

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPV++ DHY  PF+DVL WD F++ + V EIP L+++L S+P+EKY  ++E    VR HF
Sbjct  393   VPVILSDHYVLPFSDVLRWDAFSIQLNVSEIPRLEEVLRSVPEEKYERLKEGLRTVRTHF  452

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              +N P KR+DVFHM+LHSIWLRRLN+ +
Sbjct  453   MLNQPAKRFDVFHMILHSIWLRRLNLRL  480



>ref|XP_010057604.1| PREDICTED: probable glycosyltransferase At3g42180 [Eucalyptus 
grandis]
Length=406

 Score =   412 bits (1058),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 197/405 (49%), Positives = 286/405 (71%), Gaps = 11/405 (3%)
 Frame = +1

Query  262   YQLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYRNPHA  435
             YQ  S H +  K  +NLE++E  LA+ RAAIR+A      + D    ++P G +YRNP+A
Sbjct  2     YQSRSRH-NTNKIKSNLEKIEDDLAQARAAIRKAIRSRSYVSDGKETFIPRGNVYRNPYA  60

Query  436   FHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAH  609
             F++S++EM KRFKI+ Y EG+ P+ HY     +  IEG  I ++E  +  FR  +P++AH
Sbjct  61    FYQSHMEMMKRFKIWTYREGDHPLVHYGPVNDLYAIEGQFIDEMEDKRNPFRAHHPDQAH  120

Query  610   VFFLPFSSYSLVHFVF-----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFML  774
              FFLPFS  ++V +V+     + D +    +Q+  RDY++ ++ ++ +WNRS G DHFM 
Sbjct  121   AFFLPFSVTNVVSYVYQPILSIND-YRRDRLQRFVRDYVHVVADRHEHWNRSKGADHFMF  179

Query  775   ACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPP  954
             +CHDWAP +S   P+LFKN IRV+CNANTSEGF+P  D+S+ +IYL  G +     G  P
Sbjct  180   SCHDWAPDVSSADPELFKNFIRVLCNANTSEGFRPERDISMADIYLTYGELGPPRLGLDP  239

Query  955   SNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGY  1134
              NRS+L F+AGG HG+IR++++E W++KD +V++HEYLPK  +Y  ++ +S+YC+CPSG+
Sbjct  240   RNRSILAFFAGGAHGHIRELLLEHWKDKDADVQVHEYLPKGQNYTQLMGRSRYCLCPSGF  299

Query  1135  EVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEK  1314
             EVAS R+VEA+Y  CVPV+IKD Y  PF+DVL+W  F+V IPV  I ++K IL +IP EK
Sbjct  300   EVASSRIVEAIYAECVPVIIKDSYWLPFSDVLNWSKFSVRIPVNRIKDIKTILEAIPFEK  359

Query  1315  YLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             Y+ +Q++ ++VRRHFEV+ P K +DV HM LHS+WLRRLNI++ +
Sbjct  360   YVKLQKRVVKVRRHFEVHRPAKPFDVIHMALHSVWLRRLNIKLEE  404



>gb|KCW74792.1| hypothetical protein EUGRSUZ_E03525 [Eucalyptus grandis]
Length=475

 Score =   414 bits (1064),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 198/409 (48%), Positives = 286/409 (70%), Gaps = 10/409 (2%)
 Frame = +1

Query  250   SMPFYQLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYR  423
             S   YQ  S H     K +NLE++E  LA+ RAAIR+A      + D    ++P G +YR
Sbjct  66    STLMYQSRSRHNTNKIKKSNLEKIEDDLAQARAAIRKAIRSRSYVSDGKETFIPRGNVYR  125

Query  424   NPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNP  597
             NP+AF++S++EM KRFKI+ Y EG+ P+ HY     +  IEG  I ++E  +  FR  +P
Sbjct  126   NPYAFYQSHMEMMKRFKIWTYREGDHPLVHYGPVNDLYAIEGQFIDEMEDKRNPFRAHHP  185

Query  598   EKAHVFFLPFSSYSLVHFVF-----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYD  762
             ++AH FFLPFS  ++V +V+     + D +    +Q+  RDY++ ++ ++ +WNRS G D
Sbjct  186   DQAHAFFLPFSVTNVVSYVYQPILSIND-YRRDRLQRFVRDYVHVVADRHEHWNRSKGAD  244

Query  763   HFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIG  942
             HFM +CHDWAP +S   P+LFKN IRV+CNANTSEGF+P  D+S+ +IYL  G +     
Sbjct  245   HFMFSCHDWAPDVSSADPELFKNFIRVLCNANTSEGFRPERDISMADIYLTYGELGPPRL  304

Query  943   GPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCIC  1122
             G  P NRS+L F+AGG HG+IR++++E W++KD +V++HEYLPK  +Y  ++ +S+YC+C
Sbjct  305   GLDPRNRSILAFFAGGAHGHIRELLLEHWKDKDADVQVHEYLPKGQNYTQLMGRSRYCLC  364

Query  1123  PSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSI  1302
             PSG+EVAS R+VEA+Y  CVPV+IKD Y  PF+DVL+W  F+V IPV  I ++K IL +I
Sbjct  365   PSGFEVASSRIVEAIYAECVPVIIKDSYWLPFSDVLNWSKFSVRIPVNRIKDIKTILEAI  424

Query  1303  PQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             P EKY+ +Q++ ++VRRHFEV+ P K +DV HM LHS+WLRRLNI++ +
Sbjct  425   PFEKYVKLQKRVVKVRRHFEVHRPAKPFDVIHMALHSVWLRRLNIKLEE  473



>gb|KHN15048.1| Xylogalacturonan beta-1,3-xylosyltransferase, partial [Glycine 
soja]
Length=605

 Score =   418 bits (1074),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/399 (50%), Positives = 285/399 (71%), Gaps = 18/399 (5%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA------QTENRILEDPDYVPHGPIYRNPHAFHRSY  450
              + K  +LE++E GLAR RA+I+++       + NR+    ++VP G IY NPHAFH+S+
Sbjct  205   TIMKYPSLEKIEEGLARARASIQESIRSRNYTSANRV----NFVPKGSIYLNPHAFHQSH  260

Query  451   LEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFF  618
              EM KRFK+++YEEGE P+ H   +  I  IEG  I +++     S FR ++P++A VFF
Sbjct  261   EEMLKRFKVWVYEEGEQPLVHDGPANDIYSIEGQFIDEIDNDAKWSHFRAEHPDQAQVFF  320

Query  619   LPFSSYSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHD  786
             LPFS  ++VH+V+  +R   ++ PI  Q+   DYI  I+ KYPYWNRS G DHF+L+CHD
Sbjct  321   LPFSIANVVHYVYKPIRKHSDYEPIRLQRLVEDYIGVIANKYPYWNRSEGADHFLLSCHD  380

Query  787   WAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRS  966
             W P +S+G PKLFKN IRV+CNANTSEGF P  DVS+PE+YLP+G +     G  P++RS
Sbjct  381   WGPKVSYGNPKLFKNFIRVLCNANTSEGFLPNKDVSIPEVYLPKGKLGPPNLGQRPNDRS  440

Query  967   VLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVAS  1146
             +L F+AG  HG IR++++  W+ KD ++++HEYLPK  +Y  ++ +SK+C+CPSGYEVAS
Sbjct  441   ILAFFAGREHGDIRKILLNHWKGKDNDIQVHEYLPKGKNYTQLMGQSKFCLCPSGYEVAS  500

Query  1147  PRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSM  1326
             PR+VEA++ GCVPVLI   Y+ PF DVL+W  F+V+IPV++I  +K IL SI + +YL +
Sbjct  501   PRVVEAIHAGCVPVLISSSYSPPFTDVLNWSQFSVEIPVEKISEIKTILQSISRNRYLRL  560

Query  1327  QEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
                 ++VRRHF +N P K +D+ HM+LHSIWLRRLN+ +
Sbjct  561   HMNVLRVRRHFMLNRPAKPFDLMHMILHSIWLRRLNLRL  599


 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = +1

Query  439  HRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKA  606
            +RS++EM KRFK+++Y+EGE P+ H      I  IEG  + +++     S+FR ++PE+A
Sbjct  1    NRSHIEMVKRFKVWVYQEGEQPLVHDGPVNNIYAIEGQFMDEIDNNDKWSQFRARHPEEA  60

