BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24624_g1_i1 len=1373 path=[1:0-98 100:99-140 142:141-218
220:219-257 4130:258-282 284:283-308 310:309-456 458:457-566
568:567-590 592:591-647 649:648-726 728:727-785 787:786-828
830:829-914 916:915-1372]

Length=1373
                                                                      Score     E

ref|XP_009596350.1|  PREDICTED: probable cinnamyl alcohol dehydro...    558   0.0      
ref|XP_009775562.1|  PREDICTED: probable cinnamyl alcohol dehydro...    555   0.0      
gb|ACV74414.1|  putative cinnamyl alcohol dehydrogenase                 553   0.0      Camellia sinensis [black tea]
gb|KDP36885.1|  hypothetical protein JCGZ_08176                         548   0.0      
ref|XP_004233212.1|  PREDICTED: probable cinnamyl alcohol dehydro...    547   0.0      
ref|XP_010266028.1|  PREDICTED: probable cinnamyl alcohol dehydro...    542   0.0      
gb|KDO84939.1|  hypothetical protein CISIN_1g018158mg                   542   0.0      
ref|XP_002510582.1|  alcohol dehydrogenase, putative                    542   0.0      Ricinus communis
ref|XP_006473703.1|  PREDICTED: probable cinnamyl alcohol dehydro...    542   0.0      
ref|XP_006435236.1|  hypothetical protein CICLE_v10001618mg             540   0.0      
ref|XP_011083448.1|  PREDICTED: probable cinnamyl alcohol dehydro...    539   0.0      
ref|XP_007017876.1|  Cinnamyl alcohol dehydrogenase 9                   538   0.0      
emb|CBI19922.3|  unnamed protein product                                534   0.0      
ref|XP_009623076.1|  PREDICTED: probable cinnamyl alcohol dehydro...    534   0.0      
ref|XP_002269356.2|  PREDICTED: probable cinnamyl alcohol dehydro...    535   0.0      Vitis vinifera
gb|EYU17576.1|  hypothetical protein MIMGU_mgv1a008846mg                532   0.0      
gb|ACQ59091.1|  cinnamyl alcohol dehydrogenase 3                        531   0.0      
gb|KHG08440.1|  putative cinnamyl alcohol dehydrogenase 6               531   0.0      
ref|XP_011034982.1|  PREDICTED: probable cinnamyl alcohol dehydro...    531   0.0      
gb|AGU43757.1|  cinnamyl alcohol dehydrogenase 3                        530   0.0      
gb|KHN39408.1|  Putative cinnamyl alcohol dehydrogenase 6               530   0.0      
ref|XP_009767608.1|  PREDICTED: probable cinnamyl alcohol dehydro...    531   0.0      
emb|CDP07361.1|  unnamed protein product                                529   0.0      
ref|XP_004291336.1|  PREDICTED: probable cinnamyl alcohol dehydro...    529   0.0      
ref|XP_010061094.1|  PREDICTED: probable cinnamyl alcohol dehydro...    528   0.0      
ref|XP_008466466.1|  PREDICTED: probable cinnamyl alcohol dehydro...    527   0.0      
ref|XP_004136373.1|  PREDICTED: probable cinnamyl alcohol dehydro...    527   0.0      
ref|NP_001242314.1|  uncharacterized protein LOC100820588               527   0.0      
ref|XP_006356896.1|  PREDICTED: probable cinnamyl alcohol dehydro...    526   0.0      
ref|XP_002301953.1|  hypothetical protein POPTR_0002s01990g             526   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008221221.1|  PREDICTED: probable cinnamyl alcohol dehydro...    525   0.0      
ref|XP_004231578.1|  PREDICTED: probable cinnamyl alcohol dehydro...    522   0.0      
ref|XP_007222094.1|  hypothetical protein PRUPE_ppa007634mg             521   1e-180   
ref|XP_009400342.1|  PREDICTED: probable cinnamyl alcohol dehydro...    520   4e-180   
ref|XP_010061091.1|  PREDICTED: probable cinnamyl alcohol dehydro...    520   7e-180   
ref|XP_010666914.1|  PREDICTED: probable cinnamyl alcohol dehydro...    520   8e-180   
ref|NP_001242404.1|  uncharacterized protein LOC100779140               518   3e-179   
ref|XP_008359757.1|  PREDICTED: probable cinnamyl alcohol dehydro...    517   1e-178   
ref|XP_010061092.1|  PREDICTED: probable cinnamyl alcohol dehydro...    515   3e-178   
ref|XP_004499301.1|  PREDICTED: probable cinnamyl alcohol dehydro...    515   5e-178   
ref|XP_009334729.1|  PREDICTED: probable cinnamyl alcohol dehydro...    515   6e-178   
ref|XP_007160636.1|  hypothetical protein PHAVU_001G004000g             513   4e-177   
ref|XP_008807131.1|  PREDICTED: probable cinnamyl alcohol dehydro...    512   5e-177   
ref|XP_010061095.1|  PREDICTED: probable cinnamyl alcohol dehydro...    512   8e-177   
ref|XP_008807129.1|  PREDICTED: probable cinnamyl alcohol dehydro...    509   9e-176   
ref|XP_003589548.1|  Cinnamyl alcohol dehydrogenase-related protein     507   5e-175   
ref|XP_008807127.1|  PREDICTED: probable cinnamyl alcohol dehydro...    506   2e-174   
ref|XP_010920094.1|  PREDICTED: probable cinnamyl alcohol dehydro...    506   2e-174   
gb|AHF20169.1|  cinnamyl alcohol dehydrogenase                          487   2e-167   
ref|XP_006652134.1|  PREDICTED: probable cinnamyl alcohol dehydro...    474   7e-162   
ref|NP_001052290.1|  Os04g0229100                                       473   9e-162   Oryza sativa Japonica Group [Japonica rice]
gb|KCW67988.1|  hypothetical protein EUGRSUZ_F01678                     472   2e-161   
ref|NP_001136687.1|  putative cinnamyl-alcohol dehydrogenase fami...    473   2e-161   Zea mays [maize]
ref|XP_002446076.1|  hypothetical protein SORBIDRAFT_06g001430          470   3e-160   Sorghum bicolor [broomcorn]
gb|EPS69932.1|  hypothetical protein M569_04831                         469   6e-160   
gb|EEC76612.1|  hypothetical protein OsI_14481                          473   8e-160   Oryza sativa Indica Group [Indian rice]
ref|XP_004244822.2|  PREDICTED: probable cinnamyl alcohol dehydro...    468   1e-159   
ref|XP_006351089.1|  PREDICTED: probable cinnamyl alcohol dehydro...    468   1e-159   
ref|XP_004975118.1|  PREDICTED: probable cinnamyl alcohol dehydro...    468   2e-159   
dbj|BAK01962.1|  predicted protein                                      464   3e-158   
ref|XP_003581549.1|  PREDICTED: probable cinnamyl alcohol dehydro...    463   1e-157   
ref|XP_004975280.1|  PREDICTED: probable cinnamyl alcohol dehydro...    442   1e-149   
ref|XP_009334738.1|  PREDICTED: probable cinnamyl alcohol dehydro...    429   2e-145   
gb|EMT20116.1|  Putative cinnamyl alcohol dehydrogenase 6               431   4e-145   
ref|XP_010920095.1|  PREDICTED: probable cinnamyl alcohol dehydro...    421   1e-141   
gb|KCW67987.1|  hypothetical protein EUGRSUZ_F01677                     419   2e-141   
gb|KHN12623.1|  Putative cinnamyl alcohol dehydrogenase 6               410   7e-138   
ref|XP_006851414.1|  hypothetical protein AMTR_s00040p00072630          402   6e-134   
ref|XP_010244709.1|  PREDICTED: probable mannitol dehydrogenase         400   8e-133   
gb|AAM95578.1|  putative sinapyl alcohol dehydrogenase                  394   2e-130   Populus tremula x Populus tremuloides
gb|ADG46005.1|  cinnamyl alcohol dehydrogenase                          392   5e-130   
gb|AFZ78656.1|  sinapyl alcohol dehydrogenase                           391   1e-129   
ref|XP_011097458.1|  PREDICTED: probable mannitol dehydrogenase         391   2e-129   
emb|CDX72704.1|  BnaC07g47260D                                          390   3e-129   
ref|XP_006411735.1|  hypothetical protein EUTSA_v10025545mg             390   3e-129   
ref|XP_009101881.1|  PREDICTED: probable cinnamyl alcohol dehydro...    390   4e-129   
ref|NP_001267599.1|  probable mannitol dehydrogenase-like               389   8e-129   
ref|XP_008440516.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    389   8e-129   
gb|ABK26008.1|  unknown                                                 389   9e-129   Picea sitchensis
ref|XP_010446472.1|  PREDICTED: probable cinnamyl alcohol dehydro...    388   3e-128   
gb|AGU43751.1|  cinnamyl alcohol dehydrogenase 9                        388   3e-128   
gb|KDO53382.1|  hypothetical protein CISIN_1g018246mg                   387   4e-128   
ref|XP_011045697.1|  PREDICTED: probable cinnamyl alcohol dehydro...    387   6e-128   
ref|XP_006283984.1|  hypothetical protein CARUB_v10005116mg             387   6e-128   
ref|XP_010437051.1|  PREDICTED: probable cinnamyl alcohol dehydro...    387   7e-128   
ref|XP_009773447.1|  PREDICTED: probable mannitol dehydrogenase         387   9e-128   
ref|XP_002279832.1|  PREDICTED: probable mannitol dehydrogenase         387   1e-127   Vitis vinifera
ref|XP_008785257.1|  PREDICTED: LOW QUALITY PROTEIN: 8-hydroxyger...    386   1e-127   
ref|XP_008809345.1|  PREDICTED: probable mannitol dehydrogenase         386   2e-127   
ref|XP_011100934.1|  PREDICTED: probable mannitol dehydrogenase         386   2e-127   
ref|XP_004288495.1|  PREDICTED: probable mannitol dehydrogenase-like    386   2e-127   
emb|CDP19913.1|  unnamed protein product                                386   2e-127   
ref|XP_006427864.1|  hypothetical protein CICLE_v10025939mg             385   4e-127   
gb|KDP35308.1|  hypothetical protein JCGZ_09467                         385   4e-127   
ref|XP_010431900.1|  PREDICTED: probable cinnamyl alcohol dehydro...    385   6e-127   
ref|XP_010241689.1|  PREDICTED: probable cinnamyl alcohol dehydro...    384   7e-127   
ref|XP_010241688.1|  PREDICTED: probable cinnamyl alcohol dehydro...    385   7e-127   
ref|XP_010241687.1|  PREDICTED: probable cinnamyl alcohol dehydro...    384   8e-127   
gb|KFK30507.1|  hypothetical protein AALP_AA7G271000                    384   1e-126   
gb|EEE60360.1|  hypothetical protein OsJ_13484                          393   2e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002300211.1|  mannitol dehydrogenase 1 family protein            384   2e-126   Populus trichocarpa [western balsam poplar]
gb|ACN40687.1|  unknown                                                 384   2e-126   Picea sitchensis
ref|XP_009387440.1|  PREDICTED: probable mannitol dehydrogenase         383   2e-126   
gb|ABK94550.1|  unknown                                                 383   3e-126   Populus trichocarpa [western balsam poplar]
ref|XP_009117369.1|  PREDICTED: cinnamyl alcohol dehydrogenase 2        382   4e-126   
gb|KDO60515.1|  hypothetical protein CISIN_1g0180941mg                  382   7e-126   
gb|ABK21490.1|  unknown                                                 382   8e-126   Picea sitchensis
gb|KHG29850.1|  putative mannitol dehydrogenase                         381   1e-125   
ref|XP_006426239.1|  hypothetical protein CICLE_v10025933mg             381   1e-125   
ref|XP_006466345.1|  PREDICTED: probable mannitol dehydrogenase-like    381   1e-125   
gb|KDO60514.1|  hypothetical protein CISIN_1g0180941mg                  381   1e-125   
ref|XP_008236513.1|  PREDICTED: probable mannitol dehydrogenase         380   3e-125   
ref|XP_006355137.1|  PREDICTED: probable cinnamyl alcohol dehydro...    380   3e-125   
ref|XP_008338758.1|  PREDICTED: probable mannitol dehydrogenase         380   4e-125   
gb|EPS72626.1|  10-hydroxygeraniol oxidoreductase                       380   5e-125   
ref|XP_010555305.1|  PREDICTED: probable cinnamyl alcohol dehydro...    380   5e-125   
ref|XP_009350500.1|  PREDICTED: probable mannitol dehydrogenase         380   5e-125   
ref|XP_004307159.1|  PREDICTED: probable mannitol dehydrogenase-like    380   6e-125   
ref|XP_010066666.1|  PREDICTED: probable mannitol dehydrogenase         379   6e-125   
ref|XP_007205415.1|  hypothetical protein PRUPE_ppa007626mg             379   1e-124   
ref|XP_003635278.1|  PREDICTED: probable mannitol dehydrogenase         379   1e-124   
ref|XP_002530071.1|  alcohol dehydrogenase, putative                    379   1e-124   Ricinus communis
ref|XP_007205414.1|  hypothetical protein PRUPE_ppa007622mg             379   1e-124   
ref|XP_010531428.1|  PREDICTED: probable cinnamyl alcohol dehydro...    379   1e-124   
ref|XP_002534367.1|  alcohol dehydrogenase, putative                    379   1e-124   Ricinus communis
ref|NP_001240222.1|  uncharacterized protein LOC100809071               379   2e-124   
ref|XP_002534365.1|  alcohol dehydrogenase, putative                    379   2e-124   Ricinus communis
ref|XP_010416928.1|  PREDICTED: cinnamyl alcohol dehydrogenase 2 ...    378   2e-124   
gb|AEA36767.1|  cinnamyl alcohol dehydrogenase                          378   2e-124   
ref|XP_007205421.1|  hypothetical protein PRUPE_ppa007668mg             378   2e-124   
emb|CAN77732.1|  hypothetical protein VITISV_036461                     378   2e-124   Vitis vinifera
ref|XP_011025421.1|  PREDICTED: probable mannitol dehydrogenase         378   3e-124   
gb|AAA99511.1|  cinnamyl-alcohol dehydrogenase                          378   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236481.1|  PREDICTED: probable mannitol dehydrogenase         378   3e-124   
ref|XP_002866841.1|  hypothetical protein ARALYDRAFT_912392             377   3e-124   
ref|NP_195643.1|  putative cinnamyl alcohol dehydrogenase 9             377   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011042531.1|  PREDICTED: probable mannitol dehydrogenase         378   3e-124   
ref|XP_008236492.1|  PREDICTED: probable mannitol dehydrogenase         377   4e-124   
ref|XP_004235066.1|  PREDICTED: probable cinnamyl alcohol dehydro...    377   4e-124   
gb|AAA74746.1|  cinnamyl-alcohol dehydrogenase                          377   4e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272479.1|  PREDICTED: probable mannitol dehydrogenase         377   4e-124   Vitis vinifera
ref|XP_006294485.1|  hypothetical protein CARUB_v10023512mg             377   4e-124   
ref|XP_003612978.1|  Mannitol dehydrogenase                             377   4e-124   
gb|AEE69008.1|  cinnamyl alcohol dehydrogenase 3                        377   4e-124   
ref|XP_007205416.1|  hypothetical protein PRUPE_ppa007626mg             377   4e-124   
emb|CDP01607.1|  unnamed protein product                                377   5e-124   
gb|KFK32866.1|  hypothetical protein AALP_AA6G297300                    377   5e-124   
sp|Q9ZRF1.1|MTDH_FRAAN  RecName: Full=Probable mannitol dehydroge...    377   6e-124   Fragaria x ananassa
ref|XP_010429094.1|  PREDICTED: cinnamyl alcohol dehydrogenase 3-...    377   7e-124   
ref|NP_001289257.1|  8-hydroxygeraniol dehydrogenase-like               376   1e-123   
gb|AGU43754.1|  cinnamyl alcohol dehydrogenase 6                        376   1e-123   
ref|XP_002313294.2|  hypothetical protein POPTR_0009s06770g             376   2e-123   Populus trichocarpa [western balsam poplar]
gb|AAM64913.1|  cinnamyl-alcohol dehydrogenase CAD1                     376   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313297.2|  hypothetical protein POPTR_0009s06740g             376   2e-123   Populus trichocarpa [western balsam poplar]
gb|ADK63098.1|  cinnamyl alcohol dehydrogenase                          375   2e-123   
ref|XP_004512560.1|  PREDICTED: probable mannitol dehydrogenase-like    375   2e-123   
gb|AGY96956.1|  mannitol dehydrogenase 1                                375   2e-123   
ref|XP_004288323.1|  PREDICTED: probable cinnamyl alcohol dehydro...    375   4e-123   
gb|AFQ36034.1|  cinnamyl alcohol dehydrogenase                          375   4e-123   
ref|XP_002322761.2|  cinnamyl-alcohol dehydrogenase family protein      375   4e-123   Populus trichocarpa [western balsam poplar]
gb|AFK47110.1|  unknown                                                 375   4e-123   
ref|XP_003612973.1|  Cinnamyl alcohol dehydrogenase                     375   5e-123   
ref|XP_010095885.1|  putative mannitol dehydrogenase                    375   5e-123   
emb|CDX76968.1|  BnaC08g35540D                                          374   5e-123   
ref|XP_010052660.1|  PREDICTED: probable mannitol dehydrogenase         374   6e-123   
ref|XP_003635434.1|  PREDICTED: probable mannitol dehydrogenase         374   7e-123   
ref|XP_003517258.1|  PREDICTED: probable mannitol dehydrogenase         374   8e-123   
ref|XP_010472167.1|  PREDICTED: cinnamyl alcohol dehydrogenase 3-...    374   9e-123   
ref|XP_007158345.1|  hypothetical protein PHAVU_002G144800g             374   1e-122   
gb|ACC63874.1|  cinnamyl alcohol dehydrogenase                          374   1e-122   Populus trichocarpa [western balsam poplar]
gb|EYU45817.1|  hypothetical protein MIMGU_mgv1a008879mg                374   1e-122   
ref|XP_003635436.1|  PREDICTED: probable mannitol dehydrogenase i...    374   1e-122   
ref|XP_008384197.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    374   1e-122   
emb|CDY13791.1|  BnaA09g42930D                                          373   2e-122   
ref|XP_007211488.1|  hypothetical protein PRUPE_ppa007678mg             373   2e-122   
ref|XP_006379103.1|  hypothetical protein POPTR_0009s06780g             373   2e-122   
ref|XP_009767330.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    373   2e-122   
ref|XP_002309270.2|  mannitol dehydrogenase 1 family protein            373   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009419520.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    373   3e-122   
ref|XP_010647499.1|  PREDICTED: probable mannitol dehydrogenase         373   3e-122   
ref|XP_010095884.1|  putative mannitol dehydrogenase                    372   3e-122   
ref|XP_011097456.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase         372   3e-122   
ref|XP_010040581.1|  PREDICTED: probable mannitol dehydrogenase         372   4e-122   
gb|AAW45741.1|  sinapyl alcohol dehydrogenase-like protein              372   5e-122   Populus tremula x Populus tremuloides
ref|XP_004512563.1|  PREDICTED: probable mannitol dehydrogenase-like    372   5e-122   
ref|NP_179765.1|  cinnamyl alcohol dehydrogenase 2                      372   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322822.1|  mannitol dehydrogenase family protein              372   8e-122   Populus trichocarpa [western balsam poplar]
ref|XP_007048215.1|  Cinnamyl alcohol dehydrogenase 9 isoform 1         372   8e-122   
dbj|BAN91672.1|  cinnamyl alcohol dehydrogenase 3                       372   8e-122   
gb|KHG20287.1|  putative mannitol dehydrogenase                         372   9e-122   
ref|XP_011004094.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    371   1e-121   
gb|AGU43756.1|  cinnamyl alcohol dehydrogenase 2                        371   1e-121   
ref|XP_006851411.1|  hypothetical protein AMTR_s00040p00069200          391   1e-121   
emb|CDP01602.1|  unnamed protein product                                383   1e-121   
ref|NP_179780.1|  cinnamyl alcohol dehydrogenase-like protein 3         371   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878570.1|  hypothetical protein ARALYDRAFT_320022             371   2e-121   
ref|XP_007207965.1|  hypothetical protein PRUPE_ppa016455mg             370   3e-121   
gb|AAQ20892.1|  10-hydroxygeraniol oxidoreductase                       370   3e-121   Camptotheca acuminata
ref|XP_002279718.1|  PREDICTED: probable cinnamyl alcohol dehydro...    370   3e-121   Vitis vinifera
ref|XP_007158342.1|  hypothetical protein PHAVU_002G144500g             370   3e-121   
ref|XP_002276703.1|  PREDICTED: probable mannitol dehydrogenase         370   3e-121   Vitis vinifera
gb|ABK96585.1|  unknown                                                 370   4e-121   Populus trichocarpa x Populus deltoides
pdb|1YQD|A  Chain A, Sinapyl Alcohol Dehydrogenase Complexed With...    370   4e-121   
ref|XP_011047124.1|  PREDICTED: probable mannitol dehydrogenase         369   5e-121   
ref|XP_003612984.1|  Cinnamyl alcohol dehydrogenase                     369   5e-121   
gb|AGU43758.1|  cinnamyl alcohol dehydrogenase 5                        369   8e-121   
gb|AAK58693.1|AF273256_1  sinapyl alcohol dehydrogenase                 369   8e-121   Populus tremuloides
ref|XP_010680374.1|  PREDICTED: probable mannitol dehydrogenase         369   1e-120   
gb|KHN04905.1|  Putative mannitol dehydrogenase                         369   1e-120   
ref|NP_001147726.1|  LOC100281336                                       371   1e-120   Zea mays [maize]
gb|AFW57003.1|  putative cinnamyl-alcohol dehydrogenase family pr...    369   1e-120   
ref|XP_009364795.1|  PREDICTED: probable mannitol dehydrogenase         369   1e-120   
ref|XP_003612986.1|  Cinnamyl alcohol dehydrogenase                     369   1e-120   
gb|AFY63474.1|  geraniol dehydrogenase                                  368   2e-120   
ref|XP_008236460.1|  PREDICTED: probable mannitol dehydrogenase         368   2e-120   
ref|XP_007047728.1|  Cinnamyl alcohol dehydrogenase 6                   368   2e-120   
gb|KHG24369.1|  putative cinnamyl alcohol dehydrogenase 9 -like p...    368   2e-120   
gb|ABZ01816.1|  cinnamyl alcohol dehydrogenase                          367   4e-120   Gossypium hirsutum [American cotton]
ref|XP_006411831.1|  hypothetical protein EUTSA_v10025540mg             367   4e-120   
ref|XP_003612989.1|  Cinnamyl alcohol dehydrogenase                     367   4e-120   
ref|XP_010911601.1|  PREDICTED: probable mannitol dehydrogenase         367   5e-120   
ref|XP_006466346.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    368   5e-120   
ref|XP_007047730.1|  Geraniol dehydrogenase 1                           367   5e-120   
gb|KDP29760.1|  hypothetical protein JCGZ_18695                         367   7e-120   
ref|XP_010680373.1|  PREDICTED: probable mannitol dehydrogenase         366   8e-120   
ref|XP_008460921.1|  PREDICTED: probable mannitol dehydrogenase         366   1e-119   
ref|XP_011025422.1|  PREDICTED: probable mannitol dehydrogenase         366   1e-119   
gb|KDP29800.1|  hypothetical protein JCGZ_18735                         366   1e-119   
gb|AFY63473.1|  geraniol dehydrogenase                                  366   1e-119   
ref|XP_010027970.1|  PREDICTED: probable mannitol dehydrogenase         365   2e-119   
gb|EYU24070.1|  hypothetical protein MIMGU_mgv1a009042mg                365   2e-119   
ref|XP_007206542.1|  hypothetical protein PRUPE_ppa018829mg             365   2e-119   
ref|XP_002868956.1|  hypothetical protein ARALYDRAFT_490819             365   2e-119   
ref|XP_006466347.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    365   2e-119   
ref|NP_001064659.2|  Os10g0430200                                       365   3e-119   Oryza sativa Japonica Group [Japonica rice]
sp|Q2KNL6.1|GEDH1_OCIBA  RecName: Full=Geraniol dehydrogenase 1; ...    365   3e-119   Ocimum basilicum [basil]
ref|XP_010056832.1|  PREDICTED: probable mannitol dehydrogenase         365   3e-119   
ref|XP_003635435.1|  PREDICTED: probable mannitol dehydrogenase         365   4e-119   
ref|NP_001241491.1|  uncharacterized protein LOC100819684               364   5e-119   
ref|XP_009801633.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    364   5e-119   
ref|NP_001241232.1|  uncharacterized protein LOC100795575               364   5e-119   
ref|XP_010054512.1|  PREDICTED: probable mannitol dehydrogenase         366   6e-119   
