BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24636_g1_i1 len=734 path=[1826:0-208 2732:209-211 2043:212-263
751:264-310 798:311-321 2836:322-334 39:335-364 2883:365-376
81:377-430 135:431-463 295:464-485 2933:486-491 2939:492-532
2550:533-565 2382:566-733]

Length=734
                                                                      Score     E

gb|AAK72906.1|  proteinase inhibitor SPLTI-2                            113   3e-28   Ipomoea batatas [batate]
gb|AAK95644.1|AF404833_1  proteinase inhibitor                          112   7e-28   Ipomoea batatas [batate]
gb|AAK72904.1|AF330700_1  proteinase inhibitor SPLTI-a                  112   1e-27   Ipomoea batatas [batate]
gb|AAK72905.1|  proteinase inhibitor SPLTI-1                            105   3e-25   Ipomoea batatas [batate]
ref|XP_006295369.1|  hypothetical protein CARUB_v10024461mg           70.9    2e-12   
ref|XP_010679203.1|  PREDICTED: glu S.griseus protease inhibitor-...  70.1    3e-12   
ref|XP_002451431.1|  hypothetical protein SORBIDRAFT_04g001970        68.2    1e-11   Sorghum bicolor [broomcorn]
emb|CAZ96086.1|  putative proteinase inhibitor                        68.2    1e-11   
gb|KDP42134.1|  hypothetical protein JCGZ_03191                       67.0    3e-11   
ref|XP_007148999.1|  hypothetical protein PHAVU_005G032000g           67.0    5e-11   
ref|XP_010509102.1|  PREDICTED: protease inhibitor HPI                66.2    6e-11   
emb|CDY14424.1|  BnaC03g21710D                                        65.9    8e-11   
ref|XP_006442409.1|  hypothetical protein CICLE_v10022906mg           66.6    1e-10   
ref|XP_006495465.1|  PREDICTED: inhibitor of trypsin and hageman ...  66.6    1e-10   
ref|XP_002983045.1|  hypothetical protein SELMODRAFT_117696           65.1    1e-10   
ref|XP_010243990.1|  PREDICTED: glu S.griseus protease inhibitor-...  65.1    1e-10   
ref|XP_006442402.1|  hypothetical protein CICLE_v10022909mg           66.2    2e-10   
ref|XP_006411111.1|  hypothetical protein EUTSA_v10017502mg           64.7    2e-10   
sp|P16064.1|ICI1_PHAAN  RecName: Full=Subtilisin inhibitor 1; Alt...  65.1    2e-10   Vigna angularis [azuki bean]
gb|AFP43221.1|  proteinase inhibitor                                  64.3    3e-10   
emb|CAZ96165.1|  putative proteinase inhibitor I13, potato inhibi...  63.9    4e-10   
gb|KDP36378.1|  hypothetical protein JCGZ_08647                       63.5    7e-10   
ref|XP_003564129.1|  PREDICTED: chymotrypsin inhibitor-like           63.2    7e-10   
ref|XP_002521007.1|  Proteinase inhibitor, putative                   63.2    8e-10   Ricinus communis
emb|CAZ96083.1|  putative Subtilisin inhibitor 1 (Subtilisin inhi...  62.8    1e-09   
ref|XP_002965559.1|  hypothetical protein SELMODRAFT_84301            62.8    1e-09   
emb|CDY39726.1|  BnaA04g11270D                                        62.8    1e-09   
gb|KDP35355.1|  hypothetical protein JCGZ_10339                       62.8    1e-09   
ref|XP_009133305.1|  PREDICTED: protease inhibitor HPI-like           62.8    1e-09   
ref|XP_002879773.1|  predicted protein                                62.4    2e-09   
ref|XP_007221364.1|  hypothetical protein PRUPE_ppa018589mg           62.4    2e-09   
ref|XP_003590799.1|  Protease inhibitor                               62.4    2e-09   
ref|XP_002881621.1|  hypothetical protein ARALYDRAFT_482903           62.4    2e-09   
ref|XP_009374774.1|  PREDICTED: glu S.griseus protease inhibitor-...  62.0    2e-09   
ref|XP_011004115.1|  PREDICTED: inhibitor of trypsin and hageman ...  63.2    2e-09   
ref|XP_007009890.1|  Serine protease inhibitor                        61.6    3e-09   
ref|XP_004288451.1|  PREDICTED: inhibitor of trypsin and hageman ...  61.6    3e-09   
ref|NP_030435.1|  PR-6 proteinase inhibitor family protein            61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521006.1|  Proteinase inhibitor, putative                   60.8    5e-09   Ricinus communis
emb|CAZ96216.1|  putative Protease inhibitor HPI                      60.5    7e-09   
ref|NP_030438.1|  PR-6 proteinase inhibitor family protein            60.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007009884.1|  Serine protease inhibitor                        60.5    7e-09   
ref|XP_008391172.1|  PREDICTED: glu S.griseus protease inhibitor-...  60.5    7e-09   
ref|NP_001189707.1|  PR-6 proteinase inhibitor family protein         60.8    7e-09   
ref|XP_010243880.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.5    9e-09   
ref|XP_002451430.1|  hypothetical protein SORBIDRAFT_04g001965        60.1    9e-09   Sorghum bicolor [broomcorn]
emb|CAZ96049.1|  putative proteinase inhibitor I13, potato inhibi...  60.1    9e-09   
ref|XP_004288450.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.1    1e-08   
ref|NP_001274985.1|  proteinase inhibitor 1 PPI3B2 precursor          60.8    1e-08   
ref|XP_006363695.1|  PREDICTED: trypsin inhibitor 1-like              60.1    1e-08   
ref|XP_010094276.1|  Glu S.griseus protease inhibitor                 59.7    1e-08   
ref|XP_002323424.2|  hypothetical protein POPTR_0016s07980g           60.1    2e-08   Populus trichocarpa [western balsam poplar]
dbj|BAA02823.1|  genetic tumor-related proteinase inhibitor I pre...  60.1    2e-08   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_004247658.1|  PREDICTED: wound-induced proteinase inhibitor 1  60.5    2e-08   
gb|KFK36789.1|  hypothetical protein AALP_AA4G170900                  59.3    2e-08   
gb|KDP36380.1|  hypothetical protein JCGZ_08649                       59.3    2e-08   
ref|XP_003617314.1|  protease inhibitor                               59.3    2e-08   
ref|XP_006421577.1|  hypothetical protein CICLE_v10006203mg           60.5    2e-08   
gb|AAN76363.1|  type I proteinase inhibitor-like protein              60.5    2e-08   Citrus x paradisi [grapefruit]
ref|XP_006490176.1|  PREDICTED: inhibitor of trypsin and hageman ...  60.5    2e-08   
ref|XP_006421576.1|  hypothetical protein CICLE_v10006211mg           60.5    2e-08   
dbj|BAD09914.1|  hypothetical protein                                 59.3    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006381983.1|  hypothetical protein POPTR_0006s22880g           58.9    3e-08   
gb|KDO45261.1|  hypothetical protein CISIN_1g033055mg                 60.1    3e-08   
ref|XP_006421578.1|  hypothetical protein CICLE_v10006212mg           60.1    3e-08   
ref|XP_010100072.1|  Proteinase inhibitor                             58.9    3e-08   
ref|XP_004288449.1|  PREDICTED: glu S.griseus protease inhibitor-...  58.5    4e-08   
sp|Q6XNP7.2|HPI_HEVBR  RecName: Full=Protease inhibitor HPI; AltN...  58.5    4e-08   Hevea brasiliensis [jebe]
ref|XP_007009886.1|  Serine protease inhibitor                        58.2    5e-08   
ref|XP_006373842.1|  hypothetical protein POPTR_0016s07990g           58.2    6e-08   
gb|ABK22457.1|  unknown                                               58.5    6e-08   Picea sitchensis
emb|CAZ96136.1|  putative proteinase inhibitor I13, potato inhibi...  57.8    7e-08   
ref|XP_003598789.1|  Subtilisin inhibitor                             58.5    7e-08   
ref|XP_009782003.1|  PREDICTED: glu S.griseus protease inhibitor-...  57.8    7e-08   
ref|NP_001275446.1|  proteinase inhibitor I precursor                 58.5    8e-08   
ref|XP_009047357.1|  hypothetical protein LOTGIDRAFT_230585           57.4    9e-08   
gb|AIT42233.1|  proteinase inhibitor 1                                58.2    9e-08   
gb|KDP42132.1|  hypothetical protein JCGZ_03189                       57.4    1e-07   
ref|XP_010100075.1|  Proteinase inhibitor                             58.5    1e-07   
gb|ACN40009.1|  unknown                                               58.2    1e-07   Picea sitchensis
ref|XP_006367782.1|  PREDICTED: serine protease inhibitor isoform X1  58.2    1e-07   
dbj|BAD09916.1|  hypothetical protein                                 57.4    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006363669.1|  PREDICTED: trypsin inhibitor 1-like              57.4    1e-07   
ref|XP_009774947.1|  PREDICTED: trypsin inhibitor 1                   57.4    2e-07   
gb|KGN49621.1|  hypothetical protein Csa_5G027950                     57.0    2e-07   
ref|XP_007224127.1|  hypothetical protein PRUPE_ppa015912mg           57.0    2e-07   
sp|P24076.1|BGIA_MOMCH  RecName: Full=Glu S.griseus protease inhi...  56.6    2e-07   Momordica charantia [balsam pear]
ref|XP_004134091.1|  PREDICTED: inhibitor of trypsin and hageman ...  56.6    2e-07   
gb|AAA33816.1|  proteinase inhibitor I                                57.0    3e-07   Solanum tuberosum [potatoes]
pdb|1MIT|A  Chain A, Recombinant Cucurbita Maxima Trypsin Inhibit...  56.2    3e-07   
ref|XP_006363672.1|  PREDICTED: trypsin inhibitor 1-like              57.0    3e-07   
sp|P19873.1|ITH5_CUCMA  RecName: Full=Inhibitor of trypsin and ha...  56.2    3e-07   Cucurbita maxima [Boston marrow]
ref|NP_001066344.1|  Os12g0193100                                     56.6    3e-07   Oryza sativa Japonica Group [Japonica rice]
pdb|1TIN|A  Chain A, Three-Dimensional Structure In Solution Of C...  56.2    3e-07   
dbj|BAA05472.1|  tumor-related protein                                56.2    3e-07   Nicotiana glauca x Nicotiana langsdorffii
gb|AAC49603.1|  wound-inducible proteinase inhibitor I                57.0    3e-07   Solanum tuberosum [potatoes]
ref|XP_007224255.1|  hypothetical protein PRUPE_ppa018391mg           56.2    3e-07   
gb|KFK29320.1|  hypothetical protein AALP_AA7G118100                  56.2    3e-07   
ref|XP_002284454.1|  PREDICTED: inhibitor of trypsin and hageman ...  56.2    3e-07   Vitis vinifera
gb|AAS46024.1|  serine protease inhibitor                             56.2    3e-07   Solanum tuberosum [potatoes]
ref|XP_004249689.1|  PREDICTED: trypsin inhibitor 1-like              56.6    4e-07   
ref|XP_004952054.1|  PREDICTED: subtilisin inhibitor 1-like           55.8    4e-07   
gb|AAA69780.1|  proteinase inhibitor I                                56.6    4e-07   Solanum tuberosum [potatoes]
ref|XP_010278088.1|  PREDICTED: inhibitor of trypsin and hageman ...  55.8    4e-07   
gb|EAY82524.1|  hypothetical protein OsI_37748                        56.2    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006606926.1|  PREDICTED: glu S.griseus protease inhibitor-...  55.8    4e-07   
ref|XP_007221365.1|  hypothetical protein PRUPE_ppa024500mg           55.8    4e-07   
ref|XP_009410013.1|  PREDICTED: subtilisin inhibitor-like             56.2    5e-07   
gb|AAP46156.1|  protease inhibitor protein 1                          55.8    5e-07   Hevea brasiliensis [jebe]
ref|XP_007009885.1|  Serine protease inhibitor                        55.8    5e-07   
gb|KDP35352.1|  hypothetical protein JCGZ_10336                       55.8    5e-07   
ref|XP_004134089.1|  PREDICTED: inhibitor of trypsin and hageman ...  55.8    5e-07   
gb|AID52861.1|  serine protease inhibitor                             55.5    5e-07   
ref|XP_002440437.1|  hypothetical protein SORBIDRAFT_09g001010        55.8    5e-07   Sorghum bicolor [broomcorn]
gb|EYU40892.1|  hypothetical protein MIMGU_mgv1a017848mg              55.5    5e-07   
ref|XP_008224409.1|  PREDICTED: glu S.griseus protease inhibitor-...  55.5    5e-07   
gb|KFK36788.1|  hypothetical protein AALP_AA4G170800                  55.5    5e-07   
sp|P01052.1|ICIA_SOLTU  RecName: Full=Chymotrypsin inhibitor I, A...  55.5    6e-07   Solanum tuberosum [potatoes]
gb|AIT42232.1|  proteinase inhibitor 1                                56.2    6e-07   
ref|XP_001424380.1|  hypothetical protein                             55.5    6e-07   Paramecium tetraurelia strain d4-2
gb|KDP21344.1|  hypothetical protein JCGZ_21815                       55.5    6e-07   
gb|ADD51184.1|  protease inhibitor 1                                  55.5    7e-07   Vitis cinerea var. helleri x Vitis riparia
sp|P08454.2|ICID_SOLTU  RecName: Full=Wound-induced proteinase in...  55.8    7e-07   Solanum tuberosum [potatoes]
ref|XP_011004117.1|  PREDICTED: uncharacterized protein LOC105110701  59.3    7e-07   
ref|XP_004247695.1|  PREDICTED: proteinase inhibitor 1-like           55.8    7e-07   
ref|XP_007227104.1|  hypothetical protein PRUPE_ppa025505mg           55.1    7e-07   
ref|XP_010322583.1|  PREDICTED: subtilisin inhibitor-like             55.5    8e-07   
prf||1314299A  proteinase inhibitor I                                 55.8    8e-07
gb|AAA72133.1|  proteinase inhibitor I                                55.8    8e-07   Solanum tuberosum [potatoes]
ref|XP_006663898.1|  PREDICTED: subtilisin inhibitor 1-like           55.5    8e-07   
ref|XP_010687945.1|  PREDICTED: glu S.griseus protease inhibitor-...  55.1    8e-07   
ref|XP_007009887.1|  Serine protease inhibitor, putative              55.1    8e-07   
ref|XP_006420158.1|  hypothetical protein CICLE_v10007123mg           55.5    8e-07   
gb|ADP05503.1|  serine proteinase inhibitor 1b                        54.7    9e-07   
ref|XP_002314193.1|  hypothetical protein POPTR_0009s03360g           55.1    9e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010229493.1|  PREDICTED: subtilisin inhibitor CLSI-I-like      55.8    9e-07   
gb|AID52862.1|  serine protease inhibitor                             55.1    9e-07   
ref|XP_006489606.1|  PREDICTED: uncharacterized protein LOC102620214  57.0    9e-07   
gb|ABZ88804.1|  protease inhibitor protein                            54.7    9e-07   Hevea brasiliensis [jebe]
emb|CBI26387.3|  unnamed protein product                              54.7    1e-06   
emb|CBI26384.3|  unnamed protein product                              55.5    1e-06   
emb|CAN75275.1|  hypothetical protein VITISV_043736                   54.7    1e-06   Vitis vinifera
ref|XP_006354745.1|  PREDICTED: subtilisin inhibitor 1-like           55.1    1e-06   
sp|P16231.1|ICI1_SOLPE  RecName: Full=Wound-induced proteinase in...  55.5    1e-06   Solanum peruvianum [Peruvian tomato]
gb|AAA34198.1|  proteinase inhibitor I                                55.5    1e-06   Solanum peruvianum [Peruvian tomato]
ref|XP_007009882.1|  Serine protease inhibitor                        54.7    1e-06   
ref|XP_006367784.1|  PREDICTED: proteinase inhibitor 1 PPI2C1A        55.1    1e-06   
gb|ADP05502.1|  serine proteinase inhibitor 1a                        54.3    1e-06   
gb|AIT42237.1|  proteinase inhibitor 1                                55.1    1e-06   
ref|XP_004247654.1|  PREDICTED: wound-induced proteinase inhibitor 1  55.1    1e-06   
gb|KDP36376.1|  hypothetical protein JCGZ_08645                       54.3    1e-06   
gb|AAN85825.1|  protease inhibitor                                    54.3    1e-06   Vitis vinifera
gb|KDP36377.1|  hypothetical protein JCGZ_08646                       54.3    2e-06   
gb|ADB85100.1|  proteinase inhibitor                                  54.3    2e-06   
emb|CAA47907.1|  proteinase inhibitor I                               54.7    2e-06   Solanum tuberosum [potatoes]
ref|XP_004249682.1|  PREDICTED: trypsin inhibitor 1-like              54.7    2e-06   
ref|XP_007050380.1|  Inhibitor of trypsin and hageman factor          53.9    2e-06   
dbj|BAC10910.1|  protease inhibitor 2                                 53.9    2e-06   Zinnia violacea [garden zinnia]
gb|EMT22929.1|  Subtilisin-chymotrypsin inhibitor-2A                  54.7    2e-06   
ref|XP_003590801.1|  Inhibitor of trypsin and hageman factor          53.9    2e-06   
emb|CAA87073.1|  pathogenesis-related protein PR-6 type               54.3    2e-06   Sambucus nigra
ref|XP_002309424.2|  hypothetical protein POPTR_0006s22860g           53.9    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010100074.1|  Proteinase inhibitor                             53.9    2e-06   
ref|XP_006296188.1|  hypothetical protein CARUB_v10025358mg           53.9    3e-06   
ref|XP_008439364.1|  PREDICTED: inhibitor of trypsin and hageman ...  53.5    3e-06   
gb|EPS59152.1|  hypothetical protein M569_15657                       53.5    3e-06   
ref|XP_006420157.1|  hypothetical protein CICLE_v10007070mg           53.5    3e-06   
emb|CCW27997.1|  serine protease inhibitor                            53.5    3e-06   
ref|XP_007009891.1|  Serine protease inhibitor                        53.5    3e-06   
ref|XP_008391168.1|  PREDICTED: glu S.griseus protease inhibitor-...  53.5    3e-06   
ref|XP_002314645.1|  hypothetical protein POPTR_0010s08640g           53.5    4e-06   Populus trichocarpa [western balsam poplar]
sp|Q00783.1|ICI1_SOLTU  RecName: Full=Proteinase inhibitor 1; Alt...  53.9    4e-06   Solanum tuberosum [potatoes]
ref|XP_004490203.1|  PREDICTED: glu S.griseus protease inhibitor-...  53.1    4e-06   
ref|XP_009590374.1|  PREDICTED: trypsin inhibitor 1                   53.5    4e-06   
ref|XP_002323423.1|  hypothetical protein POPTR_0016s07970g           53.1    4e-06   Populus trichocarpa [western balsam poplar]
gb|KDP42136.1|  hypothetical protein JCGZ_03193                       55.1    4e-06   
ref|XP_004247660.1|  PREDICTED: wound-induced proteinase inhibitor 1  53.9    5e-06   
gb|AAZ08249.1|  proteinase inhibitor 1 PPI3A4                         53.5    5e-06   Solanum tuberosum [potatoes]
ref|XP_007201476.1|  hypothetical protein PRUPE_ppa014449mg           52.8    5e-06   
ref|XP_006363673.1|  PREDICTED: trypsin inhibitor 1-like              53.5    5e-06   
ref|XP_006378353.1|  hypothetical protein POPTR_0010s08630g           52.8    5e-06   
emb|CAN75276.1|  hypothetical protein VITISV_043737                   52.8    5e-06   Vitis vinifera
ref|XP_007226170.1|  hypothetical protein PRUPE_ppa015379mg           52.8    5e-06   
sp|P08820.1|ICIS_VICFA  RecName: Full=Subtilisin inhibitor            52.8    6e-06   Vicia faba [broad bean]
ref|XP_004247656.1|  PREDICTED: wound-induced proteinase inhibitor 1  53.5    6e-06   
ref|XP_004288448.1|  PREDICTED: glu S.griseus protease inhibitor-...  53.5    6e-06   
ref|XP_008224407.1|  PREDICTED: inhibitor of trypsin and hageman ...  52.8    6e-06   
ref|XP_008391173.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.8    6e-06   
ref|XP_003556368.1|  PREDICTED: glu S.griseus protease inhibitor      52.8    6e-06   
ref|XP_007138379.1|  hypothetical protein PHAVU_009G203600g           52.4    7e-06   
sp|P82381.1|ICI_LINUS  RecName: Full=Proteinase inhibitor; AltNam...  52.4    7e-06   Linum usitatissimum
pdb|1DWM|A  Chain A, Solution Structure Of Linum Usitatissinum Tr...  52.4    7e-06   
gb|ACU19481.1|  unknown                                               52.4    8e-06   Glycine max [soybeans]
ref|XP_002442971.1|  hypothetical protein SORBIDRAFT_08g005570        52.4    9e-06   Sorghum bicolor [broomcorn]
ref|XP_004134085.1|  PREDICTED: protease inhibitor HPI-like           52.4    9e-06   
gb|KDO37763.1|  hypothetical protein CISIN_1g040548mg                 52.4    9e-06   
gb|AAZ08246.1|  proteinase inhibitor 1 PPI2C1A                        52.8    9e-06   Solanum tuberosum [potatoes]
ref|XP_009603954.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    1e-05   
ref|XP_007199579.1|  hypothetical protein PRUPE_ppb023174mg           53.1    1e-05   
gb|EMT22931.1|  Subtilisin-chymotrypsin inhibitor-2A                  52.4    1e-05   
ref|XP_003535093.2|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    1e-05   
ref|XP_009396358.1|  PREDICTED: glu S.griseus protease inhibitor-...  52.0    1e-05   
ref|XP_006489607.1|  PREDICTED: inhibitor of trypsin and hageman ...  52.0    1e-05   
ref|XP_006367783.1|  PREDICTED: proteinase inhibitor 1-like           52.4    1e-05   
ref|XP_006387620.1|  hypothetical protein POPTR_0770s00230g           52.0    1e-05   
ref|XP_002314644.1|  hypothetical protein POPTR_0010s08610g           52.0    1e-05   Populus trichocarpa [western balsam poplar]
gb|KDP21343.1|  hypothetical protein JCGZ_21814                       52.4    1e-05   
gb|AIT42231.1|  proteinase inhibitor 1                                52.4    1e-05   
gb|EYU46483.1|  hypothetical protein MIMGU_mgv1a023325mg              51.6    1e-05   
gb|KDP35356.1|  hypothetical protein JCGZ_10340                       51.6    1e-05   
ref|XP_004247655.1|  PREDICTED: wound-induced proteinase inhibito...  52.4    1e-05   
ref|XP_007029839.1|  Uncharacterized protein TCM_025715               53.1    1e-05   
ref|XP_002517007.1|  Glu S.griseus protease inhibitor, putative       51.6    1e-05   Ricinus communis
ref|XP_008391169.1|  PREDICTED: glu S.griseus protease inhibitor-...  51.6    2e-05   
ref|XP_002315724.2|  trypsin inhibitor family protein                 51.6    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002440441.1|  hypothetical protein SORBIDRAFT_09g001050        51.6    2e-05   Sorghum bicolor [broomcorn]
gb|KEH42587.1|  inhibitor of trypsin and hageman factor-like protein  51.6    2e-05   
gb|KFK29321.1|  hypothetical protein AALP_AA7G118200                  51.6    2e-05   
ref|XP_004499830.1|  PREDICTED: subtilisin inhibitor 1-like           52.0    2e-05   
ref|XP_009140106.1|  PREDICTED: protease inhibitor HPI-like           51.6    2e-05   
ref|XP_004134090.1|  PREDICTED: glu S.griseus protease inhibitor-...  51.6    2e-05   
ref|XP_002532999.1|  subtilisin inhibitor 1, putative                 52.0    2e-05   Ricinus communis
gb|KGN56903.1|  hypothetical protein Csa_3G142950                     51.2    2e-05   
pdb|1VBW|A  Chain A, Crystal Structure Of Bitter Gourd Trypsin In...  51.2    2e-05   
dbj|BAB32588.1|  inhibitor against trypsin                            51.2    2e-05   Momordica charantia [balsam pear]
gb|EWM21885.1|  subtilisin inhibitor                                  52.8    2e-05   
gb|EMS68098.1|  Subtilisin-chymotrypsin inhibitor-2A                  51.6    2e-05   
gb|KDP35354.1|  hypothetical protein JCGZ_10338                       51.2    2e-05   
ref|XP_003614151.1|  Trypsin inhibitor                                50.8    2e-05   
sp|Q03199.1|IPIB_TOBAC  RecName: Full=Proteinase inhibitor I-B; S...  51.6    3e-05   Nicotiana tabacum [American tobacco]
ref|XP_011081244.1|  PREDICTED: proteinase inhibitor-like             51.2    3e-05   
ref|XP_004977162.1|  PREDICTED: subtilisin inhibitor 1-like           51.6    3e-05   
ref|XP_004247696.2|  PREDICTED: wound-induced proteinase inhibito...  51.6    3e-05   
gb|ABP01767.1|  ptoteinase inhibitor 2                                50.8    3e-05   Salvia miltiorrhiza [Chinese salvia]
gb|EYU17889.1|  hypothetical protein MIMGU_mgv1a022666mg              50.8    3e-05   
ref|NP_001234615.1|  ethylene-responsive proteinase inhibitor 1 p...  51.6    3e-05   
gb|EMS66467.1|  hypothetical protein TRIUR3_25503                     50.8    3e-05   
ref|WP_017626123.1|  hypothetical protein                             51.2    4e-05   
ref|XP_003598785.1|  CCP                                              51.2    4e-05   
ref|XP_009610134.1|  PREDICTED: proteinase inhibitor I-B              51.6    4e-05   
gb|KGN60477.1|  hypothetical protein Csa_3G914570                     50.4    4e-05   
gb|AAT40087.1|  MPI                                                   50.4    5e-05   Tripsacum dactyloides
ref|NP_001274835.1|  proteinase inhibitor 1 PPI3A2 precursor          50.8    5e-05   
ref|XP_006420961.1|  hypothetical protein CICLE_v10006680mg           50.1    5e-05   
gb|EMT14369.1|  Chymotrypsin inhibitor                                50.1    5e-05   
gb|AAT40076.1|  MPI                                                   50.1    6e-05   Zea perennis [perennial teosinte]
gb|AAT40058.1|  MPI                                                   50.1    6e-05   Zea diploperennis [chapule]
gb|AAT40067.1|  MPI                                                   50.1    6e-05   Zea diploperennis [chapule]
ref|XP_009774949.1|  PREDICTED: trypsin inhibitor 1-like              50.4    6e-05   
emb|CDO99178.1|  unnamed protein product                              50.1    6e-05   
gb|AAT40063.1|  MPI                                                   50.1    6e-05   Zea diploperennis [chapule]
ref|XP_009782399.1|  PREDICTED: proteinase inhibitor I-A              50.4    6e-05   
ref|XP_008447238.1|  PREDICTED: glu S.griseus protease inhibitor-...  50.1    6e-05   
gb|ACJ62226.1|  maize proteinase inhibitor                            50.1    6e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFT92003.1|  potato inhibitor I family protein                     50.1    7e-05   
ref|NP_001275264.1|  proteinase inhibitor I precursor                 50.4    7e-05   
gb|EMT11499.1|  Subtilisin-chymotrypsin inhibitor-2A                  49.7    7e-05   
gb|ABP01766.1|  proteinase inhibitor 1                                49.7    8e-05   Salvia miltiorrhiza [Chinese salvia]
gb|ABA34115.1|  maize protease inhibitor                              49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62205.1|  maize proteinase inhibitor                            49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002440442.1|  hypothetical protein SORBIDRAFT_09g001060        49.7    8e-05   Sorghum bicolor [broomcorn]
ref|NP_001177000.1|  Os12g0548450                                     49.7    8e-05   
gb|ABA34116.1|  maize protease inhibitor                              49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62208.1|  maize proteinase inhibitor                            49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007029841.1|  Uncharacterized protein TCM_025717               51.2    8e-05   
gb|ACJ62214.1|  maize proteinase inhibitor                            49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009599918.1|  PREDICTED: trypsin inhibitor 1-like              50.1    8e-05   
gb|ACJ62163.1|  maize proteinase inhibitor                            49.7    8e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009028832.1|  hypothetical protein HELRODRAFT_69476            49.7    9e-05   
gb|ABA34107.1|  maize protease inhibitor                              49.7    9e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34112.1|  maize protease inhibitor                              49.7    9e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003568911.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  49.7    9e-05   
ref|NP_001105449.1|  subtilisin-chymotrypsin inhibitor homolog1       49.7    9e-05   Zea mays [maize]
sp|P81712.1|ICI1_CANLI  RecName: Full=Subtilisin inhibitor CLSI-I     49.3    9e-05   Canavalia lineata
ref|XP_003542413.1|  PREDICTED: inhibitor of trypsin and hageman ...  49.7    9e-05   
gb|ACJ62231.1|  maize proteinase inhibitor                            49.7    9e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001232814.1|  subtilisin-chymotrypsin inhibitor CI-1B          49.7    9e-05   
gb|ABA34114.1|  maize protease inhibitor                              49.3    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EAY80620.1|  hypothetical protein OsI_35801                        49.3    1e-04   Oryza sativa Indica Group [Indian rice]
prf||1105220A  inhibitor,subtilisin                                   49.3    1e-04
gb|EMT16510.1|  hypothetical protein F775_04512                       49.3    1e-04   
ref|XP_008438569.1|  PREDICTED: inhibitor of trypsin and hageman ...  49.3    1e-04   
ref|NP_001275201.1|  type I serine protease inhibitor precursor       49.7    1e-04   
ref|XP_003556369.1|  PREDICTED: inhibitor of trypsin and hageman ...  49.3    1e-04   
ref|XP_011030541.1|  PREDICTED: glu S.griseus protease inhibitor      49.3    1e-04   
gb|KDO68501.1|  hypothetical protein CISIN_1g039274mg                 49.3    1e-04   
dbj|BAC10909.1|  protease inhibitor 1                                 48.9    1e-04   
ref|XP_006358889.1|  PREDICTED: ethylene-responsive proteinase in...  49.7    1e-04   
gb|KCW88972.1|  hypothetical protein EUGRSUZ_A01291                   50.1    1e-04   
gb|EYU32852.1|  hypothetical protein MIMGU_mgv1a019023mg              48.9    1e-04   
ref|XP_006443889.1|  hypothetical protein CICLE_v10023822mg           49.3    2e-04   
ref|XP_002440438.1|  hypothetical protein SORBIDRAFT_09g001020        48.9    2e-04   
emb|CAZ96140.1|  putative proteinase inhibitor I13, potato inhibi...  49.3    2e-04   
ref|NP_001238694.1|  protease inhibitor-like                          48.9    2e-04   
gb|KDO41812.1|  hypothetical protein CISIN_1g044806mg                 48.5    2e-04   
ref|XP_004962355.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  48.5    2e-04   
ref|XP_006383697.1|  hypothetical protein POPTR_0005s24230g           48.5    2e-04   
ref|XP_008224405.1|  PREDICTED: glu S.griseus protease inhibitor-...  48.5    2e-04   
gb|AAB35320.1|  BWI-1=protease inhibitor/trypsin inhibitor            48.5    2e-04   
ref|NP_001147170.1|  subtilisin-chymotrypsin inhibitor CI-1C          48.5    2e-04   
gb|EWM21884.1|  subtilisin inhibitor                                  49.7    2e-04   
gb|EMT22407.1|  Subtilisin inhibitor 1                                49.3    2e-04   
gb|ABA34106.1|  maize protease inhibitor                              48.5    2e-04   
pdb|3RDY|A  Chain A, Crystal Structure Of Buckwheat Trypsin Inhib...  48.5    2e-04   
ref|XP_010038018.1|  PREDICTED: proteinase inhibitor-like             48.5    2e-04   
ref|XP_003598776.1|  Chymotrypsin inhibitor-2                         48.9    2e-04   
ref|XP_006367785.1|  PREDICTED: wound-induced proteinase inhibito...  48.9    3e-04   
gb|KGN50840.1|  hypothetical protein Csa_5G286040                     48.1    3e-04   
ref|XP_008674421.1|  PREDICTED: subtilisin inhibitor-like             48.1    3e-04   
gb|ABB96723.1|  proteinase inhibitor BTIw1                            48.1    3e-04   
ref|XP_003590795.1|  Inhibitor of trypsin and hageman factor          48.1    3e-04   
gb|AAB46906.1|  BTI-2=trypsin inhibitor isoform                       48.1    3e-04   
ref|XP_003538225.2|  PREDICTED: subtilisin inhibitor 1-like           48.9    3e-04   
ref|XP_010094275.1|  Glu S.griseus protease inhibitor                 48.1    3e-04   
ref|XP_007144065.1|  hypothetical protein PHAVU_007G125500g           47.8    3e-04   
ref|XP_010650045.1|  PREDICTED: uncharacterized protein LOC104879281  51.2    3e-04   
ref|XP_006378352.1|  hypothetical protein POPTR_0010s08600g           47.8    3e-04   
gb|EMT14367.1|  Subtilisin inhibitor 1                                47.8    3e-04   
gb|EMT06350.1|  Subtilisin-chymotrypsin inhibitor CI-1C               48.1    4e-04   
ref|XP_002317460.1|  hypothetical protein POPTR_0011s11140g           47.8    4e-04   
ref|XP_007227504.1|  hypothetical protein PRUPE_ppa014371mg           47.8    4e-04   
ref|XP_009631665.1|  PREDICTED: subtilisin inhibitor-like             48.1    4e-04   
ref|XP_006381208.1|  hypothetical protein POPTR_0006s08920g           48.1    4e-04   
ref|XP_004962602.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  47.8    4e-04   
ref|XP_006387619.1|  hypothetical protein POPTR_0770s00220g           47.8    4e-04   
gb|AFT92004.1|  potato inhibitor I family protein                     47.8    4e-04   
ref|XP_007224909.1|  hypothetical protein PRUPE_ppa021973mg           47.8    4e-04   
gb|AIT42235.1|  proteinase inhibitor 1                                48.1    4e-04   
emb|CDX93297.1|  BnaC04g45990D                                        47.8    4e-04   
gb|ELU11714.1|  hypothetical protein CAPTEDRAFT_21329                 47.4    5e-04   
gb|KHN13695.1|  Subtilisin inhibitor 1                                48.1    5e-04   
ref|XP_006381211.1|  hypothetical protein POPTR_0006s08950g           48.1    5e-04   
emb|CDM81426.1|  unnamed protein product                              47.4    5e-04   
sp|P83472.2|ICI_LUMTE  RecName: Full=Chymotrypsin inhibitor; Shor...  47.8    5e-04   
ref|XP_001782101.1|  predicted protein                                47.4    5e-04   
ref|XP_004171937.1|  PREDICTED: protease inhibitor HPI-like           47.4    5e-04   
gb|EYU32851.1|  hypothetical protein MIMGU_mgv1a022632mg              47.4    5e-04   
gb|AFX66991.1|  proteinase inhibitor I                                48.1    6e-04   
gb|AAB46905.1|  BTI-1=7.634 kda trypsin inhibitor isoform             47.4    6e-04   
ref|XP_006421631.1|  hypothetical protein CICLE_v10006306mg           47.8    6e-04   
gb|AAK73145.1|AC079022_18  putative proteinase inhibitor              47.4    6e-04   
ref|XP_010442010.1|  PREDICTED: inhibitor of trypsin and hageman ...  47.4    6e-04   
ref|XP_004247659.1|  PREDICTED: wound-induced proteinase inhibito...  47.8    7e-04   
ref|XP_006281379.1|  hypothetical protein CARUB_v10027439mg           47.4    7e-04   
gb|EYU46484.1|  hypothetical protein MIMGU_mgv1a017534mg              47.0    7e-04   
gb|KGN50838.1|  hypothetical protein Csa_5G285030                     47.0    8e-04   
ref|XP_002440440.1|  hypothetical protein SORBIDRAFT_09g001040        47.0    8e-04   
gb|KDP34823.1|  hypothetical protein JCGZ_11185                       47.0    8e-04   
ref|XP_006381202.1|  hypothetical protein POPTR_0006s08880g           47.4    8e-04   
ref|XP_008438570.1|  PREDICTED: glu S.griseus protease inhibitor-...  47.0    8e-04   
ref|XP_004960537.1|  PREDICTED: subtilisin-chymotrypsin inhibitor...  47.0    8e-04   
ref|XP_008224480.1|  PREDICTED: FHA domain-containing protein At4...  50.1    8e-04   
ref|XP_008454787.1|  PREDICTED: inhibitor of trypsin and hageman ...  47.0    9e-04   
gb|AGB85042.1|  hypothetical protein CHLPROCp014                      48.5    9e-04   
gb|AIT42234.1|  proteinase inhibitor 1                                47.4    9e-04   
emb|CAZ96047.1|  conserved hypothetical protein; putative protein...  47.0    0.001   
ref|XP_004247692.1|  PREDICTED: proteinase inhibitor I-B-like iso...  47.4    0.001   
ref|XP_010932900.1|  PREDICTED: glu S.griseus protease inhibitor-...  46.6    0.001   
ref|XP_006377750.1|  hypothetical protein POPTR_0011s11170g           46.6    0.001   
ref|XP_006295810.1|  hypothetical protein CARUB_v10024936mg           46.6    0.001   
ref|XP_007026950.1|  Subtilisin inhibitor 1, putative                 47.0    0.001   