Query  607  HVFFLPFSSYSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFML  774
            HVFFLPFS  ++VH+V+  +    ++ P+  Q    DYI+ I  KYPYWNRS G DHF+L
Sbjct  61   HVFFLPFSIANVVHYVYKPILKQSDYEPVRLQLLVEDYISVIEDKYPYWNRSKGADHFLL  120

Query  775  ACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNM  927
            +CHDWAP +S+G P+LF++ IR +CNANTSEGF P  DVS+PE+YLP G +
Sbjct  121  SCHDWAPKVSNGNPELFQSFIRALCNANTSEGFHPNRDVSIPEVYLPVGKL  171



>emb|CBI21065.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   410 bits (1055),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/392 (48%), Positives = 278/392 (71%), Gaps = 8/392 (2%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             ++K +  E+ E  LA+ R AIR+A    +  + ++  + P GP+YRNP+AF++S++EMEK
Sbjct  9     LEKKSYFEKREESLAKARVAIRKAGRSRDYTLYKNESFFPRGPVYRNPYAFYQSHIEMEK  68

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYS  639
             RF+++ Y+EGE P+FH      I GIEG  + +LE     F  ++P++A +F++P S  +
Sbjct  69    RFRVWTYQEGEKPLFHSGPMNLIYGIEGQFMDELESKNCPFSARHPDEAMLFYIPISVVN  128

Query  640   LVHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
             ++ +V+       ++    +Q    DYI+ IS KYP+WNRS G DHFM++CHDWAP IS 
Sbjct  129   IIRYVYQPYTNSASYSRVRLQGLVADYIDVISRKYPFWNRSSGADHFMVSCHDWAPEISA  188

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAG  987
               PK F++ IRV+CNANTSEGFKP  DVSLPEI +P   +     G PP+NRS+L F+AG
Sbjct  189   ANPKFFRHFIRVLCNANTSEGFKPVRDVSLPEILVPYRMLGPPYLGQPPTNRSILAFFAG  248

Query  988   GIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAM  1167
             G HG +R ++   W+ KD ++++HEYLP  ++Y  ++ +SK+C+CPSG+EVASPR+VE++
Sbjct  249   GAHGKVRSILFHYWKEKDEDIQVHEYLPTTLNYTELMGRSKFCLCPSGFEVASPRVVESI  308

Query  1168  YMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQV  1347
             Y GCVPV+I D+Y+ PF+DVLDW  F+V IP+  IP  K IL +IP ++YL+ Q+  +QV
Sbjct  309   YAGCVPVIISDNYSLPFSDVLDWSQFSVHIPIARIPETKTILQAIPIQEYLTKQKTVMQV  368

Query  1348  RRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +RHF +N P KR+DV HMVLHSIWLRR+NI++
Sbjct  369   QRHFTLNRPAKRFDVLHMVLHSIWLRRINIQL  400



>ref|XP_010042007.1| PREDICTED: probable glycosyltransferase At3g42180, partial [Eucalyptus 
grandis]
Length=393

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 281/390 (72%), Gaps = 8/390 (2%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYRNPHAFHRSYLEMEKRFKI  477
             ++LE++E  LA+VRAAIR+A      + D    ++P G +YRNP+AF++S++EM K FKI
Sbjct  2     SSLEKIEDDLAQVRAAIRKAIRSQSYVSDGKETFIPRGNVYRNPYAFYQSHMEMMKGFKI  61

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSLVHF  651
             + Y EG+ P+ HY     +  IEG  I ++E  +  FR  +P++AH FFLPFS  ++V +
Sbjct  62    WTYREGDHPLVHYGPVNDLYAIEGQFIDEMEDKRNPFRASHPDQAHAFFLPFSVTNVVSY  121

Query  652   VF--VRDAHEW--PPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             V+  +   H++    +Q+  RDY++ ++ ++ +WNRS G DHFM +CHDWAP +S   P+
Sbjct  122   VYQPILSIHDYRRDRLQRFVRDYVHVVADRHEHWNRSKGADHFMFSCHDWAPDVSSADPE  181

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHG  999
             LFKN IRV+CNANTSEGF+P  DVS+ +IYL  G +     G  P NRS+L F+AGG HG
Sbjct  182   LFKNFIRVLCNANTSEGFRPERDVSMADIYLAYGELGPPRLGLDPRNRSILAFFAGGAHG  241

Query  1000  YIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGC  1179
             YIR++++E W++KD +V++HEYLPK  +Y  ++ +S+YC+CPSG+EVAS R+VEA+Y  C
Sbjct  242   YIRELLLEHWKDKDADVQVHEYLPKGQNYTQLMGRSRYCLCPSGFEVASSRIVEAIYAEC  301

Query  1180  VPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHF  1359
             VPV+IKD Y  PF+DVL+W  F+V IPV  I ++K IL +IP EKY+ +Q++ ++VRRHF
Sbjct  302   VPVIIKDSYWLPFSDVLNWSKFSVRIPVNRIKDIKTILEAIPFEKYVKLQKRVVKVRRHF  361

Query  1360  EVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             EV+ P K +DV HM LHS+WLRRLNI++ +
Sbjct  362   EVHRPAKPFDVIHMALHSVWLRRLNIKLEE  391



>ref|XP_008352234.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 282/397 (71%), Gaps = 10/397 (3%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYRNPHAFHRSYLEM  459
             +  K  T+L+ +E GLA+ RAAI +A    +    ++  ++P G IY+NP+AFH+S++EM
Sbjct  9     NLTKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEM  68

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
              KRFK++ Y+EGE P+ H+     I GIEG  I ++E   S FR  +P++AH FFLPFS 
Sbjct  69    MKRFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSV  128

Query  634   YSLVHFVFV-----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
              ++V +V +     +D H    +Q+   D I+ ++ KYPYWNRS G DHFM +CHDWAP 
Sbjct  129   ANVVRYVXMPITRKQDYHR-DRLQRVVTDXISVVADKYPYWNRSNGADHFMASCHDWAPE  187

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
             +S   P+LFKN IRV+CNANTSEGF    DVSLP+IYLP+GN+D    G  P +R +L F
Sbjct  188   VSIENPELFKNFIRVLCNANTSEGFXLKRDVSLPKIYLPKGNLDPPNLGQAPKSRPILAF  247

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG +R ++++ W++KD EV+++E LPK ++Y   + +SK+C+CPSG+EVASPR+V
Sbjct  248   FAGRVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIV  307

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y GCVPVLI D+Y   F+DVLDW  F+V IPV +IP +K IL +IP +KYL MQ++ 
Sbjct  308   EAIYAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRV  367

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +VRRHF +N P K +DV HMVLHS+WLRRLN ++ +
Sbjct  368   YRVRRHFVLNRPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>ref|XP_008361205.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At3g42180 [Malus domestica]
Length=404

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 281/397 (71%), Gaps = 10/397 (3%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYRNPHAFHRSYLEM  459
             +  K  T+L+ +E GLA+ RAAI +A    +    ++  ++P G IY+NP+AFH+S++EM
Sbjct  9     NLTKGKTSLDTIEEGLAKARAAILEAIQFKKYASQKNETFIPRGTIYKNPYAFHQSHVEM  68

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
              KRFK++ Y+EGE P+ H+     I GIEG  I ++E   S FR  +P++AH FFLPFS 
Sbjct  69    MKRFKVWSYKEGEHPLIHFGPVNDIYGIEGQFIDEIEREESPFRATHPDEAHTFFLPFSV  128

Query  634   YSLVHFVFV-----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
              ++V +V +     +D H    +Q+   D I+ ++ KYPYWNRS G DHFM +CHDWAP 
Sbjct  129   ANVVRYVXMPITRKQDYHR-DRLQRVVTDXISVVADKYPYWNRSNGADHFMASCHDWAPE  187

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
             +S   P+LFKN IRV+CNANTSEGF    DVSLP IYLP+GN+D    G  P +R +L F
Sbjct  188   VSIENPELFKNFIRVLCNANTSEGFXLKRDVSLPXIYLPKGNLDPPNLGQAPKSRPILAF  247