ref|XP_004171787.1|  PREDICTED: probable mannitol dehydrogenase-like    364   6e-119   
ref|XP_004151454.1|  PREDICTED: probable cinnamyl alcohol dehydro...    364   7e-119   
emb|CDX69347.1|  BnaC01g01060D                                          364   7e-119   
gb|AHX58273.1|  cinnamyl alcohol dehydrogenase 7                        364   8e-119   
ref|XP_003612977.1|  Cinnamyl alcohol dehydrogenase                     364   8e-119   
ref|XP_010025539.1|  PREDICTED: probable cinnamyl alcohol dehydro...    363   9e-119   
ref|XP_007158344.1|  hypothetical protein PHAVU_002G144700g             363   9e-119   
gb|AFQ59973.1|  nerol dehydrogenase                                     364   9e-119   
ref|XP_009335148.1|  PREDICTED: probable mannitol dehydrogenase         363   1e-118   
gb|AAK28509.1|  cinnamyl alcohol dehydrogenase                          363   1e-118   Fragaria x ananassa
gb|AFY63472.1|  geraniol dehydrogenase                                  363   1e-118   
gb|AEI54337.1|  cinnamyl-alcohol dehydrogenase                          363   1e-118   
ref|XP_004512561.1|  PREDICTED: probable mannitol dehydrogenase-like    363   1e-118   
ref|XP_008236524.1|  PREDICTED: probable mannitol dehydrogenase         363   1e-118   
ref|XP_002534286.1|  alcohol dehydrogenase, putative                    363   1e-118   Ricinus communis
gb|KCW76736.1|  hypothetical protein EUGRSUZ_D01091                     363   1e-118   
ref|XP_008353959.1|  PREDICTED: probable mannitol dehydrogenase         363   2e-118   
ref|XP_008384087.1|  PREDICTED: probable mannitol dehydrogenase         363   2e-118   
ref|XP_008351726.1|  PREDICTED: probable mannitol dehydrogenase         363   2e-118   
ref|XP_008367678.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    363   2e-118   
ref|XP_008236471.1|  PREDICTED: probable mannitol dehydrogenase         363   2e-118   
sp|P93257.1|MTDH_MESCR  RecName: Full=Probable mannitol dehydroge...    363   2e-118   Mesembryanthemum crystallinum
ref|XP_003635280.1|  PREDICTED: probable mannitol dehydrogenase         363   2e-118   
ref|XP_006283970.1|  hypothetical protein CARUB_v10005093mg             363   2e-118   
ref|XP_007206856.1|  hypothetical protein PRUPE_ppa027148mg             363   2e-118   
ref|XP_008231559.1|  PREDICTED: probable mannitol dehydrogenase         363   3e-118   
dbj|BAJ86533.1|  predicted protein                                      363   3e-118   
ref|XP_002313293.2|  hypothetical protein POPTR_0009s06790g             363   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_003628882.1|  Cinnamyl alcohol dehydrogenase                     362   3e-118   
gb|AFX98062.1|  cinnamyl alcohol dehydrogenase                          362   4e-118   
dbj|BAJ94260.1|  predicted protein                                      362   4e-118   
dbj|BAJ91956.1|  predicted protein                                      362   4e-118   
gb|AES95930.2|  cinnamyl alcohol dehydrogenase-like protein             362   4e-118   
ref|NP_195510.1|  cinnamyl-alcohol dehydrogenase 6                      362   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288496.1|  PREDICTED: probable mannitol dehydrogenase-like    362   4e-118   
ref|XP_008236420.1|  PREDICTED: probable mannitol dehydrogenase         362   5e-118   
ref|XP_010058928.1|  PREDICTED: probable mannitol dehydrogenase         362   5e-118   
ref|XP_010088733.1|  putative cinnamyl alcohol dehydrogenase 9          369   5e-118   
ref|XP_011083435.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    362   6e-118   
ref|XP_009759254.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    362   6e-118   
ref|XP_008809350.1|  PREDICTED: putative cinnamyl alcohol dehydro...    362   7e-118   
ref|XP_010054514.1|  PREDICTED: probable mannitol dehydrogenase         361   8e-118   
ref|XP_003635250.1|  PREDICTED: probable mannitol dehydrogenase         361   1e-117   
ref|XP_006364647.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    360   1e-117   
ref|XP_006426236.1|  hypothetical protein CICLE_v10025755mg             362   1e-117   
gb|KEH27726.1|  cinnamyl alcohol dehydrogenase-like protein             360   2e-117   
ref|XP_004250169.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    360   2e-117   
ref|XP_008338488.1|  PREDICTED: probable mannitol dehydrogenase         360   2e-117   
gb|ADD81206.1|  sinapyl alcohol dehydrogenase-like 3                    360   2e-117   
dbj|BAE48786.1|  10-hydroxygeraniol oxidoreductase                      360   2e-117   
ref|XP_002445214.1|  hypothetical protein SORBIDRAFT_07g006090          360   2e-117   
ref|XP_009364231.1|  PREDICTED: probable mannitol dehydrogenase         360   2e-117   
sp|P42754.1|MTDH_PETCR  RecName: Full=Mannitol dehydrogenase; Alt...    359   3e-117   
ref|XP_010446605.1|  PREDICTED: probable cinnamyl alcohol dehydro...    360   3e-117   
ref|XP_008386378.1|  PREDICTED: probable mannitol dehydrogenase         360   3e-117   
gb|EPS74150.1|  geraniol dehydrogenase 1                                359   4e-117   
ref|XP_009364797.1|  PREDICTED: probable mannitol dehydrogenase         360   4e-117   
ref|XP_011025073.1|  PREDICTED: probable mannitol dehydrogenase         359   4e-117   
ref|XP_009407801.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    359   4e-117   
gb|AAL99536.1|AF472592_1  cinnamyl alcohol dehydrogenase                360   4e-117   
ref|XP_009764994.1|  PREDICTED: probable mannitol dehydrogenase         359   5e-117   
gb|EYU23717.1|  hypothetical protein MIMGU_mgv1a008843mg                359   5e-117   
ref|XP_006353144.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    359   5e-117   
ref|XP_008236502.1|  PREDICTED: probable mannitol dehydrogenase         359   5e-117   
dbj|BAN91670.1|  cinnamyl alcohol dehydrogenase 1                       359   5e-117   
sp|Q6V4H0.1|10HGO_CATRO  RecName: Full=8-hydroxygeraniol dehydrog...    359   7e-117   
gb|ADD81205.1|  sinapyl alcohol dehydrogenase 2                         359   7e-117   
ref|XP_004296150.1|  PREDICTED: probable mannitol dehydrogenase-like    358   9e-117   
ref|XP_009364796.1|  PREDICTED: probable mannitol dehydrogenase         358   1e-116   
gb|EPS72627.1|  cinnamyl alcohol dehydrogenase                          358   1e-116   
ref|XP_010023424.1|  PREDICTED: probable mannitol dehydrogenase         358   1e-116   
gb|AGU43750.1|  cinnamyl alcohol dehydrogenase 8                        358   1e-116   
ref|XP_004976783.1|  PREDICTED: LOW QUALITY PROTEIN: cinnamyl alc...    358   1e-116   
ref|XP_009419122.1|  PREDICTED: probable mannitol dehydrogenase         358   1e-116   
ref|XP_003612975.1|  Cinnamyl alcohol dehydrogenase                     358   1e-116   
ref|XP_009407800.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    358   1e-116   
ref|XP_007156455.1|  hypothetical protein PHAVU_003G287400g             358   1e-116   
ref|XP_007207887.1|  hypothetical protein PRUPE_ppa021232mg             358   1e-116   
ref|XP_009759255.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    358   2e-116   
ref|XP_007205417.1|  hypothetical protein PRUPE_ppa007627mg             358   2e-116   
gb|ACG44715.1|  mannitol dehydrogenase                                  358   2e-116   
emb|CDP01608.1|  unnamed protein product                                357   2e-116   
ref|XP_010941696.1|  PREDICTED: putative cinnamyl alcohol dehydro...    358   2e-116   
ref|XP_010023422.1|  PREDICTED: probable mannitol dehydrogenase         357   3e-116   
ref|XP_003609401.1|  Cinnamyl alcohol dehydrogenase                     357   3e-116   
ref|XP_006659936.1|  PREDICTED: putative cinnamyl alcohol dehydro...    357   3e-116   
ref|XP_009364226.1|  PREDICTED: probable mannitol dehydrogenase         357   4e-116   
ref|XP_002299950.1|  hypothetical protein POPTR_0001s27550g             357   4e-116   
ref|XP_011083434.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    357   4e-116   
ref|XP_008383728.1|  PREDICTED: probable mannitol dehydrogenase         357   4e-116   
ref|XP_011100037.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    357   5e-116   
ref|XP_009131836.1|  PREDICTED: probable cinnamyl alcohol dehydro...    357   6e-116   
ref|XP_004512559.1|  PREDICTED: probable mannitol dehydrogenase-like    356   7e-116   
sp|Q38707.1|MTDH_APIGR  RecName: Full=Mannitol dehydrogenase; Alt...    356   9e-116   
ref|XP_009592886.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    356   9e-116   
ref|XP_007156456.1|  hypothetical protein PHAVU_003G287500g             355   1e-115   
ref|XP_002963866.1|  hypothetical protein SELMODRAFT_230239             355   1e-115   
ref|XP_006404630.1|  hypothetical protein EUTSA_v10000712mg             355   1e-115   
ref|XP_009609570.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    355   2e-115   
gb|AFX98063.1|  cinnamyl alcohol dehydrogenase                          355   2e-115   
gb|AHF20166.1|  cinnamyl alcohol dehydrogenase                          355   2e-115   
ref|XP_009783463.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    355   2e-115   
gb|AAC61854.1|  mannitol dehydrogenase                                  355   2e-115   
ref|XP_010432011.1|  PREDICTED: probable cinnamyl alcohol dehydro...    355   2e-115   
ref|XP_010547584.1|  PREDICTED: probable cinnamyl alcohol dehydro...    355   3e-115   
gb|EMS45840.1|  Putative cinnamyl alcohol dehydrogenase 5               355   4e-115   
emb|CDP01603.1|  unnamed protein product                                354   5e-115   
ref|XP_004150677.1|  PREDICTED: probable cinnamyl alcohol dehydro...    354   5e-115   
ref|XP_008236534.1|  PREDICTED: probable mannitol dehydrogenase i...    354   6e-115   
ref|XP_010027972.1|  PREDICTED: probable mannitol dehydrogenase         354   6e-115   
ref|NP_001130781.1|  cinnamyl alcohol dehydrogenase1                    354   8e-115   
ref|XP_007159802.1|  hypothetical protein PHAVU_002G268500g             353   1e-114   
gb|EMT14649.1|  Putative cinnamyl alcohol dehydrogenase 5               355   1e-114   
ref|XP_007205411.1|  hypothetical protein PRUPE_ppa007615mg             353   1e-114   
ref|XP_002988269.1|  hypothetical protein SELMODRAFT_426904             353   1e-114   
gb|ADP68546.1|  putative sinapyl alcohol dehydrogenase                  351   2e-114   
ref|XP_002447082.1|  hypothetical protein SORBIDRAFT_06g028240          352   3e-114   
ref|XP_010027971.1|  PREDICTED: probable mannitol dehydrogenase         352   3e-114   
ref|XP_009364233.1|  PREDICTED: probable mannitol dehydrogenase         352   3e-114   
ref|XP_006340040.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    351   5e-114   
ref|XP_008812449.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    352   5e-114   
ref|XP_008460922.1|  PREDICTED: probable cinnamyl alcohol dehydro...    351   6e-114   
ref|XP_008352574.1|  PREDICTED: probable mannitol dehydrogenase         355   8e-114   
sp|Q43137.1|MTDH1_STYHU  RecName: Full=Probable mannitol dehydrog...    350   1e-113   
emb|CDX90392.1|  BnaA08g15920D                                          350   1e-113   
ref|XP_011099958.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    350   1e-113   
ref|XP_011097455.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    350   2e-113   
gb|EMT31529.1|  Putative cinnamyl alcohol dehydrogenase 5               350   2e-113   
ref|XP_010027973.1|  PREDICTED: probable mannitol dehydrogenase         350   2e-113   
ref|XP_006652804.1|  PREDICTED: cinnamyl alcohol dehydrogenase 7-...    350   2e-113   
ref|XP_008236439.1|  PREDICTED: probable mannitol dehydrogenase         350   3e-113   
gb|AFL03407.1|  geraniol dehydrogenase 1                                349   3e-113   
gb|ADD81208.1|  sinapyl alcohol dehydrogenase-like 5                    349   3e-113   
ref|XP_011097453.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    349   4e-113   
emb|CDP13328.1|  unnamed protein product                                353   4e-113   
emb|CBI18803.3|  unnamed protein product                                348   6e-113   
ref|XP_002994000.1|  hypothetical protein SELMODRAFT_187673             348   6e-113   
ref|XP_009764993.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    348   6e-113   
ref|XP_009623568.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    348   8e-113   
gb|EYU30917.1|  hypothetical protein MIMGU_mgv1a008848mg                348   9e-113   
gb|AFN44009.1|  cinnamyl alcohol dehydrogenase                          348   9e-113   
gb|EAY95517.1|  hypothetical protein OsI_17363                          348   1e-112   
emb|CBI33197.3|  unnamed protein product                                348   1e-112   
ref|XP_004972583.1|  PREDICTED: putative cinnamyl alcohol dehydro...    348   1e-112   
ref|XP_011083436.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    348   1e-112   
ref|XP_002989906.1|  hypothetical protein SELMODRAFT_428454             347   2e-112   
ref|XP_002271579.3|  PREDICTED: probable mannitol dehydrogenase         348   2e-112   
gb|EAZ06307.1|  hypothetical protein OsI_28541                          347   2e-112   
gb|ADN78309.1|  cinnamyl alcohol dehydrogenase                          348   2e-112   
gb|AEO99200.1|  Cr2141                                                  347   2e-112   
gb|KFK30405.1|  hypothetical protein AALP_AA7G256800                    347   2e-112   
emb|CDP01601.1|  unnamed protein product                                347   2e-112   
ref|XP_002968657.1|  hypothetical protein SELMODRAFT_90947              347   2e-112   
ref|XP_011083438.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    348   3e-112   
ref|XP_009764995.1|  PREDICTED: probable mannitol dehydrogenase         347   3e-112   
sp|P41637.1|CADH_PINTA  RecName: Full=Probable cinnamyl alcohol d...    347   3e-112   
ref|XP_002271374.2|  PREDICTED: probable mannitol dehydrogenase         347   4e-112   
gb|ADP68548.1|  putative sinapyl alcohol dehydrogenase                  345   4e-112   
sp|O82515.1|MTDH_MEDSA  RecName: Full=Probable mannitol dehydroge...    347   4e-112   
gb|AES95941.2|  cinnamyl alcohol dehydrogenase-like protein             347   4e-112   
ref|XP_010680294.1|  PREDICTED: probable mannitol dehydrogenase         347   5e-112   
ref|XP_003573548.1|  PREDICTED: putative cinnamyl alcohol dehydro...    347   6e-112   
ref|XP_003612983.1|  Cinnamyl alcohol dehydrogenase                     359   9e-112   
dbj|BAK03430.1|  predicted protein                                      345   1e-111   
ref|XP_004289513.1|  PREDICTED: uncharacterized protein LOC101304719    364   1e-111   
gb|AAC31166.1|  cinnamyl alcohol dehydrogenase                          345   2e-111   
ref|XP_004250191.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    345   2e-111   
gb|AFK34702.1|  unknown                                                 345   2e-111   
gb|ACN25289.1|  unknown                                                 345   2e-111   
gb|ADP68550.1|  putative sinapyl alcohol dehydrogenase                  343   3e-111   
ref|XP_006659935.1|  PREDICTED: putative cinnamyl alcohol dehydro...    345   3e-111   
gb|ADP68543.1|  putative sinapyl alcohol dehydrogenase                  343   3e-111   
gb|ACJ84730.1|  unknown                                                 344   3e-111   
ref|XP_010113399.1|  putative mannitol dehydrogenase                    344   4e-111   
ref|XP_011097452.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    344   4e-111   
ref|XP_010251429.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    344   4e-111   
gb|AHK60844.1|  CrADH9                                                  344   5e-111   
gb|EPS67580.1|  geraniol dehydrogenase 1                                343   6e-111   
gb|KHN38894.1|  Putative mannitol dehydrogenase                         344   6e-111   
emb|CBL95258.1|  cinnamyl alcohol dehydrogenase                         343   6e-111   
ref|XP_003533426.1|  PREDICTED: probable mannitol dehydrogenase-like    343   7e-111   
emb|CAN78954.1|  hypothetical protein VITISV_033855                     343   8e-111   
sp|Q40976.1|CADH_PINRA  RecName: Full=Probable cinnamyl alcohol d...    343   1e-110   
ref|XP_004250190.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase         343   1e-110   
gb|ADP68549.1|  putative sinapyl alcohol dehydrogenase                  341   1e-110   
gb|ADP68552.1|  putative sinapyl alcohol dehydrogenase                  341   1e-110   
ref|XP_004972588.1|  PREDICTED: LOW QUALITY PROTEIN: probable cin...    343   2e-110   
ref|XP_004503979.1|  PREDICTED: probable mannitol dehydrogenase-like    342   2e-110   
ref|XP_008237214.1|  PREDICTED: probable mannitol dehydrogenase         343   2e-110   
ref|NP_001053848.1|  Os04g0612700                                       343   2e-110   
gb|AFK46246.1|  unknown                                                 342   2e-110   
dbj|BAJ94928.1|  predicted protein                                      342   2e-110   
ref|XP_009615339.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    342   2e-110   
ref|XP_010056826.1|  PREDICTED: probable mannitol dehydrogenase         342   3e-110   
ref|XP_003630177.1|  Cinnamyl-alcohol dehydrogenase                     344   3e-110   
ref|XP_006353146.1|  PREDICTED: probable mannitol dehydrogenase-like    342   3e-110   
gb|AFK43439.1|  unknown                                                 342   3e-110   
ref|XP_006353145.1|  PREDICTED: probable mannitol dehydrogenase-like    342   4e-110   
ref|XP_010025541.1|  PREDICTED: probable mannitol dehydrogenase i...    340   4e-110   
ref|XP_009623570.1|  PREDICTED: probable mannitol dehydrogenase i...    342   4e-110   
ref|XP_004972582.1|  PREDICTED: putative cinnamyl alcohol dehydro...    342   5e-110   
ref|XP_009623569.1|  PREDICTED: probable mannitol dehydrogenase         341   5e-110   
ref|XP_004512564.1|  PREDICTED: probable mannitol dehydrogenase-like    341   6e-110   
emb|CAD29291.1|  alcohol NADP+ oxidoreductase                           341   7e-110   
ref|XP_010939791.1|  PREDICTED: probable mannitol dehydrogenase         340   9e-110   
ref|XP_010025540.1|  PREDICTED: probable mannitol dehydrogenase i...    340   1e-109   
emb|CAA86073.1|  cinnamyl alcohol dehydrogenase                         340   1e-109   
gb|ADP68551.1|  putative sinapyl alcohol dehydrogenase                  338   1e-109   
ref|XP_007153369.1|  hypothetical protein PHAVU_003G029500g             340   1e-109   
ref|XP_006649655.1|  PREDICTED: probable cinnamyl alcohol dehydro...    340   2e-109   
ref|XP_010023416.1|  PREDICTED: probable mannitol dehydrogenase         340   2e-109   
sp|Q0J6T3.2|CADH5_ORYSJ  RecName: Full=Putative cinnamyl alcohol ...    340   2e-109   
gb|ADP68553.1|  putative sinapyl alcohol dehydrogenase                  338   2e-109   
ref|XP_010056787.1|  PREDICTED: probable mannitol dehydrogenase         340   2e-109   
ref|XP_003612993.1|  Cinnamyl alcohol dehydrogenase-like protein        340   2e-109   
ref|XP_006284001.1|  hypothetical protein CARUB_v10005123mg             339   2e-109   
ref|XP_010432010.1|  PREDICTED: cinnamyl alcohol dehydrogenase 8        339   3e-109   
ref|XP_010446601.1|  PREDICTED: cinnamyl alcohol dehydrogenase 8-...    339   3e-109   
ref|XP_001693170.1|  predicted protein                                  339   4e-109   
dbj|BAJ87302.1|  predicted protein                                      341   5e-109   
ref|XP_008384348.1|  PREDICTED: probable mannitol dehydrogenase 1       339   5e-109   
sp|Q08350.1|CADH7_PICAB  RecName: Full=Probable cinnamyl alcohol ...    338   5e-109   
ref|XP_010446604.1|  PREDICTED: cinnamyl alcohol dehydrogenase 7        338   5e-109   
gb|ABK23170.1|  unknown                                                 338   6e-109   
ref|XP_002868953.1|  elicitor-activated gene 3                          338   6e-109   
ref|XP_002968671.1|  hypothetical protein SELMODRAFT_90436              338   6e-109   
ref|NP_195512.1|  cinnamyl alcohol dehydrogenase 8                      338   6e-109   
sp|O82035.1|CADH2_PICAB  RecName: Full=Probable cinnamyl alcohol ...    338   7e-109   
ref|NP_001275871.1|  carbamoyl-phosphate synthetase 2, aspartate ...    338   7e-109   
ref|XP_002989920.1|  hypothetical protein SELMODRAFT_235915             338   8e-109   
dbj|BAK05763.1|  predicted protein                                      338   1e-108   
emb|CAI30877.1|  cinnamyl-alcohol dehydrogenase                         338   1e-108   
gb|EMT16612.1|  Putative cinnamyl alcohol dehydrogenase 5               338   1e-108   
ref|XP_007206687.1|  hypothetical protein PRUPE_ppa022088mg             338   1e-108   
gb|KFM28250.1|  putative cinnamyl alcohol dehydrogenase                 338   2e-108   
ref|XP_010916206.1|  PREDICTED: probable mannitol dehydrogenase i...    337   2e-108   
gb|AHL67653.1|  cinnamyl alcohol dehydrogenase                          337   2e-108   
ref|XP_003580533.1|  PREDICTED: cinnamyl alcohol dehydrogenase 7-...    337   2e-108   
ref|XP_008236557.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-l...    337   3e-108   
emb|CBI40842.3|  unnamed protein product                                336   3e-108   
ref|XP_010523573.1|  PREDICTED: 8-hydroxygeraniol dehydrogenase-like    337   3e-108   
emb|CAN80210.1|  hypothetical protein VITISV_005115                     337   5e-108   
ref|NP_001140793.1|  uncharacterized protein LOC100272868               336   5e-108   
emb|CDY52519.1|  BnaC03g61120D                                          336   5e-108   
ref|XP_005652266.1|  GroES-like protein                                 338   6e-108   
emb|CDX75688.1|  BnaA01g00140D                                          336   6e-108   
ref|XP_010432007.1|  PREDICTED: cinnamyl alcohol dehydrogenase 7-...    336   6e-108   
ref|XP_003612972.1|  Cinnamyl alcohol dehydrogenase                     338   6e-108   
emb|CDX69348.1|  BnaC01g01050D                                          335   7e-108   
ref|XP_007153368.1|  hypothetical protein PHAVU_003G029500g             335   1e-107   
ref|XP_008236551.1|  PREDICTED: probable mannitol dehydrogenase         335   1e-107   
ref|XP_007047729.1|  Geraniol dehydrogenase 1                           335   2e-107   
ref|XP_007205409.1|  hypothetical protein PRUPE_ppa007605mg             334   2e-107   
ref|XP_009109413.1|  PREDICTED: cinnamyl alcohol dehydrogenase 8        334   2e-107   
gb|ABK27071.1|  unknown                                                 334   3e-107   
gb|EMS45843.1|  Putative cinnamyl alcohol dehydrogenase 5               334   3e-107   
emb|CDX90391.1|  BnaA08g15930D                                          334   3e-107   
ref|XP_002868955.1|  elicitor-activated gene 3                          333   5e-107   