>gb|AAK72906.1| proteinase inhibitor SPLTI-2 [Ipomoea batatas]
Length=70

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M RITDG +SWPELVGVDAFLAKSTIEKENSDL+VV +FQ CP T +Y   RVRL VDCS
Sbjct  1    MQRITDGTSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYVFNRVRLIVDCS  60

Query  350  NVVIRTPVTG  321
            NVVIRTPV G
Sbjct  61   NVVIRTPVIG  70



>gb|AAK95644.1|AF404833_1 proteinase inhibitor [Ipomoea batatas]
Length=70

 Score =   112 bits (280),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M RITDGK+SWPELVGVDAFLAKSTIEKENSDL+VV +FQ CP T +Y   RVRL VDCS
Sbjct  1    MQRITDGKSSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCS  60

Query  350  NVVIRTPVTG  321
            NVVIRTP  G
Sbjct  61   NVVIRTPSIG  70



>gb|AAK72904.1|AF330700_1 proteinase inhibitor SPLTI-a [Ipomoea batatas]
Length=70

 Score =   112 bits (279),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M RITDGK SWPELVGVDAFLAKSTIEKENSDL+VV +FQ CP T +Y   RVRL VDCS
Sbjct  1    MQRITDGKTSWPELVGVDAFLAKSTIEKENSDLYVVFLFQGCPETREYIFDRVRLIVDCS  60