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG +R ++++ W++KD EV+++E LPK ++Y   + +SK+C+CPSG+EVASPR+V
Sbjct  248   FAGRVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMGQSKFCLCPSGFEVASPRIV  307

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y GCVPVLI D+Y   F+DVLDW  F+V IPV +IP +K IL +IP +KYL MQ++ 
Sbjct  308   EAIYAGCVPVLISDNYTLLFSDVLDWSKFSVQIPVDKIPEIKTILQAIPFDKYLKMQKRV  367

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              +VRRHF +N P K +DV HMVLHS+WLRRLN ++ +
Sbjct  368   YRVRRHFVLNXPSKPFDVIHMVLHSVWLRRLNFKLEN  404



>ref|XP_003541484.1| PREDICTED: probable glycosyltransferase At3g42180-like [Glycine 
max]
Length=468

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/394 (49%), Positives = 279/394 (71%), Gaps = 10/394 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQA---QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +KK T+ + VE GLA+ RA+IR+A   +  +   +  D++P G IYRNPHAFH+S++EM 
Sbjct  71    IKKRTSFDVVEEGLAKARASIREAILSRNHSNSGKQEDFIPKGSIYRNPHAFHQSHIEMV  130

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK---FRTKNPEKAHVFFLPFSS  633
             KRFK+++YEEG+ P+ HY     I  IEG  I +++ SK   F+ KNP++AH FFLPFS 
Sbjct  131   KRFKVWVYEEGDQPLVHYGPVNDIYAIEGQFIDEMDNSKRSPFKAKNPDEAHAFFLPFSV  190

Query  634   YSLVHFVF----VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++VH+ +     ++ +    +Q+   DYI  ++ KYPYWNRS G DHF+L+CHDWAP I
Sbjct  191   VNVVHYAYKPYMSQNDYRRDRLQRLVEDYIVVVADKYPYWNRSNGADHFLLSCHDWAPEI  250

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             SH  P LFKN IRV+CNAN SEGF+P  DVS+PE+YL  G +     G  P NR++L F+
Sbjct  251   SHANPDLFKNFIRVLCNANNSEGFQPKRDVSIPEVYLSVGKLGPPNLGQHPMNRTILAFF  310

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             +GG HG IR+++++ W++KD +V++HEYLPK  +Y  ++  SK+C+CPSGYEVASPR+VE
Sbjct  311   SGGAHGDIRKLLLKHWKDKDNQVQVHEYLPKGQNYTELMGLSKFCLCPSGYEVASPRVVE  370

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+   CVPV+I ++Y+ P +DVL+W  F++ I V+ IP++K IL ++ Q+KY  +     
Sbjct  371   AINAVCVPVIISENYSLPLSDVLNWSQFSIQISVENIPDIKTILQNVTQKKYKKLYRNVR  430

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VRRHF ++ P K +D+ HM++HSIWLRRLN  +
Sbjct  431   RVRRHFVMHRPAKPFDLMHMIIHSIWLRRLNFRL  464



>ref|XP_007202437.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
 gb|EMJ03636.1| hypothetical protein PRUPE_ppa014750mg, partial [Prunus persica]
Length=390

 Score =   409 bits (1051),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/391 (50%), Positives = 275/391 (70%), Gaps = 16/391 (4%)
 Frame = +1

Query  298   KLTNLERVEAGLARVRAAIR---QAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEKR  468
             K++NLER+EA LAR R AIR   QA+  ++  +D  ++P G IYRN H+FH+S++EME+R
Sbjct  1     KMSNLERIEADLARARDAIRKAVQAKNHSKGNDDEGFIPTGSIYRNAHSFHQSHVEMEER  60

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSL  642
              K++IY EGEPP+ H      I GIEG  I ++E   S+F  ++P++A++F +P S  ++
Sbjct  61    LKVWIYREGEPPLVHDGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPISVVNI  120

Query  643   VH------FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             V+        + RD      +Q+   DYI  IS +YPYWNRS G DHF+++CHDWAP IS
Sbjct  121   VNTLYNPLVTYSRDQ-----LQRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDIS  175

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                PKL+   IRV+CNANTSEGFKP  DVS+PEI +P G +        P  RS+L F+A
Sbjct  176   EANPKLYDKFIRVLCNANTSEGFKPQRDVSIPEINIPYGKLGPTPQRASPDKRSILAFFA  235

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG HG IR +++E W++KD EV++HEYL K  +Y+ ++ KSK+C+CPSGYEVASPR+V A
Sbjct  236   GGAHGNIRHILLEHWKDKDKEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASPRVVTA  295

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             + +GCVPVLI D+YA PF+DVLDW  F+V IP ++IP +K IL  I  ++YL +Q++  +
Sbjct  296   ISVGCVPVLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVTE  355

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNI  1437
             V RHF ++ P + YD+ HM+LHS+WLRRL++
Sbjct  356   VHRHFMIHRPAQPYDMIHMLLHSVWLRRLDV  386



>gb|AAU04753.1| EXO [Cucumis melo]
Length=343

 Score =   407 bits (1046),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 249/337 (74%), Gaps = 1/337 (0%)
 Frame = +1

Query  442   RSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISKFRTKN-PEKAHVFF  618
             RSYLEME+  KI++Y+EGEPP+FH    + I   EG  IH++E     T N P++A ++F
Sbjct  7     RSYLEMERLLKIYVYKEGEPPMFHGGPCKSIYSTEGRFIHEMEKGNLYTTNDPDQALLYF  66

Query  619   LPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
             LPFS  +LV +++V ++HE   I +   DYIN IS K+P+W+RSLG DHFML+CHDW P 
Sbjct  67    LPFSVVNLVQYLYVPNSHEVNAIGRAITDYINVISKKHPFWDRSLGADHFMLSCHDWGPR  126

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
              +   P LF NSIRV+CNAN SEGF P+ D S PEI+L  G +DGLIGG  PS RSVL F
Sbjct  127   TTSYVPLLFNNSIRVLCNANVSEGFLPSKDASFPEIHLRTGEIDGLIGGLSPSRRSVLAF  186

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG +HG+IR ++++ W+ KD +V ++E LP  +SY  M++KS++C+CPSGYEVASPR+V
Sbjct  187   FAGRLHGHIRYLLLQEWKEKDEDVLVYEELPSGISYNSMLKKSRFCLCPSGYEVASPRVV  246

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+Y  CVPVLI + Y  PF+DVL+W +F+V I VK+IPN+KKIL  I Q +YL MQ + 
Sbjct  247   EAIYAECVPVLISESYVPPFSDVLNWKSFSVQIQVKDIPNIKKILKGISQTQYLRMQRRV  306

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
              QV+RHF +N  PKR+D FHM+LHSIWLRRLNI + D
Sbjct  307   KQVQRHFALNGTPKRFDAFHMILHSIWLRRLNIHIQD  343



>ref|XP_002285239.2| PREDICTED: probable glycosyltransferase At5g11130 [Vitis vinifera]
Length=472

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 279/393 (71%), Gaps = 8/393 (2%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQA--QTENRILEDPDYVPHGPIYRNPHAFHRSYLEME  462
             +++K +  E+ E  LA+ R AIR+A    +  + ++  + P GP+YRNP+AF++S++EME
Sbjct  78    SLEKKSYFEKREESLAKARVAIRKAGRSRDYTLYKNESFFPRGPVYRNPYAFYQSHIEME  137

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNPEKAHVFFLPFSSY  636
             KRF+++ Y+EGE P+FH      I GIEG  + +LE     F  ++P++A +F++P S  
Sbjct  138   KRFRVWTYQEGEKPLFHSGPMNLIYGIEGQFMDELESKNCPFSARHPDEAMLFYIPISVV  197

Query  637   SLVHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             +++ +V+       ++    +Q    DYI+ IS KYP+WNRS G DHFM++CHDWAP IS
Sbjct  198   NIIRYVYQPYTNSASYSRVRLQGLVADYIDVISRKYPFWNRSSGADHFMVSCHDWAPEIS  257

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                PK F++ IRV+CNANTSEGFKP  DVSLPEI +P   +     G PP+NRS+L F+A
Sbjct  258   AANPKFFRHFIRVLCNANTSEGFKPVRDVSLPEILVPYRMLGPPYLGQPPTNRSILAFFA  317