>ref|XP_009596350.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Nicotiana 
tomentosiformis]
Length=360

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/358 (75%), Positives = 317/358 (89%), Gaps = 0/358 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQVVSGWAA DSSGKI PY F RRENG NDVTIKILYCGICH+DLH AKNDW
Sbjct  1     MAKTTQNHTQVVSGWAALDSSGKITPYIFNRRENGVNDVTIKILYCGICHTDLHYAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEITGIV  VGSNVTNFK GD+VGVGCM+ASCLECEFCK S+ENYC  +Q
Sbjct  61    GITTYPVVPGHEITGIVVEVGSNVTNFKTGDKVGVGCMSASCLECEFCKNSEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNG+FWDGSITYGGYSK+ VADYRFVV +P++LPMDRAAPLLCAGVT+FCP+KDNNL+
Sbjct  121   FTYNGVFWDGSITYGGYSKMLVADYRFVVAIPDNLPMDRAAPLLCAGVTVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               P K+IG+IG+GGLGHL +KF KAFGHHVTVISTS SK+ EAK +LGAD+FI+S++AHQ
Sbjct  181   NSPRKKIGVIGLGGLGHLAIKFAKAFGHHVTVISTSLSKENEAKTKLGADDFIVSSNAHQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ+++R++DF+LDTVSANHSLGPYLELLKV GT V+VGAPDKP+    FPLI GKRTVKG
Sbjct  241   MQSRQRTLDFVLDTVSANHSLGPYLELLKVKGTFVIVGAPDKPLGLPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             S+IGS++ETQEM++IC K+NI+CDIE +TP++IN A++R+ KND+KYRFVID+AG  +
Sbjct  301   SMIGSIKETQEMIDICGKYNIMCDIEIVTPNRINEAYERIEKNDIKYRFVIDIAGQSS  358



>ref|XP_009775562.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Nicotiana 
sylvestris]
Length=360

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/358 (75%), Positives = 315/358 (88%), Gaps = 0/358 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQVVSGWAA DSSGKI PY F RRENG NDVTIKILYCGICH+DLH AKNDW
Sbjct  1     MAKTTPNHTQVVSGWAALDSSGKITPYIFNRRENGVNDVTIKILYCGICHTDLHYAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGIV  VGSNVTNFK GD+VGVGCM+ASCLECEFCK S+ENYC  +Q
Sbjct  61    GITMYPVVPGHEITGIVVEVGSNVTNFKTGDKVGVGCMSASCLECEFCKNSEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNG+FWDGSITYGGYSK+ VADYRFVV VP++LPMDRAAPLLCAGVT+FCP+KDNNL+
Sbjct  121   FTYNGVFWDGSITYGGYSKMLVADYRFVVAVPDNLPMDRAAPLLCAGVTVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               P K+IG+IG+GGLGHL +KF KAFGHHVTVISTS SK+ EAK +LGAD+FI S++ HQ
Sbjct  181   DSPRKKIGVIGLGGLGHLAIKFAKAFGHHVTVISTSLSKENEAKSKLGADDFIASSNTHQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ++++++DFILDTVSANHSLGPYLELLKV GT V+VGAPDKP+    FPLI GKRTVKG
Sbjct  241   MQSRQKTLDFILDTVSANHSLGPYLELLKVKGTFVIVGAPDKPLGLPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             S+IGS++ETQEM++IC K+NI+CDIE +TPD+IN A++R+ KND+KYRFVID+A   +
Sbjct  301   SMIGSIKETQEMIDICGKYNIMCDIEIVTPDRINEAYERIEKNDIKYRFVIDIAAQSS  358



>gb|ACV74414.1| putative cinnamyl alcohol dehydrogenase [Camellia sinensis]
Length=360

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/356 (78%), Positives = 312/356 (88%), Gaps = 2/356 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PYTFKRRENG NDVTI ILYCGICH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPYTFKRRENGINDVTIDILYCGICHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+++ VGSNV+ FKIGDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGLISKVGSNVSKFKIGDRVGVGCLAASCLECEFCKDSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL-  571
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVPE+LPMD AAPLLCAGVT+FCPLKDNN+ 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADQRYVVHVPENLPMDAAAPLLCAGVTVFCPLKDNNML  180

Query  572   -VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDA  748
              +  P K++G++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAK RLGAD+FI+STD 
Sbjct  181   ELDSPPKKLGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEDEAKHRLGADDFIVSTDL  240

Query  749   HQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTV  928
              QMQAKKRS+D ILDTV+A HSLG YLELLKVNGTLV+VGAPDKPID   FPLI GKR V
Sbjct  241   AQMQAKKRSLDLILDTVAAKHSLGSYLELLKVNGTLVIVGAPDKPIDLPSFPLIFGKRVV  300

Query  929   KGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             KGS+ GSM+ETQEM+++C K+NI CDIE  TP+KIN A DRL+KNDVKYRFVID+A
Sbjct  301   KGSMTGSMKETQEMMDVCGKYNIKCDIEKTTPNKINEALDRLSKNDVKYRFVIDIA  356



>gb|KDP36885.1| hypothetical protein JCGZ_08176 [Jatropha curcas]
Length=359

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/355 (76%), Positives = 311/355 (88%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PY FKRRENG NDVTIKILYCGICH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPYIFKRRENGINDVTIKILYCGICHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV NFK+GDR GVGC+ ASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGIITKVGSNVKNFKVGDRAGVGCLTASCLECEFCKTSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VAD+R+VVH+PE+LPMD AAPLLCAG+T+F P+KD+NLV
Sbjct  121   FTYNGIFWDGSITYGGYSEMLVADHRYVVHIPENLPMDAAAPLLCAGITVFSPMKDSNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGKR+GI+G+GGLGH+ VKF KAFGHHVTVISTSPSK+ EAK+RLGAD+FI+ST+A Q
Sbjct  181   ELPGKRVGIVGLGGLGHVAVKFAKAFGHHVTVISTSPSKETEAKDRLGADDFIVSTNAKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M+A KR++DFILDTVSANHSLGP LELLKVNGTLV VGAP+KP +   FPLI GKRTVKG
Sbjct  241   MKAGKRTLDFILDTVSANHSLGPILELLKVNGTLVAVGAPEKPFELPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M ETQEM+++C K+NI CDIE + P+KIN A DRLA+NDV+YRFVID+AG
Sbjct  301   SMTGGMRETQEMMDLCGKYNITCDIEVVKPNKINDALDRLARNDVRYRFVIDIAG  355



>ref|XP_004233212.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Solanum 
lycopersicum]
Length=360

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/358 (75%), Positives = 313/358 (87%), Gaps = 0/358 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQVVSGWAA DSSGKI PYTF RRENG NDVTIKILYCGICH+DLH AKNDW
Sbjct  1     MAKTTPKHTQVVSGWAALDSSGKITPYTFNRRENGVNDVTIKILYCGICHTDLHYAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGIV  VGSNV++FK GD+VGVGCM+ASCL+CE CK S+ENYC  +Q
Sbjct  61    GITMYPVVPGHEITGIVVQVGSNVSHFKTGDKVGVGCMSASCLQCESCKTSEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNG+FWDGSITYGGYS + VADYRFVV +P +LPMDRAAPLLCAGVT+FCP+KDNNL+
Sbjct  121   FTYNGVFWDGSITYGGYSNMLVADYRFVVAIPNNLPMDRAAPLLCAGVTVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G   + IG+IG+GGLGHL +KF KAFGHHVTVISTS SK+KEAK +LGAD+FI+S++  Q
Sbjct  181   GSQRQNIGVIGLGGLGHLAIKFAKAFGHHVTVISTSLSKEKEAKTKLGADDFIVSSNPQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M+++ RS+DFILDTVSANHSLGPYLELLK+ GT V+VGAPDKP+D   FPLI GKRTVKG
Sbjct  241   MKSRHRSLDFILDTVSANHSLGPYLELLKIKGTFVIVGAPDKPMDLPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             S+IGS++ETQEM++IC KFNI+CDIE ITP +IN A++R+ KND+KYRFVID+AG  +
Sbjct  301   SMIGSIKETQEMMDICGKFNIMCDIEIITPHQINEAYERIEKNDIKYRFVIDIAGQSS  358



>ref|XP_010266028.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Nelumbo 
nucifera]
Length=361

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/360 (73%), Positives = 311/360 (86%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ V GWAAHDSSGKI P+TFKRRENG +DVTI+ILYCG+CH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVFGWAAHDSSGKITPFTFKRRENGVDDVTIEILYCGMCHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNVT FK+GDRVGVGC+AASCL+CEFCK+SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVTRFKMGDRVGVGCIAASCLDCEFCKESQENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNGIFWDGSITYGGYSK+ VA  RFVVHVPE LPMD AAPLLCAG+T+FCP+KDN ++
Sbjct  121   FVYNGIFWDGSITYGGYSKMLVAHQRFVVHVPEKLPMDGAAPLLCAGITVFCPMKDNKML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KF KAFG HVTVISTSPSK+KEAK+RLG D+F+LST++  
Sbjct  181   ESPGKKLGVVGLGGLGHVAIKFAKAFGLHVTVISTSPSKEKEAKDRLGVDDFLLSTNSEH  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA +RS+DFI+DTVSA HSLGP LELLKVNGTLV+VGAPDKP++   FPLI GKR VKG
Sbjct  241   MQAARRSLDFIIDTVSAKHSLGPILELLKVNGTLVMVGAPDKPVELPSFPLIFGKRVVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S+IG M+ETQEML +CAK NI CD+E +TPDKIN A DRLA+NDV+YRFVID+AG    S
Sbjct  301   SMIGGMKETQEMLELCAKHNITCDVEIVTPDKINEAMDRLARNDVRYRFVIDVAGRTPES  360



>gb|KDO84939.1| hypothetical protein CISIN_1g018158mg [Citrus sinensis]
Length=360

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/356 (74%), Positives = 298/356 (84%), Gaps = 1/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ V GWAAHD SGKI PY FKRRENG NDVTIKILYCGICH+D+H  KNDW
Sbjct  1     MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV NFK+GDR  VGC+AA+C+ECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VADYRFVVHVPE++ MD AAPLLCAG+T+FCP+KDNNL+
Sbjct  121   FTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglgh-lgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
               P K+   I   G    + VKFGKAFGHHVTVISTSPSK+KEAKE LGADEFILST+A 
Sbjct  181   DSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAM  240

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA KR++DFILDTVSA HSLGP LELLKVNGTL +VGAP+ P +   FPLI GKR+VK
Sbjct  241   QMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVK  300

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             GS+ G M ETQEM+N+C K+NI C+IE I PD+IN A DRLA+NDV+YRFVID+AG
Sbjct  301   GSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG  356



>ref|XP_002510582.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF52769.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=362

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/356 (76%), Positives = 308/356 (87%), Gaps = 0/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ VSGWAAHDSSGKI PY FKRRENG NDVTIKILYCGICH+D+H AKNDW
Sbjct  1     MTQTTPNHTQTVSGWAAHDSSGKITPYIFKRRENGINDVTIKILYCGICHTDIHHAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV NFK+GDR GVGC+AASCL CEFC   QENYC  IQ
Sbjct  61    GITIYPVVPGHEITGIITKVGSNVKNFKVGDRAGVGCLAASCLNCEFCNNDQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTYNGIFWDGSITYGGYS+  VAD+R+VVH+PESLPMD AAPLLCAG+T+F P+KDN L+
Sbjct  121   LTYNGIFWDGSITYGGYSEFLVADHRYVVHIPESLPMDAAAPLLCAGITVFSPMKDNKLL  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IGI+G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEAKERLGAD+FI+ST+  Q
Sbjct  181   DSPGKKIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKERLGADDFIVSTNPEQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  K+++D ILDTVSANHSLGP LELLKVNGTLV VGAP+KP +   FPLI GKR+VKG
Sbjct  241   MQEGKKTLDLILDTVSANHSLGPILELLKVNGTLVAVGAPEKPFELPSFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             S+ G ++ETQEM+++C K NI CDIE + PDKIN + DRLA+NDV+YRFVID+AGN
Sbjct  301   SMTGGIKETQEMMDVCGKHNITCDIEVVKPDKINESLDRLARNDVRYRFVIDIAGN  356



>ref|XP_006473703.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Citrus 
sinensis]
Length=360

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/356 (74%), Positives = 298/356 (84%), Gaps = 1/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ V GWAAHD SGKI PY FKRRENG NDVTIKILYCGICH+D+H  KNDW
Sbjct  1     MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHIKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV NFK+GDR  VGC+AA+C+ECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VADYRFVVHVPE++ MD AAPLLCAG+T+FCP+KDNNL+
Sbjct  121   FTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglgh-lgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
               P K+   I   G    + VKFGKAFGHHVTVISTSPSK+KEAKE LGADEFILST+A 
Sbjct  181   DSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAM  240

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA KR++DFILDTVSA HSLGP LELLKVNGTL +VGAP+ P +   FPLI GKR+VK
Sbjct  241   QMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVK  300

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             GS+ G M ETQEM+N+C K+NI C+IE I PD+IN A DRLA+NDV+YRFVID+AG
Sbjct  301   GSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG  356



>ref|XP_006435236.1| hypothetical protein CICLE_v10001618mg [Citrus clementina]
 gb|ESR48476.1| hypothetical protein CICLE_v10001618mg [Citrus clementina]
Length=360

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 298/356 (84%), Gaps = 1/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ V GWAAHD SGKI PY FKRRENG NDVTIKILYCGICH+D+H  KNDW
Sbjct  1     MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHIKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV NFK+GDR  VGC+AA+C+ECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VADYRFVVHVPE++ MD AAPLLCAG+T+FCP+KDNNL+
Sbjct  121   FTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLI  180

Query  575   GHPgkrigiigmgglgh-lgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
               P K+   I   G    + VKFGKAFGHHVTVISTSPSK+KEAKE LGADEFILST+A 
Sbjct  181   DSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAM  240

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA KR++DFILDTVSA HSLGP LELL+VNGTL +VGAP+ P +   FPLI GKR+VK
Sbjct  241   QMQAGKRTLDFILDTVSAKHSLGPILELLEVNGTLSVVGAPEAPFELPSFPLIFGKRSVK  300

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             GS+ G M ETQEM+N+C K+NI C+IE I PD+IN A DRLA+NDV+YRFVID+AG
Sbjct  301   GSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG  356



>ref|XP_011083448.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Sesamum 
indicum]
Length=361

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/360 (75%), Positives = 312/360 (87%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHD SGKI PYTFKRRENG NDVTIKILYCGICH+DLH  KNDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDPSGKITPYTFKRRENGKNDVTIKILYCGICHTDLHHVKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI GI+T VGS VTNFK+GDR GVGC+AA+CL+CE+C+ SQENYC  +Q
Sbjct  61    GITMYPVVPGHEIVGIITKVGSKVTNFKVGDRAGVGCLAATCLDCEYCRDSQENYCDQVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNG+FWDGSITYGGYS+  VAD+R+VV VPESLPMD AAPLLCAG+T+F PLKDNNL+
Sbjct  121   FVYNGVFWDGSITYGGYSEFLVADHRYVVRVPESLPMDAAAPLLCAGITVFSPLKDNNLL  180

Query  575   -GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PGKRIG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEAK RLGAD+FILSTDA 
Sbjct  181   DSSPGKRIGVVGLGGLGHIAVKFGKAFGHHVTVISTSPSKEKEAKNRLGADDFILSTDAD  240

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQAKKR++DFILDTV+A+HSLGP LELLKVNGTLV+VGAPDKP+D   FPLI GKR VK
Sbjct  241   QMQAKKRTLDFILDTVAAHHSLGPTLELLKVNGTLVVVGAPDKPVDLPSFPLIFGKRVVK  300

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             GS+IGS++ETQEM+++C K NI CDIE ++  +IN A  RL KNDVKYRFVID+AG  ++
Sbjct  301   GSMIGSIKETQEMMDLCGKHNISCDIEVVSTSEINEALHRLTKNDVKYRFVIDIAGKSSN  360



>ref|XP_007017876.1| Cinnamyl alcohol dehydrogenase 9 [Theobroma cacao]
 gb|EOY15101.1| Cinnamyl alcohol dehydrogenase 9 [Theobroma cacao]
Length=359

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/356 (74%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HTQ V GWAA+DSSGKI PY FKRRENG NDVTIK+LYCGICH+DLH  KNDW
Sbjct  1     MAVETPNHTQTVGGWAAYDSSGKIAPYIFKRRENGVNDVTIKVLYCGICHTDLHHVKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV NFK+GDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVKNFKVGDRVGVGCLAASCLECEFCKSSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VV VP++LPMD AAPLLCAG+T+F P+KD+ L+
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVRVPDNLPMDAAAPLLCAGITVFSPMKDSQLL  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK +GI+G+GGLGH+ VK  KAFGHHVTVISTSPSK+KEA++RLGAD FI+ST+A Q
Sbjct  181   ESPGKMVGIVGLGGLGHVAVKMAKAFGHHVTVISTSPSKEKEARQRLGADGFIVSTNAEQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  KR++D ILDTVSA HSLGP LELLKVNGTLV+VGAPD+P+D   FPLI GKR VKG
Sbjct  241   MQRGKRTLDVILDTVSAKHSLGPILELLKVNGTLVVVGAPDRPMDLPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             S+ G M+ETQEM+++C K NI CD+E I PD+IN A DRLA+NDV+YRFVID+AG 
Sbjct  301   SMTGGMKETQEMMDVCGKHNITCDVELIEPDQINEALDRLARNDVRYRFVIDIAGR  356



>emb|CBI19922.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/356 (74%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PY FKRRENG NDVTI+ILYCGICH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPYVFKRRENGPNDVTIEILYCGICHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+VT VG+NVT FK GDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGVVTKVGTNVTRFKTGDRVGVGCLAASCLECEFCKSSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VAD R+VV VPE+LPMD  AP+LCAG+T++ P+KD  ++
Sbjct  121   FTYNGIFWDGSITYGGYSRMLVADQRYVVRVPENLPMDAVAPMLCAGITVYSPMKDTKML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++GIIG+GGLGH+ VKF KAFG HVT+ISTSPSK+KEAKERLGAD FI+ST+  Q
Sbjct  181   ESPGKKLGIIGLGGLGHVAVKFAKAFGLHVTIISTSPSKEKEAKERLGADHFIVSTNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSANHSLG YLELLKVNGT+V+VGAP+KP++   FPLI GKRTVKG
Sbjct  241   MQAGKRSLDFILDTVSANHSLGHYLELLKVNGTMVIVGAPEKPMELPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             S+ G M ETQEM+++C K NI CDIE + PD+IN A +RLA NDV+YRFVID+AG 
Sbjct  301   SMTGGMNETQEMMDVCGKHNITCDIEVVKPDQINEALERLANNDVRYRFVIDIAGQ  356



>ref|XP_009623076.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Nicotiana 
tomentosiformis]
Length=360

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/359 (75%), Positives = 312/359 (87%), Gaps = 0/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI P+TFKRRENG NDVTI ILYCG+CH+DLH  KNDW
Sbjct  1     MAQTTPNHTQSVSGWAAHDSSGKITPFTFKRRENGENDVTIAILYCGMCHTDLHHVKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGIVT VGSNVT FK GDRVGVGC+AA+CL+CE+CK SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGIVTKVGSNVTKFKNGDRVGVGCLAATCLKCEYCKDSQENYCDQVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWD +ITYGGYS + VAD+R+VV +P++L MDRAAPLLCAG+T++ PLKDNNLV
Sbjct  121   FTYNGIFWDDTITYGGYSNMLVADHRYVVRIPDNLAMDRAAPLLCAGITVYTPLKDNNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IG+IG+GGLGH+ VKFGKAFGHHVTVISTSPSK++EAK  LGAD+FILST+  Q
Sbjct  181   ETQGKKIGVIGLGGLGHVAVKFGKAFGHHVTVISTSPSKEQEAKHNLGADDFILSTNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA+KRS+DFILDTV+A HSLG YLELLKV GTLV+VGAPDKPID   FP+I GKRTVKG
Sbjct  241   IQARKRSLDFILDTVAAKHSLGIYLELLKVKGTLVIVGAPDKPIDLPAFPMIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+IGS+EETQEM+++C K+NIL DIE IT D+IN   DRLA+NDVKYRFVID+AG  ++
Sbjct  301   SMIGSIEETQEMMDLCGKYNILSDIEIITTDQINEGLDRLAQNDVKYRFVIDIAGQSSN  359



>ref|XP_002269356.2| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Vitis vinifera]
Length=391

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/356 (74%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PY FKRRENG NDVTI+ILYCGICH+DLH  +NDW
Sbjct  32    MAQTTPNHTQTVSGWAAHDSSGKITPYVFKRRENGPNDVTIEILYCGICHTDLHHVRNDW  91

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+VT VG+NVT FK GDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  92    GITMYPVVPGHEITGVVTKVGTNVTRFKTGDRVGVGCLAASCLECEFCKSSQENYCDQIQ  151

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VAD R+VV VPE+LPMD  AP+LCAG+T++ P+KD  ++
Sbjct  152   FTYNGIFWDGSITYGGYSRMLVADQRYVVRVPENLPMDAVAPMLCAGITVYSPMKDTKML  211

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++GIIG+GGLGH+ VKF KAFG HVT+ISTSPSK+KEAKERLGAD FI+ST+  Q
Sbjct  212   ESPGKKLGIIGLGGLGHVAVKFAKAFGLHVTIISTSPSKEKEAKERLGADHFIVSTNPKQ  271

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSANHSLG YLELLKVNGT+V+VGAP+KP++   FPLI GKRTVKG
Sbjct  272   MQAGKRSLDFILDTVSANHSLGHYLELLKVNGTMVIVGAPEKPMELPSFPLIFGKRTVKG  331

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             S+ G M ETQEM+++C K NI CDIE + PD+IN A +RLA NDV+YRFVID+AG 
Sbjct  332   SMTGGMNETQEMMDVCGKHNITCDIEVVKPDQINEALERLANNDVRYRFVIDIAGQ  387



>gb|EYU17576.1| hypothetical protein MIMGU_mgv1a008846mg [Erythranthe guttata]
Length=360

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 306/355 (86%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHD+SG I PYTFKRRENG +DVTIKILYCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDTSGNITPYTFKRRENGVDDVTIKILYCGICHTDLHQAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI GI+T VGSNV NF +GDR GVGC+AA+CL+CE C Q QENYC  +Q
Sbjct  61    GITMYPVVPGHEIVGIITKVGSNVKNFTVGDRAGVGCLAATCLKCEHCIQGQENYCDAVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNG+FWDGSITYGGYS+  VAD+R+VV VPE+LPMD AAPLLCAG+T+F P+KDNNL+
Sbjct  121   FVYNGVFWDGSITYGGYSESLVADHRYVVRVPENLPMDAAAPLLCAGITVFAPMKDNNLL  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGKRIGI+G+GGLGH+ VKF KAFGHHVT+ISTSPSK+KEAK+ LGAD+FILSTD  Q
Sbjct  181   DSPGKRIGIVGLGGLGHVAVKFAKAFGHHVTIISTSPSKEKEAKDNLGADDFILSTDPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M  KKR++DFILDTVSA+HSLGP LELLKVNGTLV+VGAPDKPID   FPLI GKR VKG
Sbjct  241   MLLKKRNLDFILDTVSAHHSLGPILELLKVNGTLVIVGAPDKPIDLPSFPLIFGKRVVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+IGS++ETQ+M+++C K NI CDIE + PDKIN A  RLAKNDVKYRFVID+AG
Sbjct  301   SMIGSIKETQDMMDLCGKHNITCDIEVVKPDKINEALLRLAKNDVKYRFVIDIAG  355