Query  350  NVVIRTPVTG  321
            NVVIRTP  G
Sbjct  61   NVVIRTPSIG  70



>gb|AAK72905.1| proteinase inhibitor SPLTI-1 [Ipomoea batatas]
Length=71

 Score =   105 bits (261),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGK-NSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDC  354
            M RITDGK +SWPELVGVDAFLAKSTIEKENSDL VV +FQ CP + +Y   RVRL VDC
Sbjct  1    MQRITDGKTSSWPELVGVDAFLAKSTIEKENSDLFVVFLFQGCPESREYIFDRVRLIVDC  60

Query  353  SNVVIRTPVTG  321
            SNVVIRTP  G
Sbjct  61   SNVVIRTPSIG  71



>ref|XP_006295369.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
 gb|EOA28267.1| hypothetical protein CARUB_v10024461mg [Capsella rubella]
Length=71

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            T GKNSWPELV  +   A S IE+EN+ +  V++    PVT D +  RVR+FVD + +V+
Sbjct  6    TAGKNSWPELVRTNGDYAASVIERENTSVDAVVILDGSPVTADIRCDRVRVFVDRNRIVV  65

Query  338  RTPVTG  321
            RTPVTG
Sbjct  66   RTPVTG  71



>ref|XP_010679203.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN+WPELVG     A   IEKEN ++  +++    PVT D++  RVR+FVDC ++V+R 
Sbjct  6    GKNTWPELVGEKGQKAAEIIEKENPNVKAIVILDGTPVTLDFRCDRVRVFVDCKDIVVRA  65

Query  332  PVTG  321
            P+ G
Sbjct  66   PIIG  69



>ref|XP_002451431.1| hypothetical protein SORBIDRAFT_04g001970 [Sorghum bicolor]
 gb|EES04407.1| hypothetical protein SORBIDRAFT_04g001970 [Sorghum bicolor]
 emb|CAZ96051.1| putative proteinase inhibitor I13, potato inhibitor I [Sorghum 
bicolor]
Length=70

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+A LA + I  +  D+ V ++    PV PDY P RVR+F+D +N+V + 
Sbjct  7    GKSSWPELVGVNATLAATAIAHDRPDVAVEVLPPGAPVIPDYNPLRVRVFIDNNNLVSQV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>emb|CAZ96086.1| putative proteinase inhibitor [Saccharum hybrid cultivar R570]
Length=70

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+A LA + I  +  D+ V ++    P+ PDY P RVR+F+D +N+V + 
Sbjct  7    GKSSWPELVGVNATLAATAIAHDRPDVAVEVLPPGAPIIPDYNPLRVRVFIDNNNLVSKV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>gb|KDP42134.1| hypothetical protein JCGZ_03191 [Jatropha curcas]
Length=71

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A + IEKEN +++ +++ +  PVTPD++  RVR+FV+   VV+R 
Sbjct  8    GKSSWPELLGANGQAAAALIEKENGNVNAIVLNERSPVTPDFRCDRVRVFVNDCGVVVRV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PIVG  71



>ref|XP_007148999.1| hypothetical protein PHAVU_005G032000g [Phaseolus vulgaris]
 gb|ESW20993.1| hypothetical protein PHAVU_005G032000g [Phaseolus vulgaris]
Length=95

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPELVGV A  A++ I++E S++ + +V  +  VT D+KP RVRL+VD SN VIRTP
Sbjct  33   KTSWPELVGVTAEEAETKIKEEMSEVQIQVVPPDSFVTADFKPKRVRLYVDESNKVIRTP  92

Query  329  VTG  321
              G
Sbjct  93   AIG  95



>ref|XP_010509102.1| PREDICTED: protease inhibitor HPI [Camelina sativa]
Length=74

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G +   A S I+ ENS L V+++    PVT D +  RVR+ VD S +V++T
Sbjct  11   GKNSWPELLGTNGDYAASVIKGENSSLKVIVILVGSPVTADLRCDRVRVRVDKSRIVVKT  70

Query  332  PVTG  321
            P  G
Sbjct  71   PTAG  74



>emb|CDY14424.1| BnaC03g21710D [Brassica napus]
Length=70

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG +   A S IE+EN+ +  +++    PVT D++  RVR+ VD + +V+R 
Sbjct  7    GKNSWPELVGTNGDYAASVIERENTRVDAIVILDGTPVTTDFRCNRVRVRVDGNRIVVRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PTAG  70



>ref|XP_006442409.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
 gb|ESR55649.1| hypothetical protein CICLE_v10022906mg [Citrus clementina]
Length=119

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPELVGV+  +A +TI+KEN ++H +++ +  PVT D++  RVR+ VD    V++
Sbjct  55   NGKSSWPELVGVNGEIAAATIQKENPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQ  114

Query  335  TPVTG  321
             P  G
Sbjct  115  VPRIG  119



>ref|XP_006495465.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=119

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPELVGV+  +A +TI+KEN ++H +++ +  PVT D++  RVR+ VD    V++
Sbjct  55   NGKSSWPELVGVNGEIAAATIQKENPNVHAIIILEGTPVTQDFRCDRVRVVVDKYEKVVQ  114

Query  335  TPVTG  321
             P  G
Sbjct  115  VPRIG  119



>ref|XP_002983045.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
 gb|EFJ15854.1| hypothetical protein SELMODRAFT_117696, partial [Selaginella 
moellendorffii]
Length=64

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVF-QNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPELVG DA  A+  I  +N  L + +VF ++C VT D+   RVR++ DCSN V+RT
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYESCSVTADFDTNRVRIYTDCSNRVVRT  60

Query  332  PVTG  321
            P  G
Sbjct  61   PSIG  64



>ref|XP_010243990.1| PREDICTED: glu S.griseus protease inhibitor-like [Nelumbo nucifera]
Length=70

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG +  +AK+TIE+EN  +  V++ +   VT D+   RVR++VDC+  V + 
Sbjct  7    GKNSWPELVGCEGKVAKATIEQENPAVTAVVLLEGSIVTADFLCTRVRVWVDCNGTVTKV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PTIG  70



>ref|XP_006442402.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
 gb|ESR55642.1| hypothetical protein CICLE_v10022909mg [Citrus clementina]
Length=119

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPELVGV+  +A +TI+ EN ++H +++ +  PVTPD++  RVR+ VD    V++
Sbjct  55   NGKSSWPELVGVNGEIAAATIQIENPNVHAIIILKGTPVTPDFRCDRVRVVVDKYEKVVQ  114

Query  335  TPVTG  321
             P  G
Sbjct  115  VPRIG  119



>ref|XP_006411111.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
 gb|ESQ52564.1| hypothetical protein EUTSA_v10017502mg [Eutrema salsugineum]
Length=70

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN+WPELVG +   A S IEKEN+ +  V++    PVT D++  RVR+ VD + +V++ 
Sbjct  7    GKNAWPELVGTNGEYAASVIEKENTSVDAVVILDGIPVTADFRCDRVRVRVDRNGIVVKV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PTIG  70



>sp|P16064.1|ICI1_PHAAN RecName: Full=Subtilisin inhibitor 1; AltName: Full=ASI-I; AltName: 
Full=Subtilisin inhibitor I; Contains: RecName: Full=Subtilisin 
inhibitor 2; AltName: Full=ASI-II; AltName: Full=Subtilisin 
inhibitor II [Vigna angularis]
Length=92

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  PAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPW  378
            P P++ +  +   T  K SWPELVGV A  A++ I++E  D+ + +   +  VT DY P 
Sbjct  14   PLPRNYKQALETNTPTKTSWPELVGVTAEQAETKIKEEMVDVQIQVSPHDSFVTADYNPK  73

Query  377  RVRLFVDCSNVVIRTPVTG  321
            RVRL+VD SN V RTP  G
Sbjct  74   RVRLYVDESNKVTRTPSIG  92



>gb|AFP43221.1| proteinase inhibitor [Gossypium arboreum]
 gb|AFP43222.1| proteinase inhibitor [Gossypium arboreum]
 gb|KHG01984.1| Inhibitor of trypsin and hageman factor [Gossypium arboreum]
Length=69

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG D   AK+TIE+ENS++  +++    PVT D++  RV ++VD +  V+R 
Sbjct  6    GKNSWPELVGKDGEGAKTTIERENSNVDAIVLLDGTPVTRDFRCDRVWVWVDSNGHVVRP  65

Query  332  PVTG  321
            P  G
Sbjct  66   PTIG  69



>emb|CAZ96165.1| putative proteinase inhibitor I13, potato inhibitor I [Saccharum 
hybrid cultivar R570]
Length=70

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A  A STI  E  D+ V ++    PV PD+ P RVR+F+D +++V + 
Sbjct  7    GKSSWPELVGVLATPAASTIAHERPDVSVEVLPPGSPVIPDFNPTRVRVFIDNNSIVNQV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>gb|KDP36378.1| hypothetical protein JCGZ_08647 [Jatropha curcas]
Length=71

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+G +   A + IEKEN DLH +++ +  PVT +++  RVR++VD   VVI  
Sbjct  8    GKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTMEFRWDRVRVWVDECGVVILV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PING  71



>ref|XP_003564129.1| PREDICTED: chymotrypsin inhibitor-like [Brachypodium distachyon]
Length=70

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            G++SWPELVGV A  A + I  +  D+ V ++    P+TPDY   RVR+F++ S VVI+T
Sbjct  7    GRSSWPELVGVMATAAATQIGHDRPDVAVEVLPPGAPLTPDYNDHRVRVFINLSAVVIQT  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis]
Length=70

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  +  GK+SWPELVG     A +T+EKEN  +H +++ +  PVT D++  RV ++VD +
Sbjct  1    MSNVCLGKDSWPELVGAKGDDAAATVEKENKHVHAIVLKEGTPVTRDFRCNRVWVWVDEN  60

Query  350  NVVIRTPVTG  321
             VV R P TG
Sbjct  61   GVVTRAPKTG  70



>emb|CAZ96083.1| putative Subtilisin inhibitor 1 (Subtilisin inhibitor I) (ASI-I) 
[Contains: Subtilisin inhibitor 2 (Subtilisin inhibitor 
II) (ASI-II)] (fragment) [Saccharum hybrid cultivar R570]
Length=70

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A  A +TI  E  D+ V ++    PV PD+ P RVR+F+D +++V + 
Sbjct  7    GKSSWPELVGVLATPAATTIAHERPDVSVEVLPPGSPVIPDFNPTRVRVFIDNNSIVNQV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>ref|XP_002965559.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
 gb|EFJ32979.1| hypothetical protein SELMODRAFT_84301, partial [Selaginella moellendorffii]
Length=64

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVF-QNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPELVG DA  A+  I  +N  L + +VF + C VT D+   RVR++ DCSN V+RT
Sbjct  1    KTAWPELVGKDAIYAREQILADNPKLEIHIVFYEACLVTADFDKNRVRIYTDCSNRVVRT  60

Query  332  PVTG  321
            P  G
Sbjct  61   PSIG  64



>emb|CDY39726.1| BnaA04g11270D [Brassica napus]
Length=72

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYK--PWRVRLFVDCSNVVI  339
            GK SWPELVG +   A S IE++NS ++ V++    PVT D++    RVR++VD + +V+
Sbjct  7    GKTSWPELVGTNGDYAASVIERQNSRVNAVVILDGSPVTADFRCDRNRVRVWVDTNRIVV  66

Query  338  RTPVTG  321
            R P TG
Sbjct  67   RVPTTG  72



>gb|KDP35355.1| hypothetical protein JCGZ_10339 [Jatropha curcas]
 gb|KDP42131.1| hypothetical protein JCGZ_03188 [Jatropha curcas]
Length=71

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+G +   A + IEKEN DLH +++ +  PVT D +  RVR++VD   VVI  
Sbjct  8    GKTSWPELLGENGKAAAALIEKENKDLHAIVLKEGTPVTKDLRWDRVRVWVDECGVVILV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PTIG  71



>ref|XP_009133305.1| PREDICTED: protease inhibitor HPI-like [Brassica rapa]
Length=70

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG +   A   IE+EN+ +  +++    PVT D++  RVR+ VD + +V++ 
Sbjct  7    GKNSWPELVGTNGDYAALVIERENTRVDAIVILDGTPVTADFRCDRVRVRVDKNRIVVKV  66

Query  332  PVTG  321
            P+ G
Sbjct  67   PIAG  70



>ref|XP_002879773.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56032.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G +   A S I+ ENS L V ++    PVTPD +  RVR++V+ S +V++ 
Sbjct  10   GKNSWPELLGTNGDYAASVIKGENSSLQVNVILVGTPVTPDLRCDRVRVWVNESRLVVKN  69

Query  332  PVTG  321
            P  G
Sbjct  70   PTAG  73



>ref|XP_007221364.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
 gb|EMJ22563.1| hypothetical protein PRUPE_ppa018589mg [Prunus persica]
Length=70

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+ WPEL+G    +A++TIE++NS +   +V +  PVT D++  RVR++VD   +VIR 
Sbjct  7    GKSRWPELLGAQGTVAEATIERQNSSVDAQIVLEGTPVTRDFRCDRVRVWVDTDGIVIRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PSIG  70



>ref|XP_003590799.1| Protease inhibitor [Medicago truncatula]
 gb|AES61050.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=71

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+  +A++TI++EN+ +  ++V +   VT D +  RVR++VD   +V + 
Sbjct  8    GKSSWPELVGVEGKVAEATIQRENASVKAIIVLEGSSVTDDLRFDRVRVWVDKEGIVTQV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PTIG  71



>ref|XP_002881621.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57880.1| hypothetical protein ARALYDRAFT_482903 [Arabidopsis lyrata subsp. 
lyrata]
Length=70

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KNSWPEL G +   A + IE+EN  +  V++    PVT D++  RVR+FVD   +V++TP
Sbjct  8    KNSWPELRGTNGDYAATVIERENPTVDAVVILDGSPVTADFRCDRVRVFVDRHRIVVKTP  67

Query  329  VTG  321
             +G
Sbjct  68   TSG  70



>ref|XP_009374774.1| PREDICTED: glu S.griseus protease inhibitor-like [Pyrus x bretschneideri]
Length=70

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GK+SWPELVG     AK+ IE EN  +HVV+V +   VT DY+  RVR++VD  
Sbjct  1    MSSECEGKDSWPELVGAKGKDAKAIIESENRLVHVVIVKEGLFVTMDYRCDRVRVWVDKH  60

Query  350  NVVIRTPVTG  321
            ++V + P +G
Sbjct  61   DIVTKIPQSG  70



>ref|XP_011004115.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Populus 
euphratica]
Length=135

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 15/113 (13%)
 Frame = -1

Query  614  FLTIETKQPQREAK---------NNVTHPAPKHQEAKMPRITD------GKNSWPELVGV  480
             +T+ET+ P  +A+           V+H     +  +  +I D      GK+SWPEL+G 
Sbjct  23   IVTVETQNPNVDAQVVLEGTVVSGEVSHVQQHQRSKRGKKIRDIASDCQGKSSWPELLGA  82

Query  479  DAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
             A +A  TIE +N  +   +V +  PVT D+   RVR+++D + +V R PV G
Sbjct  83   QARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQNRIVTRVPVIG  135



>ref|XP_007009890.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18700.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G     A +TIE+EN +++ V+V +   VTPD+   RVR++V+   +V R 
Sbjct  8    GKSSWPELLGAKGEEAAATIERENPNVNAVIVLEGSFVTPDFLCTRVRVWVNTDGIVTRV  67

Query  332  PVTG  321
            PV G
Sbjct  68   PVIG  71



>ref|XP_004288451.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GK+SWPEL+G    +AK+TIE EN+ +  V+V +   VT D++  RVR++V+  
Sbjct  1    MSDQCEGKDSWPELLGAQGTVAKATIESENASVKAVIVLEGTSVTDDFRLDRVRVWVNTE  60

Query  350  NVVIRTPVTG  321
             +V   P  G
Sbjct  61   GIVTSVPKIG  70



>ref|NP_030435.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AAC79626.2| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAM61318.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO41943.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO50715.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AEC09597.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=70

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KNSWPEL G +   A   IE+EN  ++  ++    PVT D++  RVR+FVD + +V++TP
Sbjct  8    KNSWPELTGTNGDYAAVVIERENPTVNAAVILDGSPVTADFRCDRVRVFVDGNRIVVKTP  67

Query  329  VTG  321
             +G
Sbjct  68   KSG  70



>ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis]
 gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis]
Length=69

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG +   A + IEKEN  +  +++ +  PVT D++  RV ++VD + VV RT
Sbjct  6    GKNSWPELVGANGDEAAAAIEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENGVVTRT  65

Query  332  PVTG  321
            P  G
Sbjct  66   PTIG  69



>emb|CAZ96216.1| putative Protease inhibitor HPI [Saccharum hybrid cultivar R570]
Length=70

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            G+++WPELVGV A LA + I  +  D+ V ++ Q  PV P + P RVR+F+D + VV + 
Sbjct  7    GRSTWPELVGVQATLAATAIAHDRPDVSVEVLPQGSPVIPGFNPERVRVFIDDNLVVRQI  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>ref|NP_030438.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AAC79627.2| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAM62978.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO42265.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AAO63946.1| putative protease inhibitor [Arabidopsis thaliana]
 gb|AEC09608.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=73

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G +   A S I+ ENS L+VV+V     VT D   +RVR++VD   +V+R 
Sbjct  10   GKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRN  69

Query  332  PVTG  321
            P  G
Sbjct  70   PTAG  73



>ref|XP_007009884.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18694.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G     A +TIE+EN +++ V+V +   VTPD+   RVR++V+   +V R 
Sbjct  8    GKSSWPELLGAKGEEAAATIERENPNVNAVIVSEGSFVTPDFLCTRVRVWVNTDGIVTRV  67

Query  332  PVTG  321
            PV G
Sbjct  68   PVIG  71



>ref|XP_008391172.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GK SWPEL+G    +A++TIE+EN  +  V+V Q   VT D++  RVR++VD  
Sbjct  1    MSSECEGKASWPELLGTQGTVAEATIERENPLVDAVIVLQGTIVTDDFRCDRVRVWVDTD  60

Query  350  NVVIRTPVTG  321
             +V+  P  G
Sbjct  61   GIVVDVPAIG  70



>ref|NP_001189707.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
 gb|AEC09609.1| PR-6 proteinase inhibitor family protein [Arabidopsis thaliana]
Length=88

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G +   A S I+ ENS L+VV+V     VT D   +RVR++VD   +V+R 
Sbjct  25   GKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRN  84

Query  332  PVTG  321
            P  G
Sbjct  85   PTAG  88



>ref|XP_010243880.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  I  GK+SW ELVG +  +AK+TIE+EN  +  ++V Q   V  D++  RV ++VD +
Sbjct  1    MSSICSGKSSWAELVGAEGEVAKATIEQENPAVSAIVVLQGTNVHEDFRCSRVWVWVDAN  60

Query  350  NVVIRTPVTG  321
              VI  P  G
Sbjct  61   GTVISVPTIG  70



>ref|XP_002451430.1| hypothetical protein SORBIDRAFT_04g001965 [Sorghum bicolor]
 gb|EES04406.1| hypothetical protein SORBIDRAFT_04g001965 [Sorghum bicolor]
Length=66

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A LA + I  +  D+ V ++    PV PD+ P RVR+F++    V + 
Sbjct  3    GKSSWPELVGVQATLAATAIAHDRPDVSVEVLPPGSPVIPDFNPTRVRVFINNGGFVNQV  62