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG HG +R ++   W+ KD ++++HEYLP  ++Y  ++ +SK+C+CPSG+EVASPR+VE+
Sbjct  318   GGAHGKVRSILFHYWKEKDEDIQVHEYLPTTLNYTELMGRSKFCLCPSGFEVASPRVVES  377

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPV+I D+Y+ PF+DVLDW  F+V IP+  IP  K IL +IP ++YL+ Q+  +Q
Sbjct  378   IYAGCVPVIISDNYSLPFSDVLDWSQFSVHIPIARIPETKTILQAIPIQEYLTKQKTVMQ  437

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             V+RHF +N P KR+DV HMVLHSIWLRR+NI++
Sbjct  438   VQRHFTLNRPAKRFDVLHMVLHSIWLRRINIQL  470



>ref|XP_007011817.1| Exostosin family protein [Theobroma cacao]
 gb|EOY29436.1| Exostosin family protein [Theobroma cacao]
Length=479

 Score =   412 bits (1058),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/390 (51%), Positives = 270/390 (69%), Gaps = 7/390 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQAQTENRI---LEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             KK +  + +E GLAR RA+IR A T   +    E+ D VP G +YRNP AF+ SY+EME+
Sbjct  89    KKPSREQVLEQGLARARASIRSAATARNVTVTFENDDDVPVGDVYRNPSAFYDSYVEMER  148

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYS  639
             RFK+++Y EGE P+ H    + I  IEG  IH++E    +FRT +P  AHV+F+PFS   
Sbjct  149   RFKVYVYTEGELPIVHDGPCKEIYTIEGRFIHEMEHGAKRFRTNDPGHAHVYFMPFSVTW  208

Query  640   LVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPK  819
             +V +++   ++   P+++   DY+  +STKYP+WNR+ G DHFMLACHDW P  S G   
Sbjct  209   MVKYIYKPLSYNVSPLKQFVSDYVKVVSTKYPFWNRTHGADHFMLACHDWGPHASQGNSH  268

Query  820   LFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFYAGGI  993
             L+ NSIRV+CNANTSEGF P  DVSLPEI+L  G +   +  PP  N  R  L F+AGG+
Sbjct  269   LYTNSIRVLCNANTSEGFNPQKDVSLPEIHLNGGFLSPKLLHPPLPNVSRPHLSFFAGGL  328

Query  994   HGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYM  1173
             HG IR  +++ W+ +D E+++ EYLPK+  YY  + +SK+C+CPSGYEVASPR+VEA+Y 
Sbjct  329   HGPIRPFLLQHWKGRDDEMQVFEYLPKDKDYYSYMLQSKFCLCPSGYEVASPRIVEAIYS  388

Query  1174  GCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRR  1353
              CVPV++ +HY  PF+DVL W+ F+V +    IP LK+ILL IP+EKY  +QE    VRR
Sbjct  389   ECVPVILSEHYVLPFSDVLRWEAFSVQVETTAIPRLKEILLGIPEEKYRKLQEGVRAVRR  448

Query  1354  HFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             HF +N P KR+D+FHM+LHSIWLRR+N  +
Sbjct  449   HFMLNQPSKRFDMFHMILHSIWLRRINARL  478



>ref|XP_011036587.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Populus euphratica]
Length=490

 Score =   412 bits (1059),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 192/386 (50%), Positives = 277/386 (72%), Gaps = 9/386 (2%)
 Frame = +1

Query  313   ERVEAGLARVRAAIRQAQTE----NRILEDPDYVP-HGPIYRNPHAFHRSYLEMEKRFKI  477
             E +E GLAR RA IR+A +     +RI+ D D     G IY N  AF++SY+EMEKRFK+
Sbjct  104   EEMEHGLARARATIRKAASLTGNISRIVADGDENDVAGAIYLNARAFYQSYMEMEKRFKV  163

Query  478   FIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFSSYSLVHF  651
              +Y EGE P+ H    + I  IEG  IH++E    +F+T++P +AHV+F+PFS   +V +
Sbjct  164   HVYSEGELPIVHDGPCKDIYTIEGRFIHEMEHGAKRFKTRDPLRAHVYFMPFSVAWMVKY  223

Query  652   VFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKN  831
             ++    ++   +++   DY+  +S+KYP+WNR+ G DHFML+CHDW P  SHG P L+  
Sbjct  224   LYKPLTYDHTAMKQFVADYVRVVSSKYPFWNRTQGADHFMLSCHDWGPHASHGNPFLYNT  283

Query  832   SIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSN--RSVLVFYAGGIHGYI  1005
             SIRV+CNAN+SEGF P  DVSLPEI+L  GN+   +  PPP+   R  L F++GG+HG I
Sbjct  284   SIRVLCNANSSEGFSPRKDVSLPEIHLYGGNVPPKLISPPPATSPRPYLAFFSGGLHGPI  343

Query  1006  RQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVP  1185
             R ++++ W+ +DP++++HEYLPK++ YY  + +SK+C+CPSG+EVASPR+VEA+Y  CVP
Sbjct  344   RPILLDHWKGRDPDLQVHEYLPKDLDYYSFMLRSKFCLCPSGHEVASPRIVEAIYAECVP  403

Query  1186  VLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEV  1365
             V++ DHY  PF+DVL W+ FA+ + V EIP LK++L+S+P+EKY  ++E    +R+HF +
Sbjct  404   VILSDHYVLPFSDVLRWEAFAIQVNVSEIPRLKEVLISVPEEKYRRLKEGLRAIRKHFVL  463

Query  1366  NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             N P KR+DVFHM+LHSIWLRRLN+ +
Sbjct  464   NQPAKRFDVFHMILHSIWLRRLNLRL  489



>ref|XP_008242826.1| PREDICTED: probable glycosyltransferase At5g20260 [Prunus mume]
Length=488

 Score =   412 bits (1058),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 275/392 (70%), Gaps = 16/392 (4%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIR---QAQTENRILEDPDYVPHGPIYRNPHAFHRSYLEMEK  465
             KK++NLER+EA LAR R AIR   QA+  ++  +D  ++P G IYRN H+FH+S++EMEK
Sbjct  98    KKMSNLERIEADLARARDAIRKAVQAKNHSKGNDDQGFIPTGSIYRNAHSFHQSHVEMEK  157

Query  466   RFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYS  639
             R K++IY EGEPP+ H      I GIEG  I ++E   S+F  ++P++A++F +P S  +
Sbjct  158   RLKVWIYREGEPPLVHGGPLNNIYGIEGQFIDEMESGKSRFMARHPDEANLFLIPISVVN  217

Query  640   LVH------FVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             +V+        + RD      +Q+   DYI  IS +YPYWNRS G DHF+++CHDWAP I
Sbjct  218   IVNTLYKPLVTYSRDQ-----LQRVVLDYIGIISERYPYWNRSQGADHFLVSCHDWAPDI  272

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S   PKL+   IRV+CNANTSEGFKP  DVS+PEI +P G +        P  RS+L F+
Sbjct  273   SEADPKLYDKFIRVLCNANTSEGFKPRRDVSIPEINIPYGKLGPTPQSTSPDKRSILAFF  332

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG HG IR +++E W++KD EV++HEYL K  +Y+ ++ KSK+C+CPSGYEVAS R+V 
Sbjct  333   AGGAHGNIRHILLEHWKDKDNEVQVHEYLDKKKNYFKLMGKSKFCLCPSGYEVASARVVT  392

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+ +GCVPVLI D+YA PF+DVLDW  F+V IP ++IP +K IL  I  ++YL +Q++  
Sbjct  393   AISVGCVPVLISDYYALPFSDVLDWTKFSVYIPSEKIPEIKTILKGISPKRYLKLQKRVT  452

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNI  1437
             +V RHF ++ P + YD+ HM+LHS+WLRRL++
Sbjct  453   EVHRHFMIHRPAQPYDMIHMLLHSVWLRRLDV  484



>ref|XP_007204648.1| hypothetical protein PRUPE_ppa001571mg [Prunus persica]
 gb|EMJ05847.1| hypothetical protein PRUPE_ppa001571mg [Prunus persica]
Length=800

 Score =   421 bits (1083),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 282/396 (71%), Gaps = 8/396 (2%)
 Frame = +1

