BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24626_g3_i2 len=777 path=[2869:0-657 5951:658-660 5396:661-776]

Length=777
                                                                      Score     E

emb|CDP04443.1|  unnamed protein product                                181   8e-52   
ref|XP_011095999.1|  PREDICTED: uncharacterized protein At1g04910...    186   2e-51   
ref|XP_011095998.1|  PREDICTED: uncharacterized protein At1g04910...    186   8e-51   
ref|XP_009777767.1|  PREDICTED: uncharacterized protein At1g04910       182   2e-49   
ref|XP_009613681.1|  PREDICTED: uncharacterized protein At1g04910       182   2e-49   
gb|EYU27727.1|  hypothetical protein MIMGU_mgv1a002727mg                182   4e-49   
ref|XP_006348159.1|  PREDICTED: uncharacterized protein At1g04910...    179   1e-48   
ref|XP_004232682.1|  PREDICTED: uncharacterized protein At1g04910       179   2e-48   
ref|XP_010553452.1|  PREDICTED: uncharacterized protein At1g04910       178   6e-48   
gb|EPS69385.1|  hypothetical protein M569_05376                         176   3e-47   
ref|XP_010057887.1|  PREDICTED: uncharacterized protein At1g04910...    175   9e-47   
ref|XP_002304905.2|  hypothetical protein POPTR_0004s00690g             174   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011046990.1|  PREDICTED: uncharacterized protein At1g04910...    174   2e-46   
ref|XP_006300315.1|  hypothetical protein CARUB_v10019899mg             174   3e-46   
ref|NP_176423.3|  O-fucosyltransferase family protein                   173   3e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44565.1|  unnamed protein product                                173   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888034.1|  hypothetical protein ARALYDRAFT_475111             173   5e-46   
emb|CDY12942.1|  BnaA09g13320D                                          173   6e-46   
ref|XP_010473452.1|  PREDICTED: uncharacterized protein At1g04910...    173   6e-46   
ref|XP_010430282.1|  PREDICTED: uncharacterized protein At1g04910...    173   6e-46   
ref|XP_009113085.1|  PREDICTED: uncharacterized protein At1g04910       173   6e-46   
ref|XP_010418221.1|  PREDICTED: uncharacterized protein At1g04910...    173   6e-46   
emb|CDY19543.1|  BnaC09g13600D                                          172   8e-46   
gb|AAF70834.1|AC003113_1  F24O1.5                                       172   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026176.1|  O-fucosyltransferase family protein isoform 2      169   9e-46   
ref|XP_009148624.1|  PREDICTED: uncharacterized protein At1g04910       172   1e-45   
emb|CDY30045.1|  BnaC05g09750D                                          171   1e-45   
emb|CDX98087.1|  BnaA06g08380D                                          171   2e-45   
ref|XP_010252508.1|  PREDICTED: uncharacterized protein At1g04910...    171   2e-45   
ref|XP_010252507.1|  PREDICTED: uncharacterized protein At1g04910...    171   2e-45   
ref|XP_008458995.1|  PREDICTED: uncharacterized protein At1g04910...    168   3e-45   
ref|XP_002316562.2|  hypothetical protein POPTR_0011s01550g             170   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011002566.1|  PREDICTED: uncharacterized protein At1g04910       170   5e-45   
ref|XP_006391902.1|  hypothetical protein EUTSA_v10023332mg             170   5e-45   
gb|KHG30772.1|  hypothetical protein F383_15375                         169   7e-45   
ref|XP_002518425.1|  conserved hypothetical protein                     169   1e-44   Ricinus communis
gb|KFK40606.1|  hypothetical protein AALP_AA2G017600                    169   1e-44   
ref|XP_006449803.1|  hypothetical protein CICLE_v10014653mg             166   2e-44   
ref|XP_007026175.1|  O-fucosyltransferase family protein isoform 1      168   2e-44   
ref|XP_006449800.1|  hypothetical protein CICLE_v10014653mg             166   3e-44   
ref|XP_006417280.1|  hypothetical protein EUTSA_v10007119mg             167   3e-44   
gb|KDP20702.1|  hypothetical protein JCGZ_21173                         167   3e-44   
ref|XP_004164352.1|  PREDICTED: DUF246 domain-containing protein ...    168   4e-44   
ref|XP_004145470.1|  PREDICTED: DUF246 domain-containing protein ...    168   4e-44   
gb|KGN66851.1|  hypothetical protein Csa_1G701270                       168   4e-44   
ref|XP_008458993.1|  PREDICTED: uncharacterized protein At1g04910...    167   5e-44   
gb|KHN35713.1|  DUF246 domain-containing protein                        166   5e-44   
ref|XP_008458994.1|  PREDICTED: uncharacterized protein At1g04910...    167   5e-44   
ref|XP_008798044.1|  PREDICTED: uncharacterized protein At1g04910...    166   5e-44   
ref|XP_006449801.1|  hypothetical protein CICLE_v10014653mg             166   5e-44   
ref|XP_004507663.1|  PREDICTED: uncharacterized protein At1g04910...    167   6e-44   
ref|XP_006449796.1|  hypothetical protein CICLE_v10014653mg             165   6e-44   
ref|XP_004507662.1|  PREDICTED: uncharacterized protein At1g04910...    167   6e-44   
gb|KDO78360.1|  hypothetical protein CISIN_1g007425mg                   163   7e-44   
ref|XP_006584088.1|  PREDICTED: uncharacterized protein At1g04910...    166   9e-44   
gb|KHN03501.1|  DUF246 domain-containing protein                        166   9e-44   
ref|XP_003550479.1|  PREDICTED: uncharacterized protein At1g04910...    166   1e-43   
gb|KEH32648.1|  GDP-fucose protein O-fucosyltransferase                 165   1e-43   
ref|XP_006449797.1|  hypothetical protein CICLE_v10014653mg             165   1e-43   
ref|XP_003528699.1|  PREDICTED: uncharacterized protein At1g04910...    166   1e-43   
ref|XP_010244143.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-43   
ref|XP_006449798.1|  hypothetical protein CICLE_v10014653mg             165   2e-43   
ref|XP_006449802.1|  hypothetical protein CICLE_v10014653mg             165   2e-43   
gb|KDO78358.1|  hypothetical protein CISIN_1g007425mg                   162   3e-43   
ref|XP_008798042.1|  PREDICTED: uncharacterized protein At1g04910...    165   3e-43   
ref|XP_008224713.1|  PREDICTED: uncharacterized protein At1g04910...    165   3e-43   
gb|AES92670.2|  GDP-fucose protein O-fucosyltransferase                 164   4e-43   
ref|XP_008384256.1|  PREDICTED: uncharacterized protein At1g04910...    164   4e-43   
ref|XP_007153988.1|  hypothetical protein PHAVU_003G081600g             164   6e-43   
gb|KDO78357.1|  hypothetical protein CISIN_1g007425mg                   162   6e-43   
ref|XP_009357489.1|  PREDICTED: uncharacterized protein At1g04910...    164   7e-43   
ref|XP_007214654.1|  hypothetical protein PRUPE_ppa002626mg             164   7e-43   
gb|KDO78356.1|  hypothetical protein CISIN_1g007425mg                   162   1e-42   
ref|XP_010099160.1|  hypothetical protein L484_014158                   163   1e-42   
gb|KDO78355.1|  hypothetical protein CISIN_1g007425mg                   162   1e-42   
emb|CBI14835.3|  unnamed protein product                                155   2e-42   
ref|XP_003619270.1|  DUF246 domain-containing protein                   162   3e-42   
ref|XP_010244142.1|  PREDICTED: uncharacterized protein At1g04910...    162   3e-42   
ref|XP_010244141.1|  PREDICTED: uncharacterized protein At1g04910...    162   3e-42   
ref|XP_006467376.1|  PREDICTED: uncharacterized protein At1g04910...    162   3e-42   
ref|XP_006467377.1|  PREDICTED: uncharacterized protein At1g04910...    162   3e-42   
gb|KDO78354.1|  hypothetical protein CISIN_1g007425mg                   162   3e-42   
ref|XP_003610473.1|  hypothetical protein MTR_4g132590                  162   5e-42   
ref|XP_010686779.1|  PREDICTED: uncharacterized protein At1g04910       161   6e-42   
ref|XP_003635616.2|  PREDICTED: uncharacterized protein At1g04910...    155   7e-42   
ref|XP_006830095.1|  hypothetical protein AMTR_s00123p00071440          159   5e-41   
gb|KFK43461.1|  hypothetical protein AALP_AA1G128400                    158   7e-41   
ref|XP_004293322.1|  PREDICTED: uncharacterized protein At1g04910...    158   1e-40   
gb|AAX23739.1|  hypothetical protein At1g11990                          151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010645345.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-39   
ref|XP_010645346.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-39   
ref|XP_009391469.1|  PREDICTED: uncharacterized protein At1g04910...    154   3e-39   
emb|CBI32992.3|  unnamed protein product                                154   4e-39   
ref|XP_010546573.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-38   
ref|XP_002892668.1|  hypothetical protein ARALYDRAFT_471348             150   3e-38   
gb|AAC17628.1|  Contains similarity to axi 1 gene gb|X80301 from ...    150   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172663.2|  O-fucosyltransferase family protein                   150   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227801.1|  PREDICTED: uncharacterized protein At1g04910...    149   7e-38   
ref|XP_010476152.1|  PREDICTED: uncharacterized protein At1g04910...    146   8e-38   
ref|XP_010476150.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37   
ref|XP_002978066.1|  hypothetical protein SELMODRAFT_108165             148   1e-37   
ref|XP_002966670.1|  hypothetical protein SELMODRAFT_85972              147   3e-37   
dbj|BAJ99135.1|  predicted protein                                      146   8e-37   
ref|XP_010476148.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-36   
ref|XP_010476147.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-36   
ref|XP_010458619.1|  PREDICTED: uncharacterized protein At1g04910...    146   1e-36   
ref|XP_010493605.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-36   
ref|XP_010458620.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-36   
ref|XP_010458618.1|  PREDICTED: uncharacterized protein At1g04910...    146   2e-36   
ref|XP_010913450.1|  PREDICTED: uncharacterized protein At1g04910...    145   2e-36   
ref|XP_006306191.1|  hypothetical protein CARUB_v10011821mg             145   3e-36   
ref|XP_010913449.1|  PREDICTED: uncharacterized protein At1g04910...    144   4e-36   
ref|XP_010913448.1|  PREDICTED: uncharacterized protein At1g04910...    145   5e-36   
ref|XP_010913447.1|  PREDICTED: uncharacterized protein At1g04910...    145   7e-36   
ref|NP_001117378.1|  O-fucosyltransferase-like protein                  142   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893554.1|  hypothetical protein ARALYDRAFT_473137             144   8e-36   
ref|NP_174215.2|  O-fucosyltransferase-like protein                     143   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAF88118.1|AC021043_11  Hypothetical protein                         143   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478287.1|  PREDICTED: uncharacterized protein At1g04910...    143   1e-35   
gb|KHG19624.1|  hypothetical protein F383_26440                         137   2e-35   
ref|NP_001117377.1|  O-fucosyltransferase-like protein                  143   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460701.1|  PREDICTED: uncharacterized protein At1g04910...    142   3e-35   
ref|XP_006307011.1|  hypothetical protein CARUB_v10008597mg             142   3e-35   
gb|EPS63261.1|  hypothetical protein M569_11522                         138   4e-35   
ref|XP_001768745.1|  predicted protein                                  141   4e-35   
gb|KDP21114.1|  hypothetical protein JCGZ_21585                         141   5e-35   
emb|CDY15638.1|  BnaA07g08090D                                          141   5e-35   
ref|XP_008443407.1|  PREDICTED: uncharacterized protein At1g04910...    140   6e-35   
ref|XP_009102867.1|  PREDICTED: uncharacterized protein At1g04910       141   6e-35   
gb|EMT23612.1|  hypothetical protein F775_09460                         141   7e-35   
ref|XP_010549414.1|  PREDICTED: uncharacterized protein At1g04910...    140   8e-35   
ref|XP_006415594.1|  hypothetical protein EUTSA_v10007505mg             140   9e-35   
emb|CDY57756.1|  BnaCnng32400D                                          141   9e-35   
ref|XP_011101413.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-34   
ref|XP_011101415.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-34   
ref|XP_001766418.1|  predicted protein                                  139   1e-34   
emb|CDY50783.1|  BnaA09g54120D                                          140   1e-34   
emb|CDX99802.1|  BnaC05g22240D                                          140   1e-34   
ref|XP_008443392.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-34   
ref|XP_008443399.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-34   
ref|XP_004161210.1|  PREDICTED: DUF246 domain-containing protein ...    140   2e-34   
ref|XP_004150223.1|  PREDICTED: DUF246 domain-containing protein ...    140   2e-34   
ref|XP_010549413.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-34   
ref|XP_011101411.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-34   
ref|XP_011101412.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-34   
gb|AAT64033.1|  putative growth regulator                               139   4e-34   Gossypium hirsutum [American cotton]
ref|XP_010246469.1|  PREDICTED: uncharacterized protein At1g04910...    139   5e-34   
ref|XP_010246468.1|  PREDICTED: uncharacterized protein At1g04910...    139   5e-34   
ref|XP_010655536.1|  PREDICTED: uncharacterized protein At1g04910...    138   7e-34   
ref|XP_007025345.1|  O-fucosyltransferase family protein isoform 1      138   9e-34   
gb|ACD56665.1|  putative growth regulator                               138   1e-33   Gossypium arboreum [tree cotton]
gb|AAT64018.1|  putative growth regulator                               138   1e-33   Gossypium hirsutum [American cotton]
gb|KHG23960.1|  hypothetical protein F383_02013                         137   1e-33   
ref|XP_008225312.1|  PREDICTED: uncharacterized protein At1g04910...    137   2e-33   
ref|XP_009115262.1|  PREDICTED: uncharacterized protein At1g04910...    137   2e-33   
ref|XP_010655535.1|  PREDICTED: uncharacterized protein At1g04910...    137   2e-33   
ref|XP_007214626.1|  hypothetical protein PRUPE_ppa002927mg             137   2e-33   
ref|XP_010499443.1|  PREDICTED: uncharacterized protein At1g04910...    137   2e-33   
ref|XP_002522229.1|  conserved hypothetical protein                     137   2e-33   Ricinus communis
gb|KCW75235.1|  hypothetical protein EUGRSUZ_E03988                     131   3e-33   
gb|ACD56651.1|  putative growth regulator                               136   3e-33   Gossypioides kirkii
ref|XP_010103919.1|  hypothetical protein L484_000637                   134   3e-33   
gb|EMS46512.1|  hypothetical protein TRIUR3_15824                       137   3e-33   
ref|XP_011039416.1|  PREDICTED: uncharacterized protein At1g04910...    135   4e-33   
ref|NP_001167713.1|  uncharacterized protein LOC100381401               130   5e-33   Zea mays [maize]
ref|XP_006830245.1|  hypothetical protein AMTR_s00130p00081820          135   5e-33   
ref|NP_001057262.1|  Os06g0239600                                       127   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011039415.1|  PREDICTED: uncharacterized protein At1g04910...    135   8e-33   
ref|XP_004295581.1|  PREDICTED: uncharacterized protein At1g04910...    134   1e-32   
ref|XP_006358125.1|  PREDICTED: uncharacterized protein At1g04910...    134   1e-32   
ref|XP_004485909.1|  PREDICTED: uncharacterized protein At1g04910...    135   1e-32   
ref|XP_011039413.1|  PREDICTED: uncharacterized protein At1g04910...    134   2e-32   
ref|XP_011039411.1|  PREDICTED: uncharacterized protein At1g04910...    134   2e-32   
ref|XP_006467631.1|  PREDICTED: uncharacterized protein At1g04910...    133   2e-32   
ref|XP_006358124.1|  PREDICTED: uncharacterized protein At1g04910...    134   3e-32   
ref|XP_002316818.2|  hypothetical protein POPTR_0011s07160g             134   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006449523.1|  hypothetical protein CICLE_v10014718mg             134   3e-32   
ref|XP_010316827.1|  PREDICTED: uncharacterized protein At1g04910...    134   3e-32   
ref|XP_004233041.1|  PREDICTED: uncharacterized protein At1g04910...    134   3e-32   
gb|KDO77884.1|  hypothetical protein CISIN_1g007320mg                   134   4e-32   
ref|XP_009351445.1|  PREDICTED: uncharacterized protein At1g04910...    134   4e-32   
ref|XP_009351449.1|  PREDICTED: uncharacterized protein At1g04910...    134   4e-32   
ref|XP_002305063.2|  hypothetical protein POPTR_0004s05760g             133   4e-32   Populus trichocarpa [western balsam poplar]
gb|AFW76850.1|  hypothetical protein ZEAMMB73_590923                    130   5e-32   
ref|XP_008371492.1|  PREDICTED: uncharacterized protein At1g04910       133   6e-32   
ref|XP_009799750.1|  PREDICTED: uncharacterized protein At1g04910...    132   6e-32   
gb|KEH36621.1|  GDP-fucose protein O-fucosyltransferase                 133   6e-32   
ref|XP_010100749.1|  hypothetical protein L484_005816                   133   6e-32   
ref|XP_009604296.1|  PREDICTED: uncharacterized protein At1g04910...    133   7e-32   
ref|XP_009604295.1|  PREDICTED: uncharacterized protein At1g04910...    133   8e-32   
ref|XP_009799749.1|  PREDICTED: uncharacterized protein At1g04910...    132   1e-31   
gb|AFW85187.1|  hypothetical protein ZEAMMB73_421614                    129   1e-31   
ref|XP_009799748.1|  PREDICTED: uncharacterized protein At1g04910...    132   1e-31   
ref|XP_007148031.1|  hypothetical protein PHAVU_006G174600g             132   1e-31   
ref|XP_010925619.1|  PREDICTED: uncharacterized protein At1g04910...    132   2e-31   
ref|XP_008799362.1|  PREDICTED: uncharacterized protein At1g04910       131   2e-31   
ref|XP_009383237.1|  PREDICTED: uncharacterized protein At1g04910...    131   3e-31   
ref|XP_004965111.1|  PREDICTED: uncharacterized protein At1g04910...    130   3e-31   
ref|XP_009383238.1|  PREDICTED: uncharacterized protein At1g04910...    131   3e-31   
ref|XP_002436782.1|  hypothetical protein SORBIDRAFT_10g008680          130   3e-31   Sorghum bicolor [broomcorn]
ref|XP_008648012.1|  PREDICTED: uncharacterized protein LOC100381...    130   4e-31   
ref|XP_008659068.1|  PREDICTED: uncharacterized protein At1g04910...    129   8e-31   
ref|XP_009352742.1|  PREDICTED: uncharacterized protein At1g04910...    130   9e-31   
ref|XP_009352745.1|  PREDICTED: uncharacterized protein At1g04910...    130   9e-31   
ref|XP_009352746.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-30   
ref|XP_006594549.1|  PREDICTED: uncharacterized protein At1g04910...    128   3e-30   
gb|ACG28723.1|  growth regulator                                        128   3e-30   Zea mays [maize]
ref|XP_006656834.1|  PREDICTED: uncharacterized protein At1g04910...    127   3e-30   
ref|XP_008349205.1|  PREDICTED: uncharacterized protein At1g04910...    128   4e-30   
ref|XP_008349206.1|  PREDICTED: uncharacterized protein At1g04910...    128   5e-30   
ref|XP_010686224.1|  PREDICTED: uncharacterized protein At1g04910...    126   8e-30   
ref|XP_010227672.1|  PREDICTED: uncharacterized protein At1g04910       126   9e-30   
ref|NP_001132314.1|  growth regulator                                   126   2e-29   Zea mays [maize]
ref|XP_010686223.1|  PREDICTED: uncharacterized protein At1g04910...    126   2e-29   
gb|EMT12043.1|  hypothetical protein F775_07612                         125   3e-29   
ref|XP_010057121.1|  PREDICTED: uncharacterized protein At1g04910...    124   3e-29   
ref|XP_002489034.1|  hypothetical protein SORBIDRAFT_0344s002010        125   3e-29   Sorghum bicolor [broomcorn]
dbj|BAJ93371.1|  predicted protein                                      124   7e-29   
ref|XP_010057120.1|  PREDICTED: uncharacterized protein At1g04910...    124   9e-29   
ref|XP_004965564.1|  PREDICTED: uncharacterized protein At1g04910...    122   2e-28   