Query  332  PVTG  321
            PV G
Sbjct  63   PVIG  66



>emb|CAZ96049.1| putative proteinase inhibitor I13, potato inhibitor I [Sorghum 
bicolor]
Length=70

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A LA + I  +  D+ V ++    PV PD+ P RVR+F++    V + 
Sbjct  7    GKSSWPELVGVQATLAATAIAHDRPDVSVEVLPPGSPVIPDFNPTRVRVFINNGGFVNQV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>ref|XP_004288450.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Fragaria 
vesca subsp. vesca]
Length=70

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+G +  +AK  IE EN+ +  V+V +  PVT D++  RVR++V+   +VI  
Sbjct  7    GKESWPELLGAEGTVAKEIIESENASVTAVIVLEGTPVTRDFRLDRVRVWVNTDGIVISI  66

Query  332  PVTG  321
            P  G
Sbjct  67   PKIG  70



>ref|NP_001274985.1| proteinase inhibitor 1 PPI3B2 precursor [Solanum tuberosum]
 gb|AAZ08245.1| proteinase inhibitor 1 PPI3B2 [Solanum tuberosum]
Length=107

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 50/97 (52%), Gaps = 7/97 (7%)
 Frame = -1

Query  608  TIETKQPQREAKNNVTHPAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLH  429
            + ET   ++E+        PK  E K      GK  WPEL+GV   LAK  IEKENS + 
Sbjct  17   SFETLMARKESDGPEVIELPKEFECK------GKLQWPELIGVPTKLAKEIIEKENSLIT  70

Query  428  VVMVFQN-CPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
             V +  N  PVT D+   RVRLF +   VV+  PV G
Sbjct  71   NVQILLNGSPVTLDFSCNRVRLFDNILGVVVDMPVVG  107



>ref|XP_006363695.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=89

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVV-MVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPELVGV A LA+ TI+KENS L +V  V    PVT D+   RVRLFV+  + V++ 
Sbjct  26   KVTWPELVGVPAKLARETIQKENSRLTIVPSVLSGSPVTADFSCNRVRLFVNVIDFVVQV  85

Query  332  PVTG  321
            P  G
Sbjct  86   PRIG  89



>ref|XP_010094276.1| Glu S.griseus protease inhibitor [Morus notabilis]
 ref|XP_010094277.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55550.1| Glu S.griseus protease inhibitor [Morus notabilis]
 gb|EXB55551.1| Glu S.griseus protease inhibitor [Morus notabilis]
Length=70

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GKNSWPELVGV   +A+  IEKEN  +  ++V +   VT DY+  RVR++V+  
Sbjct  1    MSTECSGKNSWPELVGVQGEVAEKIIEKENPAVDAIIVTEGSVVTADYRCDRVRVWVNNH  60

Query  350  NVVIRTPVTG  321
             +V + P  G
Sbjct  61   GIVYKVPTIG  70



>ref|XP_002323424.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
 gb|EEF05185.2| hypothetical protein POPTR_0016s07980g, partial [Populus trichocarpa]
Length=83

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -1

Query  545  HQEAKMPRITD------GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYK  384
            H+  +  +I D      GK+SWPEL+G  A +A  TIE +N  +   +V +  PVT D+ 
Sbjct  3    HRSKRGKKIRDMASDCQGKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFS  62

Query  383  PWRVRLFVDCSNVVIRTPVTG  321
              RVR+++D + +V R PV+G
Sbjct  63   CSRVRVWIDQNRIVTRVPVSG  83



>dbj|BAA02823.1| genetic tumor-related proteinase inhibitor I precursor [Nicotiana 
glauca x Nicotiana langsdorffii]
Length=94

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPEL+GV A LA+ TI+KENS L +V  V    PVT D +  RVRLFV+  ++V++ 
Sbjct  31   KETWPELIGVPAKLARETIQKENSKLTNVPSVLNGSPVTQDLRCDRVRLFVNLLDIVVQI  90

Query  332  PVTG  321
            P  G
Sbjct  91   PRVG  94



>ref|XP_004247658.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 7/99 (7%)
 Frame = -1

Query  608  TIETKQPQREAKNNVTHPAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKEN---S  438
            + ET   ++E          K  E+ +  +  GK SWPEL+GV A  AK  I+KEN   +
Sbjct  17   SFETLMARKEIDRLEVTELLKEFESDL--MCKGKLSWPELIGVPAQYAKGIIQKENPFVT  74

Query  437  DLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
            D+ +V+     PVT D++ +RVR+ V+  NV +  PV G
Sbjct  75   DVQIVL--NGSPVTADFRCFRVRIVVNILNVAVSIPVVG  111



>gb|KFK36789.1| hypothetical protein AALP_AA4G170900 [Arabis alpina]
Length=70

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KN+WPEL G +   A S IE+EN+ +  V++ +  PVT D++  RVR+FV+   +V+  P
Sbjct  8    KNAWPELRGTNGDFAVSVIERENTRVDAVVILEGSPVTTDFRCDRVRVFVNRYRIVVGVP  67

Query  329  VTG  321
             TG
Sbjct  68   TTG  70



>gb|KDP36380.1| hypothetical protein JCGZ_08649 [Jatropha curcas]
Length=71

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A + IEKENS+++ +++ +  PVT D++  RVR++V+   VV++ 
Sbjct  8    GKSSWPELLGANGKAAAALIEKENSNVNAIVLKEGTPVTADFRCDRVRVWVNECGVVVQV  67

Query  332  PV  327
            P+
Sbjct  68   PI  69



>ref|XP_003617314.1| protease inhibitor [Medicago truncatula]
 gb|AET00273.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
 gb|KEH28391.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVGV+  +A++TI+ EN  ++ ++V +   VT D++  RVR++VD   +V + 
Sbjct  7    GKNSWPELVGVEGKVAEATIQSENPLVNAIIVPEGSFVTADFRCDRVRVWVDKDGIVYQV  66

Query  332  PVTG  321
            P+ G
Sbjct  67   PIIG  70



>ref|XP_006421577.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
 gb|ESR34817.1| hypothetical protein CICLE_v10006203mg [Citrus clementina]
Length=131

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  69   KSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  128

Query  329  VTG  321
              G
Sbjct  129  RIG  131



>gb|AAN76363.1| type I proteinase inhibitor-like protein [Citrus x paradisi]
Length=128

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  66   KSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  125

Query  329  VTG  321
              G
Sbjct  126  RIG  128



>ref|XP_006490176.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
Length=128

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  66   KSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  125

Query  329  VTG  321
              G
Sbjct  126  RIG  128



>ref|XP_006421576.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
 gb|ESR34816.1| hypothetical protein CICLE_v10006211mg [Citrus clementina]
Length=128

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  66   KSSWPELVGKNGKVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVIRVP  125

Query  329  VTG  321
              G
Sbjct  126  RIG  128



>dbj|BAD09914.1| hypothetical protein [Oryza sativa Japonica Group]
Length=68

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVGV A LA + I K+  D+ V ++    P+TPD+   RVR+F+D + +V + P
Sbjct  4    KSSWPELVGVLATLAATQIGKDRPDVAVEVLPPGAPLTPDFNDKRVRVFMDDNGIVFKIP  63

Query  329  VTG  321
            V G
Sbjct  64   VIG  66



>ref|XP_006381983.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
 gb|ERP59780.1| hypothetical protein POPTR_0006s22880g [Populus trichocarpa]
Length=70

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK+SWPEL+G  A +A +TIE EN  +   +V +  PVT ++   RVR+++D + +V R
Sbjct  6    QGKSSWPELLGAQARVAVATIETENPYVDTQVVLEGTPVTGEFSCTRVRVWIDRNRIVTR  65

Query  335  TPVTG  321
             PV G
Sbjct  66   VPVIG  70



>gb|KDO45261.1| hypothetical protein CISIN_1g033055mg [Citrus sinensis]
Length=128

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  66   KSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNKKGKVIRVP  125

Query  329  VTG  321
              G
Sbjct  126  RIG  128



>ref|XP_006421578.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
 gb|ESR34818.1| hypothetical protein CICLE_v10006212mg [Citrus clementina]
Length=128

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +A + IEKEN  +H +++ +  PVT DY+  RVR++V+    VIR P
Sbjct  66   KSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTRDYRIDRVRVWVNKKGKVIRVP  125

Query  329  VTG  321
              G
Sbjct  126  RIG  128



>ref|XP_010100072.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81308.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVGV   +A +TIE+EN  +H ++  Q   VT D K  RV ++VD   VV   
Sbjct  8    GKKSWPELVGVSGEIATATIERENPTVHAIIKRQGTGVTDDLKCNRVWVWVDAHGVVTTV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PMIG  71



>ref|XP_004288449.1| PREDICTED: glu S.griseus protease inhibitor-like [Fragaria vesca 
subsp. vesca]
Length=72

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            ++GK+SWPEL+G     AK+TIE ENS +  V+V +   VT D +  RVR++VD   +V 
Sbjct  7    SEGKSSWPELLGAQGTDAKATIESENSSVTAVIVQEGSIVTQDIRCDRVRVWVDSYGIVT  66

Query  338  RTPV  327
            R P+
Sbjct  67   RVPI  70



>sp|Q6XNP7.2|HPI_HEVBR RecName: Full=Protease inhibitor HPI; AltName: Full=HbPI1; AltName: 
Full=Protease inhibitor 1 [Hevea brasiliensis]
Length=70

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KNSWPELVG +  +A   I+ EN+++  ++V +  P+T D    RVR+FVD + VV + P
Sbjct  8    KNSWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDENRVVTQVP  67

Query  329  VTG  321
              G
Sbjct  68   AIG  70



>ref|XP_007009886.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18696.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPELVG     A +TIEKEN  ++ V+V +   VT D+   RVR++V+   +V R
Sbjct  7    EGKSSWPELVGKKGEDAAATIEKENPRVNAVIVLEGSFVTGDFLCTRVRVWVNTYGIVTR  66

Query  335  TPVTG  321
             P+ G
Sbjct  67   VPIIG  71



>ref|XP_006373842.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
 gb|ERP51639.1| hypothetical protein POPTR_0016s07990g [Populus trichocarpa]
Length=70

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G  A +A  TIE +N  +   +V +  PVT D+   RVR+++D + +V R 
Sbjct  7    GKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGTPVTKDFSCSRVRVWIDQNRIVTRV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>gb|ABK22457.1| unknown [Picea sitchensis]
 gb|ABR16187.1| unknown [Picea sitchensis]
Length=97

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            + +WPE+VG+    AK  IE E  DL V+++ +N   T DY   RVR+FVD +  V +TP
Sbjct  35   RGTWPEVVGISGEDAKKKIEAEYPDLKVLIMSENSIFTADYNVKRVRVFVDSNGKVTKTP  94

Query  329  VTG  321
            + G
Sbjct  95   IIG  97



>emb|CAZ96136.1| putative proteinase inhibitor I13, potato inhibitor I [Saccharum 
hybrid cultivar R570]
Length=70

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A  A +TI  E  D+ V ++    PV  D+ P RVR+F+D +++  + 
Sbjct  7    GKSSWPELVGVLATPAATTIAHERPDVSVEVLPPGSPVITDFNPTRVRVFIDNNSIANQV  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>ref|XP_003598789.1| Subtilisin inhibitor [Medicago truncatula]
 gb|AES69040.1| subtilisin inhibitor 1 [Medicago truncatula]
Length=98

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPELVGV A  A+  I+++ S + + +V  +  VT D++  RVRL+VD SN VIRTP
Sbjct  36   KTSWPELVGVTAEEAERKIKEDISGVEIQVVPPDSFVTADFRFKRVRLYVDESNKVIRTP  95

Query  329  VTG  321
            + G
Sbjct  96   IIG  98



>ref|XP_009782003.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana sylvestris]
Length=68

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK++WPELVG +   AK TIE+EN  +   +     P T D++  RVR+FVD  N V++ 
Sbjct  5    GKDAWPELVGENGQTAKETIERENPLVTANVALVGSPGTTDFRCDRVRVFVDRDNSVVQV  64

Query  332  PVTG  321
            PV G
Sbjct  65   PVIG  68



>ref|NP_001275446.1| proteinase inhibitor I precursor [Solanum tuberosum]
 gb|AAZ94190.1| proteinase inhibitor I precursor [Solanum tuberosum]
Length=107

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 50/97 (52%), Gaps = 7/97 (7%)
 Frame = -1

Query  608  TIETKQPQREAKNNVTHPAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLH  429
            + ET   Q+E+         K  E K      GK SWPEL+GV   LAK  IEK+NS + 
Sbjct  17   SFETLMAQKESDGPEVIELLKEFECK------GKLSWPELIGVPTKLAKGIIEKQNSLIS  70

Query  428  VVMVFQN-CPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
             V +  N  PVT D +  RVRLF +    V++ PV G
Sbjct  71   NVHILLNGSPVTLDIRCDRVRLFDNILGAVVQIPVVG  107



>ref|XP_009047357.1| hypothetical protein LOTGIDRAFT_230585 [Lottia gigantea]
 gb|ESP02199.1| hypothetical protein LOTGIDRAFT_230585 [Lottia gigantea]
Length=65

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
             K  WPELVG+ A  A++ I++ENS+L V ++ +  PVT DY+  RVR+F +  N V + 
Sbjct  2    SKTEWPELVGLPAQEAEAKIKEENSNLTVHILPELSPVTMDYREDRVRIFTNAENKVSQV  61

Query  332  PVTG  321
            P TG
Sbjct  62   PRTG  65



>gb|AIT42233.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D++  RVRLF +    V+
Sbjct  42   NGKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDFRCDRVRLFDNILGDVV  101

Query  338  RTPVTG  321
            + PV G
Sbjct  102  QIPVVG  107



>gb|KDP42132.1| hypothetical protein JCGZ_03189 [Jatropha curcas]
Length=71

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+G +   A + IEKENS+++ +++ +  PVTPD++  RVR+ V+   VV+R 
Sbjct  8    GKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRVRVVVNDCGVVVRV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PIVG  71



>ref|XP_010100075.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81311.1| Proteinase inhibitor [Morus notabilis]
Length=130

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -1

Query  533  KMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDC  354
            ++PR+  GKNSWPELVGV+   A+  IEKEN ++  ++V +  PV  D++  RV ++V+ 
Sbjct  65   EVPRV--GKNSWPELVGVNGKEAEKQIEKENDNVDAIVVLEGTPVPEDFRCTRVWVWVND  122

Query  353  SNVVIRTP  330
            S +V + P
Sbjct  123  SGIVTQLP  130


 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GK+SWPEL+G +   A   IEKEN ++   ++ +   VT D++  RV ++V+  
Sbjct  1    MASECQGKSSWPELLGKNGEEAAKQIEKENKNVDAKVILEGTAVTKDFRCDRVWVWVNNY  60

Query  350  NVVIRTPVTG*SSW  309
              V   P  G +SW
Sbjct  61   GTVTEVPRVGKNSW  74



>gb|ACN40009.1| unknown [Picea sitchensis]
Length=97

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            + +WPE+VG+    AK  IE E  DL V+++ +N   T DY   RVR+FVD +  V +TP
Sbjct  35   RGTWPEVVGISGEDAKKKIEAEYPDLKVLIMSENSIFTADYNVKRVRVFVDSNGKVSKTP  94

Query  329  VTG  321
            + G
Sbjct  95   IIG  97



>ref|XP_006367782.1| PREDICTED: serine protease inhibitor isoform X1 [Solanum tuberosum]
 gb|AIT42236.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D++  RVRLF +    V+
Sbjct  42   NGKLSWPELIGVPTKLAKEIIEKENSLISNVHILLNGSPVTLDFRCDRVRLFDNILGDVV  101

Query  338  RTPVTG  321
            + PV G
Sbjct  102  QLPVVG  107



>dbj|BAD09916.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ07133.1| hypothetical protein OsI_29381 [Oryza sativa Indica Group]
 gb|EAZ42884.1| hypothetical protein OsJ_27477 [Oryza sativa Japonica Group]
Length=67

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVGV A LA + I K+  D+ V ++    P+TPD+   RVR+F+D + +V + P
Sbjct  4    KSSWPELVGVLATLAATQIGKDRPDVAVEVLPPGAPLTPDFNDKRVRVFMDDNGIVFKIP  63

Query  329  V  327
            V
Sbjct  64   V  64



>ref|XP_006363669.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=94

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K++WPEL+GV A LA+ TI+KEN  L +V  V    PVT D++  RVRLFV+  + V++ 
Sbjct  31   KDTWPELLGVPARLARETIQKENPRLTNVGNVLNGSPVTQDFRCDRVRLFVNVLDFVVQI  90

Query  332  PVTG  321
            P  G
Sbjct  91   PRVG  94



>ref|XP_009774947.1| PREDICTED: trypsin inhibitor 1 [Nicotiana sylvestris]
 sp|Q02214.1|ITR1_NICSY RecName: Full=Trypsin inhibitor 1; AltName: Full=NSTI-I; AltName: 
Full=Trypsin inhibitor I; Flags: Precursor [Nicotiana sylvestris]
 gb|AAA34067.1| pre-pro-proteinase inhibitor I [Nicotiana sylvestris]
Length=94

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            + K +WPEL+GV A  A+  I+KENS L +V  V    PVT D++  RVRLFV+  + V+
Sbjct  29   NKKETWPELIGVPAKFAREIIQKENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVV  88

Query  338  RTPVTG  321
            + P  G
Sbjct  89   QIPRVG  94



>gb|KGN49621.1| hypothetical protein Csa_5G027950 [Cucumis sativus]
Length=75

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  539  EAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFV  360
            E K+   + GK+SWPELV V + +A   IE++  D+  V++    PVT D +P RVR+FV
Sbjct  3    EEKIVFPSSGKSSWPELVFVKSSVAVHWIERDRPDVKPVVLLAGSPVTEDLRPNRVRIFV  62

Query  359  DCSNVVIRTPVTG  321
            + ++ V+  P TG
Sbjct  63   NMNDRVVEVPRTG  75



>ref|XP_007224127.1| hypothetical protein PRUPE_ppa015912mg [Prunus persica]
 ref|XP_008224411.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
 gb|EMJ25326.1| hypothetical protein PRUPE_ppa015912mg [Prunus persica]
Length=76

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDY--KPWRVRLFVDCSNVVI  339
            GK  WPEL+GV+  +A++TIE+ENS + V +V +   V  D+   P RVR++VD   +V 
Sbjct  11   GKYVWPELLGVEGTVAEATIERENSTVKVEVVLEGTIVPADFVCVPDRVRVWVDTDGLVT  70

Query  338  RTPVTG  321
            R PV G
Sbjct  71   RVPVIG  76



>sp|P24076.1|BGIA_MOMCH RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA 
[Momordica charantia]
 gb|AAB19651.1| BGIA=acidic amino acid-specific endopeptidase inhibitor [Momordica 
charantia L.=bitter gourd, Peptide, 68 aa]
Length=68

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK SWP+LVG     AK+ IE+EN  +  V+V    PVT D++  RVR++V    +V R
Sbjct  4    QGKRSWPQLVGSTGAAAKAVIERENPRVRAVIVRVGSPVTADFRCDRVRVWVTERGIVAR  63

Query  335  TPVTG  321
             P  G
Sbjct  64   PPAIG  68



>ref|XP_004134091.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 gb|KGN56905.1| hypothetical protein Csa_3G142970 [Cucumis sativus]
Length=71