Query  295   KKLTNLERVEAGLARVRAAIRQA-QTENRILEDPD-YVPHGPIYRNPHAFHRSYLEMEKR  468
             K  T+LER+E  LA+ RAAIR+A Q+ N   E  + ++P G IY+NP+AFH+S++EM KR
Sbjct  402   KNKTSLERIEEDLAQARAAIREAIQSRNYKSERTETFIPRGSIYKNPYAFHQSHIEMRKR  461

Query  469   FKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSSYSL  642
             FK++ Y+EGE P+ H      I GIEG  I ++E   S FR  +P++AH FFLPFS  ++
Sbjct  462   FKVWSYKEGELPLVHIGPMTNIYGIEGHFIDEIEREESPFRATHPDRAHTFFLPFSVANI  521

Query  643   VHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
             V +V++    +  +    +Q+   DYI  ++ KYPYWNRS G DHFM +CHDW P IS G
Sbjct  522   VEYVYLPITQKQDYYRDRLQRIVVDYIGVVARKYPYWNRSHGADHFMASCHDWGPEISVG  581

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGG  990
              P+LFKN IRV+CNANTSEGF+P  DV LPEIY+P   +     G PP+NR +L F+AG 
Sbjct  582   QPELFKNFIRVLCNANTSEGFQPRRDVPLPEIYVPSRKLGPPYLGQPPNNRPILAFFAGR  641

Query  991   IHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEAMY  1170
             +HG IR ++++ W++KD EV++HE LP + +Y  ++ +SKYC+CPSG+EVASPR++EA Y
Sbjct  642   VHGSIRPILLDNWKDKDDEVQVHEKLPLDQNYTKLMGQSKYCLCPSGFEVASPRVMEAFY  701

Query  1171  MGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQVR  1350
              GCVPVLI D+Y  PF+DVL+W  F++ IPV +IP +K IL  IP EKYL MQ++  +V+
Sbjct  702   AGCVPVLISDNYTLPFSDVLNWSQFSIQIPVAKIPEIKTILQGIPYEKYLRMQKRVSKVK  761

Query  1351  RHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHDIQE  1458
             RHF +N P + +DV HMVLHS+WLRRLN ++  I +
Sbjct  762   RHFVLNRPSQPFDVIHMVLHSVWLRRLNSKLDTIHD  797



>ref|XP_009151057.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Brassica rapa]
Length=478

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 280/401 (70%), Gaps = 16/401 (4%)
 Frame = +1

Query  274   SSHPDAMKKLTNLER-VEAGLARVRAAIRQAQTENR--ILEDPDYVPHGPIYRNPHAFHR  444
             +S P+  KK  N  R VE GL++ RA+IR+A + NR   L   D +P+  +YRNP A  +
Sbjct  82    TSKPEKKKKKLNRRRTVEVGLSKARASIREAASSNRNATLFSVD-LPNAQVYRNPSALSQ  140

Query  445   SYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS--KFRTKNPEKAHVFF  618
             SYLEMEKRFK+++YEEGEPP+ H    + +  +EG  I ++E S  KFRT +P++AHV+F
Sbjct  141   SYLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYF  200

Query  619   LPFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
             LPFS   LV +++  + ++  P++  A DY+  IS+K+P+WNR+ G DHFMLACHDW P 
Sbjct  201   LPFSVTWLVTYLYQYN-YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPL  259

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYL------PQGNMDGLIGGPPPSN  960
              S     LF  SIRVMCNAN+SEGF PA D +LPEI L      PQ  +  ++   P   
Sbjct  260   TSKANEDLFHKSIRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSP---  316

Query  961   RSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEV  1140
             R  L F+AGG+HG +R ++++ W+ +DP++ + EYLPK+++YY  +R SK+C CPSGYEV
Sbjct  317   RPHLAFFAGGVHGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEV  376

Query  1141  ASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYL  1320
             ASPR++EA+Y  C+PV++  ++  PF+D+L W+TF+V + V EIP LK+IL SI  EKY 
Sbjct  377   ASPRLIEAIYSECIPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQ  436

Query  1321  SMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             S++     VRRHFE+N PPKRYD FHM+LHSIWLRRLN+ +
Sbjct  437   SLKRNLRYVRRHFELNDPPKRYDAFHMILHSIWLRRLNLRL  477



>ref|XP_002285237.2| PREDICTED: probable glycosyltransferase At5g25310 [Vitis vinifera]
 emb|CBI21064.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 280/393 (71%), Gaps = 9/393 (2%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTE-NRILE----DPDYVPHGPIYRNPHAFHRSYLE  456
             +KK T  +  E GLAR RA+IR+A +  NR  E    D + VP G +YRN  AF++SY+E
Sbjct  85    IKKRTRYQGQEEGLARARASIRKAFSNLNRSSEIGGEDNNEVPTGDVYRNAGAFYQSYVE  144

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE--ISKFRTKNPEKAHVFFLPFS  630
             MEKR K+++YEEGE P+ H    + I  IEG  IH++E    KFRT++ E+AHV+F+PFS
Sbjct  145   MEKRLKVYVYEEGEVPMIHDGPCKDIYTIEGRFIHEIEHGDGKFRTRDAERAHVYFMPFS  204

Query  631   SYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHG  810
                +V +++    +   P+++   DY++ ISTKYP+WN + G DHFMLACHDW P  S G
Sbjct  205   VTWMVKYLYKPLTYNLTPLRQFVSDYVSVISTKYPFWNTTQGADHFMLACHDWGPHASRG  264

Query  811   TPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDG--LIGGPPPSNRSVLVFYA  984
              P L+  SIRV+CNANTSEGF P  DVSLPEI+L  GN++   L   PP S R  L F+A
Sbjct  265   HPVLYNTSIRVLCNANTSEGFNPQKDVSLPEIHLYGGNVNPKLLSPPPPNSPRPFLAFFA  324

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             GG+HG IR ++++ W  +D ++ ++EYLPK++ YY ++ +SKYC+CPSG+EVASPR+VEA
Sbjct  325   GGLHGPIRPILIQHWMGRDTDLRVYEYLPKDMDYYSLMLQSKYCLCPSGHEVASPRIVEA  384

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y  CVPV++ DHY  PF+DVL W+ F+V +   EIP LK++L +I +EKY  ++E    
Sbjct  385   IYSECVPVILSDHYVLPFSDVLRWEAFSVKVEASEIPRLKEVLQAISEEKYTRLKEGVRA  444

Query  1345  VRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             VRRHFE+N P KR+DVFHM+LHS+WLRR+N+++
Sbjct  445   VRRHFELNQPAKRFDVFHMILHSVWLRRINLKL  477



>ref|XP_008652150.1| PREDICTED: probable glycosyltransferase At5g03795 [Zea mays]
Length=579

 Score =   413 bits (1062),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/400 (51%), Positives = 277/400 (69%), Gaps = 20/400 (5%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA-QTENRI--LEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LER+E GLAR R+AI +A + ++++  L D DYVP GP+YRN H FHRSYLEME++ K
Sbjct  176   VKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEMERQLK  235

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-------KFRTKNPEKAHVFFLPFSS  633
             +++YEEGEPPVFH    + I   EG  IH +E         + RT++P +AHVFFLPFS 
Sbjct  236   VYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFFLPFSV  295

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V  ++   + +  P+++T  DY+  +S+KYPYWNRSLG DHFML+CHDW P +S   
Sbjct  296   VKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPYVSSAN  355

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +LF NSIRV+CNANTSEGF PA DVSLP++ L    ++  +GGP  S R VL F+AGG 
Sbjct  356   AQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAFFAGGN  415

Query  994   HGYIRQVMMETW-----ENKDPEVEIHEYLPKNV---SYYGMVRKSKYCICPSGYEVASP  1149
             HG +R  ++  W        DP+V + EYLP+     SY  M+R+S++C+CP GYEVASP
Sbjct  416   HGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGYEVASP  475

Query  1150  RMVEAMYMGCVPVLIKD-HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSM  1326
             R+ EA+Y+GCVPV++ D  YA PFADVLDWD FA+ + V +IP LK+IL ++   +Y+ M
Sbjct  476   RLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPRQYIRM  535