gb|KHN28621.1|  DUF246 domain-containing protein                        122   3e-28   
ref|XP_006597482.1|  PREDICTED: uncharacterized protein At1g04910...    122   3e-28   
ref|XP_004965563.1|  PREDICTED: uncharacterized protein At1g04910...    122   4e-28   
ref|XP_004965562.1|  PREDICTED: uncharacterized protein At1g04910...    122   4e-28   
ref|XP_004965561.1|  PREDICTED: uncharacterized protein At1g04910...    122   4e-28   
gb|AEW07749.1|  hypothetical protein 0_10509_02                         108   3e-26   
gb|AFG68130.1|  hypothetical protein 0_10509_02                         106   2e-25   
ref|NP_001057817.1|  Os06g0545900                                       113   6e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80777.1|  hypothetical protein OsI_23300                          113   6e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006657039.1|  PREDICTED: uncharacterized protein At1g04910...    111   5e-24   
emb|CDO96817.1|  unnamed protein product                                106   2e-22   
gb|AFW85188.1|  hypothetical protein ZEAMMB73_421614                  88.2    4e-16   
dbj|BAD37877.1|  putative auxin-independent growth promoter           85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE65417.1|  hypothetical protein OsJ_20764                        85.5    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80302.1|  hypothetical protein OsI_22331                        85.5    3e-15   Oryza sativa Indica Group [Indian rice]
gb|EPS68582.1|  hypothetical protein M569_06186                       65.9    3e-10   
emb|CDY28009.1|  BnaC05g44110D                                        68.2    9e-10   
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    1e-09   
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    1e-09   
gb|KHN47089.1|  DUF246 domain-containing protein                      67.8    1e-09   
ref|XP_009147015.1|  PREDICTED: uncharacterized protein At1g04910     67.4    2e-09   
emb|CDY35972.1|  BnaA05g29780D                                        67.4    2e-09   
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g           67.0    2e-09   
emb|CDP10650.1|  unnamed protein product                              66.2    4e-09   
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    4e-09   
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    4e-09   
gb|AFK46212.1|  unknown                                               65.5    5e-09   
ref|XP_003598018.1|  DUF246 domain-containing protein                 65.5    8e-09   
ref|XP_010104478.1|  hypothetical protein L484_025447                 63.2    2e-08   
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    2e-08   
gb|AAL16192.1|AF428423_1  AT3g07900/F17A17_24                         63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    2e-08   
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              63.9    2e-08   
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     63.9    2e-08   
ref|NP_187447.1|  O-fucosyltransferase-like protein                   63.2    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     63.2    4e-08   
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           63.2    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    5e-08   
ref|XP_006407782.1|  hypothetical protein EUTSA_v10022290mg           62.8    6e-08   
ref|XP_009407812.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    7e-08   
ref|XP_002882556.1|  hypothetical protein ARALYDRAFT_478129           62.4    8e-08   
ref|XP_004161417.1|  PREDICTED: DUF246 domain-containing protein ...  62.4    8e-08   
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    8e-08   
gb|KGN58618.1|  hypothetical protein Csa_3G702070                     62.4    8e-08   
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           62.4    8e-08   
gb|KDP36824.1|  hypothetical protein JCGZ_08115                       62.4    9e-08   
ref|XP_008461772.1|  PREDICTED: uncharacterized protein At1g04910     62.4    9e-08   
ref|XP_004149620.1|  PREDICTED: DUF246 domain-containing protein ...  62.0    1e-07   
ref|XP_011041258.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   
ref|XP_002307782.1|  hypothetical protein POPTR_0005s27130g           62.0    1e-07   Populus trichocarpa [western balsam poplar]
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  62.0    1e-07   
gb|KDP34835.1|  hypothetical protein JCGZ_11197                       62.0    1e-07   
emb|CDX84250.1|  BnaC04g10120D                                        58.5    1e-07   
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   
ref|XP_010486367.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    1e-07   
ref|XP_006652611.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   
ref|XP_007142562.1|  hypothetical protein PHAVU_008G291300g           61.6    1e-07   
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   
ref|XP_002300651.1|  hypothetical protein POPTR_0002s01230g           61.6    1e-07   
ref|XP_011034893.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    2e-07   
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    2e-07   
ref|XP_010093364.1|  hypothetical protein L484_022926                 61.2    2e-07   
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    2e-07   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           61.2    2e-07   
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg              61.2    2e-07   
ref|XP_008349183.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    2e-07   
ref|XP_008383543.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    2e-07   
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    3e-07   
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910     60.5    3e-07   
gb|KHG28222.1|  hypothetical protein F383_11890                       60.5    3e-07   
emb|CDY03127.1|  BnaC06g08460D                                        60.5    3e-07   
emb|CDY66921.1|  BnaAnng23210D                                        60.5    4e-07   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    60.5    4e-07   
ref|XP_009345471.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    4e-07   
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     60.5    4e-07   
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    4e-07   
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910     60.1    4e-07   
gb|EPS61269.1|  hypothetical protein M569_13528                       58.2    4e-07   
ref|XP_010061151.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    4e-07   
gb|AAK93632.1|  putative growth regulator protein                     60.1    4e-07   
ref|NP_564461.1|  O-fucosyltransferase-like protein                   60.1    4e-07   
ref|XP_010061150.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    4e-07   
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           60.1    4e-07   
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910     60.1    4e-07   
gb|KFK38242.1|  hypothetical protein AALP_AA3G087900                  60.1    4e-07   
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    5e-07   
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    5e-07   
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...  60.1    5e-07   
ref|XP_002510658.1|  conserved hypothetical protein                   60.1    5e-07   
gb|KHG09805.1|  hypothetical protein F383_15167                       60.1    5e-07   
gb|KEH30846.1|  O-fucosyltransferase family protein                   60.1    5e-07   
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           60.1    5e-07   
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    5e-07   
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    5e-07   
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    5e-07   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg           60.1    6e-07   
gb|KHG19963.1|  hypothetical protein F383_04918                       59.7    6e-07   
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg           59.7    6e-07   
ref|XP_010459424.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
gb|AAF79365.1|AC007887_24  F15O4.45                                   59.7    6e-07   
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    6e-07   
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    7e-07   
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    7e-07   
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                  59.7    7e-07   
ref|XP_010110838.1|  hypothetical protein L484_011821                 59.7    7e-07   
ref|XP_010664086.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    7e-07   
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    8e-07   
ref|XP_002284838.2|  PREDICTED: uncharacterized protein At1g04910...  59.7    8e-07   
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g           59.7    8e-07   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_009344792.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_006299231.1|  hypothetical protein CARUB_v10015380mg           59.3    8e-07   
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910     59.3    8e-07   
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    8e-07   
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    9e-07   
ref|XP_011087180.1|  PREDICTED: uncharacterized protein At1g04910     59.3    9e-07   
ref|XP_001760728.1|  predicted protein                                59.3    9e-07   
ref|XP_010677047.1|  PREDICTED: uncharacterized protein At1g04910     59.3    1e-06   
ref|XP_002533585.1|  conserved hypothetical protein                   59.3    1e-06   
gb|KHG05439.1|  hypothetical protein F383_31655                       58.9    1e-06   
ref|XP_007018000.1|  O-fucosyltransferase family protein              58.9    1e-06   
ref|XP_008645342.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_007045152.1|  O-fucosyltransferase family protein              58.9    1e-06   
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    1e-06   
ref|XP_010464437.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    1e-06   
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    1e-06   
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    1e-06   
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    1e-06   
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910     58.5    1e-06   
tpg|DAA59674.1|  TPA: hypothetical protein ZEAMMB73_298098            56.6    1e-06   
gb|EYU31341.1|  hypothetical protein MIMGU_mgv1a006110mg              58.5    1e-06   
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910     58.5    2e-06   
gb|KDP39880.1|  hypothetical protein JCGZ_03411                       58.5    2e-06   
ref|XP_009344152.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    2e-06   
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910     58.5    2e-06   
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    2e-06   
ref|XP_010498487.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    2e-06   
ref|XP_010477297.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    2e-06   
ref|XP_008221149.1|  PREDICTED: uncharacterized protein At1g04910     58.5    2e-06   
ref|XP_010666088.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    2e-06   
ref|XP_010459738.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910     58.2    2e-06   
gb|KHN08072.1|  DUF246 domain-containing protein                      58.2    2e-06   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450        58.2    2e-06   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_001753764.1|  predicted protein                                58.2    2e-06   
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                  58.2    2e-06   
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g           58.2    2e-06   
emb|CDY67173.1|  BnaUnng01980D                                        54.7    2e-06   
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g           58.2    2e-06   
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_010327510.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_008674839.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910     58.2    3e-06   
ref|XP_009389009.1|  PREDICTED: uncharacterized protein At1g04910     57.8    3e-06   
emb|CDP07301.1|  unnamed protein product                              57.8    3e-06   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_003618102.1|  Auxin-independent growth promoter                57.8    3e-06   
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560        57.8    3e-06   
ref|XP_010547235.1|  PREDICTED: uncharacterized protein At1g04910     57.8    3e-06   
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_009413170.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_010673474.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_009786248.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_001753325.1|  predicted protein                                57.8    3e-06   
ref|XP_008368503.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg           57.8    3e-06   
ref|XP_009373425.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     57.8    3e-06   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    3e-06   
ref|XP_008353543.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_002526030.1|  conserved hypothetical protein                   57.4    3e-06   
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     57.4    4e-06   
gb|EYU40470.1|  hypothetical protein MIMGU_mgv1a018303mg              57.4    4e-06   
gb|EYU42230.1|  hypothetical protein MIMGU_mgv1a025229mg              57.4    4e-06   
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685           57.4    4e-06   
emb|CBI18521.3|  unnamed protein product                              57.4    4e-06   
ref|XP_011088688.1|  PREDICTED: uncharacterized protein At1g04910     57.4    4e-06   
gb|KDO68280.1|  hypothetical protein CISIN_1g018623mg                 57.0    4e-06   
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190        57.4    4e-06   
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    4e-06   
ref|XP_011093377.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    4e-06   
ref|XP_004248822.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
dbj|BAD81763.1|  putative auxin-independent growth promoter           56.6    5e-06   
ref|XP_004249701.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     57.0    5e-06   
gb|KCW64186.1|  hypothetical protein EUGRSUZ_G01835                   57.0    5e-06   
ref|XP_010066322.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
gb|KHN43011.1|  DUF246 domain-containing protein                      57.0    5e-06   
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     57.0    5e-06   
gb|EEE55649.1|  hypothetical protein OsJ_04031                        57.0    5e-06   
ref|XP_010242865.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
ref|XP_010242866.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    5e-06   
gb|KHG05427.1|  hypothetical protein F383_01689                       57.0    5e-06   
ref|XP_002889072.1|  hypothetical protein ARALYDRAFT_476779           57.0    6e-06   
ref|XP_009602405.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    6e-06   
gb|EEC71770.1|  hypothetical protein OsI_04380                        56.6    6e-06   
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                  57.0    6e-06   
ref|XP_008655749.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    6e-06   
ref|NP_001044765.1|  Os01g0841200                                     56.6    6e-06   
gb|EMS52898.1|  hypothetical protein TRIUR3_23011                     57.0    6e-06   
gb|EMT14891.1|  hypothetical protein F775_28466                       56.6    6e-06   
ref|XP_006435336.1|  hypothetical protein CICLE_v10000708mg           56.6    6e-06   
ref|XP_006365316.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    6e-06   
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    6e-06   
ref|XP_007136010.1|  hypothetical protein PHAVU_009G010300g           56.6    6e-06   
ref|XP_006435337.1|  hypothetical protein CICLE_v10000708mg           56.6    6e-06   
ref|XP_006422463.1|  hypothetical protein CICLE_v10028129mg           56.6    7e-06   
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg           56.6    7e-06   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  56.6    7e-06   
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    7e-06   
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    7e-06   
ref|XP_008796107.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    7e-06   
ref|XP_006486629.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    7e-06   
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    7e-06   
ref|XP_010692819.1|  PREDICTED: uncharacterized protein At1g04910     56.6    7e-06   
gb|EYU17502.1|  hypothetical protein MIMGU_mgv1a003569mg              56.6    7e-06   
ref|XP_007041650.1|  O-fucosyltransferase family protein              56.6    8e-06   
ref|XP_007039815.1|  O-fucosyltransferase family protein isoform 2    56.6    8e-06   
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890        56.6    8e-06   
ref|XP_010918225.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    8e-06   
ref|XP_008235937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    8e-06   
ref|XP_007039814.1|  O-fucosyltransferase family protein isoform 1    56.6    8e-06   
ref|XP_011045156.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    8e-06   
ref|XP_009591037.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    9e-06   
ref|XP_009768450.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    9e-06   
gb|AFW80351.1|  hypothetical protein ZEAMMB73_842533                  56.2    9e-06   
ref|XP_010419220.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    9e-06   
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    9e-06   
gb|AAF79229.1|AC006917_14  F10B6.36                                   56.2    9e-06   
ref|XP_010325489.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    9e-06   
ref|XP_002312912.2|  hypothetical protein POPTR_0009s14510g           56.2    9e-06   
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812           56.6    9e-06   
ref|XP_002306226.1|  hypothetical protein POPTR_0004s19390g           56.2    9e-06   
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                  56.2    1e-05   
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_009390143.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
emb|CDX81687.1|  BnaC08g39140D                                        56.2    1e-05   
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                 56.2    1e-05   
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
emb|CDY36519.1|  BnaA06g09720D                                        56.2    1e-05   
ref|XP_004491638.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_009793733.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg           56.2    1e-05   
gb|EPS60639.1|  hypothetical protein M569_14161                       56.2    1e-05   
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_006341331.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910     56.2    1e-05   
ref|XP_006390216.1|  hypothetical protein EUTSA_v10018355mg           56.2    1e-05   
ref|NP_178257.1|  O-fucosyltransferase family protein                 56.2    1e-05   
ref|NP_001183075.1|  hypothetical protein                             55.5    1e-05   
ref|XP_011046290.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_011046291.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   
emb|CDY33727.1|  BnaA09g45330D                                        56.2    1e-05   
ref|XP_006355513.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    1e-05   