>gb|ACQ59091.1| cinnamyl alcohol dehydrogenase 3 [Gossypium hirsutum]
Length=359

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 305/355 (86%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HTQ V+GWAA+DSSGKI PY FKRRENG NDVTI+++YCGICH+DLH  K+DW
Sbjct  1     MALETPNHTQTVAGWAAYDSSGKIAPYIFKRRENGVNDVTIQVMYCGICHTDLHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV NFK+GDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVKNFKLGDRVGVGCLAASCLECEFCKNSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VAD+R+VVHVP++LPMD AAPLLCAG+T+F P+KD  L+
Sbjct  121   FTYNGIFWDGSITYGGYSEMLVADHRYVVHVPDNLPMDAAAPLLCAGITVFSPMKDCQLL  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++GI+G+GGLGH+ VK  KAFGH VTVISTSPSK+ EAK+RLGAD F++STDA Q
Sbjct  181   ESPGKKVGIVGLGGLGHVAVKMAKAFGHQVTVISTSPSKENEAKQRLGADYFLVSTDAKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  KR++D ILDTVSA HSLGP LELLKVNGTLV+VGAPD+PI+   FPLI GKR VKG
Sbjct  241   MQRGKRTLDVILDTVSAKHSLGPILELLKVNGTLVVVGAPDRPIELPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M+ETQEM+++C K NI CD+E I PDKIN A DRLA+NDV+YRFVID+AG
Sbjct  301   SMTGGMKETQEMMDVCGKHNITCDVELIKPDKINQALDRLARNDVRYRFVIDIAG  355



>gb|KHG08440.1| putative cinnamyl alcohol dehydrogenase 6 [Gossypium arboreum]
Length=359

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 304/355 (86%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HTQ V+GWAA+DSSGKI PY FKRRENG NDVTI+++YCGICH+DLH  K+DW
Sbjct  1     MALETPNHTQTVAGWAAYDSSGKIAPYIFKRRENGVNDVTIQVMYCGICHTDLHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV NFK+GDRVGVGC+AASCLECEFCK SQENYC  IQ
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVKNFKLGDRVGVGCLAASCLECEFCKNSQENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDG+ITYGGYS + VAD+R+VVHVP++LPMD AAPLLCAG+T+F P+KD  L+
Sbjct  121   FTYNGIFWDGTITYGGYSDMLVADHRYVVHVPDNLPMDAAAPLLCAGITVFSPMKDCQLL  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++GI+G+GGLGH+ VK  KAFGH VTVISTSPSK+ EAK+RLGAD F++STDA Q
Sbjct  181   ESPGKKVGIVGLGGLGHVAVKMAKAFGHQVTVISTSPSKENEAKQRLGADYFLVSTDAKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  KRS+D ILDTVSA HSLGP LELLKVNGTLV+VGAPD+PI+   FPLI GKR VKG
Sbjct  241   MQRGKRSLDIILDTVSAKHSLGPILELLKVNGTLVVVGAPDRPIELPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M+ETQEM+++C K NI CD+E I PDKIN A DRLA+NDV+YRFVID+AG
Sbjct  301   SMTGGMKETQEMMDVCGKHNITCDVELIKPDKINEALDRLARNDVRYRFVIDIAG  355



>ref|XP_011034982.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Populus 
euphratica]
Length=360

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/359 (73%), Positives = 312/359 (87%), Gaps = 0/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAA DSSGK+VPYTFKRRENG NDVTI+I+YCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAALDSSGKVVPYTFKRRENGVNDVTIEIMYCGICHTDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G ++YPVVPGHEITGI+T VGSNV  FK+GDRVGVGC+AASCLEC+FCK S+ENYC  IQ
Sbjct  61    GISMYPVVPGHEITGIITKVGSNVNKFKLGDRVGVGCLAASCLECDFCKSSRENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTYNGIFWDGSITYGGYSK  VAD+R+VV +PE+LPMD  APLLCAG+T+F P K++NLV
Sbjct  121   LTYNGIFWDGSITYGGYSKFLVADHRYVVRIPENLPMDATAPLLCAGITVFSPFKESNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGKR+G++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEA+ERLGAD+FI+ST+A +
Sbjct  181   ETPGKRVGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEARERLGADDFIVSTNAQE  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +R++DFI+DTVSA HSLGP LELLKVNGTL +V APD+P++   FPLI GKR+V+G
Sbjct  241   LQAARRTLDFIVDTVSAKHSLGPTLELLKVNGTLAVVCAPDQPMELPAFPLIFGKRSVRG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+ GS  ETQEML++C K NI CDIE +  D IN A+DRLAKNDV+YRFVID+AG  ++
Sbjct  301   SMTGSTSETQEMLDVCGKHNITCDIELVKTDNINEAWDRLAKNDVRYRFVIDIAGKSSN  359



>gb|AGU43757.1| cinnamyl alcohol dehydrogenase 3 [Populus tomentosa]
Length=360

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 311/359 (87%), Gaps = 0/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAA DSSGK+VPYTFKRRENG NDVTI+I+YCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAALDSSGKVVPYTFKRRENGVNDVTIEIMYCGICHTDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G ++YPVVPGHEITGI+T VGSNV  F++GDRVGVGC+AASCLEC+FCK S ENYC  IQ
Sbjct  61    GISMYPVVPGHEITGIITKVGSNVNKFRLGDRVGVGCLAASCLECDFCKSSHENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTYNGIFWDGSITYGGYSK  VAD+R+VV +PE+LPMD  APLLCAG+T+F P KD+NLV
Sbjct  121   LTYNGIFWDGSITYGGYSKFLVADHRYVVRIPENLPMDATAPLLCAGITVFSPFKDSNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGKR+G++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEA+ERLGAD+FI+ST+A +
Sbjct  181   DTPGKRVGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEARERLGADDFIVSTNAQE  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +R++DFI+DTVSA HSLGP LELLKVNGTL +V APD+P++   FPLI GKR+V+G
Sbjct  241   LQAARRTLDFIVDTVSAKHSLGPVLELLKVNGTLAVVCAPDQPMELPAFPLIFGKRSVRG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+ GS  ETQEML++C K NI CDIE +  D IN A+DRLA+NDV+YRFVID+AG  ++
Sbjct  301   SMTGSTSETQEMLDVCGKHNITCDIELVKTDNINEAWDRLARNDVRYRFVIDIAGKSSN  359



>gb|KHN39408.1| Putative cinnamyl alcohol dehydrogenase 6 [Glycine soja]
Length=361

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/360 (74%), Positives = 307/360 (85%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HT  VSGWAAHDSSGKI PYTFKRRENG NDVTIKILYCGICH+DLH AKN+W
Sbjct  1     MAQTTANHTVTVSGWAAHDSSGKITPYTFKRRENGVNDVTIKILYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI G+VT VG +V  FK GDRVGVGC+AASCLECE CK  QENYC+ +Q
Sbjct  61    GITMYPVVPGHEIIGVVTKVGRDVKGFKEGDRVGVGCLAASCLECEHCKTDQENYCEKLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNG+FWDGSITYGGYS++ VADYR+VVH+PE+L MD AAPLLCAG+T+F PLKD++LV
Sbjct  121   FVYNGVFWDGSITYGGYSQIFVADYRYVVHIPENLAMDAAAPLLCAGITVFNPLKDHDLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAK+RLGAD+FI+S++  Q
Sbjct  181   ASPGKKIGVVGLGGLGHIAVKFGKAFGHHVTVISTSPSKEAEAKQRLGADDFIVSSNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +RSIDFILDTVSA HSL P LELLKVNGTL LVGAPDKP+    FPLI GKR+VKG
Sbjct  241   LQAARRSIDFILDTVSAEHSLLPILELLKVNGTLFLVGAPDKPLQLPAFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
              +IG ++ETQEML +CAK+NI  DIE ITPDKIN A +RLAKNDV+YRFVID+A    S+
Sbjct  301   GIIGGIKETQEMLEVCAKYNITSDIELITPDKINEAMERLAKNDVRYRFVIDIANAAASN  360



>ref|XP_009767608.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Nicotiana 
sylvestris]
Length=400

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 313/359 (87%), Gaps = 0/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI P+TFKRRENG NDV+I+ILYCG+CH+DLH  KNDW
Sbjct  39    MAQTTPNHTQSVSGWAAHDSSGKITPFTFKRRENGENDVSIRILYCGMCHTDLHHVKNDW  98

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNVT FK GDRVGVGC+AA+CL+CE+CK SQENYC  +Q
Sbjct  99    GITMYPVVPGHEITGIITKVGSNVTKFKNGDRVGVGCLAATCLKCEYCKDSQENYCDQVQ  158

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDG+ITYGGYS + VAD+R+VV +P++L MDRAAPLLCAG+T++ PLKDNNLV
Sbjct  159   FTYNGIFWDGTITYGGYSNMLVADHRYVVRIPDNLAMDRAAPLLCAGITVYSPLKDNNLV  218

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GKRIG+IG+GGLGH+ VKFGKAFGHHVTVISTSPSK++EAK  LGAD+FILST+  Q
Sbjct  219   KTQGKRIGVIGLGGLGHVAVKFGKAFGHHVTVISTSPSKEQEAKHNLGADDFILSTNPKQ  278

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +Q +KR++DFILDTV+ANHSLG YLELLKVNGTLV+VGAP+KPID   FP+I GKR VKG
Sbjct  279   IQERKRTLDFILDTVAANHSLGIYLELLKVNGTLVIVGAPEKPIDLPAFPMIFGKRNVKG  338

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+IGS+EETQEM+++C K+NIL DIE IT  +I+   DRLAKNDVKYRFVID+AG  ++
Sbjct  339   SMIGSIEETQEMMDLCGKYNILSDIEIITTHQIDEGLDRLAKNDVKYRFVIDIAGQSSN  397



>emb|CDP07361.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/362 (72%), Positives = 309/362 (85%), Gaps = 2/362 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PY FKRRENGA+DVTI+ILYCG+CH+D+H  KNDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPYVFKRRENGADDVTIQILYCGMCHTDIHHVKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T VGSNV  FK GD+VGVGC+AA+CL+CEFCK SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGIITKVGSNVRKFKTGDKVGVGCLAATCLQCEFCKDSQENYCDEVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VV VP+SLPMD AAPLLCAG+T++CP+KD+NL+
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADQRYVVRVPDSLPMDAAAPLLCAGITVYCPMKDHNLL  180

Query  575   --GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDA  748
                   ++IG++G+GGLGH+ VKF KAFGHHVTVISTSPSK+KEAK RLGAD+F+LSTDA
Sbjct  181   EPDSAARKIGVVGLGGLGHVAVKFAKAFGHHVTVISTSPSKEKEAKVRLGADDFLLSTDA  240

Query  749   HQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTV  928
               MQA+KR++DFI+DTVSA HS+GP LELLKV GTLV+VGAP+KP++   FPLI GKR V
Sbjct  241   KLMQARKRTLDFIVDTVSAKHSIGPLLELLKVKGTLVIVGAPEKPMELPSFPLIFGKRVV  300

Query  929   KGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             KG +IGS++ETQEM+ +C K NI+CDIE +  D+IN A +RLA NDVKYRFVID+AG  +
Sbjct  301   KGGIIGSIKETQEMMEVCGKRNIVCDIEVVRTDQINAALERLANNDVKYRFVIDIAGKQS  360

Query  1109  SS  1114
              S
Sbjct  361   RS  362



>ref|XP_004291336.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Fragaria 
vesca subsp. vesca]
Length=370

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/357 (73%), Positives = 308/357 (86%), Gaps = 0/357 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  H Q VSGWAAHDSSGKI P+ FKRRENG NDVTIKILYCGICH+DLH A+NDW
Sbjct  1     MAQTTPNHIQTVSGWAAHDSSGKITPFIFKRRENGINDVTIKILYCGICHTDLHQARNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YP+VPGHEITG+V  VGSNV NF +GDRVGVGC+AA+CLEC+FCK+SQENYC+++Q
Sbjct  61    GITMYPIVPGHEITGLVMKVGSNVKNFSVGDRVGVGCLAATCLECDFCKESQENYCEDLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNG+FWDGSITYGGYSK+ VAD+R+VV +PE+LPMD AAPLLCAGVT+F P +D++L 
Sbjct  121   FTYNGVFWDGSITYGGYSKMLVADHRYVVRIPENLPMDSAAPLLCAGVTVFTPFRDHDLH  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK++EAK  LGAD+FI+STD  Q
Sbjct  181   KTPGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEEEAKGHLGADDFIVSTDEQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  KRS+DFIL+TVSA H LGP LELLKVNGT+V+VGAPD+P     FPLI GKR VKG
Sbjct  241   MQRGKRSLDFILNTVSAKHCLGPLLELLKVNGTMVVVGAPDQPFTLPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNP  1105
             SVIG MEET+EM+ +C K NI CDIE  TPDKIN AF+R+AKNDV+YRFVID+A +P
Sbjct  301   SVIGGMEETREMMELCGKHNITCDIELTTPDKINQAFERVAKNDVRYRFVIDIASSP  357



>ref|XP_010061094.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Eucalyptus 
grandis]
 gb|KCW67986.1| hypothetical protein EUGRSUZ_F01676 [Eucalyptus grandis]
Length=360

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 304/355 (86%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HT  VSGWAA+DSSG+I PYTFKRRENG NDVTIK+LYCGICH+DLH AKNDW
Sbjct  1     MAQETQNHTLSVSGWAAYDSSGEIKPYTFKRRENGVNDVTIKVLYCGICHTDLHYAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+V  VG N   FKIGDRVGVGC+AASCL+CEFC  SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVVIKVGCNAGKFKIGDRVGVGCLAASCLKCEFCADSQENYCDQMQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS + VADYR+VV +PE+LPMD  APLLCAG+T+F PLKDN ++
Sbjct  121   FTYNGIFWDGSITYGGYSNVIVADYRYVVRIPENLPMDSVAPLLCAGITVFSPLKDNGML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G PGK++G++G+GGLGH+ VKFGKAFGHHVTV+STSPSK+ EAK RLGAD+FI+ST++ Q
Sbjct  181   GSPGKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTSPSKETEAKGRLGADDFIVSTNSQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSA HSLGP LELLKV+GTLV+VGAPD+P++   FPLI GKR+VKG
Sbjct  241   MQAGKRSLDFILDTVSAQHSLGPILELLKVDGTLVMVGAPDQPLELPSFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  301   SMTGGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  355



>ref|XP_008466466.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Cucumis 
melo]
Length=360

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/358 (72%), Positives = 307/358 (86%), Gaps = 0/358 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PYTFKRRENG +DVTI+ILYCGICH+D+H AKN+W
Sbjct  1     MAQTTSNHTQTVSGWAAHDSSGKITPYTFKRRENGPDDVTIEILYCGICHTDIHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHE+TG++T VG+NV  FKIGD+VGVGC+AA+CL CEFC+ SQENYC+N+Q
Sbjct  61    GITMYPVVPGHEMTGVITKVGNNVKKFKIGDKVGVGCIAATCLNCEFCQDSQENYCENLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ V+D R+VVH+PESLPMD AAPLLCAG+T+F P+KD  L+
Sbjct  121   FTYNGIFWDGSITYGGYSKMFVSDQRYVVHIPESLPMDAAAPLLCAGITVFTPMKDLGLI  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGHL VKF KAFGHHVTVISTS SK++EAK+RLGADEFI+S D+ Q
Sbjct  181   DSPGKKVGVVGLGGLGHLAVKFAKAFGHHVTVISTSASKEQEAKKRLGADEFIVSKDSEQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  KR++DFILDTVSA H +GP LELLKVNGTL +VGAPDKPI    FPLI GKRTVKG
Sbjct  241   MQNYKRTLDFILDTVSAQHCIGPILELLKVNGTLSIVGAPDKPIQLPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             S+IG ++ETQEM+N+C K+NI  DIE I P  IN A +RL +NDV+YRFVID+A N T
Sbjct  301   SIIGGIQETQEMMNLCGKYNITSDIEVIKPQHINHAMERLIQNDVRYRFVIDIAQNKT  358



>ref|XP_004136373.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Cucumis 
sativus]
 ref|XP_004171461.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Cucumis 
sativus]
 gb|KGN60054.1| hypothetical protein Csa_3G874320 [Cucumis sativus]
Length=362

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/360 (71%), Positives = 311/360 (86%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PYTFKRRENG +DVTI+ILYCGICH+D+H AKN+W
Sbjct  1     MAQTTSNHTQTVSGWAAHDSSGKITPYTFKRRENGPDDVTIEILYCGICHTDIHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHE+TG++T VG+NV  FKIGD+VGVGC+AA+CL CEFCK SQENYC+N+Q
Sbjct  61    GITMYPVVPGHEMTGVITKVGNNVKKFKIGDKVGVGCIAATCLNCEFCKDSQENYCENLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              +YNGIFWDGSITYGGYSK+ V+D R+VVH+PESLPMD AAPLLCAG+T+F P+KD  L+
Sbjct  121   FSYNGIFWDGSITYGGYSKMFVSDQRYVVHIPESLPMDAAAPLLCAGITVFTPMKDLGLI  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ VKF KAFGHHVTVISTS SK++EAK+RLGADEFI+S D+ Q
Sbjct  181   DSPGKKVGVVGLGGLGHIAVKFAKAFGHHVTVISTSASKEQEAKKRLGADEFIVSKDSQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ+ KR++DFI+DTVSA H +GP LELLKVNGTL +VGAP+KPI    FPLI GKRTVKG
Sbjct  241   MQSNKRTLDFIMDTVSAQHCIGPILELLKVNGTLSIVGAPEKPIQLPSFPLIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S+IG ++ETQ+M+++C K+NI CDIE + P +IN A +RL +NDV+YRFVID+A N  +S
Sbjct  301   SIIGGIQETQQMMDLCGKYNITCDIEVVKPHEINHAMERLIQNDVRYRFVIDIAQNKPNS  360



>ref|NP_001242314.1| uncharacterized protein LOC100820588 [Glycine max]
 gb|ACU20956.1| unknown [Glycine max]
Length=361

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 307/360 (85%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HT  VSGWAAHDSSGKI PYTFKRRENG NDVTIKILYCGICH+DLH AKN+W
Sbjct  1     MAQTTANHTVTVSGWAAHDSSGKITPYTFKRRENGVNDVTIKILYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI G+VT VG +V  FK GDRVGVGC+AA+CLECE CK  QENYC+ +Q
Sbjct  61    GITMYPVVPGHEIIGVVTKVGRDVKGFKEGDRVGVGCLAATCLECEHCKTDQENYCEKLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNG+FWDGSITYGGYS++ VADYR+VVH+PE+L MD AAPLLCAG+T+F PLKD++LV
Sbjct  121   FVYNGVFWDGSITYGGYSQIFVADYRYVVHIPENLAMDAAAPLLCAGITVFNPLKDHDLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAK+RLGAD+FI+S++  Q
Sbjct  181   ASPGKKIGVVGLGGLGHIAVKFGKAFGHHVTVISTSPSKEAEAKQRLGADDFIVSSNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +RSIDFILDTVSA HSL P LELLKVNGTL LVGAPDKP+    FPLI GKR+VKG
Sbjct  241   LQAARRSIDFILDTVSAEHSLLPILELLKVNGTLFLVGAPDKPLQLPAFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
              +IG ++ETQEML +CAK+NI  DIE ITPD+IN A +RLAKNDV+YRFVID+A    S+
Sbjct  301   GIIGGIKETQEMLEVCAKYNITSDIELITPDRINEAMERLAKNDVRYRFVIDIANAAASN  360



>ref|XP_006356896.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Solanum 
tuberosum]
Length=360

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HTQ V+GWAAHDSSGKI P+ FKRRENG NDVTI+ILYCGICH+D+H  K+DW
Sbjct  1     MAQATPNHTQTVAGWAAHDSSGKITPFNFKRRENGENDVTIEILYCGICHTDIHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEITGI+T VGSNV+ FK+GDRVGVGC+AA+CL+CE+C++SQENYC  ++
Sbjct  61    GITKYPVVPGHEITGIITKVGSNVSKFKMGDRVGVGCLAATCLKCEYCEESQENYCDQVE  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VV +P+++ MDRAAPLLCAG+T+F PLKDNNLV
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVRIPDNMAMDRAAPLLCAGITVFTPLKDNNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IGIIG+GGLGH+ VKFGKAFGHHVTVISTSP K++EAK+ LGAD+FI+ST+  Q
Sbjct  181   DTKGKKIGIIGLGGLGHVAVKFGKAFGHHVTVISTSPIKEQEAKDNLGADDFIISTNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M  KKR++DFILDTVSA HSLG YLELLKVNGTLV+VGAPDKPID   FP+I GKRTVKG
Sbjct  241   MLEKKRTLDFILDTVSAKHSLGSYLELLKVNGTLVIVGAPDKPIDLPAFPMIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+IGS+EETQEM+++C K NIL DIE IT D+IN   +RLAKNDVKYRFVID+AG P+S
Sbjct  301   SMIGSIEETQEMMDLCGKHNILSDIEIITTDQINEGLERLAKNDVKYRFVIDIAG-PSS  358



>ref|XP_002301953.1| hypothetical protein POPTR_0002s01990g [Populus trichocarpa]
 gb|ABK95994.1| unknown [Populus trichocarpa]
 gb|EEE81226.1| hypothetical protein POPTR_0002s01990g [Populus trichocarpa]
Length=360

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 310/359 (86%), Gaps = 0/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAA DSSGK+VPYTFKRRENG NDVTI+I+YCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAALDSSGKVVPYTFKRRENGVNDVTIEIMYCGICHTDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G ++YPVVPGHEITGI+T VGSNV  FK+GDRVGVGC+AASCLEC+FCK S ENYC  IQ
Sbjct  61    GISMYPVVPGHEITGIITKVGSNVNKFKLGDRVGVGCLAASCLECDFCKSSHENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTYNGIFWDGSITYGGYSK  VAD+R+VV +PE+LPMD  APLLCAG+T+F   KD+NLV
Sbjct  121   LTYNGIFWDGSITYGGYSKFLVADHRYVVRIPENLPMDATAPLLCAGITVFSAFKDSNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGKR+G++G+GGLGH+ VKFGKAF HHVTVISTSPSK+KEA+ERLGAD+FI+ST+A +
Sbjct  181   DTPGKRVGVVGLGGLGHVAVKFGKAFRHHVTVISTSPSKEKEARERLGADDFIVSTNAQE  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +R++DFI+DTVSA HSLGP LELLKVNGTL +V APD+P++   FPLI GKR+V+G
Sbjct  241   LQAARRTLDFIVDTVSAKHSLGPTLELLKVNGTLAVVCAPDQPMELPAFPLIFGKRSVRG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+ GS +ETQEML++C K NI CDIE +  D IN A+DRLA+NDV+YRFVID+AG  ++
Sbjct  301   SMTGSTKETQEMLDVCGKHNITCDIELVKTDNINEAWDRLARNDVRYRFVIDIAGKSSN  359



>ref|XP_008221221.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Prunus 
mume]
Length=361

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/360 (72%), Positives = 308/360 (86%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI P+ FKRRENG NDVTI+ILYCGICH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPFIFKRRENGINDVTIEILYCGICHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV  FK+GDRVGVGC+AA+CLEC+FCK SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVKEFKVGDRVGVGCLAATCLECDFCKDSQENYCDQVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VVH+P +LP+D  APLLCAGVT+F P+KD+NL 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVHIPANLPLDATAPLLCAGVTVFSPMKDHNLH  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEAKERLGAD+F++STDA Q
Sbjct  181   QAPGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKERLGADDFLVSTDAQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             ++   R++DFIL+TVSA HSLGP LELLKVNGT+V+VGAPD+P +   FP+I GKR VKG
Sbjct  241   LKKGMRTLDFILNTVSAKHSLGPLLELLKVNGTMVVVGAPDQPFELPSFPMIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             SVIG M +T+EM+ +C K NI CDIE  TPDK++ A DR+AKNDV+YRFVID+A    S+
Sbjct  301   SVIGGMRDTKEMMELCGKHNITCDIEVTTPDKLDEALDRVAKNDVRYRFVIDIAAGLPSN  360