Query  1327  QEKGIQVRRHFEV-NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             Q +   VRRHF +   PP+RYD FHM+LHS+WLRRLN+ +
Sbjct  536   QRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRI  575



>ref|XP_009151056.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Brassica rapa]
 emb|CDX88169.1| BnaA06g27600D [Brassica napus]
Length=480

 Score =   410 bits (1053),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 279/400 (70%), Gaps = 16/400 (4%)
 Frame = +1

Query  277   SHPDAMKKLTNLER-VEAGLARVRAAIRQAQTENR--ILEDPDYVPHGPIYRNPHAFHRS  447
             S P+  KK  N  R VE GL++ RA+IR+A + NR   L   D +P+  +YRNP A  +S
Sbjct  85    SKPEKKKKKLNRRRTVEVGLSKARASIREAASSNRNATLFSVD-LPNAQVYRNPSALSQS  143

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS--KFRTKNPEKAHVFFL  621
             YLEMEKRFK+++YEEGEPP+ H    + +  +EG  I ++E S  KFRT +P++AHV+FL
Sbjct  144   YLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFIMEMEKSRTKFRTYDPDQAHVYFL  203

Query  622   PFSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
             PFS   LV +++  + ++  P++  A DY+  IS+K+P+WNR+ G DHFMLACHDW P  
Sbjct  204   PFSVTWLVTYLYQYN-YDAEPLRTFASDYVRLISSKHPFWNRTSGADHFMLACHDWGPLT  262

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYL------PQGNMDGLIGGPPPSNR  963
             S     LF  SIRVMCNAN+SEGF PA D +LPEI L      PQ  +  ++   P   R
Sbjct  263   SKANEDLFHKSIRVMCNANSSEGFNPAKDATLPEIKLYGGEVHPQLRLSKILMTSP---R  319

Query  964   SVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVA  1143
               L F+AGG+HG +R ++++ W+ +DP++ + EYLPK+++YY  +R SK+C CPSGYEVA
Sbjct  320   PHLAFFAGGVHGPVRPILLDHWKQRDPDMPVFEYLPKHLNYYDFMRSSKFCFCPSGYEVA  379

Query  1144  SPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLS  1323
             SPR++EA+Y  C+PV++  ++  PF+D+L W+TF+V + V EIP LK+IL SI  EKY S
Sbjct  380   SPRLIEAIYSECIPVILSVNFVLPFSDILRWETFSVQVDVSEIPRLKEILTSISDEKYQS  439

Query  1324  MQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             ++     VRRHFE+N PPKRYD FHM+LHSIWLRRLN+ +
Sbjct  440   LKRNLRYVRRHFELNDPPKRYDAFHMILHSIWLRRLNLRL  479



>tpg|DAA59884.1| TPA: hypothetical protein ZEAMMB73_690759, partial [Zea mays]
Length=577

 Score =   413 bits (1061),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 205/400 (51%), Positives = 277/400 (69%), Gaps = 20/400 (5%)
 Frame = +1

Query  304   TNLERVEAGLARVRAAIRQA-QTENRI--LEDPDYVPHGPIYRNPHAFHRSYLEMEKRFK  474
               LER+E GLAR R+AI +A + ++++  L D DYVP GP+YRN H FHRSYLEME++ K
Sbjct  176   VKLERLELGLARARSAIMEAIRKKDKVSPLPDKDYVPMGPVYRNAHVFHRSYLEMERQLK  235

Query  475   IFIYEEGEPPVFHYSFSQGILGIEGILIHQLEIS-------KFRTKNPEKAHVFFLPFSS  633
             +++YEEGEPPVFH    + I   EG  IH +E         + RT++P +AHVFFLPFS 
Sbjct  236   VYVYEEGEPPVFHDGPCRSIYSTEGRFIHSMETETEAEEGRRLRTRDPARAHVFFLPFSV  295

Query  634   YSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISHGT  813
               +V  ++   + +  P+++T  DY+  +S+KYPYWNRSLG DHFML+CHDW P +S   
Sbjct  296   VKMVQTIYEPGSRDMAPLKRTVADYVRVLSSKYPYWNRSLGADHFMLSCHDWGPYVSSAN  355

Query  814   PKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGI  993
              +LF NSIRV+CNANTSEGF PA DVSLP++ L    ++  +GGP  S R VL F+AGG 
Sbjct  356   AQLFGNSIRVLCNANTSEGFDPARDVSLPQVNLRSDAVERQVGGPSASRRPVLAFFAGGN  415

Query  994   HGYIRQVMMETW-----ENKDPEVEIHEYLPKNV---SYYGMVRKSKYCICPSGYEVASP  1149
             HG +R  ++  W        DP+V + EYLP+     SY  M+R+S++C+CP GYEVASP
Sbjct  416   HGPVRPALLAHWGPGGRRGGDPDVRVSEYLPRGGGAPSYADMMRRSRFCLCPGGYEVASP  475

Query  1150  RMVEAMYMGCVPVLIKD-HYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSM  1326
             R+ EA+Y+GCVPV++ D  YA PFADVLDWD FA+ + V +IP LK+IL ++   +Y+ M
Sbjct  476   RLAEALYLGCVPVVVDDGEYALPFADVLDWDAFALRLRVADIPRLKEILAAVSPRQYIRM  535

Query  1327  QEKGIQVRRHFEV-NFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             Q +   VRRHF +   PP+RYD FHM+LHS+WLRRLN+ +
Sbjct  536   QRRVRMVRRHFMLHGGPPRRYDAFHMILHSVWLRRLNVRI  575



>ref|XP_008385236.1| PREDICTED: probable glycosyltransferase At3g42180 [Malus domestica]
Length=505

 Score =   410 bits (1053),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/394 (50%), Positives = 274/394 (70%), Gaps = 8/394 (2%)
 Frame = +1

Query  286   DAMKKLTNLERVEAGLARVRAAIRQAQTENRILEDP--DYVPHGPIYRNPHAFHRSYLEM  459
             +  K  T+L+R+E  LA+ RAAI +A    +        ++P G IY+NP+AFH+S++EM
Sbjct  110   NLTKGKTSLDRIEEDLAKARAAILEAIXYKKYTSQKIETFIPRGTIYKNPYAFHQSHIEM  169

Query  460   EKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEI--SKFRTKNPEKAHVFFLPFSS  633
              KRFK++ Y+EGE P+ H+     I GIEG  I ++E   S FR  +P+KAH FFLP S 
Sbjct  170   VKRFKVWSYKEGEHPLIHFGPLNDIYGIEGQFIDEIEREESPFRATHPDKAHTFFLPLSV  229

Query  634   YSLVHFVFV----RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTI  801
              ++V FV++    R  +    +Q+   DYI  ++ KYPYWNRS G DHFM +CHDWAP +
Sbjct  230   ANVVRFVYMPITRRQDYHRDRLQRVVTDYIGVVAGKYPYWNRSNGADHFMASCHDWAPEV  289

Query  802   SHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFY  981
             S G  +LFKN IRV+CNANTSEGFKP  DVSLPEIYL +GN+          +R +L F+
Sbjct  290   SVGNQELFKNFIRVLCNANTSEGFKPKRDVSLPEIYLYKGNLGSSNLCQAXKSRPILAFF  349

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AG +HG +R ++++ W++KD EV+++E LPK ++Y   + +SK+C+CPSG+EVASPR+VE
Sbjct  350   AGRVHGPVRPILLDHWKDKDDEVQVYEKLPKGLNYTKFMVQSKFCLCPSGFEVASPRIVE  409

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             A+Y GCVPVLI D Y  PF+DVLDW  F+V IPV +IP +K IL +IP +KYL MQ++  
Sbjct  410   AIYAGCVPVLISDSYTLPFSDVLDWSKFSVQIPVAKIPEIKTILQAIPFDKYLKMQKRVC  469

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             +VR HF +N P   +DV HM+LHS+WLRRL+ ++
Sbjct  470   RVRPHFVINRPAXPFDVIHMILHSVWLRRLDFKL  503



>ref|XP_007155060.1| hypothetical protein PHAVU_003G169700g [Phaseolus vulgaris]
 gb|ESW27054.1| hypothetical protein PHAVU_003G169700g [Phaseolus vulgaris]
Length=497