>emb|CDP04443.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQFSSL+SGYR+YYG G+MPTIRPNKRRLADIF KNNTIEW V
Sbjct  170  DFITCTAADNFAMTDSGSQFSSLVSGYRIYYGGGEMPTIRPNKRRLADIFVKNNTIEWSV  229

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ KRVF+RP GRSVYRYPRC ECMC++
Sbjct  230  FEKRVRKAVRQTKRVFSRPTGRSVYRYPRCLECMCSD  266



>ref|XP_011095999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=500

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQFSSLI+GYR+YYG GKMPTIRPNKRRLADIF KNNTIEWKV
Sbjct  403  DFIVCTAADAFAMTDSGSQFSSLIAGYRIYYGGGKMPTIRPNKRRLADIFLKNNTIEWKV  462

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RVRKAVRQNKRVF+RPVGRSVYRYPRC +CMC++
Sbjct  463  FETRVRKAVRQNKRVFSRPVGRSVYRYPRCRDCMCSS  499



>ref|XP_011095998.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=642

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQFSSLI+GYR+YYG GKMPTIRPNKRRLADIF KNNTIEWKV
Sbjct  545  DFIVCTAADAFAMTDSGSQFSSLIAGYRIYYGGGKMPTIRPNKRRLADIFLKNNTIEWKV  604

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RVRKAVRQNKRVF+RPVGRSVYRYPRC +CMC++
Sbjct  605  FETRVRKAVRQNKRVFSRPVGRSVYRYPRCRDCMCSS  641



>ref|XP_009777767.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=609

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVCSA+DVFAMTDSGSQFSSLISG+RVYYG GKM TIRPNKRRLADIF KNNTI+W+ 
Sbjct  513  DFIVCSAADVFAMTDSGSQFSSLISGFRVYYGGGKMATIRPNKRRLADIFVKNNTIDWRT  572

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRKAVRQ KRVF+RPVGRSVYRYPRC ECMCN 
Sbjct  573  FEQRVRKAVRQTKRVFSRPVGRSVYRYPRCKECMCNT  609



>ref|XP_009613681.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=609

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVCSA+DVFAMTDSGSQFSSLISG+RVYYG GKM TIRPNKRRLADIF KNNTI+W+ 
Sbjct  513  DFIVCSAADVFAMTDSGSQFSSLISGFRVYYGGGKMATIRPNKRRLADIFVKNNTIDWRT  572

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRKAVRQ KRVF+RPVGRSVYRYPRC ECMCN 
Sbjct  573  FEQRVRKAVRQTKRVFSRPVGRSVYRYPRCKECMCNT  609



>gb|EYU27727.1| hypothetical protein MIMGU_mgv1a002727mg [Erythranthe guttata]
Length=643

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+DVFAMTDSGSQFSSL++GYR+YYG GKM TIRPNKRRLADIF +NNTIEWKV
Sbjct  546  DFIVCTAADVFAMTDSGSQFSSLVAGYRIYYGGGKMATIRPNKRRLADIFERNNTIEWKV  605

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RVRKAVRQNKRVF+RP+GRSVYRYPRC +CMC N
Sbjct  606  FETRVRKAVRQNKRVFSRPIGRSVYRYPRCRDCMCYN  642



>ref|XP_006348159.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=555

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+DVFAMTDSGSQFSSL+SG+RVY+G GKM TIRPNKRRLADIF KNNTI+W+ 
Sbjct  459  DFIVCTAADVFAMTDSGSQFSSLVSGFRVYFGGGKMATIRPNKRRLADIFVKNNTIDWRT  518

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRKAVRQ KRVF+RPVGRSVYRYPRC ECMCN 
Sbjct  519  FEQRVRKAVRQTKRVFSRPVGRSVYRYPRCKECMCNT  555



>ref|XP_004232682.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=611

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+DVFAMTDSGSQFSSL+SG+RVY+G GKM TIRPNKRRLADIF KNNTI+W+ 
Sbjct  515  DFIVCTAADVFAMTDSGSQFSSLVSGFRVYFGGGKMATIRPNKRRLADIFVKNNTIDWRT  574

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRKAVRQ KRVF+RPVGRSVYRYPRC ECMCN 
Sbjct  575  FEQRVRKAVRQTKRVFSRPVGRSVYRYPRCKECMCNT  611



>ref|XP_010553452.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=643

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRL+DIFFKNNTIEWKV
Sbjct  544  DFIGCAAADAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLSDIFFKNNTIEWKV  603

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE+RVRKA+RQ K VF RP GRSVYRYPRC ECMCN  +
Sbjct  604  FEQRVRKAIRQTKHVFARPKGRSVYRYPRCKECMCNTIQ  642



>gb|EPS69385.1| hypothetical protein M569_05376, partial [Genlisea aurea]
Length=568

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIV +ASD FA+TD GSQFSSL++GYR+YYG GKMPTIRPNKRRL+DIF KN+TIEW+V
Sbjct  471  DFIVSTASDAFAITDPGSQFSSLVAGYRIYYGGGKMPTIRPNKRRLSDIFAKNDTIEWRV  530

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FEKRVRKAVRQNKRVF+RP+GRSVYRYPRC ECMC
Sbjct  531  FEKRVRKAVRQNKRVFSRPLGRSVYRYPRCKECMC  565



>ref|XP_010057887.1| PREDICTED: uncharacterized protein At1g04910-like [Eucalyptus 
grandis]
 gb|KCW75238.1| hypothetical protein EUGRSUZ_E03991 [Eucalyptus grandis]
Length=641

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLADIF KNNTIEW+V
Sbjct  544  DFIVCTAADAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLADIFTKNNTIEWRV  603

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRPV RS+YRYPRC+ECMC
Sbjct  604  FEQRVRKAVRQTKHVQTRPVARSIYRYPRCNECMC  638



>ref|XP_002304905.2| hypothetical protein POPTR_0004s00690g [Populus trichocarpa]
 gb|EEE85416.2| hypothetical protein POPTR_0004s00690g [Populus trichocarpa]
Length=575

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLADIF KNNTIEWK+
Sbjct  478  DFIACTASDAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLADIFMKNNTIEWKI  537

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K VF RP  RSVYRYPRC ECMC
Sbjct  538  FEQRVRKAVRQTKHVFERPKARSVYRYPRCKECMC  572



>ref|XP_011046990.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=585

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLADIF KNNTIEWK+
Sbjct  488  DFIACTASDAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLADIFMKNNTIEWKL  547

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K VF RP  RSVYRYPRC ECMC
Sbjct  548  FEQRVRKAVRQTKHVFERPKARSVYRYPRCKECMC  582



>ref|XP_006300315.1| hypothetical protein CARUB_v10019899mg, partial [Capsella rubella]
 gb|EOA33213.1| hypothetical protein CARUB_v10019899mg, partial [Capsella rubella]
Length=682

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  585  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  644

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  645  FEQRVRKTVRQTKHVLVRPTGRSVYRYPRCKECMCN  680



>ref|NP_176423.3| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE33954.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=652

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  555  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  614

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  615  FEQRVRKTVRQTKHVLVRPTGRSVYRYPRCKECMCN  650



>dbj|BAD44565.1| unnamed protein product [Arabidopsis thaliana]
Length=652

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  555  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  614

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  615  FEQRVRKTVRQTKHVLVRPTGRSVYRYPRCKECMCN  650



>ref|XP_002888034.1| hypothetical protein ARALYDRAFT_475111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64293.1| hypothetical protein ARALYDRAFT_475111 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  553  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  612

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  613  FEQRVRKTVRQTKHVLVRPTGRSVYRYPRCKECMCN  648



>emb|CDY12942.1| BnaA09g13320D [Brassica napus]
Length=651

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  554  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  613

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN 
Sbjct  614  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCNE  650



>ref|XP_010473452.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=650

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  553  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  612

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  613  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCN  648



>ref|XP_010430282.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=655

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  558  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  617

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  618  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCN  653



>ref|XP_009113085.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=651

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  554  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  613

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  614  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCN  649



>ref|XP_010418221.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=658

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  561  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  620

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  621  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCN  656



>emb|CDY19543.1| BnaC09g13600D [Brassica napus]
Length=651

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  554  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  613

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  614  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMCN  649



>gb|AAF70834.1|AC003113_1 F24O1.5 [Arabidopsis thaliana]
Length=683

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  586  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGAGKMPTIRPNKRRFSDILLKNNTIEWKV  645

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMCN
Sbjct  646  FEQRVRKTVRQTKHVLVRPTGRSVYRYPRCKECMCN  681



>ref|XP_007026176.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY28798.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=426

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KNNTIEWKV
Sbjct  329  DFIACTAADAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLAAIFMKNNTIEWKV  388

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V +RP  RSVYRYPRC ECMC
Sbjct  389  FEQRVRKAVRQTKHVQSRPKARSVYRYPRCKECMC  423



>ref|XP_009148624.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=620

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KNNTI W V
Sbjct  523  DFIGCAAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILLKNNTIAWNV  582

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKA+RQ K VF RP GRSVYRYPRC ECMCN+
Sbjct  583  FEKRVRKAIRQTKHVFARPTGRSVYRYPRCKECMCND  619



>emb|CDY30045.1| BnaC05g09750D [Brassica napus]
Length=595

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KNNTI W V
Sbjct  498  DFIGCAAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILLKNNTIAWNV  557

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKA+RQ K VF RP GRSVYRYPRC ECMCN+
Sbjct  558  FEKRVRKAIRQTKHVFARPTGRSVYRYPRCKECMCND  594



>emb|CDX98087.1| BnaA06g08380D [Brassica napus]
Length=683

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KNNTI W V
Sbjct  586  DFIGCAAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILLKNNTIAWNV  645

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKA+RQ K VF RP GRSVYRYPRC ECMCN+
Sbjct  646  FEKRVRKAIRQTKHVFARPTGRSVYRYPRCKECMCND  682



>ref|XP_010252508.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=686

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLADIF KNNTIEWKV
Sbjct  588  DFISCAAADAFSMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLADIFLKNNTIEWKV  647

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTEV  347
            FEKRVRKAVRQ K+   RPV RS+YR+PRC +CMC NTE+
Sbjct  648  FEKRVRKAVRQTKQAHERPVARSIYRHPRCRQCMC-NTEI  686



>ref|XP_010252507.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=691

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLADIF KNNTIEWKV
Sbjct  593  DFISCAAADAFSMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLADIFLKNNTIEWKV  652

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTEV  347
            FEKRVRKAVRQ K+   RPV RS+YR+PRC +CMC NTE+
Sbjct  653  FEKRVRKAVRQTKQAHERPVARSIYRHPRCRQCMC-NTEI  691



>ref|XP_008458995.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Cucumis 
melo]
Length=436

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  339  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  398

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  399  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  433



>ref|XP_002316562.2| hypothetical protein POPTR_0011s01550g [Populus trichocarpa]
 gb|EEE97174.2| hypothetical protein POPTR_0011s01550g [Populus trichocarpa]
Length=585

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLADIF KNN+IEWK+
Sbjct  488  DFIACTASDAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLADIFRKNNSIEWKI  547

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V  RP  RSVYRYPRC ECMC
Sbjct  548  FEQRVRKAVRQTKHVLQRPKARSVYRYPRCKECMC  582



>ref|XP_011002566.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=585

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLADIF KNN+IEWK+
Sbjct  488  DFIACTASDAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLADIFRKNNSIEWKI  547

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V  RP  RSVYRYPRC ECMC
Sbjct  548  FEQRVRKAVRQTKHVLQRPKARSVYRYPRCKECMC  582



>ref|XP_006391902.1| hypothetical protein EUTSA_v10023332mg [Eutrema salsugineum]
 gb|ESQ29188.1| hypothetical protein EUTSA_v10023332mg [Eutrema salsugineum]
Length=655

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  558  DFIACAASDAFAMTDSGSQLSSLVSGYRIYYGTGKMPTIRPNKRRFSDILLKNNTIEWKV  617

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMC
Sbjct  618  FEQRVRKNVRQTKHVLVRPTGRSVYRYPRCKECMC  652



>gb|KHG30772.1| hypothetical protein F383_15375 [Gossypium arboreum]
Length=639

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLADIF KNNTIEWKV
Sbjct  542  DFIACTAADAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLADIFVKNNTIEWKV  601

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V +RP  RSV+RYPRC ECMC
Sbjct  602  FEQRVRKAVRQTKHVQSRPKARSVFRYPRCKECMC  636



>ref|XP_002518425.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43812.1| conserved hypothetical protein [Ricinus communis]
Length=642

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL++GYR YYG G+MPTIRPNKRRLA IF KNNTIEWKV
Sbjct  545  DFIACTAADAFAMTDSGSQLSSLVAGYRTYYGGGQMPTIRPNKRRLAAIFTKNNTIEWKV  604

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K VF RPV RSVYR+PRC ECMC
Sbjct  605  FEQRVRKAVRQTKHVFERPVARSVYRFPRCKECMC  639



>gb|KFK40606.1| hypothetical protein AALP_AA2G017600 [Arabis alpina]
Length=649

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+Y+G GKMPTIRPNKRR +DI  KNNTIEWKV
Sbjct  552  DFIACAASDAFAMTDSGSQLSSLVSGYRIYFGAGKMPTIRPNKRRFSDILLKNNTIEWKV  611

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRK VRQ K V  RP GRSVYRYPRC ECMC+ 
Sbjct  612  FEQRVRKNVRQTKHVLVRPPGRSVYRYPRCKECMCSE  648



>ref|XP_006449803.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63043.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=419

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  322  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  381

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  382  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  416



>ref|XP_007026175.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28797.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=639

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KNNTIEWKV
Sbjct  542  DFIACTAADAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLAAIFMKNNTIEWKV  601

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V +RP  RSVYRYPRC ECMC
Sbjct  602  FEQRVRKAVRQTKHVQSRPKARSVYRYPRCKECMC  636



>ref|XP_006449800.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 ref|XP_006449804.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63040.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63044.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=445

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  348  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  407

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  408  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  442



>ref|XP_006417280.1| hypothetical protein EUTSA_v10007119mg [Eutrema salsugineum]
 gb|ESQ35633.1| hypothetical protein EUTSA_v10007119mg [Eutrema salsugineum]
Length=607

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN TI W V
Sbjct  511  DFIGCAAANAFAMTDSGSQLSSLVSGYRIYYGEGKMPTIRPNKRRLSDILLKNKTIGWNV  570

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRKA+RQ K VF RP GRSVYRYPRC ECMCN
Sbjct  571  FEQRVRKAIRQTKHVFARPTGRSVYRYPRCKECMCN  606



>gb|KDP20702.1| hypothetical protein JCGZ_21173 [Jatropha curcas]
Length=639

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL++GYR YYG G+MPTIRPNKRRLA IF KN+TIEWKV
Sbjct  542  DFIACTASDAFAMTDSGSQLSSLVAGYRTYYGGGRMPTIRPNKRRLAAIFTKNSTIEWKV  601