>ref|XP_004231578.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Solanum 
lycopersicum]
Length=360

 Score =   522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI P+ FKRRENG NDVTI+ILYCG+CH+D+H  K+DW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPFIFKRRENGENDVTIEILYCGMCHTDIHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEITG +T VG NV+ FKIGDRVGVGC+AA+CL+CE+CK SQENYC  ++
Sbjct  61    GITKYPVVPGHEITGFITKVGRNVSKFKIGDRVGVGCLAATCLKCEYCKGSQENYCDQVE  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VV +P+++ MDRAAPLLCAG+T+F P KDNNLV
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVCIPDNMAMDRAAPLLCAGITVFTPFKDNNLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IGIIG+GGLGH+ VKFGKAFGHHVTVISTSPSK++EAK  LGAD+FI+ST+  Q
Sbjct  181   DTKGKKIGIIGLGGLGHVAVKFGKAFGHHVTVISTSPSKEQEAKHNLGADDFIISTNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M  KKR++DFILDTVSA HSLG YLELLKVNGTLV+VGAPDKPID   FP+I GKRTVKG
Sbjct  241   MMEKKRTLDFILDTVSAKHSLGSYLELLKVNGTLVIVGAPDKPIDLPAFPMIFGKRTVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S+IGS+EETQEM+++C K NIL DIE IT D+IN   +RLA NDVKYRFVID+AG P+S
Sbjct  301   SMIGSIEETQEMMDLCGKHNILSDIEIITTDQINEGLERLANNDVKYRFVIDIAG-PSS  358



>ref|XP_007222094.1| hypothetical protein PRUPE_ppa007634mg [Prunus persica]
 gb|EMJ23293.1| hypothetical protein PRUPE_ppa007634mg [Prunus persica]
Length=361

 Score =   521 bits (1343),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/360 (71%), Positives = 309/360 (86%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI P+ FKRRENG NDVTI++LYCGICH+DLH  +NDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDSSGKITPFIFKRRENGINDVTIEVLYCGICHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV  FK+GDRVGVGC+AA+CLEC+FCK SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVKEFKVGDRVGVGCLAATCLECDFCKDSQENYCDQVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VVH+P +LP+D  APLLCAGVT+F P+KD+NL 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVHIPANLPLDATAPLLCAGVTVFSPMKDHNLH  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+KEAKERLGAD+F++STDA Q
Sbjct  181   QAPGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKERLGADDFLVSTDAQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             ++   R++DFIL+TVSA HSLGP LELLKVNGT+V+VGAPD+P +   FP+I GKR VKG
Sbjct  241   LKKGMRTLDFILNTVSAKHSLGPLLELLKVNGTMVVVGAPDQPFELPSFPMIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM-AGNPTS  1111
             SVIG M +T+EM+ +C K NI CDIE  TP K++ A DR+AKNDV+YRFVID+ AG P++
Sbjct  301   SVIGGMRDTKEMMELCGKHNITCDIEVTTPHKLDAALDRVAKNDVRYRFVIDITAGLPSN  360



>ref|XP_009400342.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   520 bits (1340),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 256/354 (72%), Positives = 308/354 (87%), Gaps = 1/354 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ V GWAA DSSGKI P+ FKRR+NG +DVTIKILYCG+CH+DLH  KNDW
Sbjct  1     MAETTPNHTQTVFGWAAKDSSGKITPFVFKRRKNGVDDVTIKILYCGMCHTDLHYIKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITGI+T+VGSNV+NFK+GDRVGVGC+AASCL+CEFCK SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGIITMVGSNVSNFKVGDRVGVGCLAASCLKCEFCKDSQENYCDQLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS++ VAD R+VVH+P+SLP+D+AAPLLCAG+T+F P+K +N++
Sbjct  121   FTYNGIFWDGSITYGGYSQMLVADNRYVVHIPDSLPLDKAAPLLCAGITVFSPMKQHNML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ VKFGKAFG HVTVISTSPSK+ EAK RLGAD+F++STD  Q
Sbjct  181   -QPGKKLGVVGLGGLGHIAVKFGKAFGLHVTVISTSPSKETEAKMRLGADDFLVSTDPKQ  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA  RS+DFI+DTVSANHSLGP LELLK+ GTL LVGAPDKP++   FPLI GKRTV G
Sbjct  240   MQACARSLDFIIDTVSANHSLGPILELLKIRGTLALVGAPDKPMELPSFPLIFGKRTVSG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             S+IG M+ETQEM+++C K+NI  +IE +TPD IN A DRLA+NDV+YRFVID+A
Sbjct  300   SIIGGMKETQEMMDVCGKYNITSEIELVTPDHINEALDRLARNDVRYRFVIDIA  353



>ref|XP_010061091.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Eucalyptus 
grandis]
 gb|KCW67989.1| hypothetical protein EUGRSUZ_F01679 [Eucalyptus grandis]
Length=360

 Score =   520 bits (1338),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 257/355 (72%), Positives = 302/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HT  VSGWAA+DSSG+I PYTFKRRENG NDVTI++LYCGICH+DLH AKN+W
Sbjct  1     MAQETQNHTLSVSGWAAYDSSGEIKPYTFKRRENGVNDVTIEVLYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+V  VG N   FKIGDRVGVGC+AASCL+CEFC  SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVVIKVGCNAGKFKIGDRVGVGCLAASCLKCEFCADSQENYCDQMQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS + VA YR+VV +PE+LPMD  APLLCAG+T+F PLKDN ++
Sbjct  121   FTYNGIFWDGSITYGGYSNVIVAHYRYVVRIPENLPMDSVAPLLCAGITVFSPLKDNGML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G PGK++G++G+GGLGH+ VKFGKAFGHHVTV+STSPSK+ EAK RLGAD+FI+ST++ Q
Sbjct  181   GSPGKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTSPSKETEAKGRLGADDFIVSTNSQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSA HSLGP LELLKV+GTLV VGAPD+P++   FPLI GKR+VKG
Sbjct  241   MQAGKRSLDFILDTVSAQHSLGPILELLKVDGTLVTVGAPDQPLELPPFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  301   SMTGGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  355



>ref|XP_010666914.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   520 bits (1338),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 303/362 (84%), Gaps = 2/362 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGK+ PY FKRRENG NDVTIK+LYCG+CH+DLH  +NDW
Sbjct  1     MAQTTPNHTQNVSGWAAHDSSGKMTPYVFKRRENGVNDVTIKVLYCGMCHTDLHHVRNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YP VPGHEITGI+T VG +VT FK GD+VGVGC+AASCLECEFCK S+ENYC  IQ
Sbjct  61    GITMYPCVPGHEITGIITKVGKDVTRFKEGDKVGVGCLAASCLECEFCKNSEENYCDQIQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VV VPE LPMD AAPLLCAG+T++ P+KD+NL+
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADQRYVVRVPEGLPMDAAAPLLCAGITVYSPMKDSNLL  180

Query  575   --GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDA  748
                   K+IGIIG+GGLGH+ VKFGKAFGHHVT+ISTSPSK+ EA++RLGAD+FI+STD 
Sbjct  181   ESSENPKKIGIIGLGGLGHVAVKFGKAFGHHVTIISTSPSKETEARQRLGADDFIVSTDP  240

Query  749   HQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTV  928
              QM+ K+RS+D+ILDTVSA HSLGPYLELLKV GTL +VGAPDKP+    FPLI GKRTV
Sbjct  241   KQMKEKRRSLDYILDTVSAYHSLGPYLELLKVQGTLHIVGAPDKPMGLPSFPLIFGKRTV  300

Query  929   KGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPT  1108
             KGS+ G M ETQEM+++C K NI CDIE +TPDKIN A  RLA NDV+YRFVID+AG   
Sbjct  301   KGSMTGGMIETQEMMDMCGKHNITCDIEMVTPDKINEALQRLANNDVRYRFVIDIAGEEV  360

Query  1109  SS  1114
              S
Sbjct  361   GS  362



>ref|NP_001242404.1| uncharacterized protein LOC100779140 [Glycine max]
 gb|ACU18356.1| unknown [Glycine max]
Length=362

 Score =   518 bits (1334),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 261/360 (73%), Positives = 304/360 (84%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA +   HT  VSGWAAHDSSGKI PY+FKRR+NG NDVTIKILYCGICH+DLH AKN+W
Sbjct  1     MAESRANHTVSVSGWAAHDSSGKITPYSFKRRQNGVNDVTIKILYCGICHTDLHCAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI G VT VG+NV  F  GDRVGVGC+AASCLEC  CK  QENYC+++Q
Sbjct  61    GITMYPVVPGHEIIGEVTKVGTNVKGFMEGDRVGVGCLAASCLECHHCKTDQENYCQDLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNGIFWDG+ITYGGYS++ VADYR+VVH+P SLPMD AAPLLCAG+T+F PLK+++LV
Sbjct  121   FVYNGIFWDGTITYGGYSQIFVADYRYVVHIPASLPMDAAAPLLCAGITVFSPLKEHDLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GKRIG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAK+RLGAD FILS++  Q
Sbjct  181   ATAGKRIGVVGLGGLGHIAVKFGKAFGHHVTVISTSPSKEPEAKQRLGADHFILSSNPKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA +RS+DFILDTVSA HSL P LELLKVNGTL LVGAPDKP+    FPLI GKR+VKG
Sbjct  241   LQAARRSMDFILDTVSAEHSLSPILELLKVNGTLFLVGAPDKPLQLPAFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
              +IG ++ETQEML +CAK+NI  DIE ITPDKIN A +RLAKNDV+YRFVID+A   TS+
Sbjct  301   GIIGGIKETQEMLEVCAKYNITSDIELITPDKINEAMERLAKNDVRYRFVIDIANAVTSN  360



>ref|XP_008359757.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Malus domestica]
Length=366

 Score =   517 bits (1331),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 299/350 (85%), Gaps = 0/350 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHD SGKI P+ FKRRENG NDVTIK+LYCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDPSGKITPFVFKRRENGINDVTIKVLYCGICHTDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV  FK GDRVGVGC+AA+CLECEFCK SQENYC  +Q
Sbjct  61    GMTMYPVVPGHEITGLITKVGSNVKEFKEGDRVGVGCLAATCLECEFCKSSQENYCDQLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VVH+PE+LP+D  APLLCAGVT+F P+KD+ L 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVHIPENLPLDATAPLLCAGVTVFTPMKDHKLH  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSP+K+KEAKE LGAD+F++STD  Q
Sbjct  181   KTTGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPAKEKEAKEHLGADDFLVSTDPQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +Q  KR++DFIL+TVSA HSLG  LELLKVNGT+V+VGAPD+P +   FPLI GKR VKG
Sbjct  241   LQKGKRTLDFILNTVSAKHSLGSILELLKVNGTMVVVGAPDQPFELPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFV  1084
             SVIG + ET+EM+N+C K NI CDIE  TPDKIN A DR+AKNDV+YRFV
Sbjct  301   SVIGGISETREMMNLCGKHNITCDIELTTPDKINEALDRVAKNDVRYRFV  350



>ref|XP_010061092.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Eucalyptus 
grandis]
Length=360

 Score =   515 bits (1327),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 301/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HT  VSGWAA+DSSG+I PYTFKRR  G NDVTI++LYCGICH+DLH AKN+W
Sbjct  1     MAQETQNHTLSVSGWAAYDSSGEIKPYTFKRRWVGVNDVTIEVLYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+V  VG N   FKIGDRVGVGC+AASCL+CEFC  SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVVIKVGCNAGKFKIGDRVGVGCLAASCLKCEFCADSQENYCDQMQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS + VADYR+VV +PE+LPMD  APLLCAG+T+F PLKDN ++
Sbjct  121   FTYNGIFWDGSITYGGYSNVIVADYRYVVRIPENLPMDSVAPLLCAGITVFSPLKDNGML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G PGK++G++G+GGLGH+ VKFGKAFGHHVTV+STSPSK+ EAK RLGAD+FI+ST++ Q
Sbjct  181   GSPGKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTSPSKETEAKGRLGADDFIVSTNSQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSA HSLGP LELLKV+GTLV VGAPD+P++   FPLI GKR+VKG
Sbjct  241   MQAGKRSLDFILDTVSAQHSLGPILELLKVDGTLVTVGAPDQPLELPPFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  301   SMTGGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  355



>ref|XP_004499301.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Cicer 
arietinum]
Length=359

 Score =   515 bits (1326),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 262/356 (74%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ VSGWAAHD+S KI PYTFKRRENG  DVTIKILYCGICH+DLH AK+DW
Sbjct  1     MTQTTPNHTQTVSGWAAHDTSAKITPYTFKRRENGVTDVTIKILYCGICHTDLHHAKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGS+V  FK GDRVGVGC+AASCL+CE+CK  QENYC N+Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSDVKGFKEGDRVGVGCLAASCLDCEYCKTDQENYCDNLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNGIFWDGSITYGGYS++ VADYR+VVH+PESLPMD  APLLCAG+T+F PLKD++LV
Sbjct  121   FVYNGIFWDGSITYGGYSEMLVADYRYVVHIPESLPMDAVAPLLCAGITVFSPLKDHDLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAKERLGAD+F+LS++  Q
Sbjct  181   SSPGKKIGVVGLGGLGHMAVKFGKAFGHHVTVISTSPSKEAEAKERLGADDFLLSSNPDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA KRS+DFILDTVSA+H+L P LELLKVNGTL +VGAPDKP+    FPLI GKR++KG
Sbjct  241   LQAAKRSLDFILDTVSADHALMPILELLKVNGTLFMVGAPDKPLQLPAFPLIFGKRSIKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              +IG ++ETQEML +C K NI CDIE I PD IN AF RLAKNDV+YRFVID+AG 
Sbjct  301   GIIGGIKETQEMLEVCGKHNITCDIELIKPDTINEAFVRLAKNDVRYRFVIDIAGT  356



>ref|XP_009334729.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X1 [Pyrus x bretschneideri]
Length=366

 Score =   515 bits (1326),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 255/350 (73%), Positives = 299/350 (85%), Gaps = 0/350 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHD SGK+ P+ FKRRENG NDVTIK+LYCGICH+DLH AKNDW
Sbjct  1     MAQTTPNHTQTVSGWAAHDPSGKVTPFVFKRRENGINDVTIKVLYCGICHTDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNV  FK GDRVGVGC+AA+CLECEFCK SQENYC  +Q
Sbjct  61    GMTMYPVVPGHEITGLITKVGSNVKEFKEGDRVGVGCLAATCLECEFCKSSQENYCDQLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD+R+VVH+PE+LP+D  APLLCAGVT+F P+KD+ L 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADHRYVVHIPENLPLDATAPLLCAGVTVFTPMKDHKLH  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSP+K+KEAKE LGAD+F++STD  Q
Sbjct  181   KTTGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPAKEKEAKEHLGADDFLVSTDPQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +Q  KR++DFIL+TVSA HSLG  LELLKVNGT+V+VGAPD+P +   FPLI GKR VKG
Sbjct  241   LQKGKRTLDFILNTVSAKHSLGSILELLKVNGTMVVVGAPDQPFELPSFPLIFGKRAVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFV  1084
             SVIG + ET+EM+N+C + NI CDIE  TPDKIN A DR+AKNDV+YRFV
Sbjct  301   SVIGGISETREMMNLCGQHNITCDIELTTPDKINEALDRVAKNDVRYRFV  350



>ref|XP_007160636.1| hypothetical protein PHAVU_001G004000g [Phaseolus vulgaris]
 gb|ESW32630.1| hypothetical protein PHAVU_001G004000g [Phaseolus vulgaris]
Length=359

 Score =   513 bits (1320),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 259/354 (73%), Positives = 302/354 (85%), Gaps = 0/354 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MAATT  HT  VSGWAAHDSSGKI PYTFKRR+NG NDVTIKILYCGICH+DLH AKN+W
Sbjct  1     MAATTPNHTVTVSGWAAHDSSGKISPYTFKRRKNGVNDVTIKILYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEI G+VT  GS+V  FK GDRVG+GCMAASCL+CE C+  QENYC+ ++
Sbjct  61    GITMYPVVPGHEIVGVVTEAGSDVKGFKEGDRVGIGCMAASCLDCEHCETGQENYCEKME  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNGIFWDGSITYGGYS+L VAD+RFVVHVPESLPMD AAPLLCAG+T+F PLKD++LV
Sbjct  121   FVYNGIFWDGSITYGGYSQLIVADHRFVVHVPESLPMDAAAPLLCAGITVFSPLKDHDLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GK+IG++G+GGLGHL VKFGKAFGHHVTVISTSPSK++EAK+RLGAD+FI+ST+  Q
Sbjct  181   ATGGKKIGVVGLGGLGHLAVKFGKAFGHHVTVISTSPSKEEEAKQRLGADDFIISTNPEQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +   KRS+DFILDTVSA H L   LELLKV GTL LVGAPDKP+    FPLI GKR+VKG
Sbjct  241   LAKAKRSLDFILDTVSAEHPLLSILELLKVKGTLFLVGAPDKPLQLPSFPLIMGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
              +IG ++ETQEML++CAK+NI  DIE IT D+IN A +R+AKNDV+YRFVID+A
Sbjct  301   GIIGGIKETQEMLDVCAKYNITSDIELITADRINEAIERVAKNDVRYRFVIDIA  354



>ref|XP_008807131.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X2 [Phoenix dactylifera]
Length=358

 Score =   512 bits (1319),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 253/353 (72%), Positives = 300/353 (85%), Gaps = 1/353 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ V GWAA DS+GKI P+ FKRRENG +DVTIKILYCGICH+DLH  K+DW
Sbjct  1     MTETTPNHTQTVEGWAAMDSNGKIAPFVFKRRENGEDDVTIKILYCGICHTDLHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YP+VPGHEITG++T VGSN TNFK+GDRVGVGC+AA+CLECEFCK S+ENYC  +Q
Sbjct  61    GITMYPIVPGHEITGVITKVGSNATNFKVGDRVGVGCLAATCLECEFCKASEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVP+SLP+D AAPLLCAG+T+F P+K  N+ 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADKRYVVHVPDSLPLDAAAPLLCAGITVFSPMKYYNM-  179

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KFGKAFG HVTVISTSPSK+KEAKERLGAD+FILSTD  +
Sbjct  180   SQPGKKLGVVGLGGLGHVAIKFGKAFGLHVTVISTSPSKEKEAKERLGADDFILSTDPER  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M++ KRS+D+I+DTV+A HSLGP LELLKV GTLVLVGAPDKP+D   FPL  GKR V G
Sbjct  240   MESGKRSLDYIIDTVAAKHSLGPILELLKVRGTLVLVGAPDKPLDLPSFPLFFGKRNVAG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             S+IG M+ETQEM++ C K NI CDIE + PD IN A DRLA+NDV+YRFVID+
Sbjct  300   SMIGGMKETQEMMDFCGKHNITCDIELVKPDHINEALDRLARNDVRYRFVIDI  352



>ref|XP_010061095.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Eucalyptus 
grandis]
 gb|KCW67990.1| hypothetical protein EUGRSUZ_F01680 [Eucalyptus grandis]
Length=360

 Score =   512 bits (1318),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 255/355 (72%), Positives = 298/355 (84%), Gaps = 0/355 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HT  VSGWAA+DSSG+I PYTFKRRENG NDVTI++LYCGICH+DLH AKN+W
Sbjct  1     MAQETQNHTLSVSGWAAYDSSGEIKPYTFKRRENGVNDVTIEVLYCGICHTDLHYAKNEW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG+V  VG N   FKIG RVGVGC+AASCL+CE C  SQENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVVIKVGCNAGKFKIGARVGVGCLAASCLKCELCADSQENYCDQMQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS + VADYR+VV +PE+LPMD  APLL  GVT+F PLKDN ++
Sbjct  121   FTYNGIFWDGSITYGGYSNVIVADYRYVVRIPENLPMDSVAPLLFVGVTVFSPLKDNGML  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G PGK++G++G+GGLGH+ VKFGKAFGHHVTV+ST PSK+ EAK RLGAD+FI+ST++ Q
Sbjct  181   GSPGKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTFPSKETEAKGRLGADDFIVSTNSQQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSA HSLGP LELLKV+GTLV VGAPDKP++   FPLI GKR+VKG
Sbjct  241   MQAGKRSLDFILDTVSAQHSLGPILELLKVDGTLVTVGAPDKPLELPSFPLIFGKRSVKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  301   SMTGGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  355



>ref|XP_008807129.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   509 bits (1311),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 254/354 (72%), Positives = 300/354 (85%), Gaps = 2/354 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ V GWAA DS+GKI P+ FKRRENG +DVTIKILYCGICH+DLH  K+DW
Sbjct  1     MTETTPNHTQTVEGWAAMDSNGKIAPFVFKRRENGEDDVTIKILYCGICHTDLHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YP+VPGHEITG++T VGSN TNFK+GDRVGVGC+AA+CLECEFCK S+ENYC  +Q
Sbjct  61    GITMYPIVPGHEITGVITKVGSNATNFKVGDRVGVGCLAATCLECEFCKASEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVP+SLP+D AAPLLCAG+T+F P+K  N+ 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADKRYVVHVPDSLPLDAAAPLLCAGITVFSPMKYYNM-  179

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KFGKAFG HVTVISTSPSK+KEAKERLGAD+FILSTD  +
Sbjct  180   SQPGKKLGVVGLGGLGHVAIKFGKAFGLHVTVISTSPSKEKEAKERLGADDFILSTDPER  239

Query  755   M-QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             M Q+ KRS+D+I+DTV+A HSLGP LELLKV GTLVLVGAPDKP+D   FPL  GKR V 
Sbjct  240   MEQSGKRSLDYIIDTVAAKHSLGPILELLKVRGTLVLVGAPDKPLDLPSFPLFFGKRNVA  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             GS+IG M+ETQEM++ C K NI CDIE + PD IN A DRLA+NDV+YRFVID+
Sbjct  300   GSMIGGMKETQEMMDFCGKHNITCDIELVKPDHINEALDRLARNDVRYRFVIDI  353



>ref|XP_003589548.1| Cinnamyl alcohol dehydrogenase-related protein [Medicago truncatula]
 gb|AES59799.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=360

 Score =   507 bits (1306),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 261/354 (74%), Positives = 303/354 (86%), Gaps = 0/354 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA TT  HTQ VSGWAAHDSSGKI PYTFKRRENG  DVTIKILYCGICH+D+H AK+DW
Sbjct  1     MAKTTPNHTQTVSGWAAHDSSGKITPYTFKRRENGGTDVTIKILYCGICHTDVHHAKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGS+V  FK GD+VGVGC+AASCL+CE+CK  QENYC+ +Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSDVEGFKDGDKVGVGCLAASCLDCEYCKTDQENYCEKLQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YNGIFWDGSITYGGYS++ V DYR+VVH+PESLPMD AAPLLCAG+T+F PLKD+ LV
Sbjct  121   FVYNGIFWDGSITYGGYSQMLVVDYRYVVHIPESLPMDAAAPLLCAGITVFSPLKDHGLV  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
                GKRIG++G+GGLGH+ VKFGKAFGHHVTVISTSPSKQ EAKERLGAD+FI+ST+  Q
Sbjct  181   STAGKRIGVVGLGGLGHMAVKFGKAFGHHVTVISTSPSKQAEAKERLGADDFIISTNPDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             +QA KRS+DFILDTVSA+H+L P LELLKVNGTL +VGAPDKP+    FPLI GKR++KG
Sbjct  241   LQAAKRSLDFILDTVSADHALLPILELLKVNGTLFIVGAPDKPLQLPAFPLIFGKRSIKG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
              +IG ++ETQEML++C K NI CDIE I  D IN AF RL KNDV+YRFVID+A
Sbjct  301   GIIGGIKETQEMLDVCGKHNITCDIELIKADTINEAFQRLLKNDVRYRFVIDIA  354