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDC-SNVVIR  336
            GK+SWPELVGV   +A+  IEKEN  ++ ++V Q   VT D++  RV ++VD  +++VI+
Sbjct  7    GKSSWPELVGVSGNIAEKIIEKENCYVNAIIVEQGKFVTQDFRCDRVWVWVDKHTHIVIK  66

Query  335  TPVTG  321
            TP+ G
Sbjct  67   TPIIG  71



>gb|AAA33816.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS +  V +  N  PVT DY+  RVRLF +    V+
Sbjct  42   NGKQRWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRSNRVRLFDNILGDVV  101

Query  338  RTP  330
            + P
Sbjct  102  QIP  104



>pdb|1MIT|A Chain A, Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) 
(Nmr, Minimized Average Structure)
Length=69

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWP LVGV   +AK+ IE++N ++  V++ +  PVT D++  RVR++V+   +V+  
Sbjct  6    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  65

Query  332  PVTG  321
            P  G
Sbjct  66   PRIG  69



>ref|XP_006363672.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=95

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K++WPEL+GV A LAK  I+KEN  L ++  V    PVT D +  RVRLFV+  + V++T
Sbjct  32   KDTWPELLGVPAKLAKGIIQKENRRLSNIPNVLNGSPVTKDLRCNRVRLFVNVLDYVVQT  91

Query  332  PVTG  321
            P  G
Sbjct  92   PRVG  95



>sp|P19873.1|ITH5_CUCMA RecName: Full=Inhibitor of trypsin and hageman factor; AltName: 
Full=CMTI-V [Cucurbita maxima]
 prf||1701295A trypsin inhibitor
Length=68

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWP LVGV   +AK+ IE++N ++  V++ +  PVT D++  RVR++V+   +V+  
Sbjct  5    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  64

Query  332  PVTG  321
            P  G
Sbjct  65   PRIG  68



>ref|NP_001066344.1| Os12g0193100 [Oryza sativa Japonica Group]
 dbj|BAF29363.1| Os12g0193100 [Oryza sativa Japonica Group]
 gb|EAZ19903.1| hypothetical protein OsJ_35496 [Oryza sativa Japonica Group]
Length=84

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
             K+SWPELVGV +  AK+ I +E  +L V +V  +  VT DY   RVR+FVD  + V R 
Sbjct  21   AKDSWPELVGVSSEAAKTKIGEERPELDVQVVPADAFVTTDYNAGRVRVFVDSDDKVARP  80

Query  332  PVTG  321
            P  G
Sbjct  81   PKIG  84



>pdb|1TIN|A Chain A, Three-Dimensional Structure In Solution Of Cucurbita 
Maxima Trypsin Inhibitor-V Determined By Nmr Spectroscopy
Length=69

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWP LVGV   +AK+ IE++N ++  V++ +  PVT D++  RVR++V+   +V+  
Sbjct  6    GKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVVSP  65

Query  332  PVTG  321
            P  G
Sbjct  66   PRIG  69



>dbj|BAA05472.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=64

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPEL+GV A  A+  I+KEN  L +V  V    PVT D++  RVRLFV+  +VV++ 
Sbjct  1    KETWPELIGVPAKFAREIIQKENPKLTNVPSVLNGSPVTKDFRCNRVRLFVNVLDVVVQI  60

Query  332  PVTG  321
            P  G
Sbjct  61   PRVG  64



>gb|AAC49603.1| wound-inducible proteinase inhibitor I, partial [Solanum tuberosum]
Length=101

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV A  AK  IEKENS +  V +  N  PVT DY+  RVRLF +    V+
Sbjct  36   NGKLSWPELIGVPAHYAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVV  95

Query  338  RTP  330
            + P
Sbjct  96   QIP  98



>ref|XP_007224255.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
 gb|EMJ25454.1| hypothetical protein PRUPE_ppa018391mg [Prunus persica]
Length=70

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK++WPEL+G    +A++TIE+ENS +   +V +   VT D++  RVR++V+   +V R 
Sbjct  7    GKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGSIVTADFRCDRVRVWVNTDGIVTRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PSIG  70



>gb|KFK29320.1| hypothetical protein AALP_AA7G118100 [Arabis alpina]
Length=72

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELV  +   A S IE ENS +  V++     VT D +  RVR++VD + +V++ 
Sbjct  9    GKNSWPELVETNGDYAASVIESENSKVDAVVILVGSMVTADIRCDRVRVWVDKNRIVVKI  68

Query  332  PVTG  321
            P  G
Sbjct  69   PTIG  72



>ref|XP_002284454.1| PREDICTED: inhibitor of trypsin and hageman factor [Vitis vinifera]
 emb|CBI26386.3| unnamed protein product [Vitis vinifera]
Length=71

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVV-MVFQNCPVTPDYKPWRVRLFVDC  354
            M    +GK+SWPELVGV   +A  TI++EN  +  V +V +   VT D+   RVR++VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTSVTKDFYCTRVRVWVDE  60

Query  353  SNVVIRTPVTG  321
            + +VI  P  G
Sbjct  61   NGIVISVPTIG  71



>gb|AAS46024.1| serine protease inhibitor [Solanum tuberosum]
Length=71

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D+   RVRLF +    V+
Sbjct  6    NGKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDFHCDRVRLFDNILGDVV  65

Query  338  RTPVTG  321
            + PV G
Sbjct  66   QIPVVG  71



>ref|XP_004249689.1| PREDICTED: trypsin inhibitor 1-like [Solanum lycopersicum]
Length=95

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K++WPEL+GV A LAK  I+KEN  L ++  V    PVT D +  RVRLFV+  + V++T
Sbjct  32   KDTWPELLGVPAKLAKRIIQKENRRLTNIPNVLNGSPVTKDLRCNRVRLFVNVLDYVVQT  91

Query  332  PVTG  321
            P  G
Sbjct  92   PRVG  95



>ref|XP_004952054.1| PREDICTED: subtilisin inhibitor 1-like [Setaria italica]
Length=70

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV A LA + I  +  D+ V ++    P+ PD+ P RVR+F+D + +V +T
Sbjct  7    GKSSWPELVGVLATLAATAIAHDRPDVSVEVLPPGSPIIPDFNPSRVRVFIDNNAIVTKT  66

Query  332  PVTG  321
            PV G
Sbjct  67   PVIG  70



>gb|AAA69780.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS ++ V +  N  PVT DY+  RVRLF +    V+
Sbjct  42   NGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVTMDYRCNRVRLFDNILGSVV  101

Query  338  RTP  330
            + P
Sbjct  102  QIP  104



>ref|XP_010278088.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo 
nucifera]
Length=70

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GK+SWPELVG +  +AK+TIE+EN  +  ++V +  PV  ++   RV ++VD +
Sbjct  1    MSSECSGKSSWPELVGAEGEVAKATIEQENPAVTAIIVLEGTPVILNFDCTRVWVWVDTN  60

Query  350  NVVIRTPVTG  321
              V + P  G
Sbjct  61   GTVTKVPKIG  70



>gb|EAY82524.1| hypothetical protein OsI_37748 [Oryza sativa Indica Group]
Length=84

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
             K+SWPELVGV +  AK+ I +E  +L V +V  +  VT DY   RVR+FVD  + V R 
Sbjct  21   AKDSWPELVGVSSEEAKTKIGEERPELDVQVVPADAFVTTDYNAGRVRVFVDSDDKVARP  80

Query  332  PVTG  321
            P  G
Sbjct  81   PKIG  84



>ref|XP_006606926.1| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHN13145.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVGV   +A++TIE+ENS ++ ++V Q   VT D++  RV ++V+ +  V + 
Sbjct  6    GKRSWPELVGVKGTVAEATIERENSLVNAIVVPQGSGVTADFRCDRVWVWVNENGFVFQV  65

Query  332  PVTG  321
            P  G
Sbjct  66   PTIG  69



>ref|XP_007221365.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
 gb|EMJ22564.1| hypothetical protein PRUPE_ppa024500mg [Prunus persica]
Length=70

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK++WPEL+G    +A++TIE+ENS +   +V +   VT D++  RVR++V+   +V R 
Sbjct  7    GKDTWPELLGSQGTVAEATIERENSLVDAQIVLEGTIVTADFRCDRVRVWVNTDGIVTRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PRIG  70



>ref|XP_009410013.1| PREDICTED: subtilisin inhibitor-like [Musa acuminata subsp. malaccensis]
Length=88

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KN+WPE+VG+ A  A+  I+ +  + HV +V  N  VT DY   RVR+F+D S  V++ P
Sbjct  26   KNAWPEVVGLTAEDAEKRIKDDKPESHVQVVPPNHFVTADYNEGRVRIFIDLSGRVLKAP  85

Query  329  VTG  321
            V G
Sbjct  86   VIG  88



>gb|AAP46156.1| protease inhibitor protein 1 [Hevea brasiliensis]
Length=70

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K++WPELVG +  +A   I+ EN+++  ++V +  P+T D    RVR+FVD + VV + P
Sbjct  8    KDAWPELVGTNGDIAAGIIQTENANVKAIVVKEGLPITQDLNFNRVRVFVDENRVVTQVP  67

Query  329  VTG  321
              G
Sbjct  68   AIG  70



>ref|XP_007009885.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18695.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG     A + IEKEN  ++ V+V +   VT D+   RVR++V+   +V R 
Sbjct  8    GKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVTRV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PIIG  71



>gb|KDP35352.1| hypothetical protein JCGZ_10336 [Jatropha curcas]
Length=70

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G +   A + IEKEN  +H +++ +  PV  D++  RV ++V+   VV+R 
Sbjct  7    GKNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVWVNECGVVVRV  66

Query  332  PV  327
            P+
Sbjct  67   PI  68



>ref|XP_004134089.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
 ref|XP_004165330.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
sativus]
Length=69

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWP+LVGV   +AK+ IE+EN ++  V++    PVT D++  RVR++V  + +V   
Sbjct  6    GKRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVKKNGLVASP  65

Query  332  PVTG  321
            P+ G
Sbjct  66   PMVG  69



>gb|AID52861.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            +NSWPELVG +  +A   I+ EN+++  ++V +  P+T +Y   RV +FVD + VV + P
Sbjct  8    ENSWPELVGTNGDIAAGIIQTENANVKAIVVKEGSPMTMEYNLCRVLVFVDDNRVVTQVP  67

Query  329  VTG  321
              G
Sbjct  68   AIG  70



>ref|XP_002440437.1| hypothetical protein SORBIDRAFT_09g001010 [Sorghum bicolor]
 gb|EES18867.1| hypothetical protein SORBIDRAFT_09g001010 [Sorghum bicolor]
Length=73

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -1

Query  536  AKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVD  357
            A  P     K SWPELVG++   AK  I K+  D  +V++    PVT DY+P RVR+FVD
Sbjct  5    AAAPESGGAKTSWPELVGLNVEEAKKVILKDKPDADIVVLPVGSPVTRDYRPNRVRIFVD  64

Query  356  C  354
             
Sbjct  65   I  65



>gb|EYU40892.1| hypothetical protein MIMGU_mgv1a017848mg [Erythranthe guttata]
Length=69

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN WPEL+G + + A + IE++N +++ V+     P T D++  RV ++VD + VV+R 
Sbjct  6    GKNFWPELLGANGYAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWIWVDANGVVLRA  65

Query  332  PVTG  321
            P  G
Sbjct  66   PRAG  69



>ref|XP_008224409.1| PREDICTED: glu S.griseus protease inhibitor-like [Prunus mume]
Length=70

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN WPEL+G    +A++ IE+EN  +   +V +   VT D++  RVR++VD   +V R 
Sbjct  7    GKNRWPELLGAQGTVAEAKIERENPSVDAQIVPEGSVVTADFRCDRVRVWVDTEGIVTRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PSIG  70



>gb|KFK36788.1| hypothetical protein AALP_AA4G170800 [Arabis alpina]
Length=70

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPELVG +   A S IE+ENS ++ +++    PV  D++  RV + V+ +  V++ 
Sbjct  7    GKNSWPELVGTNGDYAASVIERENSKVNAIVILDGTPVITDFRCDRVWVRVNRNRTVVKV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PKAG  70



>sp|P01052.1|ICIA_SOLTU RecName: Full=Chymotrypsin inhibitor I, A, B and C subunits [Solanum 
tuberosum]
Length=71

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            DGK  WPEL+GV   LAK  IEK+NS +  V +  N  PVT D++  RVRLF D    V+
Sbjct  6    DGKLQWPELIGVPTKLAKEIIEKQNSLISNVHILLNGSPVTMDFRCNRVRLFDDILGSVV  65

Query  338  RTP  330
            + P
Sbjct  66   QIP  68



>gb|AIT42232.1| proteinase inhibitor 1 [Solanum tuberosum]
 gb|AIT42238.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 1/65 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVIR  336
            GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D +  RVRLF +    V+ 
Sbjct  43   GKLSWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDLRCDRVRLFDNILGYVVD  102

Query  335  TPVTG  321
             PV G
Sbjct  103  IPVVG  107



>ref|XP_001424380.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK56982.1| unnamed protein product [Paramecium tetraurelia]
Length=71

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPE VG  A  AK  I  +N++LHV ++ +N  VT DY+  RVR+F D + VV + 
Sbjct  8    GKQSWPECVGKTAEEAKQIILADNAELHVQLLPENSMVTMDYRTDRVRVFHDENGVVKQA  67

Query  332  P  330
            P
Sbjct  68   P  68



>gb|KDP21344.1| hypothetical protein JCGZ_21815 [Jatropha curcas]
Length=70

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPEL+G +   A +TIEKEN ++  ++V +   V  D++  RV ++V+ + VV R
Sbjct  6    EGKSSWPELLGANGKAAAATIEKENGNVDAILVKEGSSVILDFRCDRVWVWVNENGVVTR  65

Query  335  TPVTG  321
             P+ G
Sbjct  66   VPIIG  70



>gb|ADD51184.1| protease inhibitor 1 [Vitis cinerea var. helleri x Vitis riparia]
Length=71

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVV-MVFQNCPVTPDYKPWRVRLFVDC  354
            M    +GK+SWPELVGV   +A  TI++EN  +  V +V +   VT D+   RVR++VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDIVLEGTIVTQDFYCTRVRVWVDE  60

Query  353  SNVVIRTPVTG  321
            + +VI  P  G
Sbjct  61   NGIVISVPTIG  71



>sp|P08454.2|ICID_SOLTU RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Chymotrypsin inhibitor I, D subunit; AltName: Full=Wound-induced 
proteinase inhibitor I; Flags: Precursor [Solanum 
tuberosum]
 gb|AAA69781.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS +  V +  N  PVT DY+  RVRLF +    V+
Sbjct  42   NGKQRWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVV  101

Query  338  RTP  330
            + P
Sbjct  102  QIP  104



>ref|XP_011004117.1| PREDICTED: uncharacterized protein LOC105110701 [Populus euphratica]
Length=503

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = -1

Query  566  VTHPAPKHQEAKMPRITD------GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNC  405
            V+H     +  +  +I D      GK+SWPEL+G  A +A  TIE +N  +   +V +  
Sbjct  416  VSHVQQHQRSKRGKKIRDIASDCQGKSSWPELLGAQARVAVVTIETQNPYVDTQVVLEGT  475

Query  404  PVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
            PVT D+   RVR+++D + +V R PV G
Sbjct  476  PVTKDFSCTRVRVWIDQNRIVTRVPVIG  503



>ref|XP_004247695.1| PREDICTED: proteinase inhibitor 1-like [Solanum lycopersicum]
Length=114

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK  WPEL+GV A  AK  IEKEN   HV +V    P+T D    RVR+ V+  +  + 
Sbjct  50   QGKLMWPELIGVPAQYAKGIIEKENPLTHVQIVLNGSPITTDLSCNRVRIAVNILDYAVS  109

Query  335  TPVTG  321
             PV G
Sbjct  110  MPVVG  114



>ref|XP_007227104.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
 gb|EMJ28303.1| hypothetical protein PRUPE_ppa025505mg [Prunus persica]
Length=70

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GK+SWPELVG +   A +TIE EN  ++ V+V +   VT D++  RVR++V+  
Sbjct  1    MSSECEGKDSWPELVGDEGKDAAATIESENHLVNAVIVKEGTFVTADFRCDRVRVWVNKR  60

Query  350  NVVIRTPVTG  321
             +V + P+ G
Sbjct  61   GIVTKVPIIG  70



>ref|XP_010322583.1| PREDICTED: subtilisin inhibitor-like [Solanum lycopersicum]
Length=95

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+GV A  A+  I++E  +L + ++  N  VT DY+  RVRLFVD S  V + 
Sbjct  32   GKMSWPELLGVTAEEAERKIKEEKPELKIHIIPPNSMVTMDYRLDRVRLFVDESGKVAQE  91

Query  332  PVTG  321
            P  G
Sbjct  92   PRLG  95



>prf||1314299A proteinase inhibitor I
Length=107

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS +  V +  N  PVT DY+  RVRLF +    V+
Sbjct  42   NGKERWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVV  101

Query  338  RTP  330
            + P
Sbjct  102  QIP  104



>gb|AAA72133.1| proteinase inhibitor I, partial [Solanum tuberosum]
Length=106

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS ++ V +  N  PVT DY+  RVRLF +    V+
Sbjct  41   NGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVTMDYRCNRVRLFDNILGDVV  100

Query  338  RTP  330
            + P
Sbjct  101  QIP  103



>ref|XP_006663898.1| PREDICTED: subtilisin inhibitor 1-like [Oryza brachyantha]
Length=87

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVGV +  AK  I +E  ++ V +V  +  VT DY   RVR+FVD  + V R P
Sbjct  25   KDSWPELVGVSSEAAKEKIREERPEVDVQVVPGDAFVTMDYNAGRVRVFVDSDDKVARAP  84

Query  329  VTG  321
              G
Sbjct  85   KIG  87



>ref|XP_010687945.1| PREDICTED: glu S.griseus protease inhibitor-like [Beta vulgaris 
subsp. vulgaris]
Length=71

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN WPELVG +   A + +E+EN ++   +V Q   VT D++  RVR++V+ + VV R+
Sbjct  8    GKNEWPELVGENGPEAANIVERENPNVEAHVVLQGSIVTADFRCDRVRVWVNTNGVVYRS  67

Query  332  PVTG  321
            P  G
Sbjct  68   PRIG  71



>ref|XP_007009887.1| Serine protease inhibitor, putative [Theobroma cacao]
 gb|EOY18697.1| Serine protease inhibitor, putative [Theobroma cacao]
Length=71

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG     A + IEKEN  ++ V+V +   VT D+   RVR++V+   +V R 
Sbjct  8    GKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVTRV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PMIG  71



>ref|XP_006420158.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
 gb|ESR33398.1| hypothetical protein CICLE_v10007123mg [Citrus clementina]
Length=94

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = -1

Query  590  PQREAKNNVTHPAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQ  411
             Q++  N +T    + ++ +M     GK+SWPEL+G     A +T+E+EN  ++  +V +
Sbjct  9    SQKQINNFIT----RREKEEMASECRGKSSWPELLGAQGVEAAATVERENPLVNAQIVLE  64

Query  410  NCPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
               VT D+   RVR++V+    V R P  G
Sbjct  65   GSFVTADFLCTRVRVWVNTRGTVTRVPTIG  94



>gb|ADP05503.1| serine proteinase inhibitor 1b [Solanum nigrum]
Length=64

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K  WPELVGV A LAK  IEKEN  + HV ++    PVT D+   RVR+F +    V+R 
Sbjct  1    KQRWPELVGVPAKLAKGIIEKENPFITHVPILLIGSPVTFDFSCNRVRIFDNIFGNVVRI  60