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K VF RPV RSVYR+PRC ECMC
Sbjct  602  FEQRVRKAVRQTKHVFERPVARSVYRFPRCKECMC  636



>ref|XP_004164352.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=672

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  575  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  634

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  635  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  669



>ref|XP_004145470.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=672

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  575  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  634

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  635  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  669



>gb|KGN66851.1| hypothetical protein Csa_1G701270 [Cucumis sativus]
Length=674

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  577  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  636

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  637  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  671



>ref|XP_008458993.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Cucumis 
melo]
Length=674

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  577  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  636

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  637  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  671



>gb|KHN35713.1| DUF246 domain-containing protein [Glycine soja]
Length=524

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  427  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  486

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  487  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKECMC  521



>ref|XP_008458994.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Cucumis 
melo]
Length=671

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF +NNTIEW++
Sbjct  574  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFSRNNTIEWRI  633

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  634  FEIRVRKAVRQTKHVLTRPRGRSVYRYPRCKECMC  668



>ref|XP_008798044.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Phoenix dactylifera]
Length=489

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK 
Sbjct  392  DFIVCAAADAFAMTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKE  451

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKA+RQ K+VF RP+ RSVYR+PRC ECMC
Sbjct  452  FERRVRKAIRQTKQVFERPIARSVYRHPRCSECMC  486



>ref|XP_006449801.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63041.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=475

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  378  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  437

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  438  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  472



>ref|XP_004507663.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=604

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+I C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW++
Sbjct  507  DYIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRI  566

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+R+RKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  567  FEQRMRKAVRQTKHVLTRPKGRSVYRYPRCKECMC  601



>ref|XP_006449796.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63036.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=477

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  380  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  439

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  440  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  474



>ref|XP_004507662.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=605

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+I C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW++
Sbjct  508  DYIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRI  567

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+R+RKAVRQ K V TRP GRSVYRYPRC ECMC
Sbjct  568  FEQRMRKAVRQTKHVLTRPKGRSVYRYPRCKECMC  602



>gb|KDO78360.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
 gb|KDO78361.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
 gb|KDO78362.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=362

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  265  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  324

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  325  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  359



>ref|XP_006584088.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=524

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  427  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  486

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  487  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKECMC  521



>gb|KHN03501.1| DUF246 domain-containing protein [Glycine soja]
Length=579

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  482  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  541

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  542  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKECMC  576



>ref|XP_003550479.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=579

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  482  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  541

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  542  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKECMC  576



>gb|KEH32648.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=495

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  398  DFIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  457

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+R+RKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  458  FEQRMRKAVRQTKHVQTRPKARSVYRYPRCKECMC  492



>ref|XP_006449797.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 ref|XP_006449799.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63037.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63039.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=495

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  398  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  457

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  458  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  492



>ref|XP_003528699.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=583

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  486  DFIGCTASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  545

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  546  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKECMC  580



>ref|XP_010244143.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010244144.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=478

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+Y+G G+MPTIRPNKRRLA+IF KN+TIEWK+
Sbjct  381  DFIACAAADAFSMTDSGSQLSSLVSGYRIYFGDGRMPTIRPNKRRLANIFLKNSTIEWKM  440

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FEKRVRKAV+Q K+   RPV RSVYR+PRC ECMC
Sbjct  441  FEKRVRKAVKQTKQAHERPVARSVYRHPRCKECMC  475



>ref|XP_006449798.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63038.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=604

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  507  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  566

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  567  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  601



>ref|XP_006449802.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
 gb|ESR63042.1| hypothetical protein CICLE_v10014653mg [Citrus clementina]
Length=602

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  505  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  564

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +RP GRSVYRYPRC ECMC
Sbjct  565  FEQRVRKAVRQTKHIQSRPKGRSVYRYPRCKECMC  599



>gb|KDO78358.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
 gb|KDO78359.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=419

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  322  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  381

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  382  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  416



>ref|XP_008798042.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Phoenix dactylifera]
Length=682

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK 
Sbjct  585  DFIVCAAADAFAMTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKE  644

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKA+RQ K+VF RP+ RSVYR+PRC ECMC
Sbjct  645  FERRVRKAIRQTKQVFERPIARSVYRHPRCSECMC  679



>ref|XP_008224713.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=652

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  552  DFIGCTAADAFSMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  611

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNT  353
            FE+R+RKAVRQ K V  RP  RSVYRYPRC ECMCN T
Sbjct  612  FEQRIRKAVRQTKHVQPRPKARSVYRYPRCDECMCNMT  649



>gb|AES92670.2| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=594

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  497  DFIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  556

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+R+RKAVRQ K V TRP  RSVYRYPRC ECMC
Sbjct  557  FEQRMRKAVRQTKHVQTRPKARSVYRYPRCKECMC  591



>ref|XP_008384256.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=633

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLA IF KN+TIEW+V
Sbjct  533  DFIGCTAADAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLASIFMKNSTIEWRV  592

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNT  353
            FE+R+RKAVRQ K +  RP  RS+YRYPRC ECMCN T
Sbjct  593  FEQRIRKAVRQTKHIQPRPKARSMYRYPRCDECMCNMT  630



>ref|XP_007153988.1| hypothetical protein PHAVU_003G081600g [Phaseolus vulgaris]
 gb|ESW25982.1| hypothetical protein PHAVU_003G081600g [Phaseolus vulgaris]
Length=593

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI CSASD FAMTDSGSQ SSL+SG+R+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  496  DFIGCSASDAFAMTDSGSQLSSLVSGFRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  555

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K V TRP  RSVYRYPRC +CMC
Sbjct  556  FEQRVRKAVRQTKHVQTRPKARSVYRYPRCKDCMC  590



>gb|KDO78357.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=445

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  348  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  407

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  408  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  442



>ref|XP_009357489.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=648

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SG+R+YYG GKMPTIRPNKRRLA IF KN+TIEW+V
Sbjct  548  DFIGCTAADAFAMTDSGSQLSSLVSGFRIYYGGGKMPTIRPNKRRLASIFMKNSTIEWRV  607

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNT  353
            FE+R+RKAVRQ K +  RP  RS+YRYPRC ECMCN T
Sbjct  608  FEQRIRKAVRQTKHIQPRPRARSMYRYPRCDECMCNMT  645



>ref|XP_007214654.1| hypothetical protein PRUPE_ppa002626mg [Prunus persica]
 gb|EMJ15853.1| hypothetical protein PRUPE_ppa002626mg [Prunus persica]
Length=650

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  550  DFIGCTAADAFSMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  609

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNT  353
            FE+R+RKAVRQ K V  RP  RS+YRYPRC ECMCN T
Sbjct  610  FEQRIRKAVRQTKHVQPRPKARSMYRYPRCDECMCNMT  647



>gb|KDO78356.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=475

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  378  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  437

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  438  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  472



>ref|XP_010099160.1| hypothetical protein L484_014158 [Morus notabilis]
 gb|EXB77032.1| hypothetical protein L484_014158 [Morus notabilis]
Length=551

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGSQ SSL+SG+RVYYG G MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  454  DFIGCTAADAFAMTDSGSQLSSLVSGFRVYYGGGNMPTIRPNKRRLASIFMKNSTIEWRV  513

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKA+RQ K V TRP  RSVYRYPRC ECMC
Sbjct  514  FEQRVRKAIRQTKHVRTRPKARSVYRYPRCKECMC  548



>gb|KDO78355.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  380  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  439

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  440  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  474



>emb|CBI14835.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FA+TDSGSQ SSL+SGYR+YYG G++PT+RPNKRRLA IF KN+TIEW +
Sbjct  123  DFIGCTAADAFAITDSGSQLSSLVSGYRIYYGGGRLPTVRPNKRRLASIFLKNSTIEWSM  182

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ K +  R + RSVYR PRC ECMC  
Sbjct  183  FEKRVRKAVRQTKTIHRRSISRSVYRNPRCRECMCTT  219



>ref|XP_003619270.1| DUF246 domain-containing protein [Medicago truncatula]
Length=586

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  463  DFIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  522

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECM  365
            FE+R+RKAVRQ K V TRP  RSVYRYPRC ECM
Sbjct  523  FEQRMRKAVRQTKHVQTRPKARSVYRYPRCKECM  556



>ref|XP_010244142.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=655

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+Y+G G+MPTIRPNKRRLA+IF KN+TIEWK+
Sbjct  558  DFIACAAADAFSMTDSGSQLSSLVSGYRIYFGDGRMPTIRPNKRRLANIFLKNSTIEWKM  617

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FEKRVRKAV+Q K+   RPV RSVYR+PRC ECMC
Sbjct  618  FEKRVRKAVKQTKQAHERPVARSVYRHPRCKECMC  652



>ref|XP_010244141.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=685

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D F+MTDSGSQ SSL+SGYR+Y+G G+MPTIRPNKRRLA+IF KN+TIEWK+
Sbjct  588  DFIACAAADAFSMTDSGSQLSSLVSGYRIYFGDGRMPTIRPNKRRLANIFLKNSTIEWKM  647

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FEKRVRKAV+Q K+   RPV RSVYR+PRC ECMC
Sbjct  648  FEKRVRKAVKQTKQAHERPVARSVYRHPRCKECMC  682



>ref|XP_006467376.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
Length=604

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  507  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  566

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  567  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  601



>ref|XP_006467377.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=602

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  505  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  564

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  565  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  599



>gb|KDO78354.1| hypothetical protein CISIN_1g007425mg [Citrus sinensis]
Length=604

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA IF KN+TIEWKV
Sbjct  507  DFIGCTAANAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLAAIFVKNSTIEWKV  566

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K + +R  GRSVYRYPRC ECMC
Sbjct  567  FEQRVRKAVRQTKHIQSRSKGRSVYRYPRCKECMC  601



>ref|XP_003610473.1| hypothetical protein MTR_4g132590 [Medicago truncatula]
 ref|XP_003619269.1| DUF246 domain-containing protein [Medicago truncatula]
Length=620

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASD FAMTDSGSQ SSL+SGYR+YYG G+MPTIRPNKRRLA IF KN+TIEW+V
Sbjct  497  DFIGCAASDAFAMTDSGSQLSSLVSGYRIYYGGGRMPTIRPNKRRLASIFMKNSTIEWRV  556

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECM  365
            FE+R+RKAVRQ K V TRP  RSVYRYPRC ECM
Sbjct  557  FEQRMRKAVRQTKHVQTRPKARSVYRYPRCKECM  590



>ref|XP_010686779.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=588

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+  FAMTDSGSQ S+L+SG+R+YYG G+MPTIRPNKRRLADIF KN+TIEWKV
Sbjct  491  DFIGCTAATAFAMTDSGSQLSALVSGFRMYYGGGQMPTIRPNKRRLADIFLKNSTIEWKV  550

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRKAVRQ K+V  RP  RS+YR+PRC ECMC
Sbjct  551  FEQRVRKAVRQTKQVHRRPTARSIYRHPRCRECMC  585



>ref|XP_003635616.2| PREDICTED: uncharacterized protein At1g04910-like [Vitis vinifera]
Length=267

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FA+TDSGSQ SSL+SGYR+YYG G++PT+RPNKRRLA IF KN+TIEW +
Sbjct  170  DFIGCTAADAFAITDSGSQLSSLVSGYRIYYGGGRLPTVRPNKRRLASIFLKNSTIEWSM  229

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ K +  R + RSVYR PRC ECMC  
Sbjct  230  FEKRVRKAVRQTKTIHRRSISRSVYRNPRCRECMCTT  266



>ref|XP_006830095.1| hypothetical protein AMTR_s00123p00071440 [Amborella trichopoda]
 gb|ERM97511.1| hypothetical protein AMTR_s00123p00071440 [Amborella trichopoda]
Length=688

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FAMTDSGS+FSSL+SGYR+YYG GK+PT+RPNKRRLA IF KNN IEWKV
Sbjct  591  DFIGCAAADAFAMTDSGSRFSSLVSGYRMYYGGGKLPTVRPNKRRLAGIFVKNNKIEWKV  650

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FEK VRKAVRQ+K V  RP GR++YR+P C ECMC
Sbjct  651  FEKSVRKAVRQSKNVHIRPAGRNIYRHPLCPECMC  685



>gb|KFK43461.1| hypothetical protein AALP_AA1G128400 [Arabis alpina]
Length=603

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTD GSQ SS++SGYR+YYG GKMPTIRPNKRRL+DI  KNNTI+WKV
Sbjct  504  DFIACAAANAFAMTDPGSQLSSIVSGYRIYYGGGKMPTIRPNKRRLSDILMKNNTIDWKV  563

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE+RVRKA RQ K VF RP+GRSVYRYPRC ECMCN+ E
Sbjct  564  FEQRVRKANRQTKHVFARPIGRSVYRYPRCKECMCNDQE  602



>ref|XP_004293322.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=628

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A++ FAMTDSGSQ SSL+SG+R+YYG G  PTIRPNKRRLA IF KN++IEW+V
Sbjct  528  DFIGCTAANAFAMTDSGSQLSSLVSGFRIYYGGGLTPTIRPNKRRLASIFSKNSSIEWRV  587

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTEV  347
            FE+RVRKAVRQ K V  RP  RSVYRYPRC ECMCN T V
Sbjct  588  FEQRVRKAVRQTKHVQPRPRARSVYRYPRCDECMCNMTLV  627



>gb|AAX23739.1| hypothetical protein At1g11990 [Arabidopsis thaliana]
 gb|AAZ52677.1| expressed protein [Arabidopsis thaliana]
 gb|AAZ52678.1| expressed protein [Arabidopsis thaliana]
Length=343

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG GK+PTIRPNKRRL+DI  KN+TIEW VFEKRVRKA+RQ 
Sbjct  259  MTDSGSQLSSLVSGYRIYYGGGKLPTIRPNKRRLSDILLKNSTIEWNVFEKRVRKAIRQT  318

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K VF RP GRSVYRYPRC ECMC+
Sbjct  319  KHVFARPNGRSVYRYPRCKECMCH  342



>ref|XP_010645345.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Vitis vinifera]
 ref|XP_010645347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Vitis vinifera]
Length=617

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FA+TDSGSQ SSL+SGYR+YYG G++PT+RPNKRRLA IF KN+TIEW +
Sbjct  520  DFIGCTAADAFAITDSGSQLSSLVSGYRIYYGGGRLPTVRPNKRRLASIFLKNSTIEWSM  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ K +  R + RSVYR PRC ECMC  
Sbjct  580  FEKRVRKAVRQTKTIHRRSISRSVYRNPRCRECMCTT  616



>ref|XP_010645346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Vitis vinifera]
Length=617

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FA+TDSGSQ SSL+SGYR+YYG G++PT+RPNKRRLA IF KN+TIEW +
Sbjct  520  DFIGCTAADAFAITDSGSQLSSLVSGYRIYYGGGRLPTVRPNKRRLASIFLKNSTIEWSM  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ K +  R + RSVYR PRC ECMC  
Sbjct  580  FEKRVRKAVRQTKTIHRRSISRSVYRNPRCRECMCTT  616



>ref|XP_009391469.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=655

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+A+D FAMTDSGSQ S+L+SGYR+YYG G +PTIRPNKRRLA IF KN+TIEWK 
Sbjct  558  DFIVCAAADAFAMTDSGSQLSALVSGYRMYYGGGNLPTIRPNKRRLASIFLKNSTIEWKE  617

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK ++Q K++  RP+ RS+YR+PR  ECMC
Sbjct  618  FEDRVRKTIKQTKQIHERPIARSIYRHPRSPECMC  652



>emb|CBI32992.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+D FA+TDSGSQ SSL+SGYR+YYG G++PT+RPNKRRLA IF KN+TIEW +
Sbjct  620  DFIGCTAADAFAITDSGSQLSSLVSGYRIYYGGGRLPTVRPNKRRLASIFLKNSTIEWSM  679

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FEKRVRKAVRQ K +  R + RSVYR PRC ECMC  
Sbjct  680  FEKRVRKAVRQTKTIHRRSISRSVYRNPRCRECMCTT  716



>ref|XP_010546573.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=640

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG G+MPTIRPN RRL+DIF KNNTIEWKV E+RVRKA+RQ 
Sbjct  556  MTDSGSQLSSLVSGYRIYYGGGRMPTIRPNNRRLSDIFMKNNTIEWKVLEQRVRKAIRQT  615