>ref|XP_008807127.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Phoenix 
dactylifera]
Length=358

 Score =   506 bits (1302),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 250/353 (71%), Positives = 299/353 (85%), Gaps = 1/353 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ V GWAA +S+GKI P+ FKRRENG +DVTIKILYCGICH+DLH  K+DW
Sbjct  1     MTETTPNHTQTVEGWAAMESNGKIAPFVFKRRENGEDDVTIKILYCGICHTDLHHVKDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEITG++T VGSN TNF++GDRVGVGC+AA+CLECEFCK S+EN+C+ +Q
Sbjct  61    GITKYPVVPGHEITGVITKVGSNATNFRVGDRVGVGCLAATCLECEFCKASEENHCEKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVP+SLPMD AAPLLCAG+T+F P+K  N+ 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADKRYVVHVPDSLPMDAAAPLLCAGITVFSPMKYYNM-  179

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KFGKAFG HVTVISTSPSK+KEAKERLGAD+FI+STD  +
Sbjct  180   SQPGKKLGVVGLGGLGHVAIKFGKAFGLHVTVISTSPSKEKEAKERLGADDFIVSTDPQR  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M++  RS+D+I+DTV+A HSLGP LELL V GTLVLVGAPDKP+D   FPLI GKR V G
Sbjct  240   MKSGARSLDYIIDTVAAKHSLGPILELLTVRGTLVLVGAPDKPVDLPSFPLIFGKRNVAG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             S+IG M+ETQEM++ C K NI CDIE + PD IN A DRLA+NDV+YRFVID+
Sbjct  300   SMIGGMKETQEMMDFCGKHNITCDIELVKPDHINEALDRLARNDVRYRFVIDI  352



>ref|XP_010920094.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X1 [Elaeis guineensis]
Length=358

 Score =   506 bits (1302),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/353 (71%), Positives = 296/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ V GWAA DSSGKI P+ FKRRENG +DVTIKILYCGICH+DLH  ++DW
Sbjct  1     MKETTPNHTQTVDGWAARDSSGKITPFVFKRRENGVDDVTIKILYCGICHTDLHHVRDDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+YPVVPGHEITG++T VGSNVTNFK GDRVGVGC+AASCLECEFCK S+ENYC  +Q
Sbjct  61    GITMYPVVPGHEITGVITKVGSNVTNFKAGDRVGVGCLAASCLECEFCKASEENYCDKVQ  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVP+SLP+D AAPLLCAG+T+F P+K  N+ 
Sbjct  121   FTYNGIFWDGSITYGGYSKMLVADKRYVVHVPDSLPLDAAAPLLCAGITVFSPMKHYNM-  179

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KFGKAFG HVTVISTSPSK+KEAKERLGAD+FI+STD   
Sbjct  180   SQPGKKLGVVGLGGLGHVAIKFGKAFGLHVTVISTSPSKEKEAKERLGADDFIVSTDPKS  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M+   RS+D+I+DT +A HSLGP LELL V GTLVLVGAPD+P+D   FPLI GKR V G
Sbjct  240   MKRGARSLDYIIDTAAAKHSLGPILELLTVRGTLVLVGAPDQPVDLPSFPLIFGKRNVAG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             SVIG M+ETQEML+ C + NI CDIE + PD IN A DR+A+NDV+YRFVID+
Sbjct  300   SVIGGMKETQEMLDFCGEHNITCDIELVKPDYINEALDRVARNDVRYRFVIDI  352



>gb|AHF20169.1| cinnamyl alcohol dehydrogenase, partial [Musa acuminata AAA Group]
Length=335

 Score =   487 bits (1253),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 291/335 (87%), Gaps = 1/335 (0%)
 Frame = +2

Query  68    VSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGH  247
             V GWAA DSSGKI P+ FKRRENG +DVTIKILYCG+CH+DLH  KNDWG T+YPVVPGH
Sbjct  2     VFGWAAKDSSGKIRPFVFKRRENGVDDVTIKILYCGMCHTDLHYIKNDWGITMYPVVPGH  61

Query  248   EITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGS  427
             EITGI+T VGSNV+NFK+GDRVGVGC+AASCL+CEFCK SQENYC  +Q TYNGIFWDGS
Sbjct  62    EITGIITEVGSNVSNFKVGDRVGVGCLAASCLKCEFCKDSQENYCDQLQFTYNGIFWDGS  121

Query  428   ITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiig  607
             ITYGGYS++ VAD R+VVH+P+SLP+D+AAPLLCAG+T+F P+K ++++  PGK++G++G
Sbjct  122   ITYGGYSQMLVADNRYVVHIPDSLPLDKAAPLLCAGITVFSPMKQHDML-QPGKKLGVVG  180

Query  608   mgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFI  787
             +GGLGH+ VKFGKAFG HVTVISTSPSK+ EAK RLGAD+F++STD  QMQA  RS+DFI
Sbjct  181   LGGLGHIAVKFGKAFGLHVTVISTSPSKETEAKMRLGADDFLVSTDPKQMQACARSLDFI  240

Query  788   LDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQE  967
             +DTVSA HSLGP LELLK+ GTL LVGAPDKP++   FPLI GKRTV GS+IG M+ETQE
Sbjct  241   IDTVSAKHSLGPILELLKIRGTLALVGAPDKPMELPSFPLIFGKRTVSGSIIGGMKETQE  300

Query  968   MLNICAKFNILCDIETITPDKINVAFDRLAKNDVK  1072
             M+++C K+NI  +IE +TPD IN A DRLA+NDV+
Sbjct  301   MMDVCGKYNITSEIELVTPDHINEALDRLARNDVR  335



>ref|XP_006652134.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Oryza 
brachyantha]
Length=358

 Score =   474 bits (1219),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 230/352 (65%), Positives = 290/352 (82%), Gaps = 0/352 (0%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ V+GWAA D SGKI P+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4     TPNHTQTVTGWAAMDESGKITPFVFKRRENGVDDVTIKVQYCGMCHTDLHFIHNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VG+NV  FK+GDRVGVGC+AASCL+CE C++S+ENYC  + LTYN
Sbjct  64    YPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVALTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
             GIFWDGS+TYGGYS + VA  RFVV VP++LP+D AAPLLCAG+T++ P+K + ++   G
Sbjct  124   GIFWDGSVTYGGYSSMLVAHKRFVVRVPDTLPLDAAAPLLCAGITVYSPMKQHGMLQAAG  183

Query  587   krigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAK  766
              R+G++G+GGLGH+ VKFGKAFG +VTVISTSP+K++EA+E L AD F++STD  QMQA 
Sbjct  184   SRLGVVGLGGLGHVAVKFGKAFGLNVTVISTSPAKEREARESLKADNFVVSTDQKQMQAM  243

Query  767   KRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIG  946
              RS+D+I+DTV+A HSLGP LELLKVNG LVLVGAP+KP++   FPLI GKRTV GS+ G
Sbjct  244   TRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVSGSMTG  303

Query  947   SMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              M+ETQEM+++C + NI CDIE ++ D+IN A  RLA+NDV+YRFVI + G+
Sbjct  304   GMKETQEMMDVCGEHNITCDIELVSTDRINEALARLARNDVRYRFVISVGGD  355



>ref|NP_001052290.1| Os04g0229100 [Oryza sativa Japonica Group]
 sp|Q7XWU3.2|CADH6_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase 6; Short=OsCAD6 
[Oryza sativa Japonica Group]
 emb|CAD39904.2| OSJNBa0065B15.8 [Oryza sativa Japonica Group]
 dbj|BAF14204.1| Os04g0229100 [Oryza sativa Japonica Group]
 emb|CAH66093.1| H0209A05.10 [Oryza sativa Indica Group]
 dbj|BAG92519.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94032.1| unnamed protein product [Oryza sativa Japonica Group]
Length=360

 Score =   473 bits (1218),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 279/354 (79%), Gaps = 2/354 (1%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ VSGWAA D SGKIVP+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4     TPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VG+NV  FK+GDRVGVGC+AASCL+CE C++S+ENYC  + LTYN
Sbjct  64    YPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVALTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
             GIFWDGSITYGGYS + VA  RFVV +P++LP+D AAPLLCAG+T++ P+K + ++    
Sbjct  124   GIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQADA  183

Query  587   krigiigmgglghlgvkfg--kAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
                 +  +G  G   V     KAFG HVTVISTSP+K++EA+E L AD F++STD  QMQ
Sbjct  184   AGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFVVSTDQKQMQ  243

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A  RS+D+I+DTV+A HSLGP LELLKVNG LVLVGAP+KP++   FPLI GKRTV GS+
Sbjct  244   AMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVSGSM  303

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              G M+ETQEM++IC + NI CDIE ++ D+IN A  RLA+NDV+YRFVI++ G+
Sbjct  304   TGGMKETQEMMDICGEHNITCDIEIVSTDRINDALARLARNDVRYRFVINVGGD  357



>gb|KCW67988.1| hypothetical protein EUGRSUZ_F01678 [Eucalyptus grandis]
Length=351

 Score =   472 bits (1215),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/355 (68%), Positives = 290/355 (82%), Gaps = 9/355 (3%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA  T  HT  VSGWAA+DS+   +P +    ENG NDVTI++LYCGICH+DLH AKN+W
Sbjct  1     MAQETQNHTLSVSGWAAYDSNP--IP-SNAGGENGVNDVTIEVLYCGICHTDLHYAKNEW  57

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T+      HEITG+V  VG N   FKIGDRVGVGC+AASCL+CEFC  SQENYC  +Q
Sbjct  58    GITM------HEITGVVIKVGCNAGKFKIGDRVGVGCLAASCLKCEFCADSQENYCDQMQ  111

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYS + VADYR+VV +PE+LPMD  APLLCAG+T+F PLKDN ++
Sbjct  112   FTYNGIFWDGSITYGGYSNVIVADYRYVVRIPENLPMDSVAPLLCAGITVFSPLKDNGML  171

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
             G PGK++G++G+GGLGH+ VKFGKAFGHHVTV+STSPSK+ EAK RLGAD+FI+ST++ Q
Sbjct  172   GSPGKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTSPSKETEAKGRLGADDFIVSTNSQQ  231

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA KRS+DFILDTVSA HSLGP LELLKV+GTLV VGAPD+P++   FPLI GKR+VKG
Sbjct  232   MQAGKRSLDFILDTVSAQHSLGPILELLKVDGTLVTVGAPDQPLELPPFPLIFGKRSVKG  291

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             S+ G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  292   SMTGGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  346



>ref|NP_001136687.1| putative cinnamyl-alcohol dehydrogenase family protein isoform 
1 [Zea mays]
 gb|ACF82407.1| unknown [Zea mays]
 gb|ACG36666.1| mannitol dehydrogenase [Zea mays]
 tpg|DAA38662.1| TPA: putative cinnamyl-alcohol dehydrogenase family protein isoform 
1 [Zea mays]
 tpg|DAA38663.1| TPA: putative cinnamyl-alcohol dehydrogenase family protein isoform 
2 [Zea mays]
Length=361

 Score =   473 bits (1216),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/356 (63%), Positives = 290/356 (81%), Gaps = 1/356 (0%)
 Frame = +2

Query  47    TLTHTQVVSGWAA-HDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTT  223
             T  HT  V+GWAA ++S+GK+ P+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T
Sbjct  4     TPNHTLTVTGWAAMNESAGKVEPFVFKRRENGPDDVTIKVQYCGMCHTDLHFINNDWGIT  63

Query  224   VYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTY  403
              YP+VPGHEITG+VT  G NVT F++GDRVGVGC+AASCL+C+ C++S+ENYC  + LTY
Sbjct  64    TYPLVPGHEITGVVTKAGRNVTGFRVGDRVGVGCIAASCLDCDHCRRSEENYCDRVALTY  123

Query  404   NGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHP  583
             NG+FWDGS+TYGGYS+  VAD RFVV VP++LP+D AAPLLCAGVT++ P+K + ++GHP
Sbjct  124   NGVFWDGSVTYGGYSRALVADKRFVVRVPDALPLDAAAPLLCAGVTVYSPMKHHGMLGHP  183

Query  584   gkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQA  763
             G  +G++G+GGLGH+ VK  KAFG  VTV+STSP+K+ EA+ RLGAD F++STD  QM+ 
Sbjct  184   GASLGVVGLGGLGHVAVKLAKAFGLRVTVVSTSPAKEAEARARLGADRFVVSTDDAQMRD  243

Query  764   KKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVI  943
               RS+D+++DTVSA HSLGP L+LLKV+G LVLV APD+P++   FPLI GKRTV GS+ 
Sbjct  244   AARSLDYVIDTVSAKHSLGPILDLLKVSGKLVLVAAPDQPVELPSFPLIFGKRTVSGSMT  303

Query  944   GSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             G + ETQEML++CA+ NI CDIE ++ D IN A  RLA+NDV+YRFVID+AG+ TS
Sbjct  304   GGIRETQEMLDLCARHNITCDIELVSTDGINAALARLARNDVRYRFVIDIAGDSTS  359



>ref|XP_002446076.1| hypothetical protein SORBIDRAFT_06g001430 [Sorghum bicolor]
 gb|EES10404.1| hypothetical protein SORBIDRAFT_06g001430 [Sorghum bicolor]
Length=362

 Score =   470 bits (1209),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 227/356 (64%), Positives = 291/356 (82%), Gaps = 0/356 (0%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ V+GWAA + SGK+ P+ FKRRENG +DVTIK+ YCG+CH+DLH  +NDWG T+
Sbjct  4     TPNHTQTVAGWAAMNESGKLEPFIFKRRENGVDDVTIKVEYCGMCHTDLHFIQNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YP+VPGHEITG+VT VGSNVT F +GDRVGVGC+AASCL+C+ C++S+ENYC  + LTYN
Sbjct  64    YPLVPGHEITGVVTKVGSNVTGFGVGDRVGVGCIAASCLDCDHCRRSEENYCDKVTLTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
             G+F DGS+TYGGYSK+ VA  RFVV VP++LP+D AAPLLCAG+T++ P+K + ++   G
Sbjct  124   GVFPDGSVTYGGYSKMLVAHKRFVVRVPDTLPLDAAAPLLCAGITVYSPMKHHGMLRSAG  183

Query  587   krigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAK  766
               +G++G+GGLGH+ VKF KAFG  VTV+STSP+K+KEA+ERLGAD+F++S+D  QMQA 
Sbjct  184   ASLGVVGLGGLGHVAVKFAKAFGLRVTVVSTSPAKEKEARERLGADDFVVSSDQKQMQAM  243

Query  767   KRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIG  946
              RS+D+++DTVSA HSLGP LELLKVNG LVLV APD+P++   FPLI GKRTV GS+ G
Sbjct  244   ARSLDYVIDTVSAKHSLGPILELLKVNGKLVLVAAPDQPVELPSFPLIFGKRTVSGSMTG  303

Query  947   SMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
              M+ETQEML++C +  I CDIE ++ D IN A  RLA NDV+YRFVID+AG  +S+
Sbjct  304   GMKETQEMLDLCGQHGITCDIELVSTDGINDALQRLASNDVRYRFVIDIAGGDSSN  359



>gb|EPS69932.1| hypothetical protein M569_04831 [Genlisea aurea]
Length=354

 Score =   469 bits (1206),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 226/354 (64%), Positives = 286/354 (81%), Gaps = 0/354 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + HT+  SGWAAHD SG + PYTFKRRENG  DVTIKILYCGICH+D+H  KNDWG+T+Y
Sbjct  1     MAHTRTASGWAAHDPSGVVAPYTFKRRENGPTDVTIKILYCGICHTDVHHVKNDWGSTMY  60

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             PVVPGHEI GIVT +G  V  F++G+RVGVGC+AA+CL+CE C+  QENYC  +Q  YNG
Sbjct  61    PVVPGHEIVGIVTEIGGGVAGFEVGERVGVGCLAATCLDCEMCRDGQENYCDKVQFVYNG  120

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
              FWDG++TYGGYS   VAD+R+VV +PE+LP+D AAPLLCAG+T+F P+KD+ L+  PG 
Sbjct  121   FFWDGTVTYGGYSDFIVADHRYVVRIPENLPLDAAAPLLCAGITVFAPMKDHGLLETPGM  180

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
             R+G++G+GGLGH+ VKFGK+ GHHV VISTSPSK+ EAK++LGAD+FILS+D  QM A+ 
Sbjct  181   RLGVVGLGGLGHVAVKFGKSLGHHVAVISTSPSKEAEAKQKLGADDFILSSDPKQMMARA  240

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
             RS+D I++TVSANH +GP +ELLK  GT+VLVGAP KP++    PLI GKR +KGS+IGS
Sbjct  241   RSMDLIVNTVSANHFIGPIMELLKPKGTMVLVGAPQKPLELPWQPLIFGKRVIKGSMIGS  300

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             ++ETQEM++ C K N+ CD+E ++  +IN A  RLA NDVKYRFVID+AG   S
Sbjct  301   IKETQEMMDFCGKHNLTCDVEVVSTRRINEALQRLADNDVKYRFVIDIAGGIES  354



>gb|EEC76612.1| hypothetical protein OsI_14481 [Oryza sativa Indica Group]
Length=467

 Score =   473 bits (1216),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 224/363 (62%), Positives = 283/363 (78%), Gaps = 2/363 (1%)
 Frame = +2

Query  20    IYYSPMAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHV  199
             ++ + +   T  HTQ VSGWAA D SGKIVP+ FKRRENG +DVTIK+ YCG+CH+DLH 
Sbjct  102   VWTTLVMEVTPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHF  161

Query  200   AKNDWGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENY  379
               NDWG T+YPVVPGHEITG+VT VG+NV  FK+GDRVGVGC+AASCL+CE C++S+ENY
Sbjct  162   IHNDWGITMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENY  221

Query  380   CKNIQLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLK  559
             C  + LTYNGIFWDGSITYGGYS + VA  RFVV +P++LP+D AAPLLCAG+T++ P+K
Sbjct  222   CDKVALTYNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMK  281

Query  560   DNNLVGHPgkrigiigmgglghlgvkfg--kAFGHHVTVISTSPSKQKEAKERLGADEFI  733
              + ++        +  +G  G   V     KAFG HVTVISTSP+K++EA+E L AD F+
Sbjct  282   QHGMLQADAAGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFV  341

Query  734   LSTDAHQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLIS  913
             +STD  QMQA  RS+D+I+DTV+A HSLGP LELLKVNG LVLVGAP+KP++   FPLI 
Sbjct  342   VSTDQKQMQAMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIF  401

Query  914   GKRTVKGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             GKRTV GS+ G M+ETQEM++IC + NI CDIE ++ D+IN A  RLA+NDV+YRFVI++
Sbjct  402   GKRTVSGSMTGGMKETQEMMDICGEHNITCDIEIVSTDRINDALARLARNDVRYRFVINV  461

Query  1094  AGN  1102
              G+
Sbjct  462   GGD  464


 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  47   TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
            T  HTQ VSGWAA D SGKIVP+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4    TPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGITM  63

Query  227  YPVVPGHEITGIVT  268
            YPVVPGHEITG+VT
Sbjct  64   YPVVPGHEITGVVT  77



>ref|XP_004244822.2| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Solanum 
lycopersicum]
Length=362

 Score =   468 bits (1205),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/360 (64%), Positives = 292/360 (81%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA +T   TQ   GWAA DSSGK+ P+ FKRRENG +DVTIKILYCG+C +D+H AKNDW
Sbjct  1     MAKSTPKLTQSALGWAAQDSSGKLTPFMFKRRENGLDDVTIKILYCGMCRTDVHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YP+VPG+EI GIV  VGSNV+ FK+G+RVGVG +AA+CL+CE C   QENYC  ++
Sbjct  61    GNTTYPIVPGYEIIGIVIKVGSNVSKFKVGERVGVGYVAATCLDCELCNSFQENYCDQMK  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YN I WD + TYGGYS + VAD+R+VVH+P+SLPMDRAAPL+ AG+T++  +K++NL 
Sbjct  121   PVYNSIHWDDTPTYGGYSTIMVADHRYVVHIPDSLPMDRAAPLMGAGLTVYTAMKNSNLF  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK + +IG+GG+GH+ +KFGKAFGHHVTVISTSPSK+K+AKE+L AD FILSTD  Q
Sbjct  181   ESPGKHMAVIGLGGVGHMAIKFGKAFGHHVTVISTSPSKEKDAKEKLDADGFILSTDLKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  +RS+DFI+DTVSA HSLGPYLELLKVNGT+ +VG P +PI+ L  PLI GK+ V+G
Sbjct  241   MQRNRRSLDFIIDTVSAKHSLGPYLELLKVNGTISIVGEPAQPIEVLATPLIYGKKVVRG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S+IGS++E QEM+N C K NILC+IE +T DKIN AFDRL+KNDVK+RFV+++A +  SS
Sbjct  301   SIIGSVKELQEMMNFCGKHNILCEIELVTIDKINEAFDRLSKNDVKFRFVLNVAAHQYSS  360



>ref|XP_006351089.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Solanum 
tuberosum]
Length=362

 Score =   468 bits (1204),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 230/360 (64%), Positives = 292/360 (81%), Gaps = 0/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA +T   TQ   GWAAHDSSGK+ P+ FKRRENG  DVTIKILYCG+C +D+H AKNDW
Sbjct  1     MANSTPKFTQSALGWAAHDSSGKLTPFMFKRRENGVEDVTIKILYCGMCRTDVHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YP+VPG+EI+GIV  VGSNV+ FK+G+RVGVG +AA+CL+CE C   QENYC  ++
Sbjct  61    GNTTYPIVPGYEISGIVIKVGSNVSKFKVGERVGVGYVAATCLDCELCNSFQENYCDQMK  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
               YN I WD + TYGGYS + VAD+R+VVH+PESLPMDRAAPL+ AG+T++  +K++NL 
Sbjct  121   SVYNSIHWDDTPTYGGYSTIMVADHRYVVHIPESLPMDRAAPLMGAGLTVYTAMKNSNLF  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK + +IG+GG+GH+ +KFGKAFGHHVTVISTSPSK+K+AK++L AD F+LSTD  Q
Sbjct  181   ESPGKHMAVIGLGGVGHMAIKFGKAFGHHVTVISTSPSKEKDAKDKLDADGFVLSTDLKQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQ  +RS+DFI+DTVSA HSLGPYLELLKVNGT+ +VG P +PI+    PLI GK+ V+G
Sbjct  241   MQRNRRSLDFIIDTVSAKHSLGPYLELLKVNGTISIVGEPAQPIEVPATPLIYGKKVVRG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S+IGS++E QEM+N C K NILC+IE ++ DKIN AFDRL+KNDVK+RFV+++A +  SS
Sbjct  301   SIIGSVKELQEMMNFCGKHNILCEIELVSIDKINEAFDRLSKNDVKFRFVLNVAAHQYSS  360



>ref|XP_004975118.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Setaria 
italica]
Length=357

 Score =   468 bits (1203),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 292/352 (83%), Gaps = 1/352 (0%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ V+GWAA + SGK+ P+ FKRRENG +DVTIK+ YCG+CH+DLH  +NDWG T+
Sbjct  4     TPNHTQTVAGWAAMNESGKVEPFIFKRRENGMDDVTIKVQYCGMCHTDLHFIQNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VG+NV  FK+GDRVGVGC++ASCL+CE C++S+ENYC  + LTYN
Sbjct  64    YPVVPGHEITGVVTKVGTNVLGFKVGDRVGVGCISASCLDCEHCRRSEENYCDKVTLTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
             GIFWDGS+TYGGYS + VA+ RFVV +P++LP+D AAPLLCAG+T++ P+K + ++   G
Sbjct  124   GIFWDGSVTYGGYSNMLVANKRFVVRIPDNLPLDAAAPLLCAGITVYSPMKQHGML-QSG  182