 Score =   409 bits (1052),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/397 (49%), Positives = 280/397 (71%), Gaps = 10/397 (3%)
 Frame = +1

Query  289   AMKKLTNLERVEAGLARVRAAIRQAQTENRILED--PDYVPHGPIYRNPHAFHRSYLEME  462
             + KK  +LE+ E GLA+ RA+I++         D   ++VP G IY NPHAF++S++EM 
Sbjct  97    STKKFPDLEKTEKGLAQARASIQEFIRSRNYTSDNRQNFVPKGSIYWNPHAFYQSHMEMV  156

Query  463   KRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE----ISKFRTKNPEKAHVFFLPFS  630
             KRFK+++YEEGE P+ H      I  IEG  + +++     S FR K+PE+AHVF+LPFS
Sbjct  157   KRFKVWVYEEGEQPLVHDGPVNDIYAIEGQFMDEIDNYDKWSNFRAKHPEEAHVFYLPFS  216

Query  631   SYSLVHFVF--VRDAHEWPPI--QKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPT  798
               ++VH+V+  +R   ++ P+  Q+   DYI+ ++ KYPYWNRS G DHF+L+CHDW P 
Sbjct  217   IANIVHYVYKPIRKHSDYEPVRLQRLVEDYISVVAEKYPYWNRSEGADHFLLSCHDWGPK  276

Query  799   ISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVF  978
             +S G PKLFK+ IRV+CNANTSEGF P  DVS+PE+YLP+G +     G  P+ R++L F
Sbjct  277   VSFGNPKLFKSFIRVLCNANTSEGFIPNKDVSIPEVYLPKGKLGPPNLGQRPNERTILGF  336

Query  979   YAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMV  1158
             +AG  HG IR++++  W+ KD +V+++E LPK   Y  M+ +SK+C+CPSGYEVASPR+V
Sbjct  337   FAGREHGDIRKILLNYWKGKDNDVQVYESLPKGKDYTRMMGQSKFCLCPSGYEVASPRVV  396

Query  1159  EAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKG  1338
             EA+  GCVPVLI  +Y+ PF DVL+W  F+V+I V++IP +K IL S+ + +Y+ +    
Sbjct  397   EALNAGCVPVLISSNYSPPFTDVLNWSQFSVEISVEKIPEIKTILQSVSRNRYMKLHMNV  456

Query  1339  IQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEVHD  1449
             ++VRRHF +N P K +D+ HM+LHSIWLRRLN+ + D
Sbjct  457   MRVRRHFMINRPAKPFDLMHMILHSIWLRRLNLRLID  493



>ref|XP_010096418.1| T-complex protein 1 subunit beta [Morus notabilis]
 gb|EXB64089.1| T-complex protein 1 subunit beta [Morus notabilis]
Length=1028

 Score =   425 bits (1093),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 268/376 (71%), Gaps = 10/376 (3%)
 Frame = +1

Query  292   MKKLTNLERVEAGLARVRAAIRQAQTENR--------ILEDPDYVPHGPIYRNPHAFHRS  447
             +K  ++L ++EA L  VRA+IR+A    R         L DPD+ P G IYRNP+AFHRS
Sbjct  129   IKLSSSLHKLEARLVEVRASIREAALVARNFTPNSHDSLSDPDFTPKGHIYRNPNAFHRS  188

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK-FRTKNPEKAHVFFLP  624
             YLEMEK  KI++YEEGEPPVFH    + I   EG  IH++E    FRT++P KA V+FLP
Sbjct  189   YLEMEKLMKIYVYEEGEPPVFHDGPCRSIYSSEGRFIHEIEKGGLFRTRDPNKALVYFLP  248

Query  625   FSSYSLVHFVFVRDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTIS  804
             FS  ++V +++V D+H+  P+++   DY+N I+ K+P+WNRSLG DHFML+CHDW P+ S
Sbjct  249   FSVVNMVRYLYVPDSHDTKPMRRVVVDYMNLIAHKHPFWNRSLGADHFMLSCHDWGPSTS  308

Query  805   HGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPSNRSVLVFYA  984
                P L+  SIR +CNANTSEGF+P+ DVS PEI L  G + GL GGP PS R++L F+A
Sbjct  309   SFVPHLYHRSIRALCNANTSEGFRPSKDVSFPEINLLTGEVRGL-GGPSPSKRTILAFFA  367

Query  985   GGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVEA  1164
             G +HGYIR +++  W+NKD +V++++ LP+ VSY  M++KSK+C+CPSGYEVASPR+VEA
Sbjct  368   GRLHGYIRYLLLNQWKNKDQDVQVYDQLPRRVSYQDMMKKSKFCLCPSGYEVASPRVVEA  427

Query  1165  MYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGIQ  1344
             +Y GCVPVLI D Y  PF DVL+W +F+V I V +IP +K+IL+ I    Y  +Q     
Sbjct  428   IYAGCVPVLISDGYVPPFNDVLNWKSFSVQIKVNDIPKIKEILMGISTRHYSRLQRTLKL  487

Query  1345  VRRHFEVNFPPKRYDV  1392
             V+RHF VN  PKRYD+
Sbjct  488   VQRHFLVNATPKRYDI  503



>ref|XP_006389445.1| hypothetical protein POPTR_0025s00760g [Populus trichocarpa]
 gb|ERP48359.1| hypothetical protein POPTR_0025s00760g [Populus trichocarpa]
Length=466

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/409 (49%), Positives = 278/409 (68%), Gaps = 18/409 (4%)
 Frame = +1

Query  250   SMPFYQLPSSHPDAMKKLTNLERVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYR  423
             S P    P   P  +K+    E++E GLAR RAAI  A         ++  Y+P G IYR
Sbjct  62    SQPSPSQPHQLPTQIKR--GREKIEDGLARARAAILDAARLKNYTSYKEGTYIPKGVIYR  119

Query  424   NPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLEISK--FRTKNP  597
             NP+AFH+S+ EMEKRFKI++Y+EGE P+ H      I G+EG  + ++E  K  F   +P
Sbjct  120   NPYAFHQSHTEMEKRFKIWVYKEGERPLVHGGPLNNIYGVEGQFLDEMEHGKSPFAASHP  179

Query  598   EKAHVFFLPFSSYSLVHFVF------VRDAHEWPPIQKTARDYINGISTKYPYWNRSLGY  759
             ++AH+F LP S   ++ +V+       RD      +Q+  +DY+  ++ KYPYWNRS G 
Sbjct  180   DEAHMFLLPISVAYIISYVYKPIVTYSRDE-----LQRLVQDYVGVVADKYPYWNRSKGA  234

Query  760   DHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLI  939
             DHF+++CHDWAP IS   P L+KN IRV+CNANTSE F+P  DVS+PEI +P G +    
Sbjct  235   DHFLVSCHDWAPDISGANPDLYKNFIRVLCNANTSERFEPRRDVSIPEINIPNGKLGPPH  294

Query  940   GGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYL-PKNVSYYGMVRKSKYC  1116
              G PPS RS+  F+AGG HGYIR+V++E W++KD E+++HEYL  K   Y+ ++ +SK+C
Sbjct  295   KGLPPSKRSIFAFFAGGAHGYIRKVLLENWKDKDDEIQVHEYLDKKGTDYFELMGQSKFC  354

Query  1117  ICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILL  1296
             +CPSGYEVASPR+V A+ +GCVPV I D+Y  PF+DVLDW  F+V IP ++IP +K IL 
Sbjct  355   LCPSGYEVASPRVVTAIQLGCVPVTISDNYTLPFSDVLDWSKFSVHIPSEKIPEIKTILK  414

Query  1297  SIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
              I  ++YL MQ + IQV+RHFE+N P + YD+ HM+LHS+W+RRLN++V
Sbjct  415   KISPQRYLMMQMRVIQVQRHFELNRPARPYDLLHMLLHSVWVRRLNVKV  463



>ref|XP_009393729.1| PREDICTED: probable glycosyltransferase At5g20260 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 266/363 (73%), Gaps = 4/363 (1%)
 Frame = +1