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMCN
Sbjct  616  KHVLARPKGRSVYRYPRCKECMCN  639



>ref|XP_002892668.1| hypothetical protein ARALYDRAFT_471348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68927.1| hypothetical protein ARALYDRAFT_471348 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFE+RVRKA+RQ 
Sbjct  492  MTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILLKNSTIEWNVFERRVRKAIRQT  551

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K VF RP GRSVYRYPRC ECMC+
Sbjct  552  KHVFARPNGRSVYRYPRCKECMCH  575



>gb|AAC17628.1| Contains similarity to axi 1 gene gb|X80301 from Nicotiana tabacum 
[Arabidopsis thaliana]
Length=627

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG GK+PTIRPNKRRL+DI  KN+TIEW VFEKRVRKA+RQ 
Sbjct  543  MTDSGSQLSSLVSGYRIYYGGGKLPTIRPNKRRLSDILLKNSTIEWNVFEKRVRKAIRQT  602

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K VF RP GRSVYRYPRC ECMC+
Sbjct  603  KHVFARPNGRSVYRYPRCKECMCH  626



>ref|NP_172663.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE28824.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=590

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG GK+PTIRPNKRRL+DI  KN+TIEW VFEKRVRKA+RQ 
Sbjct  506  MTDSGSQLSSLVSGYRIYYGGGKLPTIRPNKRRLSDILLKNSTIEWNVFEKRVRKAIRQT  565

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K VF RP GRSVYRYPRC ECMC+
Sbjct  566  KHVFARPNGRSVYRYPRCKECMCH  589



>ref|XP_010227801.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=594

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++D FAMTDSGSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEWK 
Sbjct  493  DFIACASADAFAMTDSGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILVKNATIEWKE  552

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV K ++Q K+V  RPV RS++R+PRC ECMC
Sbjct  553  FETRVNKLIQQTKQVHERPVARSIFRHPRCPECMC  587



>ref|XP_010476152.1| PREDICTED: uncharacterized protein At1g04910-like isoform X5 
[Camelina sativa]
Length=344

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  260  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  319

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  320  KHVSARPTGRSVYRYPRCKECMCH  343



>ref|XP_010476150.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Camelina sativa]
 ref|XP_010476151.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Camelina sativa]
Length=378

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  294  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  353

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  354  KHVSARPTGRSVYRYPRCKECMCH  377



>ref|XP_002978066.1| hypothetical protein SELMODRAFT_108165 [Selaginella moellendorffii]
 gb|EFJ20723.1| hypothetical protein SELMODRAFT_108165 [Selaginella moellendorffii]
Length=460

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+DVFAMTDSGSQ +SL+SGYR+Y+G G++P IRPNK+RL  +F KN++I+W+ 
Sbjct  362  DFIACTAADVFAMTDSGSQLASLVSGYRMYFGGGRLPIIRPNKKRLVSLFAKNSSIQWEE  421

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            F +RVRK +R+N++V TRP  RSVYR+PRC +CMC   E
Sbjct  422  FRERVRKTIRENRKVHTRPTARSVYRHPRCEDCMCQAKE  460



>ref|XP_002966670.1| hypothetical protein SELMODRAFT_85972 [Selaginella moellendorffii]
 gb|EFJ32697.1| hypothetical protein SELMODRAFT_85972 [Selaginella moellendorffii]
Length=460

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+A+DVFAMTDSGSQ +SL+SGYR+Y+G G++P IRPNK+RL  +F KN++I+W  
Sbjct  362  DFIACTAADVFAMTDSGSQLASLVSGYRMYFGGGRLPIIRPNKKRLVSLFAKNSSIQWGE  421

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            F +RVRK +R+N++V TRP  RSVYR+PRC +CMC   E
Sbjct  422  FRERVRKTIRENRKVHTRPTARSVYRHPRCEDCMCQAKE  460



>dbj|BAJ99135.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++D FAMTD GSQFSSL+ GYR+YYG G +PT+RPNKRRLA I  KN TIEWK 
Sbjct  494  DFIACASADAFAMTDPGSQFSSLVQGYRMYYGGGDLPTLRPNKRRLASILVKNATIEWKE  553

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV K ++Q K+V  RP+ RS++R+PRC ECMC
Sbjct  554  FETRVNKLIQQTKQVHERPIARSIFRHPRCPECMC  588



>ref|XP_010476148.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=624

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  540  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  599

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  600  KHVSARPTGRSVYRYPRCKECMCH  623



>ref|XP_010476147.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=626

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  542  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  601

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  602  KHVSARPTGRSVYRYPRCKECMCH  625



>ref|XP_010458619.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=623

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  539  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  598

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  599  KHVSARPTGRSVYRYPRCKECMCH  622



>ref|XP_010493605.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=630

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  546  MTDPGSQLSSLVSGYRIYYGDGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  605

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  606  KHVSARPTGRSVYRYPRCKECMCH  629



>ref|XP_010458620.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Camelina sativa]
Length=622

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  538  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  597

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  598  KHVSARPTGRSVYRYPRCKECMCH  621



>ref|XP_010458618.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=624

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  KN+TIEW VFEKRVRKA RQ 
Sbjct  540  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMKNSTIEWNVFEKRVRKANRQT  599

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  600  KHVSARPTGRSVYRYPRCKECMCH  623



>ref|XP_010913450.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Elaeis guineensis]
Length=500

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK FE+RVRKA+RQ 
Sbjct  408  MTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKEFERRVRKAIRQT  467

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+VF RP+ RSVYR+PRC ECMC
Sbjct  468  KQVFERPIARSVYRHPRCPECMC  490



>ref|XP_006306191.1| hypothetical protein CARUB_v10011821mg [Capsella rubella]
 gb|EOA39089.1| hypothetical protein CARUB_v10011821mg [Capsella rubella]
Length=610

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQ SSL+SGYR+YYG GKMPTIRPNKRRL+DI  +N+TIEW VFE+RVRKA+RQ 
Sbjct  526  MTDPGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLSDILMRNSTIEWNVFEQRVRKAIRQT  585

Query  430  KRVFTRPVGRSVYRYPRCHECMCN  359
            K V  RP GRSVYRYPRC ECMC+
Sbjct  586  KHVSARPTGRSVYRYPRCKECMCH  609



>ref|XP_010913449.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Elaeis guineensis]
Length=597

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK FE+RVRKA+RQ 
Sbjct  505  MTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKEFERRVRKAIRQT  564

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+VF RP+ RSVYR+PRC ECMC
Sbjct  565  KQVFERPIARSVYRHPRCPECMC  587



>ref|XP_010913448.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=651

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 2/88 (2%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK FE+RVRKA+RQ 
Sbjct  559  MTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKEFERRVRKAIRQT  618

Query  430  KRVFTRPVGRSVYRYPRCHECMC--NNT  353
            K+VF RP+ RSVYR+PRC ECMC  N+T
Sbjct  619  KQVFERPIARSVYRHPRCPECMCKINDT  646



>ref|XP_010913447.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Elaeis guineensis]
Length=682

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTDSGSQ SSL+SGYR+YYG G++PTIRPNKRRLA IF KN+TIEWK FE+RVRKA+RQ 
Sbjct  590  MTDSGSQLSSLVSGYRMYYGDGRLPTIRPNKRRLASIFSKNSTIEWKEFERRVRKAIRQT  649

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+VF RP+ RSVYR+PRC ECMC
Sbjct  650  KQVFERPIARSVYRHPRCPECMC  672



>ref|NP_001117378.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE31060.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=421

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  325  DFIACIASDVFAMTDSGSQLSSLVSGFRNYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  384

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++ TRP GRS+YR PRC ECMC
Sbjct  385  FEDRVRKMVEEGQKLRTRPYGRSIYRQPRCPECMC  419



>ref|XP_002893554.1| hypothetical protein ARALYDRAFT_473137 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69813.1| hypothetical protein ARALYDRAFT_473137 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  515  DFIACIASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  574

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++ TRP GRS+YR PRC ECMC
Sbjct  575  FEDRVRKMVEEGQKLRTRPYGRSIYRQPRCPECMC  609



>ref|NP_174215.2| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAX23764.1| hypothetical protein At1g29200 [Arabidopsis thaliana]
 gb|AAZ52699.1| hypothetical protein At1g29200 [Arabidopsis thaliana]
 gb|AEE31058.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=495

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  399  DFIACIASDVFAMTDSGSQLSSLVSGFRNYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  458

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++ TRP GRS+YR PRC ECMC
Sbjct  459  FEDRVRKMVEEGQKLRTRPYGRSIYRQPRCPECMC  493



>gb|AAF88118.1|AC021043_11 Hypothetical protein [Arabidopsis thaliana]
Length=586

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  490  DFIACIASDVFAMTDSGSQLSSLVSGFRNYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  549

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++ TRP GRS+YR PRC ECMC
Sbjct  550  FEDRVRKMVEEGQKLRTRPYGRSIYRQPRCPECMC  584



>ref|XP_010478287.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=613

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  517  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  576

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK V + +++  RP GRS+YR PRC ECMC
Sbjct  577  FEERVRKMVEEGQKLRFRPYGRSIYRQPRCPECMC  611



>gb|KHG19624.1| hypothetical protein F383_26440 [Gossypium arboreum]
Length=219

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N TI W  
Sbjct  123  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAILSENRTIGWNT  182

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  183  FEDRVRKMIEEGQRVQLRGSGRSIYRQPRCPECMC  217



>ref|NP_001117377.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE31059.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=611

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  515  DFIACIASDVFAMTDSGSQLSSLVSGFRNYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  574

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++ TRP GRS+YR PRC ECMC
Sbjct  575  FEDRVRKMVEEGQKLRTRPYGRSIYRQPRCPECMC  609



>ref|XP_010460701.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
 ref|XP_010460702.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=616

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  520  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + +++  RP GRS+YR PRC ECMC
Sbjct  580  FEDRVRKMVEEGQKLRFRPYGRSIYRQPRCPECMC  614



>ref|XP_006307011.1| hypothetical protein CARUB_v10008597mg [Capsella rubella]
 gb|EOA39909.1| hypothetical protein CARUB_v10008597mg [Capsella rubella]
Length=618

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I   + TI+WK+
Sbjct  522  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDSETIKWKI  581

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V + ++   RP GRS+YR PRC ECMC
Sbjct  582  FEDRVRKMVEEGQKFRLRPYGRSIYRQPRCPECMC  616



>gb|EPS63261.1| hypothetical protein M569_11522, partial [Genlisea aurea]
Length=291

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI  +ASDVFAMTDSGSQ SSL+SG+R YYG G  PT+RP+K RLA I  +N+TI W +
Sbjct  194  DFIATAASDVFAMTDSGSQLSSLVSGFRTYYGEGNAPTLRPSKLRLAAILQQNSTISWHI  253

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            F +R++K + +N+RV TR  GRS+YR P+C+ECMC N
Sbjct  254  FRERIKKMIEENQRVHTRRNGRSIYRQPQCNECMCKN  290



>ref|XP_001768745.1| predicted protein [Physcomitrella patens]
 gb|EDQ66477.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DF+ C+ +D FAMTDSGSQ SSL+SGYR+Y+  G  PTIRPNK+RLA +F  N TIEW  
Sbjct  396  DFLGCALADAFAMTDSGSQLSSLVSGYRIYHSSGHAPTIRPNKKRLAILFDSNATIEWSF  455

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRK V++ KR+  RP  RS+YR+PRC ECMC +
Sbjct  456  FEERVRKLVKETKRIAVRPTSRSIYRHPRCEECMCKH  492



>gb|KDP21114.1| hypothetical protein JCGZ_21585 [Jatropha curcas]
Length=503

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNKRRLA I  +N+TIEW  
Sbjct  406  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKRRLAAILSENSTIEWNS  465

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  466  FEDRVRKMIEEGQRVGVRGFGRSIYRQPRCPECMC  500



>emb|CDY15638.1| BnaA07g08090D [Brassica napus]
Length=616

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I     TI+WK 
Sbjct  520  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDGETIKWKS  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V +  +V  RP GRS+YR P+C ECMC
Sbjct  580  FENRVRKMVEEGNKVSVRPYGRSIYRQPKCPECMC  614



>ref|XP_008443407.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Cucumis 
melo]
Length=445

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNKRRLA I  +N TI W  
Sbjct  347  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGGNAPTLRPNKRRLAAILSENKTIGWNT  406

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE RVRK + + +RV TR  GRS+YR PRC ECMC  ++
Sbjct  407  FEDRVRKMIEEGQRVQTRGFGRSIYRQPRCPECMCKRSQ  445



>ref|XP_009102867.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=616

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I     TI+WK 
Sbjct  520  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSDGETIKWKS  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V +  +V  RP GRS+YR P+C ECMC
Sbjct  580  FENRVRKMVEEGNKVSVRPYGRSIYRQPKCPECMC  614



>gb|EMT23612.1| hypothetical protein F775_09460 [Aegilops tauschii]
Length=611

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++D FAMTD GSQFSSL+ GYR+YYG G +PT+RPNKRRLA I  KN TIEWK 
Sbjct  483  DFIACASADAFAMTDPGSQFSSLVQGYRMYYGGGDLPTLRPNKRRLASILVKNATIEWKE  542

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHEC  368
            FE RV K ++Q K+V  RP+ RS++R+PRC EC
Sbjct  543  FETRVNKLIQQTKQVHERPIARSIFRHPRCPEC  575



>ref|XP_010549414.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010549415.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=486

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ P++RPNK+RLA I  ++ +IEW V
Sbjct  389  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGRAPSLRPNKKRLAAILSESGSIEWNV  448

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RVRK + + +RV  RP  RS+YR PRC ECMC +
Sbjct  449  FEERVRKMIEEGQRVRLRPYNRSIYRQPRCPECMCKS  485



>ref|XP_006415594.1| hypothetical protein EUTSA_v10007505mg [Eutrema salsugineum]
 gb|ESQ33947.1| hypothetical protein EUTSA_v10007505mg [Eutrema salsugineum]
Length=482

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I   + TI+WK 
Sbjct  386  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGHAPTLRPNKKRLAAILSGSETIKWKT  445

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V +  +V  RP GRS+YR P+C ECMC
Sbjct  446  FEDRVRKMVEEGNKVRLRPYGRSIYRQPKCPECMC  480



>emb|CDY57756.1| BnaCnng32400D [Brassica napus]
Length=616

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R+YYG G  PT+RPNK+RLA I   + TI+WK 
Sbjct  520  DFIACAASDVFAMTDSGSQLSSLVSGFRIYYGNGHAPTLRPNKKRLAAILSDSETIKWKS  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK V +  +V  RP GRS+YR P+C ECMC
Sbjct  580  FENRVRKMVEEGYKVSVRPYGRSIYRQPKCPECMC  614



>ref|XP_011101413.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Sesamum 
indicum]
Length=499

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R+YYG G  PT+RP+K+RLA I  +N+TI W+ 
Sbjct  402  DFIACAASDVFAMTDSGSQLSSLVSGFRIYYGGGNAPTLRPSKKRLAAILQENSTIRWQS  461

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE R+RK + + +RV  R  GRS+YR PRC+ECMC +
Sbjct  462  FENRIRKMIEEGQRVHIRGFGRSIYRQPRCNECMCKH  498



>ref|XP_011101415.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Sesamum 
indicum]
Length=490

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R+YYG G  PT+RP+K+RLA I  +N+TI W+ 
Sbjct  393  DFIACAASDVFAMTDSGSQLSSLVSGFRIYYGGGNAPTLRPSKKRLAAILQENSTIRWQS  452

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE R+RK + + +RV  R  GRS+YR PRC+ECMC +
Sbjct  453  FENRIRKMIEEGQRVHIRGFGRSIYRQPRCNECMCKH  489



>ref|XP_001766418.1| predicted protein [Physcomitrella patens]
 gb|EDQ68746.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D++ C+ +D FAMTDSGSQ SSL+SG+R+Y+G G  PTIRPNK+RLA IF  N TIEW  
Sbjct  337  DYLGCAMADAFAMTDSGSQLSSLVSGHRIYHGSGHRPTIRPNKKRLAAIFEHNATIEWSH  396

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE R+RK V + KR+  RP+ RSVYR+PRC ECMC +
Sbjct  397  FENRIRKMVAETKRIAARPISRSVYRHPRCLECMCKH  433



>emb|CDY50783.1| BnaA09g54120D [Brassica napus]
Length=615

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  ++ TI+WK 
Sbjct  519  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGHAPTLRPNKKRLAAILSESETIKWKT  578