Query  587   krigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAK  766
               +G++G+GGLGH+ VKFGKAFG  VTVISTSP+K++EA+ERL AD+FI+ST+  QMQA 
Sbjct  183   GSLGVVGLGGLGHVAVKFGKAFGLRVTVISTSPAKEREARERLKADDFIVSTNQKQMQAM  242

Query  767   KRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIG  946
              RS+D+I+DTVSA HSLGP LELLKVNG LVLV APD+P++   FPLI GKRTV GS+ G
Sbjct  243   TRSLDYIIDTVSAKHSLGPILELLKVNGKLVLVAAPDQPVELPSFPLIFGKRTVSGSMTG  302

Query  947   SMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              ++ETQEML++C + NI CDIE ++ D+IN A  RLA+NDV+YRFVI++ GN
Sbjct  303   GLKETQEMLDLCGEHNITCDIELVSTDEINEALARLARNDVRYRFVINIGGN  354



>dbj|BAK01962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   464 bits (1195),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 229/352 (65%), Positives = 290/352 (82%), Gaps = 1/352 (0%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ  SGWAA ++SGK+VP+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4     TPNHTQAASGWAAMEASGKVVPFAFKRRENGVDDVTIKVHYCGMCHTDLHFINNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VGSNV+ F+ GDRVGVGC+AASCL+C+ C++S+ENYC  + LTYN
Sbjct  64    YPVVPGHEITGVVTKVGSNVSGFRPGDRVGVGCIAASCLDCDHCRRSEENYCDKVALTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
             GIFWDGS+TYGGYS + VA  RF+V +P++LP+D AAPLLCAG+T++ P+K + ++ H G
Sbjct  124   GIFWDGSVTYGGYSNMLVAHKRFLVRIPDTLPLDAAAPLLCAGITVYSPMKQHGML-HAG  182

Query  587   krigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAK  766
             +R+G++G+GGLGH+ VKFGKAFG  VTVISTSP+K+ EA+E L AD+F+LSTD  QMQA 
Sbjct  183   RRLGVVGLGGLGHVAVKFGKAFGLKVTVISTSPAKELEARESLKADDFVLSTDDKQMQAM  242

Query  767   KRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIG  946
              RS+D+++DTVSA HSLGP LELLKVNG LVLV APDKP++   FPLI GKRTV GS+ G
Sbjct  243   ARSLDYVIDTVSAQHSLGPILELLKVNGKLVLVAAPDKPVELPSFPLIFGKRTVSGSMTG  302

Query  947   SMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              M+ETQEM+++C +  I  DIE ++ D IN A  RLA+NDV+YRFVID+AGN
Sbjct  303   GMKETQEMMDLCGEHGITADIELVSTDGINDALARLARNDVRYRFVIDVAGN  354



>ref|XP_003581549.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Brachypodium 
distachyon]
Length=361

 Score =   463 bits (1192),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 226/354 (64%), Positives = 289/354 (82%), Gaps = 2/354 (1%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ VSGWAA D SGK+ P+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4     TPNHTQTVSGWAATDESGKVAPFIFKRRENGVDDVTIKVEYCGMCHTDLHFVNNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VG+NV+ FK GDRVGVGC++ SCL+CE C +S+ENYC  + LTYN
Sbjct  64    YPVVPGHEITGVVTKVGTNVSTFKAGDRVGVGCISGSCLDCEHCARSEENYCDKVTLTYN  123

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH--  580
             G+FWDGS+TYGGYS + VA+ RF+V +P+SLP+D AAPLLCAG+T++ P+K + ++    
Sbjct  124   GVFWDGSVTYGGYSGMFVANKRFLVRIPDSLPLDAAAPLLCAGITVYSPMKQHGMLDQRG  183

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
              G+R+G++G+GGLGH+ VKFGKAFG  VTVISTSP+K++EA+E L AD+F+LSTD  QMQ
Sbjct  184   AGRRLGVVGLGGLGHVAVKFGKAFGLRVTVISTSPAKEREARENLMADDFVLSTDQKQMQ  243

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A  RS+D+++DTVSA+HSLGP LELLKVNG LVLV APDKP++   FPLI GKRTV GS+
Sbjct  244   AMARSLDYVIDTVSASHSLGPILELLKVNGKLVLVAAPDKPVELPSFPLIFGKRTVSGSM  303

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              G M+ETQEM+++C +  I CDIE +  D+IN A  RLA+NDV+YRFV+D+ G+
Sbjct  304   TGGMKETQEMMDLCGEHGITCDIELVFTDRINDALARLARNDVRYRFVLDIGGS  357



>ref|XP_004975280.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Setaria 
italica]
Length=356

 Score =   442 bits (1138),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/354 (62%), Positives = 281/354 (79%), Gaps = 1/354 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A T  HTQ V+GWAA + SGK+ P+ FKRRENG +DVTIK+LYCG+CH+DLH  KN W  
Sbjct  2     AITENHTQTVAGWAAMNESGKVEPFVFKRRENGVDDVTIKVLYCGMCHTDLHFMKNHWDI  61

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
             T+YPVVPGHEITG+VT VG+NV+ FK GDRVGVGC+  +CL+C+ C+ S ENYC  + LT
Sbjct  62    TMYPVVPGHEITGVVTSVGANVSGFKAGDRVGVGCIVEACLDCDHCRHSDENYCDKLVLT  121

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
             YNGI  DGS+TYGGYS++ V   +FV  +P++LP+D AAPLLCAG+T++ P++ + +V  
Sbjct  122   YNGILSDGSVTYGGYSEMLVVHKKFVARIPDTLPLDAAAPLLCAGITVYSPMRRHGMV-K  180

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
              G  +G++G+GGLGH+ VKFGKAFG  VTV+STSP K+KEA+E L AD+FI+STD  QMQ
Sbjct  181   AGGSLGVVGLGGLGHIAVKFGKAFGLRVTVVSTSPDKEKEAREGLKADDFIVSTDKKQMQ  240

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             AK RS+D+I+DTV   HSLGP LELLKV+G L LV APD+PI+   FPLI G+RT+ GS+
Sbjct  241   AKSRSLDYIIDTVPVKHSLGPLLELLKVDGVLALVAAPDQPIELPSFPLIFGRRTISGSI  300

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
              GSM+ETQEML++C + NI CDIE ++ + IN A  RLA+NDV+YRFVID+AG+
Sbjct  301   TGSMKETQEMLDLCGEHNITCDIELVSTNGINGALARLARNDVRYRFVIDIAGD  354



>ref|XP_009334738.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X2 [Pyrus x bretschneideri]
Length=299

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 252/292 (86%), Gaps = 0/292 (0%)
 Frame = +2

Query  35   MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
            MA TT  HTQ VSGWAAHD SGK+ P+ FKRRENG NDVTIK+LYCGICH+DLH AKNDW
Sbjct  1    MAQTTPNHTQTVSGWAAHDPSGKVTPFVFKRRENGINDVTIKVLYCGICHTDLHFAKNDW  60

Query  215  GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
            G T+YPVVPGHEITG++T VGSNV  FK GDRVGVGC+AA+CLECEFCK SQENYC  +Q
Sbjct  61   GMTMYPVVPGHEITGLITKVGSNVKEFKEGDRVGVGCLAATCLECEFCKSSQENYCDQLQ  120

Query  395  LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             TYNGIFWDGSITYGGYSK+ VAD+R+VVH+PE+LP+D  APLLCAGVT+F P+KD+ L 
Sbjct  121  FTYNGIFWDGSITYGGYSKMLVADHRYVVHIPENLPLDATAPLLCAGVTVFTPMKDHKLH  180

Query  575  GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               GK+IG++G+GGLGH+ VKFGKAFGHHVTVISTSP+K+KEAKE LGAD+F++STD  Q
Sbjct  181  KTTGKKIGVVGLGGLGHVAVKFGKAFGHHVTVISTSPAKEKEAKEHLGADDFLVSTDPQQ  240

Query  755  MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLI  910
            +Q  KR++DFIL+TVSA HSLG  LELLKVNGT+V+VGAPD+P +   FPLI
Sbjct  241  LQKGKRTLDFILNTVSAKHSLGSILELLKVNGTMVVVGAPDQPFELPSFPLI  292



>gb|EMT20116.1| Putative cinnamyl alcohol dehydrogenase 6 [Aegilops tauschii]
Length=343

 Score =   431 bits (1107),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 271/337 (80%), Gaps = 0/337 (0%)
 Frame = +2

Query  89    DSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEITGIVT  268
             D SGK+VP+ F+RRENG +DVTIK+LYCG+CH+DLH AKN WG T YPVVPGHEITG+VT
Sbjct  2     DESGKMVPFNFRRRENGVDDVTIKVLYCGMCHTDLHFAKNHWGITTYPVVPGHEITGVVT  61

Query  269   VVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSITYGGYS  448
              VG+NV+ F+ GDRVGVGC+A SCL+CE C  SQENYC  + LTYN ++WDGSITYGGYS
Sbjct  62    KVGANVSGFRPGDRVGVGCLACSCLDCEQCDISQENYCDKMGLTYNSVYWDGSITYGGYS  121

Query  449   KLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmgglghl  628
              ++VA  RFVV VP+SLP+D AAPLLCAG+T++ P+K + ++   G+R+G++G+GGLGH+
Sbjct  122   SMYVAHKRFVVRVPDSLPLDAAAPLLCAGITVYTPMKKHGMLRAAGRRLGVVGLGGLGHI  181

Query  629   gvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILDTVSAN  808
              VKFGKAFG HVTVISTSP+K++EA+E L AD+FI+STD  QMQA  R +D+++DTV A 
Sbjct  182   AVKFGKAFGLHVTVISTSPAKEQEARENLKADDFIISTDDKQMQAMARKLDYVIDTVPAA  241

Query  809   HSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEMLNICAK  988
             HSLGP LELLKV G L LV APD P++   FPLI G +T+ GS+ G M + QEM+++C +
Sbjct  242   HSLGPILELLKVGGALALVAAPDGPLELPSFPLIFGNKTISGSITGGMNDHQEMMDLCGE  301

Query  989   FNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
              NI CDIE ++ D IN A  RLA+NDV+YRFVID+ G
Sbjct  302   HNITCDIEIVSNDGINNALARLARNDVRYRFVIDIVG  338



>ref|XP_010920095.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 isoform 
X2 [Elaeis guineensis]
Length=320

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/353 (63%), Positives = 262/353 (74%), Gaps = 39/353 (11%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M  TT  HTQ V GWAA DSSGKI P+ FKRR                            
Sbjct  1     MKETTPNHTQTVDGWAARDSSGKITPFVFKRR----------------------------  32

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
                       HEITG++T VGSNVTNFK GDRVGVGC+AASCLECEFCK S+ENYC  +Q
Sbjct  33    ----------HEITGVITKVGSNVTNFKAGDRVGVGCLAASCLECEFCKASEENYCDKVQ  82

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYNGIFWDGSITYGGYSK+ VAD R+VVHVP+SLP+D AAPLLCAG+T+F P+K  N+ 
Sbjct  83    FTYNGIFWDGSITYGGYSKMLVADKRYVVHVPDSLPLDAAAPLLCAGITVFSPMKHYNM-  141

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK++G++G+GGLGH+ +KFGKAFG HVTVISTSPSK+KEAKERLGAD+FI+STD   
Sbjct  142   SQPGKKLGVVGLGGLGHVAIKFGKAFGLHVTVISTSPSKEKEAKERLGADDFIVSTDPKS  201

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             M+   RS+D+I+DT +A HSLGP LELL V GTLVLVGAPD+P+D   FPLI GKR V G
Sbjct  202   MKRGARSLDYIIDTAAAKHSLGPILELLTVRGTLVLVGAPDQPVDLPSFPLIFGKRNVAG  261

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             SVIG M+ETQEML+ C + NI CDIE + PD IN A DR+A+NDV+YRFVID+
Sbjct  262   SVIGGMKETQEMLDFCGEHNITCDIELVKPDYINEALDRVARNDVRYRFVIDI  314



>gb|KCW67987.1| hypothetical protein EUGRSUZ_F01677 [Eucalyptus grandis]
Length=297

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 250/292 (86%), Gaps = 0/292 (0%)
 Frame = +2

Query  224   VYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTY  403
             +YPVVPGHEITG+V  VG N   FKIGDRVGVGC+AASCL+CEFC  SQENYC  +Q TY
Sbjct  1     MYPVVPGHEITGVVIKVGCNAGKFKIGDRVGVGCLAASCLKCEFCADSQENYCDQMQFTY  60

Query  404   NGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHP  583
             NGIFWDGSITYGGYS + VADYR+VV +PE+LPMD  APLLCAG+T+F PLKDN ++G P
Sbjct  61    NGIFWDGSITYGGYSNVIVADYRYVVRIPENLPMDSVAPLLCAGITVFSPLKDNGMLGSP  120

Query  584   gkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQA  763
             GK++G++G+GGLGH+ VKFGKAFGHHVTV+STSPSK+ EAK RLGAD+FI+ST++ QMQA
Sbjct  121   GKKMGVVGLGGLGHVAVKFGKAFGHHVTVLSTSPSKETEAKGRLGADDFIVSTNSQQMQA  180

Query  764   KKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVI  943
              KRS+DFILDTVSA HSLGP LELLKV+GTLV VGAPD+P++   FPLI GKR+VKGS+ 
Sbjct  181   GKRSLDFILDTVSAQHSLGPILELLKVDGTLVTVGAPDQPLELPPFPLIFGKRSVKGSMT  240

Query  944   GSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG  1099
             G M +TQEM+++C K NI CD+E I PD IN A DRLAKNDV+YRFVID+AG
Sbjct  241   GGMRDTQEMMDLCGKHNITCDVEVIAPDTINEAMDRLAKNDVRYRFVIDIAG  292



>gb|KHN12623.1| Putative cinnamyl alcohol dehydrogenase 6 [Glycine soja]
Length=299

 Score =   410 bits (1054),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 251/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  224   VYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTY  403
             +YPVVPGHEI G VT VG+NV  F  GDRVGVGC+AASCLEC  CK  QENYC+++Q  Y
Sbjct  1     MYPVVPGHEIIGEVTKVGTNVKGFMEGDRVGVGCLAASCLECHHCKTDQENYCQDLQFVY  60

Query  404   NGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHP  583
             NGIFWDG+ITYGGYS++ VADYR+VVH+P SLPMD AAPLLCAG+T+F PLK+++LV   
Sbjct  61    NGIFWDGTITYGGYSQIFVADYRYVVHIPASLPMDAAAPLLCAGITVFSPLKEHDLVATA  120

Query  584   gkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQA  763
             GKRIG++G+GGLGH+ VKFGKAFGHHVTVISTSPSK+ EAK+RLGAD FILS++  Q+QA
Sbjct  121   GKRIGVVGLGGLGHIAVKFGKAFGHHVTVISTSPSKEPEAKQRLGADHFILSSNPKQLQA  180

Query  764   KKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVI  943
              +RS+DFILDTVSA HSL P LELLKVNGTL LVGAPDKP+    FPLI GKR+VKG +I
Sbjct  181   ARRSMDFILDTVSAEHSLLPILELLKVNGTLFLVGAPDKPLQLPAFPLIFGKRSVKGGII  240

Query  944   GSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             G ++ETQEML +CAK+NI  DIE ITPDKIN A +RLAKNDV+YRFVID+A   TS+
Sbjct  241   GGIKETQEMLEVCAKYNITSDIELITPDKINEAMERLAKNDVRYRFVIDIANAVTSN  297



>ref|XP_006851414.1| hypothetical protein AMTR_s00040p00072630 [Amborella trichopoda]
 gb|ERN12995.1| hypothetical protein AMTR_s00040p00072630 [Amborella trichopoda]
Length=361

 Score =   402 bits (1034),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 259/349 (74%), Gaps = 1/349 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q V GWAA D+SG + P  F RR NG  DVTIKI+YCGICHSDLH  KN+WG T+YP+
Sbjct  9     HPQKVVGWAARDASGVLSPLNFSRRANGEEDVTIKIVYCGICHSDLHAIKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI+T VGSNV  FK+GD+ GVGCM  +C  CE C+QS EN C  +  TYN I+
Sbjct  69    VPGHEIAGIITEVGSNVKEFKVGDKAGVGCMVGACHNCEACEQSLENLCPKVIFTYNSIY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D R+VV +PE+LP+D  APLLCAGVT++ P+K   L   PGK +
Sbjct  129   YDGTKTYGGYSDKIVLDKRYVVRIPENLPLDATAPLLCAGVTVYSPMKHYGLT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ +KF KAFG  VTVISTSP K+KEA E LGAD+F++S +  QMQA   +
Sbjct  188   GIVGLGGLGHVAIKFAKAFGLKVTVISTSPKKEKEATEILGADKFLVSRNPEQMQAAMCT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+ILDTVSA H+L P L LLK NG L++VG P+KP     FPLI+G++ + GS+IG M+
Sbjct  248   MDYILDTVSAEHALVPLLSLLKSNGKLIVVGLPEKPFLLPAFPLIAGRKVIGGSIIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             ETQ+M+N  +K NI  DIE +  D +N A +RLAK DV+YRFVID+A +
Sbjct  308   ETQDMINFASKHNITADIELVKMDYVNTAMERLAKGDVRYRFVIDVANS  356



>ref|XP_010244709.1| PREDICTED: probable mannitol dehydrogenase [Nelumbo nucifera]
Length=360

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 260/353 (74%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DSSG + P+ F RRE G  DV  K+LYCGICHSDLH  KNDWG  +YP+
Sbjct  9     HPRKAIGWAARDSSGVLSPFKFSRRETGDEDVAFKVLYCGICHSDLHSVKNDWGNAIYPM  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VG NV  FK+GD+VGVGCM  +C  C+ CK   ENYC  + LTYN I+
Sbjct  69    VPGHEIVGVVTEVGRNVDKFKVGDKVGVGCMVGACHSCDSCKNDLENYCPKMILTYNSIY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS + VA+ R+V+  P++LP+D  APLLCAG+T++ P+K   L   PG  +
Sbjct  129   YDGTMTYGGYSDMMVANQRYVIRFPDNLPLDAGAPLLCAGITVYSPMKYFGLC-EPGMHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVIS+SP+K+KEA ERLGAD F++S +  QMQA   +
Sbjct  188   GVLGLGGLGHVAVKFAKAFGIKVTVISSSPNKEKEAIERLGADAFLVSRNQEQMQAAAGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA HSL PYL LLK +G LV+VG P+KP++   FPL+ G++ + GS IG M+
Sbjct  248   MDGIIDTVSAVHSLMPYLSLLKSHGKLVMVGLPEKPVEIAVFPLVMGRKILAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  DIE I  D +N A +RLAK DVKYRFVID+A + TS+
Sbjct  308   ETQEMIDFAGKHNITADIEVIPIDYVNTAMERLAKADVKYRFVIDVAKSLTSA  360



>gb|AAM95578.1| putative sinapyl alcohol dehydrogenase [Populus tremula x Populus 
tremuloides]
Length=362

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 260/353 (74%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GW A DSSG + P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + YP+
Sbjct  9     HQHKAFGWTAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT +GSNV  FK+ D+VGVG M  SC  CE+C Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPKMIFTYNAQN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D  FV+H+P+S+P D AAPLLCAG+T++ P+K   +   PGK +
Sbjct  129   YDGTKTYGGYSDTIVVDQHFVLHIPDSMPADGAAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VK GKAFG  VTVIS+S  K++EA +RLGAD F++S+D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFLVSSDPEKMKAAFGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI+ D+E I  D+IN A DRLAK+DV+YRFVID+A + + S
Sbjct  308   ETQEMLDFCAKHNIIADVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSLSQS  360



>gb|ADG46005.1| cinnamyl alcohol dehydrogenase [Isatis tinctoria]
Length=360

 Score =   392 bits (1008),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 208/354 (59%), Positives = 255/354 (72%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GWAA D SG + P+ F RR+NG NDVT+KILYCG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWAARDKSGLLSPFHFSRRDNGENDVTVKILYCGVCHTDLHTIKNDWGYSFYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT F+ G+RVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFREGERVGVGVITGSCQSCESCNQDLENYCPQMSFTYNSIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS+  V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   SDGTKTYGGYSETIVVDQRFVLRFPEGLPSDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SPSK+ EA  RLGAD F++S+D  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPSKEDEAINRLGADSFLVSSDPQKMKAAVGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALFPLLGLLKVNGKLVTLGLPEKPLELPIFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML  CAK NI  DIE I  D+IN A DRLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLGFCAKHNITADIELIKIDEINTAMDRLAKSDVRYRFVIDVA-NSLSPP  360



>gb|AFZ78656.1| sinapyl alcohol dehydrogenase [Populus tomentosa]
Length=362

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 260/353 (74%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DSSG + P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + YP+
Sbjct  9     HPHKAFGWAAKDSSGVLSPFHFTRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT +GSNV  FK+ D+VGVG M  SC  CE+C Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPKMIFTYNAHN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D  FV+H+P+S+P D AAPLLCAG+T++ P+K   +   PGK +
Sbjct  129   YDGTKTYGGYSDTIVVDQHFVLHIPDSMPADGAAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VK GKAFG  VTVIS+S  K++EA +RLGAD F++S+D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFVVSSDPEKMKAAFGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  D+E I  D+IN A +RLAK+DV+YRFVID+A + + S
Sbjct  308   ETQEMLDFCAKHNITSDVEVIRMDQINTAMERLAKSDVRYRFVIDVANSLSQS  360



>ref|XP_011097458.1| PREDICTED: probable mannitol dehydrogenase [Sesamum indicum]
Length=360

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 252/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+L+CGICHSDLH  KN+WG + YP+VPGHEI
Sbjct  15    GWAAKDPSGLLSPFRFSRRATGDEDVQFKVLFCGICHSDLHSIKNEWGFSQYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VGS V NFK+GDRVGVGCM  SC  CE C    ENYC NI LTYN I++DG+ T
Sbjct  75    VGVVTEVGSKVRNFKVGDRVGVGCMVGSCRSCENCANDLENYCPNIMLTYNSIYYDGTTT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + VA+  FVVH+P++LP+D AAPLLCAG+T + PLK       PG  +G++G+G
Sbjct  135   YGGYSDIMVANEHFVVHIPDNLPLDAAAPLLCAGITTYSPLKYFGF-DKPGMHVGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSP K++EA  + GAD F++S D  QMQA   ++D ILD
Sbjct  194   GLGHVAVKFAKAFGVKVTVISTSPDKKEEALTQFGADSFLISKDPDQMQAAMGTMDGILD  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P + LLK NG L+++GAPD+P++   FPL++G++ + GS IG M+ETQEM+
Sbjct  254   TVSAVHPLVPLIGLLKTNGKLIMLGAPDRPLELPVFPLLAGRKIIAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             +  AK NI  DIE I+ D +N A +RLAK DVKYRFVID+     +S
Sbjct  314   DFAAKHNITADIEVISADYLNTAMERLAKADVKYRFVIDIGNTLRAS  360



>emb|CDX72704.1| BnaC07g47260D [Brassica napus]
Length=360

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 254/354 (72%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR+NG NDVT+KILYCG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKAFGWAAKDKSGVLTPFHFSRRDNGDNDVTVKILYCGVCHTDLHTIKNDWGFSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT F+ GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFREGDRVGVGVITGSCQSCESCNQDLENYCPQMSFTYNSIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS+  V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   SDGTKTYGGYSESIVVDQRFVLQFPEGLPSDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SPSK+ EA  RLGAD F++S+D  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPSKEDEAINRLGADSFLVSSDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALFPLLGLLKVNGKLVTLGLPEKPLELPIFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML  CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLEFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA-NSLSPP  360



>ref|XP_006411735.1| hypothetical protein EUTSA_v10025545mg [Eutrema salsugineum]
 gb|ESQ53188.1| hypothetical protein EUTSA_v10025545mg [Eutrema salsugineum]
Length=360