Query  367   TENRIL-EDPDYVPHGPIYRNPHAFHRSYLEMEKRFKIFIYEEGEPPVFHYSFSQGILGI  543
             + NR   E  D++P G +YRN +AFH+SY+EMEKRFK++IY+EGEPP+ H   S+ I  I
Sbjct  100   SRNRTFSEAQDWIPRGAVYRNAYAFHQSYIEMEKRFKVWIYKEGEPPIAHDGPSKNIYAI  159

Query  544   EGILIHQLEISK--FRTKNPEKAHVFFLPFSSYSLVHFVFVRDAHEW-PPIQKTARDYIN  714
             EG  I ++E  +  F  ++P  AHVFFLPFS  ++VHF++  +  ++  P+++   DY+ 
Sbjct  160   EGHFIIEMERERNPFVARHPADAHVFFLPFSVVNIVHFLYKPNVTDYRGPLKRLIADYVA  219

Query  715   GISTKYPYWNRSLGYDHFMLACHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVS  894
              ++ +YPYWNRSLG DHFM++CHDWAP +S     L++NSIRV+CNANTSEGFK   DV+
Sbjct  220   VVADRYPYWNRSLGADHFMVSCHDWAPHLSDANSDLYENSIRVICNANTSEGFKLGKDVT  279

Query  895   LPEIYLPQGNMDGLIGGPPPSNRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPK  1074
             LPE++LP G +         + +++L F+AGG HGYIR++++  WE KD EV +HEYLP+
Sbjct  280   LPEVHLPGGELSQPAANQLHNEKTILAFFAGGSHGYIREMLLHHWEGKDEEVVVHEYLPE  339

Query  1075  NVSYYGMVRKSKYCICPSGYEVASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVD  1254
              V+Y  ++ KSK+C+CPSGYEVASPR+VE++++GCVPV I   Y  PF+DVLDW  F+V 
Sbjct  340   GVNYDELMSKSKFCLCPSGYEVASPRIVESIFVGCVPVTISVDYPLPFSDVLDWRKFSVQ  399

Query  1255  IPVKEIPNLKKILLSIPQEKYLSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLN  1434
             IPV++I  +K IL +IP+ +Y  +Q++  QV+RHF VN P KRYD+ HMVLHSIWLRRLN
Sbjct  400   IPVEKIAEIKAILRAIPESRYKKLQKRVTQVQRHFVVNQPAKRYDMIHMVLHSIWLRRLN  459

Query  1435  IEV  1443
             + +
Sbjct  460   VRL  462



>ref|XP_009117358.1| PREDICTED: probable glycosyltransferase At3g42180 [Brassica rapa]
Length=468

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 278/402 (69%), Gaps = 18/402 (4%)
 Frame = +1

Query  283   PDAMKKLTNLERVEAGLARVRAAIRQA-----QTENRILEDPDYVPHGPIYRNPHAFHRS  447
             P ++KK +NLER E  L + R AIR+A      T N   ED  Y+P G IYRN  AFH+S
Sbjct  68    PVSIKKRSNLERREEELRKARVAIRRAVKFKNYTSN---EDMTYIPTGQIYRNSFAFHQS  124

Query  448   YLEMEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQLE------ISKFRTKNPEKAH  609
             ++EM KRFK++ Y+EG+ P+ H      I GIEG  I +LE       ++FR   PE+AH
Sbjct  125   HIEMMKRFKVWSYKEGDQPLVHDGPVNDIYGIEGQFIDELENVMGGPSARFRASQPEEAH  184

Query  610   VFFLPFSSYSLVHFVF--VRDAHEW--PPIQKTARDYINGISTKYPYWNRSLGYDHFMLA  777
              FFLPFS  ++VH+V+  +  + ++    + +   DY++ ++ KYP WN+S G DHFM++
Sbjct  185   AFFLPFSVANIVHYVYKPITSSADFNRARLHRIFNDYVDVVARKYPLWNQSNGADHFMVS  244

Query  778   CHDWAPTISHGTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGGPPPS  957
             CHDWAP +    P+ FK+ IR +CNANTSEGFKP ID S+PEI +P+G +     G  P 
Sbjct  245   CHDWAPDVPGSKPEFFKDFIRGLCNANTSEGFKPNIDFSIPEINIPKGKLKPPFMGQNPE  304

Query  958   NRSVLVFYAGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYE  1137
             NR++L F+AG  HGYIR+++   W+ KD ++++++ L K  +Y+ ++  SK+C+CPSGYE
Sbjct  305   NRTILAFFAGRAHGYIREILFSYWKGKDNDIQVYDNLTKGQNYHELIGHSKFCLCPSGYE  364

Query  1138  VASPRMVEAMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKY  1317
             VASPR VEA+Y GCVPV+I D+Y+ PF DVLDW  F+V+IPVK+I  +KKIL  IP +KY
Sbjct  365   VASPREVEAIYSGCVPVVISDNYSLPFNDVLDWSKFSVEIPVKQISEIKKILQEIPHDKY  424

Query  1318  LSMQEKGIQVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             L M +  ++VRRHF VN P + +DVFHM+LHS+WLRRLNI++
Sbjct  425   LQMHKNVMKVRRHFMVNRPAQPFDVFHMILHSVWLRRLNIKL  466



>ref|XP_010099849.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB80726.1| putative glycosyltransferase [Morus notabilis]
Length=455

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 275/394 (70%), Gaps = 9/394 (2%)
 Frame = +1

Query  289   AMKKLTNLE--RVEAGLARVRAAIRQAQTENRIL--EDPDYVPHGPIYRNPHAFHRSYLE  456
              M K  N+E  R+E GLAR RAAI++A         ++  ++P GP+Y NP+AFH+S++E
Sbjct  62    TMAKRNNVEEERIEEGLARARAAIKEAARTRTYTSYKEERFIPRGPVYHNPYAFHQSHIE  121

Query  457   MEKRFKIFIYEEGEPPVFHYSFSQGILGIEGILIHQL--EISKFRTKNPEKAHVFFLPFS  630
             MEKRF+++ Y+EGEPP+FH      I   EG+ +++L  E S F  +NP +A  F++P S
Sbjct  122   MEKRFRVWPYKEGEPPLFHMGPMNDIYSTEGLFMNELQTETSPFLARNPSEALAFYIPVS  181

Query  631   SYSLVHFVFV-RDAHEWPPIQKTARDYINGISTKYPYWNRSLGYDHFMLACHDWAPTISH  807
                ++ +V+     +    +Q    DYI  +S KYPYWNRS G DHF+++CHDWAP IS 
Sbjct  182   VVFVIEYVYKPYVTYSRTMLQDVVEDYIGIVSNKYPYWNRSKGADHFLVSCHDWAPDISR  241

Query  808   GTPKLFKNSIRVMCNANTSEGFKPAIDVSLPEIYLPQGNMDGLIGG--PPPSNRSVLVFY  981
               P L+KN IRV+CNAN+SEGF+P  DVSLPEI L +G+      G   PP+NRS+L F+
Sbjct  242   AHPDLYKNFIRVVCNANSSEGFQPFRDVSLPEINLRKGDSGLTDAGFVQPPNNRSILAFF  301

Query  982   AGGIHGYIRQVMMETWENKDPEVEIHEYLPKNVSYYGMVRKSKYCICPSGYEVASPRMVE  1161
             AGG HG++R+ + + W+ KD E+++HEYLPK ++Y  ++ KSK+C+CPSGYEVASPR+VE
Sbjct  302   AGGPHGFVREELFKHWKEKDNEIQVHEYLPKTLNYKELMGKSKFCLCPSGYEVASPRVVE  361

Query  1162  AMYMGCVPVLIKDHYAKPFADVLDWDTFAVDIPVKEIPNLKKILLSIPQEKYLSMQEKGI  1341
             ++Y GCVPV+I   Y  PF+DVLDW  F++ IP ++IP++K IL  I + +YL MQ++ I
Sbjct  362   SIYAGCVPVIISPSYVLPFSDVLDWSKFSIHIPFEKIPDIKTILEGISEAEYLEMQKRVI  421

Query  1342  QVRRHFEVNFPPKRYDVFHMVLHSIWLRRLNIEV  1443
             QV+ HF +N P K YD  HMV+HSIWLRRLN+ +
Sbjct  422   QVQHHFVLNRPAKPYDFMHMVMHSIWLRRLNVRL  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4306464265376