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV+K + +  +V  RP GRS+YR P+C ECMC
Sbjct  579  FENRVKKMIEEGHKVRLRPYGRSIYRQPKCPECMC  613



>emb|CDX99802.1| BnaC05g22240D [Brassica napus]
Length=615

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  ++ TI+WK 
Sbjct  519  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAILSESETIKWKA  578

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE R+RK + +  +V  RP GRS+YR P+C ECMC
Sbjct  579  FENRIRKMIEEGHKVRLRPYGRSIYRQPKCPECMC  613



>ref|XP_008443392.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Cucumis 
melo]
Length=630

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNKRRLA I  +N TI W  
Sbjct  532  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGGNAPTLRPNKRRLAAILSENKTIGWNT  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE RVRK + + +RV TR  GRS+YR PRC ECMC  ++
Sbjct  592  FEDRVRKMIEEGQRVQTRGFGRSIYRQPRCPECMCKRSQ  630



>ref|XP_008443399.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Cucumis 
melo]
Length=629

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNKRRLA I  +N TI W  
Sbjct  531  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGGNAPTLRPNKRRLAAILSENKTIGWNT  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE RVRK + + +RV TR  GRS+YR PRC ECMC  ++
Sbjct  591  FEDRVRKMIEEGQRVQTRGFGRSIYRQPRCPECMCKRSQ  629



>ref|XP_004161210.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=630

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R Y+G GK PT+RPNK+RLA I  +N TI W  
Sbjct  532  DFIACASADVFAMTDSGSQLSSLVSGFRTYFGGGKAPTLRPNKKRLAAILSENKTIGWNT  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE+RVRK + + +RV TR  GRS+YR PRC ECMC  ++
Sbjct  592  FEERVRKMIEEGQRVQTRGFGRSIYRQPRCPECMCKRSQ  630



>ref|XP_004150223.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN65622.1| hypothetical protein Csa_1G470380 [Cucumis sativus]
Length=630

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R Y+G GK PT+RPNK+RLA I  +N TI W  
Sbjct  532  DFIACASADVFAMTDSGSQLSSLVSGFRTYFGGGKAPTLRPNKKRLAAILSENKTIGWNT  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTE  350
            FE+RVRK + + +RV TR  GRS+YR PRC ECMC  ++
Sbjct  592  FEERVRKMIEEGQRVQTRGFGRSIYRQPRCPECMCKRSQ  630



>ref|XP_010549413.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=620

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G+ P++RPNK+RLA I  ++ +IEW V
Sbjct  523  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGRAPSLRPNKKRLAAILSESGSIEWNV  582

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK + + +RV  RP  RS+YR PRC ECMC
Sbjct  583  FEERVRKMIEEGQRVRLRPYNRSIYRQPRCPECMC  617



>ref|XP_011101411.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Sesamum 
indicum]
Length=628

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R+YYG G  PT+RP+K+RLA I  +N+TI W+ 
Sbjct  531  DFIACAASDVFAMTDSGSQLSSLVSGFRIYYGGGNAPTLRPSKKRLAAILQENSTIRWQS  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE R+RK + + +RV  R  GRS+YR PRC+ECMC +
Sbjct  591  FENRIRKMIEEGQRVHIRGFGRSIYRQPRCNECMCKH  627



>ref|XP_011101412.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Sesamum 
indicum]
Length=627

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R+YYG G  PT+RP+K+RLA I  +N+TI W+ 
Sbjct  530  DFIACAASDVFAMTDSGSQLSSLVSGFRIYYGGGNAPTLRPSKKRLAAILQENSTIRWQS  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE R+RK + + +RV  R  GRS+YR PRC+ECMC +
Sbjct  590  FENRIRKMIEEGQRVHIRGFGRSIYRQPRCNECMCKH  626



>gb|AAT64033.1| putative growth regulator [Gossypium hirsutum]
Length=598

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA IF +N+TI W  
Sbjct  502  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAIFSENSTIGWTT  561

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  562  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCPECMC  596



>ref|XP_010246469.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=628

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D I C+ +DVFAMTDSGSQFSSL+SGYRVYYG G  PT+RPNK+R+A I  +N TIEW  
Sbjct  531  DLIACATADVFAMTDSGSQFSSLVSGYRVYYGGGHAPTVRPNKKRIAAILSENGTIEWAA  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+ RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  591  FQDRVRKMIDEGQRVRIRGFGRSIYRQPRCPECMC  625



>ref|XP_010246468.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=629

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D I C+ +DVFAMTDSGSQFSSL+SGYRVYYG G  PT+RPNK+R+A I  +N TIEW  
Sbjct  532  DLIACATADVFAMTDSGSQFSSLVSGYRVYYGGGHAPTVRPNKKRIAAILSENGTIEWAA  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+ RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  592  FQDRVRKMIDEGQRVRIRGFGRSIYRQPRCPECMC  626



>ref|XP_010655536.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=511

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  ++ TIEWK 
Sbjct  412  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGRAPTLRPNKKRLAAILMESRTIEWKS  471

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  472  FEERVKKMIEEGQRVRVRGFGRSIYRQPRCPQCMCKS  508



>ref|XP_007025345.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY27967.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=626

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W +
Sbjct  529  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAILSENSTIGWNI  588

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  589  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCPECMC  623



>gb|ACD56665.1| putative growth regulator [Gossypium arboreum]
Length=599

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA IF +N++I W  
Sbjct  503  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAIFSENSSIGWTT  562

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  563  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCPECMC  597



>gb|AAT64018.1| putative growth regulator [Gossypium hirsutum]
Length=599

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA IF +N++I W  
Sbjct  503  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAIFSENSSIGWTT  562

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  563  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCPECMC  597



>gb|KHG23960.1| hypothetical protein F383_02013 [Gossypium arboreum]
Length=614

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA IF +N++I W  
Sbjct  518  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAIFSENSSIGWTT  577

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  578  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCPECMC  612



>ref|XP_008225312.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=621

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  +N+TI+W  
Sbjct  524  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGRAPTLRPNKKRLAAILSENSTIQWNS  583

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  584  FEDRVKKMIEEGQRVHVRRFGRSIYRQPRCQQCMCKS  620



>ref|XP_009115262.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=616

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +  TI+WK 
Sbjct  520  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNGHAPTLRPNKKRLAAILSEIETIKWKT  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV+K +    +V  RP GRS+YR P+C ECMC
Sbjct  580  FENRVKKMIEAGHKVRLRPYGRSIYRQPKCPECMC  614



>ref|XP_010655535.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI30704.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  ++ TIEWK 
Sbjct  530  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGRAPTLRPNKKRLAAILMESRTIEWKS  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  590  FEERVKKMIEEGQRVRVRGFGRSIYRQPRCPQCMCKS  626



>ref|XP_007214626.1| hypothetical protein PRUPE_ppa002927mg [Prunus persica]
 gb|EMJ15825.1| hypothetical protein PRUPE_ppa002927mg [Prunus persica]
Length=621

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  +N+TI+W  
Sbjct  524  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGRAPTLRPNKKRLAAILSENSTIQWNS  583

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  584  FEDRVKKMIEEGQRVHVRRFGRSIYRQPRCQQCMCKS  620



>ref|XP_010499443.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=610

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ASDVFAMTDSGSQ SSL+SG+R YYG  + PT+RPNK+RLA I   + TI+WK 
Sbjct  514  DFIACAASDVFAMTDSGSQLSSLVSGFRTYYGNSQAPTLRPNKKRLAAILSDSETIKWKT  573

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+ RVRK V + +++  RP GRS+YR PRC ECMC
Sbjct  574  FQDRVRKMVEEGQKLRFRPYGRSIYRQPRCPECMC  608



>ref|XP_002522229.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40087.1| conserved hypothetical protein [Ricinus communis]
Length=598

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G+ P++RPNK+RLA I  +N+TI W  
Sbjct  501  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGSGRAPSLRPNKKRLAAILSENSTIAWNS  560

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R +GRS+YR PRC +CMC
Sbjct  561  FEDRVRKMIEEGQRVRVRGIGRSIYRQPRCPDCMC  595



>gb|KCW75235.1| hypothetical protein EUGRSUZ_E03988 [Eucalyptus grandis]
Length=217

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+ +D FAMTDSGSQ SSL+SGYR+YYG GKMPTIRPNKRRLA+IF KNNTIEW+V
Sbjct  148  DFIVCTTADAFAMTDSGSQLSSLVSGYRIYYGGGKMPTIRPNKRRLANIFTKNNTIEWRV  207

Query  466  FEKRVRKAVR  437
            FE+RVRKAVR
Sbjct  208  FEQRVRKAVR  217



>gb|ACD56651.1| putative growth regulator [Gossypioides kirkii]
Length=596

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVF MTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA IF +N++I W  
Sbjct  500  DFIACATSDVFTMTDSGSQLSSLVSGFRTYYGDGHAPTLRPNKKRLAAIFSENSSIGWTT  559

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PRC ECMC
Sbjct  560  FEDRVRKMIEEGQRVRVRGSGRSIYRQPRCLECMC  594



>ref|XP_010103919.1| hypothetical protein L484_000637 [Morus notabilis]
 gb|EXC47233.1| hypothetical protein L484_000637 [Morus notabilis]
Length=369

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +++TIEW  
Sbjct  272  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGNAPTLRPNKKRLAAILSESDTIEWNS  331

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV+K + + +R   R  GRS+YR PRC ECMC
Sbjct  332  FEDRVKKMIEEGQRARVRGFGRSIYRQPRCPECMC  366



>gb|EMS46512.1| hypothetical protein TRIUR3_15824 [Triticum urartu]
Length=693

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++D FAMTD GSQFSSL+ GYR+YYG G +PT+RPNKRRLA I  KN TIEWK 
Sbjct  568  DFIACASADAFAMTDPGSQFSSLVQGYRMYYGGGDLPTLRPNKRRLASILVKNATIEWKE  627

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHE  371
            FE RV K ++Q K+V  RP+ RS++R+PRC E
Sbjct  628  FETRVNKLIQQTKQVHERPIARSIFRHPRCPE  659



>ref|XP_011039416.1| PREDICTED: uncharacterized protein At1g04910 isoform X5 [Populus 
euphratica]
Length=426

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  329  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENSTIGWNS  388

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + + V  R  GRS+YR PRC ECMC
Sbjct  389  FEDRVRKMIGEGQSVLIRGYGRSIYRQPRCPECMC  423



>ref|NP_001167713.1| uncharacterized protein LOC100381401 [Zea mays]
 gb|ACN25867.1| unknown [Zea mays]
Length=221

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEW  FE RVRK ++Q 
Sbjct  135  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILVKNATIEWNGFENRVRKLIQQT  194

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RSV+R+PRC ECMC
Sbjct  195  KQVHERPVARSVFRHPRCPECMC  217



>ref|XP_006830245.1| hypothetical protein AMTR_s00130p00081820 [Amborella trichopoda]
 gb|ERM97661.1| hypothetical protein AMTR_s00130p00081820 [Amborella trichopoda]
Length=585

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SGYR Y+G  KMP+IRPNK+RLA I  ++ +IEW  
Sbjct  489  DFIACATADVFAMTDSGSQLSSLVSGYRTYFGGRKMPSIRPNKKRLARILSESGSIEWVD  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK + + +RV  RPVGRS+YR PR  ECMC
Sbjct  549  FEERVRKMIEECQRVGVRPVGRSIYRQPRSPECMC  583



>ref|NP_001057262.1| Os06g0239600 [Oryza sativa Japonica Group]
 dbj|BAF19176.1| Os06g0239600, partial [Oryza sativa Japonica Group]
Length=104

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN T+EW  FE RVRK ++Q 
Sbjct  18   MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILLKNATMEWNEFETRVRKLIQQT  77

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RS++R+PRC +CMC
Sbjct  78   KQVHERPVARSIFRHPRCLDCMC  100



>ref|XP_011039415.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Populus 
euphratica]
Length=483

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  386  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENSTIGWNS  445

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + + V  R  GRS+YR PRC ECMC
Sbjct  446  FEDRVRKMIGEGQSVLIRGYGRSIYRQPRCPECMC  480



>ref|XP_004295581.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca 
subsp. vesca]
Length=535

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+T+ W  
Sbjct  437  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGSAPTLRPNKKRLAAILSENSTMGWNS  496

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  497  FEDRVKKMIEEGQRVHVRRFGRSIYRQPRCPQCMCKS  533



>ref|XP_006358125.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=493

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RP+K+RL+ I  +N TI W  
Sbjct  397  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLSAILSRNKTIGWHS  456

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE ++RK + + +RV  R +GRS+YR+PRC ECMC +
Sbjct  457  FEGKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMCRH  493



>ref|XP_004485909.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
 ref|XP_004485910.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=601

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK RLA I  +N TI W  
Sbjct  504  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKTRLATILTENGTIGWNG  563

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + ++   R  GRS+YRYPRC ECMC +
Sbjct  564  FEVRVKKMILEGQKAAIRSYGRSIYRYPRCSECMCKH  600



>ref|XP_011039413.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=603

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  506  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENSTIGWNS  565

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + + V  R  GRS+YR PRC ECMC
Sbjct  566  FEDRVRKMIGEGQSVLIRGYGRSIYRQPRCPECMC  600



>ref|XP_011039411.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=622

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  525  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENSTIGWNS  584

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + + V  R  GRS+YR PRC ECMC
Sbjct  585  FEDRVRKMIGEGQSVLIRGYGRSIYRQPRCPECMC  619



>ref|XP_006467631.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=482

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  +N+TI W  
Sbjct  386  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSENSTIRWND  445

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PR  ECMC
Sbjct  446  FEDRVRKMIEEGQRVRVRGFGRSIYRQPRSPECMC  480



>ref|XP_006358124.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=597

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RP+K+RL+ I  +N TI W  
Sbjct  501  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLSAILSRNKTIGWHS  560

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE ++RK + + +RV  R +GRS+YR+PRC ECMC
Sbjct  561  FEGKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMC  595



>ref|XP_002316818.2| hypothetical protein POPTR_0011s07160g [Populus trichocarpa]
 gb|EEE97430.2| hypothetical protein POPTR_0011s07160g [Populus trichocarpa]
Length=622

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  525  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENSTIGWNS  584

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE R RK + + + V  R  GRS+YR PRC ECMC
Sbjct  585  FEDRARKMIEEGQSVLIRGFGRSIYRQPRCPECMC  619



>ref|XP_006449523.1| hypothetical protein CICLE_v10014718mg [Citrus clementina]
 gb|ESR62763.1| hypothetical protein CICLE_v10014718mg [Citrus clementina]
Length=585

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  +N+TI W  
Sbjct  489  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLATILSENSTIRWND  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PR  ECMC
Sbjct  549  FEDRVRKMIEEGQRVRVRGFGRSIYRQPRSPECMC  583



>ref|XP_010316827.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=625

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RP+K+RL+ I  +N TI W  
Sbjct  529  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLSAILSRNKTIGWHS  588

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE ++RK + + +RV  R +GRS+YR+PRC ECMC
Sbjct  589  FEGKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMC  623



>ref|XP_004233041.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=629

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL+SG+R YYG G  PT+RP+K+RL+ I  +N TI W  
Sbjct  533  DFIACATSDVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLSAILSRNKTIGWHS  592

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE ++RK + + +RV  R +GRS+YR+PRC ECMC
Sbjct  593  FEGKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMC  627



>gb|KDO77884.1| hypothetical protein CISIN_1g007320mg [Citrus sinensis]
Length=608

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I  +N+TI W  
Sbjct  512  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGNGQAPTLRPNKKRLAAILSENSTIRWND  571

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK + + +RV  R  GRS+YR PR  ECMC
Sbjct  572  FEDRVRKMIEEGQRVRVRGFGRSIYRQPRSPECMC  606



>ref|XP_009351445.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=629

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI CS +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  532  DFIACSTADVFAMTDSGSQLSSLVSGFRTYYGDGGAPTLRPNKKRLAAILSENSTIGWNN  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  592  FEDRVKKMIDEGQRVHVRRFGRSIYRQPRCPQCMCKS  628



>ref|XP_009351449.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=628

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI CS +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  531  DFIACSTADVFAMTDSGSQLSSLVSGFRTYYGDGGAPTLRPNKKRLAAILSENSTIGWNN  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  591  FEDRVKKMIDEGQRVHVRRFGRSIYRQPRCPQCMCKS  627