Query  332  PVTG  321
            P+ G
Sbjct  61   PIVG  64



>ref|XP_002314193.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
 gb|EEE88148.1| hypothetical protein POPTR_0009s03360g [Populus trichocarpa]
Length=70

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  I  GK+SWPEL+GVD   A  TIE+ENS +  ++V +   +  D++  RV ++VD  
Sbjct  1    MASICQGKSSWPELLGVDGKCAVETIERENSLVEAIIVPEGSSIIEDFRCDRVWVWVDKD  60

Query  350  NVVIRTPVTG  321
             +V   P  G
Sbjct  61   GIVYLVPAIG  70



>ref|XP_010229493.1| PREDICTED: subtilisin inhibitor CLSI-I-like [Brachypodium distachyon]
Length=113

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -1

Query  521  ITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVV  342
            + D K+SWPE++G  A  AK TI ++  D+ V +V     VT D+   RVR+FVD SN V
Sbjct  47   MGDAKSSWPEVLGAPAEAAKQTILRDRPDVQVFIVPPGNSVTGDFNNKRVRVFVDSSNKV  106

Query  341  IRTPVTG  321
            ++ P  G
Sbjct  107  VKVPKIG  113



>gb|AID52862.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K++WPEL+G +  +A   IE EN+++  ++V +  P+T +Y   RV +FVD + VV + P
Sbjct  8    KDAWPELIGTNGDIAAGIIETENANVKAIVVKEGSPMTMEYNLCRVLVFVDDNRVVTQAP  67

Query  329  VTG  321
              G
Sbjct  68   AIG  70



>ref|XP_006489606.1| PREDICTED: uncharacterized protein LOC102620214 [Citrus sinensis]
Length=196

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            T GK+SWPEL+G     A +T+E+EN  ++  +V +   VT D+   RVR++V+    V 
Sbjct  68   TIGKSSWPELLGAQGVEAAATVERENPLVNAQIVLEGSFVTADFLCTRVRVWVNTRGTVT  127

Query  338  RTPVTG*SSW  309
            R P  G +SW
Sbjct  128  RVPTIGKNSW  137


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            T GKNSWPEL+G    +A + IEK+N  +   +V +   VT ++   RVR++V+ S +V 
Sbjct  131  TIGKNSWPELLGAKGDVAAAKIEKQNRYVSAQIVLEGTFVTLEFSCSRVRVWVNTSGIVT  190

Query  338  RTPVTG  321
            R P  G
Sbjct  191  RAPAIG  196


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SW ELVGV+  +A  TIE+EN  +   ++ +   V  D    RV + VD +++V+  
Sbjct  7    GKSSWSELVGVEGKVAAETIERENPIVSAHILLEGSNVFLDKYCGRVYVGVDTNSIVVEV  66

Query  332  PVTG*SSW  309
            P  G SSW
Sbjct  67   PTIGKSSW  74



>gb|ABZ88804.1| protease inhibitor protein [Hevea brasiliensis]
Length=70

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K++WPEL+G +  +A   IE EN+++  +++ +  P+T +Y   RV +FVD + VV + P
Sbjct  8    KDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDDNRVVTQAP  67

Query  329  VTG  321
            V G
Sbjct  68   VIG  70



>emb|CBI26387.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            DGK+SWPELVGV    A + IE+EN ++   +V +   VT D++  RVR++VD   +V  
Sbjct  6    DGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSYGIVSM  65

Query  335  TPVTG  321
             P  G
Sbjct  66   APKIG  70



>emb|CBI26384.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 12/92 (13%)
 Frame = -1

Query  560  HPAPKHQEA-----------KMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVV-MV  417
            H   ++QEA           +M    +GK+SWPELVGV   +A  TI++EN  +  V ++
Sbjct  28   HMYLEYQEALVDRYLCQTRKRMASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDIL  87

Query  416  FQNCPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
             +   VT D+   RVR++VD + +VI  P  G
Sbjct  88   LEGTIVTQDFYCTRVRVWVDENGIVISVPTIG  119



>emb|CAN75275.1| hypothetical protein VITISV_043736 [Vitis vinifera]
Length=70

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    DGK+SWPELVGV    A + IE+EN ++   +V +   VT D++  RVR++VD  
Sbjct  1    MATCPDGKSSWPELVGVHGEAAAAIIERENLNVKAGVVKEGTLVTTDFRCDRVRVWVDSY  60

Query  350  NVVIRTPVTG  321
             +V   P  G
Sbjct  61   GIVSMVPKIG  70



>ref|XP_006354745.1| PREDICTED: subtilisin inhibitor 1-like [Solanum tuberosum]
Length=95

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPEL+GV A  A+  I++E  +L + ++  N  VT DY+  RVRLFVD S  V + 
Sbjct  32   GKMSWPELLGVTAEEAERKIKEEKPELKIHIIPPNSMVTMDYRLDRVRLFVDESGKVAQE  91

Query  332  PVTG  321
            P  G
Sbjct  92   PRLG  95



>sp|P16231.1|ICI1_SOLPE RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Wound-induced proteinase inhibitor I; Flags: Precursor 
[Solanum peruvianum]
 gb|AAA34180.1| proteinase inhibitor I precursor [Solanum peruvianum]
Length=111

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKEN-SDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV A  AK  IEKEN S  ++ ++    PVT D++  RVRLFV+    V++
Sbjct  47   GKQFWPELIGVPALYAKGIIEKENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDVVQ  106

Query  335  TP  330
             P
Sbjct  107  IP  108



>gb|AAA34198.1| proteinase inhibitor I [Solanum peruvianum]
Length=111

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKEN-SDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV A  AK  IEKEN S  ++ ++    PVT D++  RVRLFV+    V++
Sbjct  47   GKQFWPELIGVPALYAKGIIEKENPSITNIPILLNGSPVTKDFRCDRVRLFVNILGDVVQ  106

Query  335  TP  330
             P
Sbjct  107  IP  108



>ref|XP_007009882.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18692.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG     A + IEKEN  ++ V+V +   VT D+   RVR++V+   +V R 
Sbjct  8    GKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGSFVTADFLCTRVRVWVNTYGIVTRV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PTIG  71



>ref|XP_006367784.1| PREDICTED: proteinase inhibitor 1 PPI2C1A [Solanum tuberosum]
Length=107

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D+   RVRLF +    V+
Sbjct  42   NGKLSWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRLFDNILGDVV  101

Query  338  RTPV  327
              PV
Sbjct  102  EMPV  105



>gb|ADP05502.1| serine proteinase inhibitor 1a [Solanum nigrum]
Length=64

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K  WPELVGV A LAK  IEKEN  + HV ++    PVT D+   RVR+F++    V+  
Sbjct  1    KQRWPELVGVPAKLAKGIIEKENPFITHVPILLIGSPVTFDFSCNRVRIFINIFGNVVDI  60

Query  332  PVTG  321
            P+ G
Sbjct  61   PIVG  64



>gb|AIT42237.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+GV   LAK  IEKENS +  V +  N  PVT D+   RVRLF +    V+
Sbjct  42   NGKLSWPELIGVPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRLFDNILGDVV  101

Query  338  RTPV  327
              PV
Sbjct  102  EMPV  105



>ref|XP_004247654.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 7/99 (7%)
 Frame = -1

Query  608  TIETKQPQREAKNNVTHPAPKHQEAKMPRITDGKNSWPELVGVDAFLAKSTIEKEN---S  438
            + ET   ++E          K  E+ +  +  GK  WPEL+GV A  AK  IEKEN   +
Sbjct  17   SFETLMARKEIGGPEVIELLKEYESNL--MCKGKRMWPELIGVPAQYAKGIIEKENPFIT  74

Query  437  DLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVTG  321
            D+ + ++    P T D+K +RVR+ V+  +V +  PV G
Sbjct  75   DVRIGLI--GSPGTADFKCFRVRIAVNILDVAVSMPVIG  111



>gb|KDP36376.1| hypothetical protein JCGZ_08645 [Jatropha curcas]
Length=70

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A + IEKEN  ++ +++ +  PVT D++  RV ++V+   VV+R 
Sbjct  7    GKSSWPELLGANGKAAAALIEKENKHVNAIVLKEGTPVTRDFRCDRVWVWVNECGVVVRV  66

Query  332  PV  327
            P+
Sbjct  67   PI  68



>gb|AAN85825.1| protease inhibitor [Vitis vinifera]
 emb|CAN62712.1| hypothetical protein VITISV_025108 [Vitis vinifera]
Length=71

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVV-MVFQNCPVTPDYKPWRVRLFVDC  354
            M    +GK+SWPELVGV   +A  TI++EN  +  V ++ +   VT D+   RVR++VD 
Sbjct  1    MASECEGKSSWPELVGVQGEVAAETIKRENPHITTVDILLEGTIVTQDFYCTRVRVWVDE  60

Query  353  SNVVIRTPVTG  321
            + +VI  P  G
Sbjct  61   NGIVISVPTIG  71



>gb|KDP36377.1| hypothetical protein JCGZ_08646 [Jatropha curcas]
Length=71

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A + IEKENS+++ +++ +  PVT D++  RV ++V+   VV++ 
Sbjct  8    GKSSWPELLGANGKPAAALIEKENSNVNAIVLKEGTPVTKDFRCDRVWVWVNECGVVVQV  67

Query  332  PV  327
            P+
Sbjct  68   PI  69



>gb|ADB85100.1| proteinase inhibitor [Jatropha curcas]
Length=70

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A + IEKEN  ++ +++ +  PVT D++  RV ++V+   VV+R 
Sbjct  7    GKSSWPELLGANGKAAAALIEKENRHVNAIVLKEGTPVTRDFRCDRVWVWVNECGVVVRV  66

Query  332  PV  327
            P+
Sbjct  67   PI  68



>emb|CAA47907.1| proteinase inhibitor I [Solanum tuberosum]
 emb|CAA48136.1| protease inhibitor I [Solanum tuberosum]
Length=107

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKENS ++ V +  N  PV  DY+  RVRLF +    V+
Sbjct  42   NGKQFWPELIGVPTKLAKEIIEKENSLINNVQILLNGSPVAMDYRCNRVRLFDNILGSVV  101

Query  338  RTP  330
            + P
Sbjct  102  QIP  104



>ref|XP_004249682.1| PREDICTED: trypsin inhibitor 1-like [Solanum lycopersicum]
Length=94

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPEL+GV A LA+  I+KEN  L  +   QN  PVT D++  RVRLF++  + V++ 
Sbjct  31   KETWPELLGVPARLAREIIQKENPRLTNIGNVQNGSPVTQDFRCDRVRLFINILDFVVQV  90

Query  332  PVTG  321
            P  G
Sbjct  91   PRIG  94



>ref|XP_007050380.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
 gb|EOX94537.1| Inhibitor of trypsin and hageman factor [Theobroma cacao]
Length=69

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+   A + I KEN  +  V+V +   VT D++  RVR++VD   +V R 
Sbjct  6    GKSSWPELVGVNGEAAAAIIVKENPKVGAVIVKEGMMVTMDFRCDRVRVWVDKYGIVKRK  65

Query  332  PVTG  321
            P  G
Sbjct  66   PQIG  69



>dbj|BAC10910.1| protease inhibitor 2 [Zinnia elegans]
Length=67

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG     A+ TIEKEN  ++ +++     VT D++  RV ++V+   +VIRT
Sbjct  4    GKSSWPELVGEKGEAARLTIEKENPLVNAIVLLDGTGVTKDFRCDRVWVWVNSKGIVIRT  63

Query  332  PV  327
            P+
Sbjct  64   PI  65



>gb|EMT22929.1| Subtilisin-chymotrypsin inhibitor-2A [Aegilops tauschii]
Length=95

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            T GK SWPE+VG+ A  AK  I K+  D  +V++     VT DY P RVR+FVD  +   
Sbjct  33   TGGKTSWPEVVGLSAEEAKKIILKDKPDADIVVLPAGSMVTMDYNPRRVRVFVDTVD---  89

Query  338  RTPVTG  321
             TP  G
Sbjct  90   ETPYAG  95



>ref|XP_003590801.1| Inhibitor of trypsin and hageman factor [Medicago truncatula]
 gb|AES61052.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=72

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+  +A++TIE+EN  ++ ++V +   V  D++  RV ++VD   +V + 
Sbjct  9    GKSSWPELVGVEGKVAEATIERENPLVNAIIVPEGSAVILDFRCDRVWVWVDKDGIVFKV  68

Query  332  PVTG  321
            P  G
Sbjct  69   PTIG  72



>emb|CAA87073.1| pathogenesis-related protein PR-6 type [Sambucus nigra]
Length=79

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN+WPEL G     A +T+E EN  +  V+V +   VT D +  RVR++VD + +V R 
Sbjct  16   GKNTWPELCGARGEEAAATVETENPSVTAVIVPEGSIVTTDERCDRVRVWVDENGIVTRV  75

Query  332  PVTG  321
            PV G
Sbjct  76   PVIG  79



>ref|XP_002309424.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
 gb|EEE92947.2| hypothetical protein POPTR_0006s22860g [Populus trichocarpa]
Length=70

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G  A +A +TIE EN  +   +V +   VT ++   RVR+++D + +V R 
Sbjct  7    GKSSWPELLGAQASVAVATIETENPYVDTQVVLEGTIVTGEFSCTRVRVWIDSNRIVTRV  66

Query  332  PVTG  321
            P+ G
Sbjct  67   PMIG  70



>ref|XP_010100074.1| Proteinase inhibitor [Morus notabilis]
 gb|EXB81310.1| Proteinase inhibitor [Morus notabilis]
Length=71

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVGV   +A + IEKEN ++  ++  Q  PV  DY+  RV ++V+   VV   
Sbjct  8    GKKSWPELVGVCGEIAAAKIEKENPNVDAIVKLQGTPVIQDYRCNRVWIWVNTHGVVSTV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PHVG  71



>ref|XP_006296188.1| hypothetical protein CARUB_v10025358mg [Capsella rubella]
 gb|EOA29086.1| hypothetical protein CARUB_v10025358mg [Capsella rubella]
Length=84

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KNSWPEL+G +   A S I+ ENS L V ++     V  D +  RVR++VD S  VI+ P
Sbjct  22   KNSWPELLGTNGDYAASVIKGENSSLQVTVILVGTWVPDDLRCDRVRVWVDESRTVIKNP  81

Query  329  VTG  321
            + G
Sbjct  82   IAG  84



>ref|XP_008439364.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis 
melo]
Length=69

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWP+LVGV   +AK+ IE+EN ++  V++    PVT D++  RVR++V+ + +V   P
Sbjct  7    KRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVNKNGLVASPP  66

Query  329  VTG  321
              G
Sbjct  67   TIG  69



>gb|EPS59152.1| hypothetical protein M569_15657, partial [Genlisea aurea]
Length=61

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVG +   A + +E+EN  +H +++    PVT D++  RV ++VD   +VIR 
Sbjct  1    GKLSWPELVGFNGREAAAVVERENPFVHPIVILDGTPVTRDFRCDRVWVWVDRRGIVIRP  60

Query  332  P  330
            P
Sbjct  61   P  61



>ref|XP_006420157.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
 gb|ESR33397.1| hypothetical protein CICLE_v10007070mg [Citrus clementina]
Length=70

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKNSWPEL+G    +A + IEK+N  +   +V +   VT ++   RVR++V+ S +V R 
Sbjct  7    GKNSWPELLGAKGDVAAAKIEKQNPYVSAQIVLEGTFVTLEFSCSRVRVWVNTSGIVTRA  66

Query  332  PVTG  321
            P  G
Sbjct  67   PAIG  70



>emb|CCW27997.1| serine protease inhibitor [Hevea brasiliensis]
Length=70

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K++WPEL+G +  +A   IE EN+++  +++ +  P+T +Y   RV +FVD + VV + P
Sbjct  8    KDAWPELIGTNGDIAAGIIETENANVKAIVLKKGSPMTMEYNLCRVLVFVDDNRVVTQAP  67

Query  329  VTG  321
              G
Sbjct  68   AIG  70



>ref|XP_007009891.1| Serine protease inhibitor [Theobroma cacao]
 gb|EOY18701.1| Serine protease inhibitor [Theobroma cacao]
Length=71

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG     A + IEKEN  ++ V+V +   VT ++   RVR++V+   +V R 
Sbjct  8    GKSSWPELVGKKGEDAAARIEKENPHVNAVIVLEGTFVTLEFLCTRVRVWVNTDGIVTRV  67

Query  332  PVTG  321
            P+ G
Sbjct  68   PIIG  71



>ref|XP_008391168.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GKNSWPELVG     A++ IE EN  ++ V+V +   VT DY+  RV ++VD +
Sbjct  1    MSSECEGKNSWPELVGAKGKDAEAIIESENRLVNAVIVKKGSFVTMDYRCDRVWVWVDKN  60

Query  350  NVVIRTPVTG  321
             +V + P  G
Sbjct  61   GIVTQIPXIG  70



>ref|XP_002314645.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
 gb|EEF00816.1| hypothetical protein POPTR_0010s08640g [Populus trichocarpa]
Length=71

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            +GK+SWPEL+GV+  +A +TIE+EN  +   MV +   V  +++  RV ++VD +N+V  
Sbjct  7    EGKSSWPELLGVEGKVAAATIERENPLVRAKMVPEGSAVIHNFRCDRVWVWVDKNNIVYT  66

Query  335  TPVTG  321
             PV G
Sbjct  67   VPVIG  71



>sp|Q00783.1|ICI1_SOLTU RecName: Full=Proteinase inhibitor 1; AltName: Full=Proteinase 
inhibitor I; Flags: Precursor [Solanum tuberosum]
 emb|CAA78259.1| proteinase inhibitor I [Solanum tuberosum]
Length=107

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV   LAK  IEKENS +  V +  N  PVT D +  RVRLF +    V+ 
Sbjct  43   GKLRWPELIGVPTKLAKGIIEKENSLISNVHILLNGSPVTLDIRCDRVRLFDNILGYVVD  102

Query  335  TPVTG  321
             PV G
Sbjct  103  IPVVG  107



>ref|XP_004490203.1| PREDICTED: glu S.griseus protease inhibitor-like [Cicer arietinum]
Length=69

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK +WPELVG++   A   I +EN+ +    + Q   VT D++  RVR+FVD  ++V R 
Sbjct  6    GKKTWPELVGINGEAASQIIMRENTRVTASTLPQESVVTTDFRCDRVRVFVDNQDIVTRV  65

Query  332  PVTG  321
            P  G
Sbjct  66   PNIG  69



>ref|XP_009590374.1| PREDICTED: trypsin inhibitor 1 [Nicotiana tomentosiformis]
Length=94

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K +WPEL+GV A  A+  I+KEN  L +V  +    PVT D +  RVRLFV+  ++V++ 
Sbjct  31   KETWPELIGVPAKFAREIIQKENPKLTNVPSLLNGSPVTKDLRCNRVRLFVNVLDIVVQL  90

Query  332  PVTG  321
            P  G
Sbjct  91   PRVG  94



>ref|XP_002323423.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
 gb|EEF05184.1| hypothetical protein POPTR_0016s07970g [Populus trichocarpa]
Length=70

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GK+SWPEL+G  A +A  T+E +N ++   +V +   VT ++   RVR+++D +
Sbjct  1    MASECQGKSSWPELLGAQARVAIVTVETQNPNVDAQVVLEGTFVTGEFSCTRVRVWIDRN  60