>ref|XP_002305063.2| hypothetical protein POPTR_0004s05760g [Populus trichocarpa]
 gb|EEE85574.2| hypothetical protein POPTR_0004s05760g [Populus trichocarpa]
Length=606

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N TI W  
Sbjct  509  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKKRLAAILSENGTIGWNS  568

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RVRK ++  + V  R  GRS+YR PRC ECMC
Sbjct  569  FEDRVRKMIKDGQSVRIRGFGRSIYRQPRCPECMC  603



>gb|AFW76850.1| hypothetical protein ZEAMMB73_590923 [Zea mays]
Length=335

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEW  FE RVRK ++Q 
Sbjct  249  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILVKNATIEWNGFENRVRKLIQQT  308

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RSV+R+PRC ECMC
Sbjct  309  KQVHERPVARSVFRHPRCPECMC  331



>ref|XP_008371492.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=629

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI CS +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +N+TI W  
Sbjct  532  DFIACSTADVFAMTDSGSQLSSLVSGFRTYYGAGGAPTLRPNKKRLAAILSENSTIGWNS  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC +CMC +
Sbjct  592  FEDRVKKMIDEGQRVRVRRFGRSIYRQPRCPQCMCKS  628



>ref|XP_009799750.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nicotiana 
sylvestris]
Length=509

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFA+TDSGSQ SSL+SG+R YYG G  PT+RP+K+RLA I  +N TI W  
Sbjct  413  DFIACATSDVFAITDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLAAILSRNKTIGWNS  472

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            F++++RK + + +RV  R +GRS+YR+PRC ECMC +
Sbjct  473  FKEKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMCRH  509



>gb|KEH36621.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=617

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVF+MTDSGSQ SSL+SG+R YYG G  PT+RPNK RLA IF +N+TI W  
Sbjct  520  DFIACASADVFSMTDSGSQLSSLVSGFRTYYGGGHAPTLRPNKTRLAAIFAENDTIGWNG  579

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV+K + + +    R  GRS+YRYPRC ECMC
Sbjct  580  FEVRVKKMILEGQNAGKRSYGRSIYRYPRCPECMC  614



>ref|XP_010100749.1| hypothetical protein L484_005816 [Morus notabilis]
 gb|EXB84052.1| hypothetical protein L484_005816 [Morus notabilis]
Length=626

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G  PT+RPNK+RLA I  +++TIEW  
Sbjct  529  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGGGNAPTLRPNKKRLAAILSESDTIEWNS  588

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE RV+K + + +R   R  GRS+YR PRC +CMC
Sbjct  589  FEDRVKKMIEEGQRARVRGFGRSIYRQPRCPQCMC  623



>ref|XP_009604296.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
tomentosiformis]
Length=622

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFA+TDSGSQ SSL+SG+R YYG G  PT+RP+K+RLA I  +N TI W  
Sbjct  526  DFIACATSDVFAITDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLAAILSRNKTIGWNS  585

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+++RK + + +RV  R  GRS+YR+PRC ECMC
Sbjct  586  FEEKIRKMIDEGQRVQVRGFGRSIYRHPRCKECMC  620



>ref|XP_009604295.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFA+TDSGSQ SSL+SG+R YYG G  PT+RP+K+RLA I  +N TI W  
Sbjct  530  DFIACATSDVFAITDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLAAILSRNKTIGWNS  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+++RK + + +RV  R  GRS+YR+PRC ECMC +
Sbjct  590  FEEKIRKMIDEGQRVQVRGFGRSIYRHPRCKECMCRH  626



>ref|XP_009799749.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=625

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFA+TDSGSQ SSL+SG+R YYG G  PT+RP+K+RLA I  +N TI W  
Sbjct  529  DFIACATSDVFAITDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLAAILSRNKTIGWNS  588

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F++++RK + + +RV  R +GRS+YR+PRC ECMC
Sbjct  589  FKEKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMC  623



>gb|AFW85187.1| hypothetical protein ZEAMMB73_421614 [Zea mays]
Length=335

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G  PTIRPNKRRLA I  KN TIEW  FE RVRK ++Q 
Sbjct  249  MTDPGSQFSSLVQGYRMYYGGGNFPTIRPNKRRLASILVKNATIEWNEFESRVRKLIQQT  308

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RS++R+PRC ECMC
Sbjct  309  KQVHERPVARSIFRHPRCPECMC  331



>ref|XP_009799748.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
Length=629

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFA+TDSGSQ SSL+SG+R YYG G  PT+RP+K+RLA I  +N TI W  
Sbjct  533  DFIACATSDVFAITDSGSQLSSLVSGFRTYYGGGHAPTLRPSKKRLAAILSRNKTIGWNS  592

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F++++RK + + +RV  R +GRS+YR+PRC ECMC
Sbjct  593  FKEKIRKMIDEGQRVQVRGLGRSIYRHPRCKECMC  627



>ref|XP_007148031.1| hypothetical protein PHAVU_006G174600g [Phaseolus vulgaris]
 gb|ESW20025.1| hypothetical protein PHAVU_006G174600g [Phaseolus vulgaris]
Length=586

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG    PT+RPNK RLA I  +NNTI+W  
Sbjct  489  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGDHAPTLRPNKTRLAAILRENNTIKWSR  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + ++   R  GRS+YR P+CHECMC +
Sbjct  549  FEVRVKKMILEGQKAGIRSYGRSIYRNPKCHECMCKH  585



>ref|XP_010925619.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=626

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL++G+R Y+GRG  PT+RPNK+R A I  +N TI+W  
Sbjct  521  DFIACATADVFAMTDSGSQLSSLVTGFRTYHGRGNAPTLRPNKKRFAKILSENRTIQWHE  580

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK + +N+RV  R  GRS+YR PR   CMC 
Sbjct  581  FEERVRKMIEENQRVIARRRGRSIYRQPRTPGCMCE  616



>ref|XP_008799362.1| PREDICTED: uncharacterized protein At1g04910 [Phoenix dactylifera]
Length=620

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ SDVFAMTDSGSQ SSL++G+R Y+GRG  PT+RPNK+R A I  +N TI+W  
Sbjct  515  DFIACATSDVFAMTDSGSQLSSLVTGFRTYHGRGNAPTLRPNKKRFAKILSENRTIQWNE  574

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCN  359
            FE+RVRK + +N+RV  R  GRS+YR PR   CMC 
Sbjct  575  FEERVRKMIEENQRVTVRRRGRSIYRQPRTPGCMCQ  610



>ref|XP_009383237.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=604

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL++GYR+Y+GRG  PTIRPNK+R A I  +N TI+W  
Sbjct  507  DFIACATADVFAMTDSGSQLSSLVNGYRIYHGRGHAPTIRPNKKRFARILSENRTIQWVD  566

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK +++N+RV  R  GRS+YR P    CMC
Sbjct  567  FEERVRKMIQENQRVIARRRGRSIYRLPMTPGCMC  601



>ref|XP_004965111.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Setaria 
italica]
Length=554

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEW+ FE RVRK ++Q 
Sbjct  468  MTDPGSQFSSLVQGYRMYYGGGNLPTIRPNKRRLASILVKNATIEWQEFETRVRKLIQQT  527

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RS++R+PRC ECMC
Sbjct  528  KQVHERPVARSIFRHPRCLECMC  550



>ref|XP_009383238.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=601

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL++GYR+Y+GRG  PTIRPNK+R A I  +N TI+W  
Sbjct  504  DFIACATADVFAMTDSGSQLSSLVNGYRIYHGRGHAPTIRPNKKRFARILSENRTIQWVD  563

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVRK +++N+RV  R  GRS+YR P    CMC
Sbjct  564  FEERVRKMIQENQRVIARRRGRSIYRLPMTPGCMC  598



>ref|XP_002436782.1| hypothetical protein SORBIDRAFT_10g008680 [Sorghum bicolor]
 gb|EER88149.1| hypothetical protein SORBIDRAFT_10g008680 [Sorghum bicolor]
Length=588

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEW  FE RVRK + Q 
Sbjct  502  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILVKNATIEWNEFESRVRKLIHQT  561

Query  430  KRVFTRPVGRSVYRYPRCHECMCNNTE  350
            K+V  RPV RS++R+PRC ECMC   +
Sbjct  562  KQVHERPVARSIFRHPRCSECMCRTEQ  588



>ref|XP_008648012.1| PREDICTED: uncharacterized protein LOC100381401 isoform X1 [Zea 
mays]
 gb|AFW76854.1| hypothetical protein ZEAMMB73_590923 [Zea mays]
Length=586

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN TIEW  FE RVRK ++Q 
Sbjct  500  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILVKNATIEWNGFENRVRKLIQQT  559

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RSV+R+PRC ECMC
Sbjct  560  KQVHERPVARSVFRHPRCPECMC  582



>ref|XP_008659068.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
Length=587

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G  PTIRPNKRRLA I  KN TIEW  FE RVRK ++Q 
Sbjct  501  MTDPGSQFSSLVQGYRMYYGGGNFPTIRPNKRRLASILVKNATIEWNEFESRVRKLIQQT  560

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RS++R+PRC ECMC
Sbjct  561  KQVHERPVARSIFRHPRCPECMC  583



>ref|XP_009352742.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009352743.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=628

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I    N+I W  
Sbjct  532  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGAGRAPTLRPNKKRLAAI-LSENSIGWNS  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC ECMC +
Sbjct  591  FEDRVKKMIDEGQRVHVRRSGRSIYRQPRCPECMCKS  627



>ref|XP_009352745.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=627

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I    N+I W  
Sbjct  531  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGAGRAPTLRPNKKRLAAI-LSENSIGWNS  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC ECMC +
Sbjct  590  FEDRVKKMIDEGQRVHVRRSGRSIYRQPRCPECMCKS  626



>ref|XP_009352746.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Pyrus x bretschneideri]
Length=622

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I    N+I W  
Sbjct  526  DFIACATADVFAMTDSGSQLSSLVSGFRTYYGAGRAPTLRPNKKRLAAI-LSENSIGWNS  584

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + +RV  R  GRS+YR PRC ECMC +
Sbjct  585  FEDRVKKMIDEGQRVHVRRSGRSIYRQPRCPECMCKS  621



>ref|XP_006594549.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN08422.1| DUF246 domain-containing protein [Glycine soja]
Length=586

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG    PT+RPNK RLA I  +N+TI W  
Sbjct  489  DFIACASADVFAMTDSGSQLSSLVSGFRTYYGGDHAPTLRPNKTRLAAILRENDTIRWNR  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV K +R++++   R  GRS+YR PRC ECMC +
Sbjct  549  FEVRVNKMIRESQKAGIRSYGRSIYRNPRCPECMCKH  585



>gb|ACG28723.1| growth regulator [Zea mays]
Length=613

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SGYR+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  509  DFIACASADVFAVTDSGSQLSSLVSGYRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  568

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+KRVR+ V + KRV TRP GRSVYR PR   CMC
Sbjct  569  FQKRVRQMVDEYKRVSTRPRGRSVYRQPRTPGCMC  603



>ref|XP_006656834.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=533

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PT+RPNKRRLA I  KN T+EW  FE RVRK ++Q 
Sbjct  447  MTDPGSQFSSLVQGYRMYYGGGDLPTVRPNKRRLASILLKNATMEWNEFESRVRKLIQQT  506

Query  430  KRVFTRPVGRSVYRYPRCHECMC  362
            K+V  RPV RS++R+PRC +CMC
Sbjct  507  KQVHERPVARSIFRHPRCLDCMC  529



>ref|XP_008349205.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=628

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ ++VFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I    N+I W  
Sbjct  532  DFIACATABVFAMTDSGSQLSSLVSGFRTYYGAGRAPTLRPNKKRLAAI-LSENSIGWNS  590

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + ++V  R  GRS+YR PRC ECMC +
Sbjct  591  FEDRVKKMIDEGQKVHVRRSGRSIYRQPRCPECMCKS  627



>ref|XP_008349206.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=627

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ ++VFAMTDSGSQ SSL+SG+R YYG G+ PT+RPNK+RLA I    N+I W  
Sbjct  531  DFIACATABVFAMTDSGSQLSSLVSGFRTYYGAGRAPTLRPNKKRLAAI-LSENSIGWNS  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE RV+K + + ++V  R  GRS+YR PRC ECMC +
Sbjct  590  FEDRVKKMIDEGQKVHVRRSGRSIYRQPRCPECMCKS  626



>ref|XP_010686224.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +D FAMTDSGSQ SSL+SG+R Y+G G  PT+RPNK+RL+ I  +N+TI W  
Sbjct  387  DFIACATADDFAMTDSGSQLSSLVSGFRTYFGGGHAPTLRPNKKRLSAILLQNDTISWNT  446

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            F+ RV+K + + +RV  R  G+S+YR PR  ECMC +
Sbjct  447  FQLRVKKMIEEGQRVHVRRYGQSIYRQPRSPECMCKS  483



>ref|XP_010227672.1| PREDICTED: uncharacterized protein At1g04910 [Brachypodium distachyon]
Length=524

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C++SDVFA+TDSGSQ SSL+SGYRVY+GRG+ PT+ PN++R A I  +   IEW  
Sbjct  420  DFIACASSDVFAVTDSGSQLSSLVSGYRVYHGRGRAPTLHPNRKRYAQILSEEGGIEWGG  479

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+KRVR  V + KRV  RP GRS YR PR   CMC
Sbjct  480  FQKRVRIMVDEYKRVRARPRGRSAYRQPRTPGCMC  514



>ref|NP_001132314.1| growth regulator [Zea mays]
 gb|ACF81111.1| unknown [Zea mays]
 gb|AFW86744.1| growth regulator [Zea mays]
Length=617

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SGYR+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  513  DFIACASADVFAVTDSGSQLSSLVSGYRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  572

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+KRVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  573  FQKRVRQMVDEYKRVSPRPRGRSVYRQPRTPGCMC  607



>ref|XP_010686223.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=627

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +D FAMTDSGSQ SSL+SG+R Y+G G  PT+RPNK+RL+ I  +N+TI W  
Sbjct  530  DFIACATADDFAMTDSGSQLSSLVSGFRTYFGGGHAPTLRPNKKRLSAILLQNDTISWNT  589

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            F+ RV+K + + +RV  R  G+S+YR PR  ECMC +
Sbjct  590  FQLRVKKMIEEGQRVHVRRYGQSIYRQPRSPECMCKS  626



>gb|EMT12043.1| hypothetical protein F775_07612 [Aegilops tauschii]
Length=612

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C++SDVFA+TDSGSQ SSL+SG+RVY+GRG+ PT+ PN++R A I  +   IEW  
Sbjct  508  DFIACASSDVFAVTDSGSQLSSLVSGHRVYHGRGRAPTLHPNRKRYAQILSEEAGIEWAG  567

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F+KRVR  V + KRV  RP GR+VYR PR   CMC
Sbjct  568  FQKRVRTMVDEYKRVRARPRGRTVYRQPRTPGCMC  602



>ref|XP_010057121.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
 gb|KCW74132.1| hypothetical protein EUGRSUZ_E02763 [Eucalyptus grandis]
Length=499

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+ +DVFAMTDSGSQ SSL+SG+R YYG    PT+RP K+RLA I   N TI WK 
Sbjct  390  DFIVCATADVFAMTDSGSQLSSLVSGFRTYYGGEHAPTLRPGKKRLAAILSWNATIRWKT  449

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTEV  347
            FE +V+K + + +    R  GRS+YR PRC ECMC +  +
Sbjct  450  FEYKVKKLIEEGQIAQVRRFGRSIYRQPRCPECMCRSPSL  489



>ref|XP_002489034.1| hypothetical protein SORBIDRAFT_0344s002010 [Sorghum bicolor]
 gb|EES20474.1| hypothetical protein SORBIDRAFT_0344s002010 [Sorghum bicolor]
Length=595

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SGYR+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  491  DFIACASADVFAVTDSGSQLSSLVSGYRIYHGRGRAPTLHPNRKRYAQVLSEEESIAWGG  550

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F++RVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  551  FQRRVRQMVEEYKRVSPRPRGRSVYRQPRTPGCMC  585



>dbj|BAJ93371.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97392.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C++SDVFA+TDSGSQ SSL+SG+RVY+GRG+ PT+ PN++R A I  +   IEW  
Sbjct  512  DFIACASSDVFAVTDSGSQLSSLVSGHRVYHGRGRAPTLHPNRKRYAQILSEEAGIEWAG  571

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F++RVR  V + KRV  RP GR+VYR PR   CMC
Sbjct  572  FQRRVRAMVDEYKRVRARPRGRTVYRQPRTPGCMC  606



>ref|XP_010057120.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW74131.1| hypothetical protein EUGRSUZ_E02763 [Eucalyptus grandis]
Length=599

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFIVC+ +DVFAMTDSGSQ SSL+SG+R YYG    PT+RP K+RLA I   N TI WK 
Sbjct  490  DFIVCATADVFAMTDSGSQLSSLVSGFRTYYGGEHAPTLRPGKKRLAAILSWNATIRWKT  549

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNNTEV  347
            FE +V+K + + +    R  GRS+YR PRC ECMC +  +
Sbjct  550  FEYKVKKLIEEGQIAQVRRFGRSIYRQPRCPECMCRSPSL  589



>ref|XP_004965564.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Setaria italica]
Length=506

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SG+R+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  402  DFIACASADVFAVTDSGSQLSSLVSGFRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  461

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F +RVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  462  FRRRVRQMVEEYKRVSPRPRGRSVYRQPRTPGCMC  496



>gb|KHN28621.1| DUF246 domain-containing protein [Glycine soja]
Length=586

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG    PT+RPNK RLA I  +N+TI W  
Sbjct  489  DFITCASADVFAMTDSGSQLSSLVSGFRTYYGGHHAPTLRPNKTRLAAILRENDTIRWNR  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECM  365
            FE RV+K + + ++   R  GRS+YR PRC ECM
Sbjct  549  FEVRVKKMILEAQKAGIRSYGRSIYRNPRCPECM  582



>ref|XP_006597482.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=586

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFAMTDSGSQ SSL+SG+R YYG    PT+RPNK RLA I  +N+TI W  
Sbjct  489  DFITCASADVFAMTDSGSQLSSLVSGFRTYYGGHHAPTLRPNKTRLAAILRENDTIRWNR  548

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECM  365
            FE RV+K + + ++   R  GRS+YR PRC ECM
Sbjct  549  FEVRVKKMILEAQKAGIRSYGRSIYRNPRCPECM  582



>ref|XP_004965563.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Setaria italica]
Length=614

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SG+R+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  510  DFIACASADVFAVTDSGSQLSSLVSGFRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  569

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F +RVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  570  FRRRVRQMVEEYKRVSPRPRGRSVYRQPRTPGCMC  604



>ref|XP_004965562.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Setaria italica]
Length=623

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SG+R+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  519  DFIACASADVFAVTDSGSQLSSLVSGFRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  578

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F +RVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  579  FRRRVRQMVEEYKRVSPRPRGRSVYRQPRTPGCMC  613



>ref|XP_004965561.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Setaria italica]
Length=630

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SG+R+Y+GRG+ PT+ PN++R A +  +  +I W  
Sbjct  526  DFIACASADVFAVTDSGSQLSSLVSGFRIYHGRGRAPTLHPNRKRYAQVLSEEGSIAWGG  585

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            F +RVR+ V + KRV  RP GRSVYR PR   CMC
Sbjct  586  FRRRVRQMVEEYKRVSPRPRGRSVYRQPRTPGCMC  620



>gb|AEW07749.1| hypothetical protein 0_10509_02, partial [Pinus radiata]
 gb|AFG68119.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68120.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68121.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68122.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68123.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68124.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68125.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68126.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68127.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68128.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68129.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68131.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68132.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68133.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68134.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68135.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
 gb|AFG68136.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
Length=79

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  565  RVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQNKRVFTRPVGRSVYRY  386
            R+YYG G +PTIRPNK+RLA IF KNNTIEW  F++RVRK VR++KR+  RP+ RS+YR+
Sbjct  1    RIYYGGGHLPTIRPNKKRLAGIFSKNNTIEWNEFQERVRKTVRESKRIQVRPIARSIYRH  60

Query  385  PRCHECMCN  359
            PRC ECMCN
Sbjct  61   PRCPECMCN  69



>gb|AFG68130.1| hypothetical protein 0_10509_02, partial [Pinus taeda]
Length=79

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  565  RVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQNKRVFTRPVGRSVYRY  386
            R+YYG G +PTIRPNK+RLA IF KNNTIEW  F++RVRK VR++KR+  RP+ RS+YR+
Sbjct  1    RIYYGGGHLPTIRPNKKRLAGIFSKNNTIEWNEFQERVRKTVRESKRIQVRPIARSIYRH  60

Query  385  PRCHECMCN  359
            PRC +CMCN
Sbjct  61   PRCPKCMCN  69



>ref|NP_001057817.1| Os06g0545900 [Oryza sativa Japonica Group]
 dbj|BAD54578.1| putative axi 1 [Oryza sativa Japonica Group]
 dbj|BAD54113.1| putative axi 1 [Oryza sativa Japonica Group]
 dbj|BAF19731.1| Os06g0545900 [Oryza sativa Japonica Group]
 dbj|BAG91783.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65849.1| hypothetical protein OsJ_21623 [Oryza sativa Japonica Group]
Length=603

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SGYRVY+GRG+ PT+ PN++R A I  +   I W  
Sbjct  499  DFIACASADVFAVTDSGSQLSSLVSGYRVYHGRGRAPTLHPNRKRYAQILGEEEGIGWGG  558

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVR  V + KRV  RP GRSVYR PR   CMC
Sbjct  559  FERRVRNMVEEYKRVSARPRGRSVYRQPRTPGCMC  593



>gb|EEC80777.1| hypothetical protein OsI_23300 [Oryza sativa Indica Group]
Length=605

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+++DVFA+TDSGSQ SSL+SGYRVY+GRG+ PT+ PN++R A I  +   I W  
Sbjct  501  DFIACASADVFAVTDSGSQLSSLVSGYRVYHGRGRAPTLHPNRKRYAQILGEEEGIGWGG  560

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            FE+RVR  V + KRV  RP GRSVYR PR   CMC
Sbjct  561  FERRVRNMVEEYKRVSARPRGRSVYRQPRTPGCMC  595



>ref|XP_006657039.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=594

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIF-----FKNNT  482
            DFI C+++DVFA+TDSGSQ SSL+SGYRVY+GRG+ PT+ PN++R A I         N 
Sbjct  485  DFIACASADVFAVTDSGSQLSSLVSGYRVYHGRGRSPTLHPNRKRYAQILGEEEGGGGNG  544

Query  481  IEWKVFEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMC  362
            + W  F++RVR  V + KRV  RP GRSVYR PR   CMC
Sbjct  545  VRWGGFQRRVRNMVEEYKRVSARPRGRSVYRQPRTPGCMC  584



>emb|CDO96817.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            DFI C+ +DVFA+TDSGSQ SSL+ GYR YYG G  PT+ P K+RLA I   N+TI+W  
Sbjct  532  DFIACATADVFAITDSGSQLSSLVYGYRTYYGGGHAPTLSPPKKRLAAILLHNHTIKWST  591

Query  466  FEKRVRKAVRQNKRVFTRPVGRSVYRYPRCHECMCNN  356
            FE+++RK +++ +RV  R   RSVYR PRC  CMC +
Sbjct  592  FEEKIRKMIQEGQRVRQRGFHRSVYRLPRCRGCMCKH  628



>gb|AFW85188.1| hypothetical protein ZEAMMB73_421614 [Zea mays]
Length=893

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRV  452
            MTD GSQFSSL+ GYR+YYG G  PTIRPNKRRLA I  KN TIEW  FE RV
Sbjct  807  MTDPGSQFSSLVQGYRMYYGGGNFPTIRPNKRRLASILVKNATIEWNEFESRV  859



>dbj|BAD37877.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
Length=585

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKR  455
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN T+EW  FE R
Sbjct  504  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILLKNATMEWNEFETR  555



>gb|EEE65417.1| hypothetical protein OsJ_20764 [Oryza sativa Japonica Group]
Length=784

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN T+EW  FE R+    R +
Sbjct  443  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILLKNATMEWNEFETRLCSHPRHS  502

Query  430  KRVFTRP  410
             R    P
Sbjct  503  LRTDDTP  509



>gb|EEC80302.1| hypothetical protein OsI_22331 [Oryza sativa Indica Group]
Length=845

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -3

Query  610  MTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKVFEKRVRKAVRQN  431
            MTD GSQFSSL+ GYR+YYG G +PTIRPNKRRLA I  KN T+EW  FE R+    R +
Sbjct  504  MTDPGSQFSSLVQGYRMYYGGGDLPTIRPNKRRLASILLKNATMEWNEFETRLCSHPRHS  563

Query  430  KRVFTRP  410
             R    P
Sbjct  564  LRTDDTP  570



>gb|EPS68582.1| hypothetical protein M569_06186, partial [Genlisea aurea]
Length=117

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 5/104 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S VF  T  G+ F   + G+R Y   G   TI+P+KR+L  +F   N I W+ 
Sbjct  12   DYTVCLHSQVFVTTQGGN-FPHFLVGHRRYTYGGHARTIKPDKRKLVQLFDDTN-IRWQD  69

Query  466  FEKRVRKAVRQN--KRVFTRPVGRSVYRYPRCHECMCNNTEVPP  341
            F+K +R  +R+N  K V  R  G S+Y +P   +CMCN  +  P
Sbjct  70   FKKHLRDMLRRNDLKGVELRKPGGSLYMHPMP-DCMCNAKKSTP  112



>emb|CDY28009.1| BnaC05g44110D [Brassica napus]
Length=458

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+IVC  SDVF M   G      I G+R Y G  K+  I PNKR++   +F N T+    
Sbjct  358  DYIVCKESDVF-MASHGGNMGRAIQGHRAYEGHKKL--ITPNKRQMLP-YFLNKTMTETE  413

Query  466  FEKRVRKAVRQN---KRVFTRPVGRSVYRYPRCHECMCNNTEVP  344
            FEK ++K  RQ+     +     GR V +YP   ECMCNN   P
Sbjct  414  FEKMMKKLHRQSLGQPEIRVSKAGRDVTKYP-VPECMCNNQTTP  456



>ref|XP_006579000.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF +T  G  F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  389  DYTVCLHSEVF-VTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLA-LLFDNPNIRWEV  446

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R + +  T  +  G S+Y +P   +CMC   E
Sbjct  447  FKQQMKDMLRHSDQKGTELKKAGESLYTFP-MPDCMCRQAE  486



>ref|XP_006578999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=566

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  455  DYTVCLHSEVFVTTQGGN-FPHFLMGHRRYMYGGHAKTIKPDKRRLA-LLFDNPNIRWEV  512

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R + +  T  +  G S+Y +P   +CMC   E
Sbjct  513  FKQQMKDMLRHSDQKGTELKKAGESLYTFP-MPDCMCRQAE  552



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF +T  G  F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  455  DYTVCLHSEVF-VTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLA-LLFDNPNIRWEV  512

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R + +  T  +  G S+Y +P   +CMC   E
Sbjct  513  FKQQMKDMLRHSDQKGTELKKAGESLYTFP-MPDCMCRQAE  552



>ref|XP_009147015.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=566

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+IVC  SDVF M   G      I G+R Y G  K+  I PNKR++   +F N ++    
Sbjct  466  DYIVCKESDVF-MASHGGNMGRAIQGHRAYEGHKKL--ITPNKRQMLP-YFLNTSMTETE  521

Query  466  FEKRVRKAVRQN---KRVFTRPVGRSVYRYPRCHECMCNNTEVP  344
            FEK ++K  RQ+     +     GR V +YP   ECMCNN   P
Sbjct  522  FEKMMKKLHRQSLGQPEIRVSKAGRDVTKYP-VPECMCNNQSTP  564



>emb|CDY35972.1| BnaA05g29780D [Brassica napus]
Length=566

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+IVC  SDVF M   G      I G+R Y G  K+  I PNKR++   +F N ++    
Sbjct  466  DYIVCKESDVF-MASHGGNMGRAIQGHRAYEGHKKL--ITPNKRQMLP-YFLNTSMTETE  521

Query  466  FEKRVRKAVRQN---KRVFTRPVGRSVYRYPRCHECMCNNTEVP  344
            FEK ++K  RQ+     +     GR V +YP   ECMCNN   P
Sbjct  522  FEKMMKKLHRQSLGQPEIRVSKAGRDVTKYP-VPECMCNNQSTP  564



>ref|XP_007148603.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
 gb|ESW20597.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
Length=565

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF +T  G  F   + G+R Y   G   TI+P+KR+LA + F N  I W+ 
Sbjct  459  DYTVCLHSEVF-VTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRKLA-LLFDNPNIRWEE  516

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTEVPPPN  335
            F+++++  +R + +  T  + VG SVY +P   +CMC   E+   N
Sbjct  517  FKQQMKDMLRHSDQKGTELKKVGGSVYTFP-MPDCMCKQAELKREN  561



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y   G   TI+P+KR+LA + F N  I WK 
Sbjct  464  DYTVCLHSEVFVSTQGGN-FPHFLVGHRRYLYEGHAKTIKPDKRKLA-LLFDNPNIRWKD  521

Query  466  FEKRVRKAVRQN--KRVFTRPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R +  K V TR    S+Y YP   +CMC + +
Sbjct  522  FKRQLQDMLRHSDVKGVETRKPSGSLYTYP-MPDCMCKHAD  561



>ref|XP_006582446.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF +T  G  F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  389  DYTVCLHSEVF-ITTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLA-LLFDNPNIRWEV  446

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F++++   +R + +  T  +  G S+Y +P   +CMC   E
Sbjct  447  FKQQMTDMLRHSDQKGTEIKKAGGSLYTFP-MPDCMCKQVE  486



>ref|XP_003526401.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN20543.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF +T  G  F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  455  DYTVCLHSEVF-ITTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLA-LLFDNPNIRWEV  512

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F++++   +R + +  T  +  G S+Y +P   +CMC   E
Sbjct  513  FKQQMTDMLRHSDQKGTEIKKAGGSLYTFP-MPDCMCKQVE  552



>gb|AFK46212.1| unknown [Medicago truncatula]
Length=359

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  248  DYTVCLHSEVFVTTQGGN-FPHFLMGHRRYMYGGHSKTIKPDKRRLA-LLFDNPNIRWEV  305

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R + +  T  +    S+Y +P   +CMC   E
Sbjct  306  FKQQMKDMLRHSDQKGTGVKKASESLYTFP-MPDCMCKQVE  345



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y   G   TI+P+KRRLA + F N  I W+V
Sbjct  451  DYTVCLHSEVFVTTQGGN-FPHFLMGHRRYMYGGHSKTIKPDKRRLA-LLFDNPNIRWEV  508

Query  466  FEKRVRKAVRQNKRVFT--RPVGRSVYRYPRCHECMCNNTE  350
            F+++++  +R + +  T  +    S+Y +P   +CMC   E
Sbjct  509  FKQQMKDMLRHSDQKGTEVKKASESLYTFP-MPDCMCKQVE  548



>ref|XP_010104478.1| hypothetical protein L484_025447 [Morus notabilis]
 gb|EXC01079.1| hypothetical protein L484_025447 [Morus notabilis]
Length=256

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y   G   TI+P+KR+LA + F N  I W+ 
Sbjct  147  DYTVCLHSEVFVTTQGGN-FPHFLMGHRRYLYGGHAKTIKPDKRKLA-VLFDNPKIRWED  204

Query  466  FEKRVRKAVRQN--KRVFTRPVGRSVYRYPRCHECMCNNTEVPPPN  335
            F++++R  +R +  K +  R    S+Y +P   +CMC   E    N
Sbjct  205  FKRQMRDMLRHSDQKGIELRKPSGSLYTFP-MPDCMCKQAEARTEN  249



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 5/101 (5%)
 Frame = -3

Query  646  DFIVCSASDVFAMTDSGSQFSSLISGYRVYYGRGKMPTIRPNKRRLADIFFKNNTIEWKV  467
            D+ VC  S+VF  T  G+ F   + G+R Y  +G   TI+P+KR+L  + F N  I W  
Sbjct  469  DYTVCLHSEVFVSTQGGN-FPHFLMGHRRYLYKGHAKTIKPDKRKLVQL-FDNPNIRWDY  526

Query  466  FEKRVRKAVRQN--KRVFTRPVGRSVYRYPRCHECMCNNTE  350
            F+K+++  +R N  K V  R    S+Y +P   +CMC   E
Sbjct  527  FKKQMQDMLRHNDAKGVELRKPASSLYTFP-MPDCMCKEPE  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1422033592588