Query  350  NVVIRTPVTG  321
             +V R P+ G
Sbjct  61   RIVTRVPIIG  70



>gb|KDP42136.1| hypothetical protein JCGZ_03193 [Jatropha curcas]
Length=181

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  542  QEAKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLF  363
             +A+  ++   KNSWPEL+G +   A + IEKEN  +H +++ +  PV  D++  RV ++
Sbjct  108  SDAETEKLELSKNSWPELLGANGKAAAALIEKENKYVHAIVLKEGTPVPRDFRCDRVWVW  167

Query  362  VDCSNVVIRTPV  327
            V+   VV+R P+
Sbjct  168  VNECGVVVRVPI  179



>ref|XP_004247660.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
 sp|P05118.1|ICI1_SOLLC RecName: Full=Wound-induced proteinase inhibitor 1; AltName: 
Full=Wound-induced proteinase inhibitor I; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34199.1| wound-induced proteinase inhibitor I prepropeptide [Solanum lycopersicum]
 gb|AAA34200.1| proteinase inhibitor I [Solanum lycopersicum]
Length=111

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKEN-SDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV   LAK  IEKEN S  ++ ++    P+T DY   RVRLF +    V+
Sbjct  46   EGKQMWPELIGVPTKLAKEIIEKENPSITNIPILLSGSPITLDYLCDRVRLFDNILGFVV  105

Query  338  RTPV  327
            + PV
Sbjct  106  QMPV  109



>gb|AAZ08249.1| proteinase inhibitor 1 PPI3A4 [Solanum tuberosum]
 gb|AIT42230.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV A  AK  IEKEN+ +  V ++    PVT D+   RVR+ V+  +  +
Sbjct  42   NGKQRWPELIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIAVNILDYAV  101

Query  338  RTPVTG  321
              PV G
Sbjct  102  SMPVVG  107



>ref|XP_007201476.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
 gb|EMJ02675.1| hypothetical protein PRUPE_ppa014449mg [Prunus persica]
Length=69

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK +WPE+VG     A + IE+EN ++  +++ +  P T D +  RVR++++ + VV+R 
Sbjct  6    GKQAWPEVVGHSGQDAAAKIERENHNVRAIVILEGSPATKDLRCDRVRVWINRNGVVVRP  65

Query  332  PVTG  321
            P  G
Sbjct  66   PHVG  69



>ref|XP_006363673.1| PREDICTED: trypsin inhibitor 1-like [Solanum tuberosum]
Length=95

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCP-VTPDYKPWRVRLFVDCSNVVIRT  333
            K+SWPEL+GV A LA+  I+KEN  L  V+   N   VT D++  RVRL+V+  +  +RT
Sbjct  32   KSSWPELLGVPAKLAREIIQKENPKLTKVLNVPNGSIVTADFRCDRVRLYVNILDFTVRT  91

Query  332  PVTG  321
            P  G
Sbjct  92   PSIG  95



>ref|XP_006378353.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
 gb|ERP56150.1| hypothetical protein POPTR_0010s08630g [Populus trichocarpa]
Length=70

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  I  GK+SWPEL+GVD   A +TIE+EN  +  ++V +   V  +++  RV ++VD  
Sbjct  1    MASICQGKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSVIMNFQCDRVWVWVDKD  60

Query  350  NVVIRTPVTG  321
             +V   PV G
Sbjct  61   GIVYIVPVIG  70



>emb|CAN75276.1| hypothetical protein VITISV_043737 [Vitis vinifera]
 gb|ADD51185.1| protease inhibitor 2 [Vitis cinerea var. helleri x Vitis riparia]
 emb|CBI26388.3| unnamed protein product [Vitis vinifera]
Length=73

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 7/69 (10%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKEN---SDLHVVMVFQNCPVTPDYKP--WRVRLFVDCSN  348
            GK SWPEL+GV   +AK+T+E+EN   +D+ +V+  +   V  D  P   RVR++VD S 
Sbjct  7    GKTSWPELLGVQKAVAKATVERENPYVTDVEIVL--EGTIVPADLVPVCTRVRIWVDESG  64

Query  347  VVIRTPVTG  321
            +V R PV G
Sbjct  65   IVTRVPVVG  73



>ref|XP_007226170.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
 gb|EMJ27369.1| hypothetical protein PRUPE_ppa015379mg [Prunus persica]
Length=68

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG +  +AK+TIE+EN  +  +++    P+T D +  RVR++V+ + +V   P
Sbjct  6    KDSWPELVGAEGKVAKATIERENPLVTALILHLGAPITQDLRFDRVRVWVNTNGIVTWIP  65

Query  329  V  327
            V
Sbjct  66   V  66



>sp|P08820.1|ICIS_VICFA RecName: Full=Subtilisin inhibitor, partial [Vicia faba]
Length=62

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            + SWPELVGV A  A+  I++E  +  + +V Q+  VT DYK  RVRL+VD SN V+R  
Sbjct  1    RTSWPELVGVSAEEARK-IKEEMPEAEIQVVPQDSFVTADYKFQRVRLYVDESNKVVRAA  59

Query  329  VTG  321
              G
Sbjct  60   PIG  62



>ref|XP_004247656.1| PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]
Length=111

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKEN-SDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV A  AK  IEKEN S  ++ ++    PVT D++  RVRLFV+    V++
Sbjct  47   GKQFWPELIGVPAQYAKGIIEKENPSIANIPILLNGSPVTKDFRCDRVRLFVNILGDVVQ  106

Query  335  TP  330
             P
Sbjct  107  IP  108



>ref|XP_004288448.1| PREDICTED: glu S.griseus protease inhibitor-like [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = -1

Query  536  AKMPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPW--RVRLF  363
            AKM     GK  WPEL+G +  +AK TIE+ENS +   +V +   V  D      RVR++
Sbjct  33   AKMAGQCVGKEDWPELLGAEGTVAKETIERENSTVKAEIVLEGTIVPADLVRVCDRVRVW  92

Query  362  VDCSNVVIRTPVTG  321
            VD   +V R P  G
Sbjct  93   VDTCGIVTRVPTIG  106



>ref|XP_008224407.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Prunus 
mume]
Length=72

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN--CPVTPDYKPWRVRLFVDCSNVVI  339
            GK+SWPELVG +  +AK+TIE+EN  +  +++ Q    P+T D +  RVR++V+ + +V 
Sbjct  7    GKDSWPELVGAEGKVAKATIERENPLVTALILHQGPMTPMTQDLRFDRVRIWVNTNGIVT  66

Query  338  RTPV  327
              PV
Sbjct  67   WIPV  70



>ref|XP_008391173.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=70

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M    +GK+SWPELVG     A +TIE  N  ++ V+V +   VT +++  +VR++V+  
Sbjct  1    MSSECEGKDSWPELVGAKGAEAAATIESNNHLVNAVIVKZRMFVTANFRCDKVRVWVNKH  60

Query  350  NVVIRTPVTG  321
             +V R PV G
Sbjct  61   GIVTRVPVIG  70



>ref|XP_003556368.1| PREDICTED: glu S.griseus protease inhibitor [Glycine max]
 gb|ACU16268.1| unknown [Glycine max]
 gb|KHN13146.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GK+SWPELVGV+  +A +TIE+EN  +    V +   VT D++  RVR++V   
Sbjct  1    MASECKGKSSWPELVGVEGTVAVATIERENPLVDANTVLKGSIVTADFRCDRVRVWVTKH  60

Query  350  NVVIRTPVTG  321
             +V + P  G
Sbjct  61   GIVYQAPRIG  70



>ref|XP_007138379.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
 gb|ESW10373.1| hypothetical protein PHAVU_009G203600g [Phaseolus vulgaris]
Length=70

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M     GK SWPELVG++   A   I KEN  +  + V +   V+ D++  RVR+FV+  
Sbjct  1    MSSYCKGKRSWPELVGINGETATQIIVKENPRVEALTVPEGSFVSTDFRCDRVRVFVNYK  60

Query  350  NVVIRTPVTG  321
            N V R P  G
Sbjct  61   NTVTRVPNIG  70



>sp|P82381.1|ICI_LINUS RecName: Full=Proteinase inhibitor; AltName: Full=LUTI [Linum 
usitatissimum]
Length=69

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN+WPELVG    +A +T+E+EN ++H +++ +   +T D++  RV + V+   VV   
Sbjct  6    GKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSV  65

Query  332  P  330
            P
Sbjct  66   P  66



>pdb|1DWM|A Chain A, Solution Structure Of Linum Usitatissinum Trypsin Inhibitor 
(Luti)
Length=70

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN+WPELVG    +A +T+E+EN ++H +++ +   +T D++  RV + V+   VV   
Sbjct  7    GKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSV  66

Query  332  P  330
            P
Sbjct  67   P  67



>gb|ACU19481.1| unknown [Glycine max]
 gb|KHN01083.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=70

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV+  +A +TIE+EN  +    V +   VTPD++  RV ++V    +V + 
Sbjct  7    GKSSWPELVGVEGTVAVATIERENPLVDANTVLKGTIVTPDFRCDRVWVWVTKDGIVYQV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PTIG  70



>ref|XP_002442971.1| hypothetical protein SORBIDRAFT_08g005570 [Sorghum bicolor]
 gb|EES16809.1| hypothetical protein SORBIDRAFT_08g005570 [Sorghum bicolor]
Length=81

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            KNSWPELVG  +  AK  I+++     V +V  +  VT DY+  RVR+FVD  + V R P
Sbjct  19   KNSWPELVGKSSEEAKKKIKEDKPGADVQVVPADAFVTLDYRTGRVRVFVDSDDKVARAP  78

Query  329  VTG  321
              G
Sbjct  79   QIG  81



>ref|XP_004134085.1| PREDICTED: protease inhibitor HPI-like [Cucumis sativus]
 ref|XP_004168336.1| PREDICTED: protease inhibitor HPI-like [Cucumis sativus]
 gb|KGN56895.1| Protease inhibitor protein [Cucumis sativus]
Length=71

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K  WPELVGVD   A +TIE ENS +  +      P+  ++ P RVR+  D  + V+  P
Sbjct  9    KTQWPELVGVDYSTAATTIETENSHVKAIKFLVGSPMYLNFDPRRVRVVCDTQDKVVEMP  68

Query  329  VTG  321
              G
Sbjct  69   YVG  71



>gb|KDO37763.1| hypothetical protein CISIN_1g040548mg [Citrus sinensis]
Length=71

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVG++   A   I  EN  +    V +N  VT D++  RVR+FV+   +V R 
Sbjct  8    GKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVNDHGIVTRV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PRIG  71



>gb|AAZ08246.1| proteinase inhibitor 1 PPI2C1A [Solanum tuberosum]
Length=107

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQN-CPVTPDYKPWRVRLFVDCSNVVI  339
            +GK SWPEL+G    LAK  IEKENS +  V +  N  PVT D+   RVRLF +    V+
Sbjct  42   NGKLSWPELIGEPTKLAKEIIEKENSLITNVQILLNGSPVTKDFSCNRVRLFDNILGDVV  101

Query  338  RTPV  327
              PV
Sbjct  102  EMPV  105



>ref|XP_009603954.1| PREDICTED: glu S.griseus protease inhibitor-like [Nicotiana tomentosiformis]
Length=68

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG +   AK TIE+EN  +   +       T D++  RVR+FVD  N V + 
Sbjct  5    GKSSWPELVGENGQTAKETIERENPLVTANVAPVGSSGTTDFRCDRVRVFVDRDNNVAQV  64

Query  332  PVTG  321
            PV G
Sbjct  65   PVIG  68



>ref|XP_007199579.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
 gb|EMJ00778.1| hypothetical protein PRUPE_ppb023174mg [Prunus persica]
Length=124

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPE+VG D  +A + IE+E  D+H +++ +   +T + +  RVR++VD + VV   
Sbjct  61   GKSSWPEIVGEDGEVAAAKIEQEKPDVHAIVIPEGTIITQELRCNRVRVWVDENGVVTTV  120

Query  332  PVTG  321
            P  G
Sbjct  121  PRVG  124



>gb|EMT22931.1| Subtilisin-chymotrypsin inhibitor-2A [Aegilops tauschii]
Length=97

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVD  357
            TD K SWPE+VG+    AK  I K+  D  +V++    PVT DY+  RVR+F+D
Sbjct  35   TDEKTSWPEVVGLSVEKAKEIILKDKPDADIVVLPVGSPVTKDYRSERVRIFID  88



>ref|XP_003535093.2| PREDICTED: glu S.griseus protease inhibitor-like [Glycine max]
 gb|KHM98960.1| Glu S.griseus protease inhibitor [Glycine soja]
Length=69

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -1

Query  521  ITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVV  342
            + +GK SWPELVGV   +A++TIE+EN  ++ ++V     VT D +  RV ++V+   +V
Sbjct  3    VINGKFSWPELVGVQGTVAEATIERENPSVNAIIVPLGSVVTTDLRSDRVWVWVNKDGIV  62

Query  341  IRTPVTG  321
             R P  G
Sbjct  63   NRVPKIG  69



>ref|XP_009396358.1| PREDICTED: glu S.griseus protease inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV    A +TIE EN  +  V+V     VT D+   RVR++VD + +V   
Sbjct  6    GKSSWPELVGVKGETAVTTIESENPTVKAVIVEVGTIVTGDFLCDRVRVWVDKAGIVAEI  65

Query  332  PVTG  321
            P  G
Sbjct  66   PRIG  69



>ref|XP_006489607.1| PREDICTED: inhibitor of trypsin and hageman factor-like [Citrus 
sinensis]
 gb|KDO41754.1| hypothetical protein CISIN_1g038500mg [Citrus sinensis]
Length=71

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVG++   A   I  EN  +    V +N  VT D++  RVR+FV+   +V R 
Sbjct  8    GKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTTDFRCDRVRVFVNDHGIVTRV  67

Query  332  PVTG  321
            P  G
Sbjct  68   PRIG  71



>ref|XP_006367783.1| PREDICTED: proteinase inhibitor 1-like [Solanum tuberosum]
Length=90

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 1/65 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLH-VVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV   LAK  IEKENS ++ V ++    PV  DY+  RVRL  +    V++
Sbjct  26   GKLFWPELIGVPTKLAKEIIEKENSLINDVQIILSGSPVPLDYRCNRVRLVDNILGSVVQ  85

Query  335  TPVTG  321
             PV G
Sbjct  86   IPVVG  90



>ref|XP_006387620.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
 gb|ERP46534.1| hypothetical protein POPTR_0770s00230g [Populus trichocarpa]
Length=70

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  I  GK+SWPEL+GVD   A +TIE+EN  +  ++V +   +  +++  RV ++VD  
Sbjct  1    MASICQGKSSWPELLGVDGKCAVTTIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDKD  60

Query  350  NVVIRTPVTG  321
             +V   PV G
Sbjct  61   GIVYIVPVIG  70



>ref|XP_002314644.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 ref|XP_006387618.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
 gb|EEF00815.1| hypothetical protein POPTR_0010s08610g [Populus trichocarpa]
 gb|ERP46532.1| hypothetical protein POPTR_0770s00210g [Populus trichocarpa]
Length=70

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            M  I  GK+SWPEL+GVD   A +TIE+EN  +  ++V +   +  +++  RV ++VD  
Sbjct  1    MASICQGKSSWPELLGVDGKCAVATIERENPLVEAIIVPEGSSIIENFRCDRVWVWVDKD  60

Query  350  NVVIRTPVTG  321
             +V   PV G
Sbjct  61   GIVYIVPVIG  70



>gb|KDP21343.1| hypothetical protein JCGZ_21814 [Jatropha curcas]
Length=114

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +   A +TIEKEN+++  ++V +   V  D++  RV ++V+   VV + 
Sbjct  51   GKSSWPELLGTNGEAAAATIEKENTNVDAIVVKEGTGVIEDFRCNRVWVWVNEYGVVTQV  110

Query  332  PVTG  321
            P  G
Sbjct  111  PTVG  114



>gb|AIT42231.1| proteinase inhibitor 1 [Solanum tuberosum]
Length=107

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WPEL+GV A  AK  IEKEN+ +  V ++    PVT D+   RVR+ V+  +  +
Sbjct  42   NGKLRWPELIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIAVNILDYAV  101

Query  338  RTPVTG  321
              PV G
Sbjct  102  SMPVVG  107



>gb|EYU46483.1| hypothetical protein MIMGU_mgv1a023325mg [Erythranthe guttata]
Length=70

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+ WPELV  +   A + IE++N +++ ++V +   VT D +  RV ++V+ SNVV+R 
Sbjct  7    GKSMWPELVRANGDAAATVIERQNRNVNAIVVREGTSVTEDLRCDRVWVWVNASNVVVRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PRIG  70



>gb|KDP35356.1| hypothetical protein JCGZ_10340 [Jatropha curcas]
Length=71

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+  +   A + IEKENS+++ +++ +  PVT D +  RV +FV+   VV++ 
Sbjct  8    GKSSWPELLRANGKAAAALIEKENSNVNAIVLKEGTPVTSDLRCDRVWVFVNECGVVVQV  67

Query  332  P  330
            P
Sbjct  68   P  68



>ref|XP_004247655.1| PREDICTED: wound-induced proteinase inhibitor 1-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010326723.1| PREDICTED: wound-induced proteinase inhibitor 1-like isoform 
X2 [Solanum lycopersicum]
Length=111

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVV-MVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
            GK  WPEL+GV A LAK  IEKEN  +  + ++    PVT D++  RVRLF +    V++
Sbjct  47   GKQFWPELIGVPAKLAKEIIEKENPSISDIPILLNGSPVTMDFRCDRVRLFDNILGYVVQ  106

Query  335  TP  330
             P
Sbjct  107  IP  108



>ref|XP_007029839.1| Uncharacterized protein TCM_025715 [Theobroma cacao]
 gb|EOY10341.1| Uncharacterized protein TCM_025715 [Theobroma cacao]
Length=160

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK SWPELVG    +A + IEKEN ++  V++ +  P    +   RVR+FV+   +V + 
Sbjct  97   GKQSWPELVGEKGDVAAAKIEKENPNVKAVVLLEGTPTDRMFDITRVRVFVNEEGMVTQV  156

Query  332  PVTG  321
            P TG
Sbjct  157  PRTG  160



>ref|XP_002517007.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
 gb|EEF45170.1| Glu S.griseus protease inhibitor, putative [Ricinus communis]
Length=70

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVG +   A + I +EN  +    V +  PV+ D++  RVR+F+D +++V   
Sbjct  7    GKSSWPELVGNNGEAATAIIMRENPRVKANTVKEGSPVSGDFRSDRVRVFIDDNHIVTLV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PKIG  70



>ref|XP_008391169.1| PREDICTED: glu S.griseus protease inhibitor-like [Malus domestica]
Length=76

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYK--PWRVRLFVDCSNV  345
            ++GK  WPEL+G    +AK+TI++ENS + V +V +   V  D +    RVR++VD    
Sbjct  9    SEGKYVWPELLGAKGTVAKATIKRENSTVKVEIVVEGTIVPADLRCVADRVRVWVDTDGF  68

Query  344  VIRTPVTG  321
            V R P+ G
Sbjct  69   VTRVPIIG  76



>ref|XP_002315724.2| trypsin inhibitor family protein [Populus trichocarpa]
 ref|XP_006387617.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|ERP46531.1| hypothetical protein POPTR_0770s00200g [Populus trichocarpa]
 gb|EEF01895.2| trypsin inhibitor family protein [Populus trichocarpa]
Length=72

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G +  +A +TIE+EN  +  ++V     V+ D++  RV ++VD   +VI  
Sbjct  9    GKSSWPELLGAEGKVAAATIERENPLVEAIIVLDGSEVSLDFRCDRVWVWVDERGIVIEV  68

Query  332  PVTG  321
            P  G
Sbjct  69   PRIG  72



>ref|XP_002440441.1| hypothetical protein SORBIDRAFT_09g001050 [Sorghum bicolor]
 gb|EES18871.1| hypothetical protein SORBIDRAFT_09g001050 [Sorghum bicolor]
Length=66

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPE+VG+    AK TI K+  D  ++++    PV  D++P RVR+FVD   +V+ TP
Sbjct  7    KTSWPEVVGLSVEKAKKTILKDKPDADIIVLPVGTPVPKDFQPNRVRIFVD---IVVETP  63

Query  329  VTG  321
              G
Sbjct  64   HVG  66



>gb|KEH42587.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=70

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN WPE+VG+D   A   IE+EN  ++ ++V +   VT D+K  RV ++VD    V R 
Sbjct  7    GKNKWPEVVGMDGDEAAEKIERENEKVNAIVVPEGSVVTMDFKCTRVWVWVDKHGRVTRM  66

Query  332  PVTG  321
            P  G
Sbjct  67   PKIG  70



>gb|KFK29321.1| hypothetical protein AALP_AA7G118200 [Arabis alpina]
Length=72

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPELVG +   A S I+ ENS L V +      V  D +  RVR++VD + +V++ P
Sbjct  10   KTSWPELVGTNGDYAASVIKGENSGLDVAVFLDGTWVYEDLRCNRVRVWVDGNRIVVKVP  69

Query  329  VTG  321
              G
Sbjct  70   TVG  72



>ref|XP_004499830.1| PREDICTED: subtilisin inhibitor 1-like [Cicer arietinum]
Length=98

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPELVGV A  A+  I++E  +  + +V  +  VT D+KP RVRL+VD SN VIR P
Sbjct  36   KKSWPELVGVTAEEAEKKIKEEMPEAEIQVVPHDSFVTADFKPHRVRLYVDLSNKVIRIP  95

Query  329  VTG  321
              G
Sbjct  96   GIG  98



>ref|XP_009140106.1| PREDICTED: protease inhibitor HPI-like [Brassica rapa]
Length=65

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  503  SWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVT  324
            +WPELVG     A S I++EN   +V ++     VT D +  RVR++VD + +V+R P T
Sbjct  5    TWPELVGTHGDDAASVIKRENPSFNVFVLLIGSIVTADLRENRVRVWVDTNRIVVRVPTT  64

Query  323  G  321
            G
Sbjct  65   G  65



>ref|XP_004134090.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 ref|XP_004165329.1| PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]
 gb|KGN56904.1| hypothetical protein Csa_3G142960 [Cucumis sativus]
Length=71

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDC-  354
            M     GK+SWPELVG     A+  IEKEN  +  V+V +   VT D++  RV ++VD  
Sbjct  1    MSTTCKGKSSWPELVGKAGKEAEKIIEKENPSVDAVIVDEGSVVTQDFRCDRVWVWVDSK  60

Query  353  SNVVIRTPVTG  321
            +++V RTP  G
Sbjct  61   TSIVTRTPFIG  71



>ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus communis]
 gb|EEF29391.1| subtilisin inhibitor 1, putative [Ricinus communis]
Length=103

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            + +WP+LVGV A  A+  I+++   + V +V  NC +T D++  RVRLF+D S  V R P
Sbjct  41   RKTWPDLVGVMAEEAERKIKEDMPGVEVQVVQPNCFITMDFREGRVRLFIDSSGKVARPP  100

Query  329  VTG  321
              G
Sbjct  101  RIG  103



>gb|KGN56903.1| hypothetical protein Csa_3G142950 [Cucumis sativus]
Length=71

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -1

Query  530  MPRITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFV-DC  354
            MP    GK+SWPELV     +A   IEKENS +  ++V +   V  +++  RV +F+   
Sbjct  1    MPNSCKGKSSWPELVNAPGEIAVKIIEKENSSVKAIIVEEGSSVVTNFECGRVFVFIHKK  60

Query  353  SNVVIRTPVTG  321
            SN+V +TP  G
Sbjct  61   SNMVTKTPHIG  71



>pdb|1VBW|A Chain A, Crystal Structure Of Bitter Gourd Trypsin Inhibitor
 prf||2111250B trypsin inhibitor BGIT
Length=68

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK+SWP+LVG     AK+ IE+EN  +  V++      T D++  RVR++V    +V R
Sbjct  4    QGKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVAR  63

Query  335  TPVTG  321
             P  G
Sbjct  64   PPTIG  68



>dbj|BAB32588.1| inhibitor against trypsin [Momordica charantia]
Length=66

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK+SWP+LVG     AK+ IE+EN  +  V++      T D++  RVR++V    +V R
Sbjct  2    QGKSSWPQLVGSTGAAAKAVIERENPRVRAVIIKVGSGATKDFRCDRVRVWVTERGIVAR  61

Query  335  TPVTG  321
             P  G
Sbjct  62   PPTIG  66



>gb|EWM21885.1| subtilisin inhibitor [Nannochloropsis gaditana]
Length=150

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  503  SWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVT  324
            SWPELVG+D   AK  I  +   L+V+++ +N P T DY+  RVR+FVD    V+  P  
Sbjct  90   SWPELVGMDGEDAKKQITADMPGLNVIVLPKNSPCTMDYRLERVRVFVDEEGKVVVAPSQ  149

Query  323  G  321
            G
Sbjct  150  G  150



>gb|EMS68098.1| Subtilisin-chymotrypsin inhibitor-2A [Triticum urartu]
Length=95

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = -1

Query  518  TDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            T  K SWPE+VG+ A  AK  I K+  D ++V++     VT DY P RVR+FVD    V 
Sbjct  33   TGEKTSWPEVVGLCAEEAKKIILKDKPDANIVVLPAGSMVTMDYDPLRVRIFVDT---VA  89

Query  338  RTPVTG  321
            + P TG
Sbjct  90   KAPHTG  95



>gb|KDP35354.1| hypothetical protein JCGZ_10338 [Jatropha curcas]
Length=71

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVR  369
            GK SWPEL+G +   A + IEKENS+++ +++ +  PVTPD++  RVR
Sbjct  8    GKRSWPELLGANGKAAAALIEKENSNVNAIVLNEMSPVTPDFRCGRVR  55



>ref|XP_003614151.1| Trypsin inhibitor [Medicago truncatula]
 gb|AES97109.1| inhibitor of trypsin and hageman factor-like protein [Medicago 
truncatula]
Length=69

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK +WPELVGV+   A   I  ENS +    + ++   T D++  RVR+FVD  +VV R 
Sbjct  6    GKKTWPELVGVNGEAAAQIIMSENSLVTASTLPEDSVFTADFRCDRVRVFVDKQDVVTRV  65

Query  332  PVTG  321
            P  G
Sbjct  66   PKIG  69



>sp|Q03199.1|IPIB_TOBAC RecName: Full=Proteinase inhibitor I-B; Short=PI-IB; AltName: 
Full=Inhibitor of microbial serine proteinases major isoform; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA78269.1| pre-pro-proteinase inhibitor I [Nicotiana tabacum]
 emb|CAA47461.1| inhibitor of microbial serine proteinases (major isoform) [Nicotiana 
tabacum]
Length=107

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K  WPEL+G  A  A   I+KEN  L +V  V    PVT D +  RVRLFV+  + V++T
Sbjct  44   KERWPELLGTPAKFAMQIIQKENPKLTNVQTVLNGTPVTEDLRCNRVRLFVNVLDFVVQT  103

Query  332  PVTG  321
            P  G
Sbjct  104  PQVG  107



>ref|XP_011081244.1| PREDICTED: proteinase inhibitor-like [Sesamum indicum]
Length=76

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = -1

Query  521  ITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTP-DYKPWRVRLFVDCSNV  345
            I  GK+SWPELVG    +A  TIE+ENS ++ V+V Q+ PV P ++   RV +F++   +
Sbjct  10   ICPGKSSWPELVGTCGEVAAKTIEEENS-VYAVIVPQSQPVLPANFNCGRVFVFINEKGI  68

Query  344  VIRTPVTG  321
            V R P  G
Sbjct  69   VTRVPRVG  76



>ref|XP_004977162.1| PREDICTED: subtilisin inhibitor 1-like [Setaria italica]
Length=117

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K+SWPELVG+ +  AK  I+++  D  V +V  +  VT DY   RVR+FVD ++ V + P
Sbjct  55   KDSWPELVGLSSEEAKKKIKEDKPDADVQVVPADAFVTMDYNTGRVRVFVDSNDKVAKAP  114

Query  329  VTG  321
              G
Sbjct  115  RIG  117



>ref|XP_004247696.2| PREDICTED: wound-induced proteinase inhibitor 1-like [Solanum 
lycopersicum]
Length=128

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIR  336
             GK SWPELVG  A  AK  IEKEN   HV ++F   P   +Y   RV L VD   +V  
Sbjct  64   SGKQSWPELVGKPAEYAKKIIEKENPIAHVSVLFPGMPRPGNYVCGRVFLVVDWEAIVKI  123

Query  335  TPVTG  321
            TP  G
Sbjct  124  TPRMG  128



>gb|ABP01767.1| ptoteinase inhibitor 2 [Salvia miltiorrhiza]
Length=71

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPELVGV    A   I +ENS ++ ++  +N P+T D++  RV +FV+ S +V R 
Sbjct  8    GKDSWPELVGVCGREAAKVISEENSLVNPLIWGENQPITRDFRCDRVFVFVNDSGIVTRV  67

Query  332  PV  327
            P+
Sbjct  68   PM  69



>gb|EYU17889.1| hypothetical protein MIMGU_mgv1a022666mg [Erythranthe guttata]
Length=69

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GKN WPEL+G +   A + IE++N +++ V+     P T D++  RV ++V+ + VV+R 
Sbjct  6    GKNFWPELLGANGDAAAAVIERQNPNVNAVVSTNPTPTTRDFRCDRVWVWVNANGVVLRA  65

Query  332  PVTG  321
            P  G
Sbjct  66   PRAG  69



>ref|NP_001234615.1| ethylene-responsive proteinase inhibitor 1 precursor [Solanum 
lycopersicum]
 sp|P20076.1|IER1_SOLLC RecName: Full=Ethylene-responsive proteinase inhibitor 1; AltName: 
Full=Ethylene-responsive proteinase inhibitor I; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA60745.1| proteinase inhibitor I [Solanum lycopersicum]
Length=119

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K SWPEL+G  A  AK  I+KEN  L +V  +      T D +  RVRLFV+  ++V++T
Sbjct  56   KESWPELLGTPAKFAKQIIQKENPKLTNVETLLNGSAFTEDLRCNRVRLFVNLLDIVVQT  115

Query  332  PVTG  321
            P  G
Sbjct  116  PKVG  119



>gb|EMS66467.1| hypothetical protein TRIUR3_25503 [Triticum urartu]
Length=78

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  521  ITDGKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVV  342
            + DGK+SWPE+VG D F A   I+ +  D+ +        V+PD    RVR+F+D   +V
Sbjct  13   VDDGKSSWPEVVGWDGFTAMIKIKADRQDVTIEFHAVGDNVSPDEDDHRVRVFLD-QQIV  71

Query  341  IRTPVTG  321
             +TPV G
Sbjct  72   AQTPVVG  78



>ref|WP_017626123.1| hypothetical protein [Nocardiopsis chromatogenes]
Length=110

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSN----V  345
            GK SWPEL G DA  A+  IE+EN  +  V+V +   VT D++  RVR+F +  +    +
Sbjct  43   GKQSWPELAGADAHTAERVIERENPRVDAVLVPKGSYVTMDFRCDRVRVFHEGDDPAPLI  102

Query  344  VIRTPVTG  321
            V R P  G
Sbjct  103  VARAPQVG  110



>ref|XP_003598785.1| CCP [Medicago truncatula]
 gb|AES69036.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
 gb|AFK43503.1| unknown [Medicago truncatula]
Length=94

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = -1

Query  515  DGKNS-----WPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCS  351
            DG+N+     W ELVGV A  A+  I++E + + + +V     VT DY   RVRL+VD S
Sbjct  25   DGRNNPTRRNWSELVGVTAEEAERKIKEEMNGVEIRVVPPGYFVTADYNTQRVRLYVDQS  84

Query  350  NVVIRTPVTG  321
            N +I+TP  G
Sbjct  85   NKLIKTPTIG  94



>ref|XP_009610134.1| PREDICTED: proteinase inhibitor I-B [Nicotiana tomentosiformis]
Length=126

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K  WPEL+G  A  A   I+KEN  L +V  V    PVT D +  RVRLFV+  + V++T
Sbjct  63   KERWPELLGTPAKFAMQIIQKENPKLTNVQTVLNGTPVTEDLRCNRVRLFVNLLDFVVQT  122

Query  332  PVTG  321
            P  G
Sbjct  123  PQVG  126



>gb|KGN60477.1| hypothetical protein Csa_3G914570 [Cucumis sativus]
Length=71

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = -1

Query  503  SWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTPVT  324
            SWP L  +DA    + I+KEN D  + ++    PVT D K  RVRLF +   +V+  P  
Sbjct  11   SWPALNFMDARTVANIIKKENPDFQIFILLAGSPVTKDLKHGRVRLFTNMEEIVVIVPQE  70

Query  323  G  321
            G
Sbjct  71   G  71



>gb|AAT40087.1| MPI [Tripsacum dactyloides]
Length=75

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = -1

Query  536  AKMPRITDG-KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFV  360
            A  P    G K SWPE+VG+    AK  I K+  D  +V++     VT DY+P RVR+FV
Sbjct  6    AAAPECGGGAKTSWPEVVGLSVEEAKKVILKDKPDADIVVLPVGSVVTADYRPDRVRIFV  65

Query  359  DCSNVVIRTPVTG  321
            D   +V +TP  G
Sbjct  66   D---IVAQTPHIG  75



>ref|NP_001274835.1| proteinase inhibitor 1 PPI3A2 precursor [Solanum tuberosum]
 gb|AAZ08248.1| proteinase inhibitor 1 PPI3A2 [Solanum tuberosum]
Length=107

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = -1

Query  515  DGKNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVI  339
            +GK  WP L+GV A  AK  IEKEN+ +  V ++    PVT D+   RVR+ V+  +  +
Sbjct  42   NGKQRWPGLIGVPAQYAKGIIEKENTLIADVQIILNGSPVTADFSCNRVRIAVNILDYAV  101

Query  338  RTPVTG  321
              PV G
Sbjct  102  SMPVVG  107



>ref|XP_006420961.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|ESR34201.1| hypothetical protein CICLE_v10006680mg [Citrus clementina]
 gb|KDO41811.1| hypothetical protein CISIN_1g035202mg [Citrus sinensis]
Length=70

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+G     A +T+E +N  ++  +V +   VT D+   RVR++V+    V R 
Sbjct  7    GKSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNTRGTVTRV  66

Query  332  PVTG  321
            P  G
Sbjct  67   PTIG  70



>gb|EMT14369.1| Chymotrypsin inhibitor [Aegilops tauschii]
Length=65

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
             K SWPE+VG     A   I  +  D+ V    Q  P+ P Y P RV L V+ S VV++T
Sbjct  2    AKTSWPEVVGWPELNAWDQITSDRPDVSVGFYVQGSPLPPGYDPKRVVLIVNPSQVVMKT  61

Query  332  PVTG  321
            PV G
Sbjct  62   PVVG  65



>gb|AAT40076.1| MPI [Zea perennis]
 gb|AAT40077.1| MPI [Zea perennis]
 gb|AAT40084.1| MPI [Zea perennis]
 gb|AAT40085.1| MPI [Zea perennis]
Length=74

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
             K SWPE+VG+    AK  I K+  D  +V++     VT DY+P RVR+FVD   +V +T
Sbjct  14   AKTSWPEVVGLSVEEAKKVILKDKPDADIVVLPVGSVVTADYRPNRVRIFVD---IVAQT  70

Query  332  PVTG  321
            P  G
Sbjct  71   PHVG  74



>gb|AAT40058.1| MPI [Zea diploperennis]
 gb|AAT40059.1| MPI [Zea diploperennis]
 gb|AAT40060.1| MPI [Zea diploperennis]
 gb|AAT40061.1| MPI [Zea diploperennis]
 gb|AAT40062.1| MPI [Zea diploperennis]
 gb|AAT40064.1| MPI [Zea diploperennis]
 gb|AAT40065.1| MPI [Zea diploperennis]
 gb|AAT40066.1| MPI [Zea diploperennis]
 gb|AAT40068.1| MPI [Zea diploperennis]
 gb|AAT40069.1| MPI [Zea diploperennis]
 gb|AAT40070.1| MPI [Zea diploperennis]
 gb|AAT40072.1| MPI [Zea perennis]
 gb|AAT40073.1| MPI [Zea perennis]
 gb|AAT40074.1| MPI [Zea perennis]
 gb|AAT40075.1| MPI [Zea perennis]
 gb|AAT40078.1| MPI [Zea perennis]
 gb|AAT40080.1| MPI [Zea perennis]
 gb|AAT40081.1| MPI [Zea perennis]
 gb|AAT40082.1| MPI [Zea perennis]
 gb|AAT40083.1| MPI [Zea perennis]
 gb|AAT40086.1| MPI [Zea perennis]
Length=72

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPE+VG+    AK  I K+  D  +V++     VT DY+P RVR+FVD   +V +TP
Sbjct  13   KTSWPEVVGLSVEEAKKVILKDKPDADIVVLPVGSVVTADYRPNRVRIFVD---IVAQTP  69

Query  329  VTG  321
              G
Sbjct  70   HVG  72



>gb|AAT40067.1| MPI [Zea diploperennis]
 gb|AAT40071.1| MPI [Zea perennis]
 gb|AAT40079.1| MPI [Zea perennis]
Length=71

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRTP  330
            K SWPE+VG+    AK  I K+  D  +V++     VT DY+P RVR+FVD   +V +TP
Sbjct  12   KTSWPEVVGLSVEEAKKVILKDKPDADIVVLPVGSVVTADYRPNRVRIFVD---IVAQTP  68

Query  329  VTG  321
              G
Sbjct  69   HVG  71



>ref|XP_009774949.1| PREDICTED: trypsin inhibitor 1-like [Nicotiana sylvestris]
Length=95

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  509  KNSWPELVGVDAFLAKSTIEKENSDL-HVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            K++WPEL+GV A LA+ TI+KE   L +V  V     VT D++  RVRL+V+  + V++T
Sbjct  32   KDTWPELLGVPAKLARETIQKEEPTLTNVQTVLNGRFVTQDFRCDRVRLWVNVLDFVVQT  91

Query  332  PVTG  321
            P  G
Sbjct  92   PRVG  95



>emb|CDO99178.1| unnamed protein product [Coffea canephora]
Length=83

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  512  GKNSWPELVGVDAFLAKSTIEKENSDLHVVMVFQNCPVTPDYKPWRVRLFVDCSNVVIRT  333
            GK+SWPEL+GVD   AK+ IEKEN  +  ++V +   V  D++  RV ++V+ +N+V   
Sbjct  20   GKSSWPELLGVDGDYAKAVIEKENPLVTAMIVPEGSSVILDFRCDRVWVWVNKNNIVTEV  79

Query  332  PVTG  321
            P  G
Sbjct  80   PHIG  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1222808918166