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR NG NDVT+KILYCG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKAFGWAAKDKSGLLSPFHFSRRNNGENDVTVKILYCGVCHTDLHTIKNDWGFSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATQVGKNVTKFKEGDRVGVGVITGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS   V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   SDGTKNYGGYSDTIVVDQRFVLRFPEGLPSDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SP+K+ EA  RLGAD F++STD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPNKEDEAINRLGADSFLVSTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALFPLLGLLKVNGKLVTLGLPEKPLELPIFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  D+IN A DRLAK+DV+YRFVID+A
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMDRLAKSDVRYRFVIDVA  354



>ref|XP_009101881.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Brassica 
rapa]
 emb|CDY56752.1| BnaA06g40660D [Brassica napus]
Length=360

 Score =   390 bits (1002),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 254/354 (72%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR+NG NDVT+KILYCG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKAFGWAAKDKSGVLSPFHFSRRDNGDNDVTVKILYCGVCHTDLHTIKNDWGFSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT F+ GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFREGDRVGVGVITGSCQSCESCNQDLENYCPQMSFTYNSIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS+  V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   SDGTKTYGGYSESIVVDQRFVLQFPEGLPSDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SPSK+ EA  RLGAD F++S+D  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPSKEDEAINRLGADSFLVSSDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALFPLLGLLKVNGKLVTLGLPEKPLELPIFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML  CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLEFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA-NSLSPP  360



>ref|NP_001267599.1| probable mannitol dehydrogenase-like [Cucumis sativus]
 ref|XP_004160124.1| PREDICTED: probable mannitol dehydrogenase-like [Cucumis sativus]
 emb|CAY19192.1| somatic embryogenesis cinnamyl alcohol dehydrogenase 1 [Cucumis 
sativus]
 gb|KGN48685.1| hypothetical protein Csa_6G497350 [Cucumis sativus]
Length=361

 Score =   389 bits (1000),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 258/353 (73%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRE G NDV  K+LYCGICHSDLH+ KN+WG T+YP+
Sbjct  9     HPKKAFGWAASDTSGILSPFHFSRRETGENDVAFKVLYCGICHSDLHMLKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V NFK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY+   
Sbjct  69    VPGHEIVGEVTEVGSKVKNFKVGDKVGVGCMVGSCRSCDNCSNNLENYCPKMILTYSSKE  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DGSITYGGYS   VAD  F+V +P+S+P+   APLLCAG+T++ PL+   L   PG +I
Sbjct  129   SDGSITYGGYSNCMVADEHFIVRIPDSIPLHAGAPLLCAGITVYSPLRYYGL-DKPGMQI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTSP+K++EA ERLGAD F++S D  QMQA + +
Sbjct  188   GVVGLGGLGHVAVKFAKAFGAKVTVISTSPNKKQEAIERLGADSFLVSRDQEQMQAARGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P L L+K +G LV+VGAP+KP++   F LI G++T+ GS IG M+
Sbjct  248   LDGIIDTVSAAHPLLPLLSLIKTHGKLVMVGAPEKPLEIPAFALIGGRKTMAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK NI  D+E I  D +N A +R+ K DVKYRFVID+A +  SS
Sbjct  308   ETQEMIDFAAKHNITADVEMIPMDDVNKAMERMLKQDVKYRFVIDIANSLKSS  360



>ref|XP_008440516.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Cucumis melo]
Length=361

 Score =   389 bits (1000),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 257/353 (73%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRE G NDV  K+LYCGICHSDLH+ KN+WG T+YP+
Sbjct  9     HPKKAFGWAASDTSGILSPFHFSRRETGENDVAFKVLYCGICHSDLHMVKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V NFK+GD+VGVGCM  SC  C+ C    ENYC  + LTY+   
Sbjct  69    VPGHEIVGEVTEVGSKVKNFKVGDKVGVGCMVGSCRSCDNCSNDLENYCPKMILTYSSKD  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DGSITYGGYS   VA+  F+V +P+S+P+   APLLCAG+T++ PL+   L   PG +I
Sbjct  129   SDGSITYGGYSDCMVANEHFIVRIPDSIPLQAGAPLLCAGITVYSPLRYFGL-DKPGMKI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTSP+K++EA ERLGAD F++S D  QMQA + +
Sbjct  188   GVVGLGGLGHVAVKFAKAFGAKVTVISTSPNKKQEATERLGADSFLVSRDQEQMQAARGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P L L+K +G LVLVGAP+KP++   F LI G++T+ GS IG M+
Sbjct  248   LDGIIDTVSATHPLLPLLSLVKTHGKLVLVGAPEKPLEIPAFALIGGRKTMAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK NI  DIE I  D +N A +R+ K DVKYRFVID+A +  SS
Sbjct  308   ETQEMIDFAAKHNITADIELIPMDDVNKAMERMLKQDVKYRFVIDIANSLKSS  360



>gb|ABK26008.1| unknown [Picea sitchensis]
Length=364

 Score =   389 bits (1000),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 205/348 (59%), Positives = 256/348 (74%), Gaps = 1/348 (0%)
 Frame = +2

Query  68    VSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGH  247
             V GWAA D SG + P+ F RR+ G++DVT K+ YCGICHSDLH  +NDW T+ YP+VPGH
Sbjct  14    VEGWAAKDESGILSPFNFTRRKTGSHDVTFKVAYCGICHSDLHQIRNDWKTSQYPMVPGH  73

Query  248   EITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGS  427
             EI G V  VGS V NF +GDRVGVGCM  SC +C+ C +  E YC+ +  TYNGI+ DGS
Sbjct  74    EIVGTVIEVGSQVKNFAVGDRVGVGCMVWSCQQCDSCSKDHEQYCEKVVWTYNGIYVDGS  133

Query  428   ITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiig  607
              T GGYS L V D+RFVV +PE LP D AAPLLCAG+T++ P+K   +   PGK +G++G
Sbjct  134   PTLGGYSSLMVCDHRFVVKIPECLPFDAAAPLLCAGITVYSPMKYFQMT-EPGKSLGVVG  192

Query  608   mgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFI  787
             +GGLGH+ VKFGKAFG  VTVISTSP K+KEA+E LGAD F++S D  QM    RS+D+I
Sbjct  193   LGGLGHMAVKFGKAFGLKVTVISTSPQKEKEAREHLGADNFLISKDQKQMLEAARSLDYI  252

Query  788   LDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQE  967
             +DTVSA+H L P + LLKVNG LV+VG P+KPI F    +I G+R V GS+IG ++ETQE
Sbjct  253   IDTVSADHPLHPIINLLKVNGKLVVVGMPEKPISFHPATVIFGRRFVGGSMIGGVKETQE  312

Query  968   MLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             ML+ CA+ NI C IE+I  D +N A  RL K DVKYRFVID+ G+ +S
Sbjct  313   MLDFCAEHNISCVIESIPMDYVNTAMQRLEKGDVKYRFVIDVTGSFSS  360



>ref|XP_010446472.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Camelina 
sativa]
Length=361

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 252/354 (71%), Gaps = 1/354 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GWAA D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWAARDKSGVLSPFNFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVITGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS   V D RFV+  PE LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   ADGTKNYGGYSDNIVVDQRFVLRFPEGLPSDSGAPLLCAGITVYSPMKYYGMTEEAGKHL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK  KAFG  VTVIS+SP K++EA  +LGAD F+++TD  +MQA   +
Sbjct  189   GVAGLGGLGHVAVKIAKAFGLKVTVISSSPKKEEEAITQLGADSFLVTTDPQKMQAAIGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKV+G L+ +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  249   MDYIIDTVSAVHALYPLLGLLKVSGKLIALGLPEKPLELPMFPLVLGRKMVGGSDIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DVKYRFVID+A N  S P
Sbjct  309   ETQEMLDFCAKHNITADIELIKMDEINSAMERLAKSDVKYRFVIDVA-NSLSPP  361



>gb|AGU43751.1| cinnamyl alcohol dehydrogenase 9 [Populus tomentosa]
Length=362

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/353 (57%), Positives = 259/353 (73%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DSSG + P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + YP+
Sbjct  9     HPHKAFGWAAKDSSGVLSPFHFTRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT +GSNV  FK+ D+VGVG M  SC  CE+C Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDSENYCPKMIFTYNAQN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D+ FV+ +P+S+P D AAPLLCAG+T++ P+K   +   PGK +
Sbjct  129   YDGTKTYGGYSDTIVVDHHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VK GKAFG  VTVIS+S  K++EA +RLGAD F++S+D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADSFLVSSDPEKMKAAFGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  D+E I  D+IN A +RLAK+DV+YRFV D+A + + S
Sbjct  308   ETQEMLDFCAKHNITSDVEVIRMDQINTAMERLAKSDVRYRFVTDVANSLSQS  360



>gb|KDO53382.1| hypothetical protein CISIN_1g018246mg [Citrus sinensis]
Length=359

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 257/347 (74%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D++G   P+ F RRE GA+DVTIKIL+CGICHSDLH A+N+WG T YP+
Sbjct  9     HPQKAIGWAARDNTGTFSPFHFSRRETGADDVTIKILFCGICHSDLHCARNEWGVTNYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VG+NV+ FK GD+VGVG + ASC +CE C+Q  ENYC N+ LTYN I 
Sbjct  69    VPGHEIVGTVTKVGNNVSKFKEGDKVGVGVLVASCQKCESCQQGLENYCPNMILTYNSID  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS L V D  +V+  P+++P+D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   RDGTKTYGGYSDLIVVDQHYVLRFPDNMPLDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVISTSP K+ EA  +LGAD F++S+D  +++A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISTSPKKESEAISKLGADAFLVSSDPAKVKAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA HSL P L LLKVNG LV VG P+KP++   F L+  +R V GS +G M+
Sbjct  248   MDYIIDTVSAVHSLAPLLGLLKVNGKLVTVGLPEKPLEVPIFALVGARRLVGGSNVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE +  D+IN A +RLAK+DVKYRFVID+ 
Sbjct  308   ETQEMLDFCAKHNIAADIELVRMDQINTAMERLAKSDVKYRFVIDVG  354



>ref|XP_011045697.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Populus 
euphratica]
Length=362

 Score =   387 bits (995),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/353 (57%), Positives = 258/353 (73%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DSSG   P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + YP+
Sbjct  9     HPHKAFGWAAKDSSGVFSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT +GSNV  FK+ D+VGVG M  SC  CE+C Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGIVTKIGSNVKKFKVDDQVGVGVMVNSCKSCEYCDQDLENYCPKMIFTYNAQN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D  FV+ +P+SLP D AAPLLCAG+T++ P+K   +   PGK +
Sbjct  129   YDGTKTYGGYSDTIVVDQHFVLRIPDSLPADGAAPLLCAGITVYSPMKYYGM-SEPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VK GKAFG  VTVIS+S  K++EA +RLGAD F++S+D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKEREALDRLGADTFLVSSDLEKMKAAFGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS +G ++
Sbjct  248   MDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDVGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  D+E I  D+IN A DRLAK+DV+YRFVID+A + + S
Sbjct  308   ETQEMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSLSQS  360



>ref|XP_006283984.1| hypothetical protein CARUB_v10005116mg [Capsella rubella]
 gb|EOA16882.1| hypothetical protein CARUB_v10005116mg [Capsella rubella]
Length=360

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 204/354 (58%), Positives = 255/354 (72%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GWAA D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWAARDKSGLLSPFNFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVITGSCQSCESCDQDLENYCPQMSFTYNAIA  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PESLP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   SDGTKNYGGYSENIVVDQRFVLRFPESLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SP+K++EA  +LGAD F+++TD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPAKEEEAISQLGADSFLVTTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPAKPLELPMFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DVKYRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVKYRFVIDVA-NSLSPP  360



>ref|XP_010437051.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Camelina 
sativa]
Length=360

 Score =   387 bits (994),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 204/354 (58%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GWAA D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWAARDKSGVLSPFNFSRRDNGENDVTVKILFCGVCHTDLHTVKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVITGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS   V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   ADGTKNYGGYSDNIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK  KAFG  VTVIS+SP K++EA  +LGAD F+++TD  +MQA   +
Sbjct  188   GVAGLGGLGHVAVKIAKAFGLKVTVISSSPKKEEEAITQLGADSFLVTTDPQKMQAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTVSAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DVKYRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINSAMERLAKSDVKYRFVIDVA-NSLSPP  360



>ref|XP_009773447.1| PREDICTED: probable mannitol dehydrogenase [Nicotiana sylvestris]
Length=364

 Score =   387 bits (993),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 201/354 (57%), Positives = 259/354 (73%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D+SG + P+ F RR+NG +DVT++ILYCG+CHSDLH  KN+WG T YP+
Sbjct  9     HPQKAFGWAARDTSGILSPFDFSRRQNGDDDVTVRILYCGVCHSDLHCLKNEWGFTKYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VG++V  FK+GDRVGVG +  SC  C+ C+QS ENYC  +  TYN  +
Sbjct  69    VPGHEIVGLVTAVGTSVHRFKVGDRVGVGVIVGSCHTCDICEQSLENYCPKVMFTYNSTY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + V   RFV+  PE+LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   HDGTRTYGGYSDMIVVHQRFVLQFPENLPSDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVISTSP K+ EA ++LGAD F+LS+D  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISTSPKKEDEAIKKLGADAFVLSSDPTKMKAFVNT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+ A H L P L LLKV+G LV VG P+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDYIIDTIGAVHPLAPLLSLLKVDGKLVTVGLPEKPLELPIFPLVLGRKLVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  ++IN A +RLAK+DVKYRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIRVEQINTAMERLAKSDVKYRFVIDIA-NSISCP  360



>ref|XP_002279832.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI37637.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 256/347 (74%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D SG + P+ F RRENG  DVT+KILYCG+CHSDLH  KN+WG T YP+
Sbjct  9     HPQKAFGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNEWGITRYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIV  +G+NV  FK+GDRVGVG +  SC  CE C+Q  ENYC ++  TYN   
Sbjct  69    VPGHEIVGIVIQLGNNVKKFKMGDRVGVGVLVGSCKTCETCQQDLENYCPSMIFTYNSTS  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + V D R+V+ +P+++P+D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   QDGTRTYGGYSDIVVVDQRYVLRIPDNMPLDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVISTSP+K+ EA  +LGAD F++ST+  ++QA   +
Sbjct  188   GVAGLGGLGHVAVKLGKAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEKVQAALGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA HSLGP L +LK+NG L+ VG PDKP++   FPL+ G++ + GS IG ++
Sbjct  248   MDYIIDTVSAIHSLGPLLAMLKLNGKLITVGLPDKPLELPIFPLVMGRKLIGGSDIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  D IN A  RL+K+DVKYRFVID+A
Sbjct  308   ETQEMLDFCAKHNITADIELIQMDYINTAMKRLSKSDVKYRFVIDVA  354



>ref|XP_008785257.1| PREDICTED: LOW QUALITY PROTEIN: 8-hydroxygeraniol dehydrogenase-like 
[Phoenix dactylifera]
Length=359

 Score =   386 bits (992),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 252/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DS+G + P+ F RR +G  DV IKILYCG+CHSDLH  KN+WG ++YP+
Sbjct  9     HPEKAFGWAARDSNGVLSPFKFSRRSSGPKDVNIKILYCGVCHSDLHFVKNEWGMSIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  F++GD VGVGCM   C ECE CK+  E+YC    LTY+ I+
Sbjct  69    VPGHEIVGIVTEVGSMVQKFRVGDAVGVGCMVGGCDECEDCKRGWESYCPKTILTYSNIY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG++TYGGYS   V +  +VV  P+ LP D  APLLCAG+T++ P++   L   PG  +
Sbjct  129   HDGTVTYGGYSDRIVVEEHYVVRFPDGLPKDAGAPLLCAGITVYSPMRYYGL-AEPGTHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGHL VKF KAFG  VTVISTSPSK+ EA E LGAD F++S +A QM+A  R+
Sbjct  188   GVVGLGGLGHLAVKFAKAFGAKVTVISTSPSKKXEAIEHLGADAFLVSRNAEQMKAAART  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ILDTVSA HSL P +ELLK +G LVLVGAP++P++   FPL+ G++ V GS  G M+
Sbjct  248   MDGILDTVSAKHSLLPLMELLKSHGKLVLVGAPEEPLELPAFPLLVGRKLVGGSATGGMQ  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+  AK NI  DIE I  + IN A +RLAK DVKYRFVID+A
Sbjct  308   ETQEMLDFAAKHNITADIEIIPMNYINTAMERLAKADVKYRFVIDVA  354



>ref|XP_008809345.1| PREDICTED: probable mannitol dehydrogenase [Phoenix dactylifera]
Length=369

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 263/359 (73%), Gaps = 1/359 (0%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             A+    H +   GWAA D+SG + P++F RR NG +DVTIKILYCGICHSDLH  KN+W 
Sbjct  12    ASPETQHPRKAFGWAARDNSGVLSPFSFSRRNNGDDDVTIKILYCGICHSDLHSIKNEWT  71

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
              T+YP+VPGHEI G VT VGSNV  FK+GD+VGVGC+  SC  C+ CKQ  ENYC  + L
Sbjct  72    NTIYPIVPGHEIVGAVTEVGSNVRKFKVGDKVGVGCLVNSCRSCDGCKQGFENYCPRMIL  131

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TYN I  DG++TYGGYS + V    FV+ +P+++P+D+ APLLCAG+T++ PLK   L  
Sbjct  132   TYNSIDADGTMTYGGYSDMVVVKEHFVMRIPDTMPLDKCAPLLCAGITVYSPLKYFGL-N  190

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
              PGK +G++G+GGLGH+ VKF KAFG  VTVIS+SP K+KEA E LGAD F++S++  QM
Sbjct  191   EPGKHLGVVGLGGLGHVAVKFAKAFGVKVTVISSSPRKEKEAIEHLGADAFMISSNPEQM  250

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             QA   ++D I++TVSA HSL P L LLK +G +++VGAPDKP++   F LI G + V GS
Sbjct  251   QAAMGTMDGIINTVSAVHSLMPLLFLLKTHGKMIMVGAPDKPLELPVFSLIMGGKIVAGS  310

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
              IG M++TQEML+  AK N+  DIE I  D +N A +RLAK+DV+YRFVID+A   T++
Sbjct  311   CIGGMQDTQEMLDFAAKHNVTADIELIGMDYVNKAMERLAKSDVRYRFVIDIANTLTAA  369



>ref|XP_011100934.1| PREDICTED: probable mannitol dehydrogenase [Sesamum indicum]
Length=355

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/352 (58%), Positives = 259/352 (74%), Gaps = 2/352 (1%)
 Frame = +2

Query  59    TQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVV  238
             +Q   GWAA D+SG + P+ F RRENGA+DVTIKILYCGICHSDLH AKN+WG T YPVV
Sbjct  5     SQKAFGWAATDTSGVLSPFHFSRRENGADDVTIKILYCGICHSDLHTAKNEWGFTKYPVV  64

Query  239   PGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFW  418
             PGHEI G+VT  GSNV +FK+GDRVGVG +  SC  C+ C+Q  ENYC+ +  TYN    
Sbjct  65    PGHEIVGLVTKTGSNVESFKVGDRVGVGVLVGSCRTCDICQQDLENYCRKMIFTYNSTDK  124

Query  419   DGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrig  598
             DG+ TYGGYS + V D  FV+  P++LP D  APLLCAG+T++ P+K   +   PGK +G
Sbjct  125   DGTRTYGGYSDIIVVDQHFVLRFPDNLPSDAGAPLLCAGITVYSPMKYYGMT-EPGKHLG  183

Query  599   iigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSI  778
             + G+GGLGH+ VKFGKAFG  VTVISTSP K+ EA  +LGAD F++S+D  Q++A   ++
Sbjct  184   VAGLGGLGHVAVKFGKAFGLKVTVISTSPKKEAEAINKLGADAFLVSSDPVQLKAAMGTM  243

Query  779   DFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEE  958
             DFI+DT++A H L P L+LLK+NG LV VG PDKP++   FPL+ G++ V GS IG M+E
Sbjct  244   DFIIDTIAAVHPLAPLLDLLKMNGKLVTVGLPDKPLELPIFPLVLGRKLVGGSDIGGMKE  303

Query  959   TQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             TQEML+ C K  I  DIE I  D IN A +R++K+DV+YRFVID+ GN  +S
Sbjct  304   TQEMLDFCGKHGITADIELIRMDYINTALERVSKSDVRYRFVIDV-GNSLAS  354



>ref|XP_004288495.1| PREDICTED: probable mannitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=361

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 256/360 (71%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             +A+    H +   GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+ KN+W
Sbjct  2     VASPDQEHPKKAIGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V N K+GDRVGVGCM  SC  C+ C    ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVQNVKVGDRVGVGCMVGSCRSCDSCADHLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY  + +DG++TYGGYS + VAD  F+V +PE+LP+D AAPLLCAG+T + PLK   L 
Sbjct  122   LTYGSVNFDGTMTYGGYSDIMVADEHFIVRIPENLPLDGAAPLLCAGITTYSPLKHFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP K+ EA ERL AD F++STDA++
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKALGVKVTVISTSPKKKAEALERLRADSFLVSTDANE  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   F LI G++ V G
Sbjct  241   MQAAMGTMDGIIDTVSALHPLPPLIGLLKAHGKLVMVGAPEKPLELPAFSLIMGRKIVAG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     +S
Sbjct  301   SAIGGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLLKADVRYRFVIDIGNTLKAS  360



>emb|CDP19913.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/362 (56%), Positives = 260/362 (72%), Gaps = 3/362 (1%)
 Frame = +2

Query  35    MAATTLT-HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND  211
             MA T  T H Q   GWAA D+SG + P+ F RRE G+ DV IKILYCG+CHSDLH AKN+
Sbjct  1     MAKTPETEHPQKAFGWAARDASGSLSPFNFSRRELGSEDVLIKILYCGVCHSDLHAAKNE  60

Query  212   WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNI  391
             WG T YP+VPGHEI G+VT  GS+V  F++GD+VGVG +  SC  C+ C+Q  ENYC  +
Sbjct  61    WGFTNYPIVPGHEIVGLVTKTGSSVQKFQVGDQVGVGVIVGSCKTCDICQQDLENYCPKV  120

Query  392   QLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL  571
               TYN    DG+ TYGGYS + V D RFV+  P++LP D  APLLCAG+T++ P+K   +
Sbjct  121   ISTYNSKDQDGTKTYGGYSDIVVVDQRFVLRFPDNLPADAGAPLLCAGITVYSPMKYYGM  180

Query  572   VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PGK +G+ G+GGLGH+ VK GKAFG  VTVISTSP K+ EA +RLGAD F+LS+D  
Sbjct  181   T-EPGKHLGVAGLGGLGHVAVKLGKAFGLKVTVISTSPKKEVEAIDRLGADSFLLSSDPE  239

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             + +A   S+D+I+DT++A H L P + LLK+NG L+ VG PDKP++   FPL+ G++ V 
Sbjct  240   KFKAAIGSMDYIIDTIAAVHPLAPLVSLLKINGKLITVGLPDKPLELPIFPLVLGRKLVG  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             GS IG M+ETQEML  CAK NI  DIE I  D+IN A +RLAK+DV+YRFV+D+A N  +
Sbjct  300   GSEIGGMKETQEMLEFCAKHNIAADIELIRMDQINSAMERLAKSDVRYRFVVDVA-NSLA  358

Query  1112  SP  1117
             SP
Sbjct  359   SP  360



>ref|XP_006427864.1| hypothetical protein CICLE_v10025939mg [Citrus clementina]
 ref|XP_006464570.1| PREDICTED: probable mannitol dehydrogenase-like [Citrus sinensis]
 gb|ESR41104.1| hypothetical protein CICLE_v10025939mg [Citrus clementina]
Length=359

 Score =   385 bits (989),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 256/345 (74%), Gaps = 1/345 (0%)
 Frame = +2

Query  62    QVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVP  241
             Q   GWAA D++G   P+ F RRE GA+DVTIKIL+CGICHSDLH A+N+WG T YP+VP
Sbjct  11    QKAIGWAARDNTGTFSPFHFSRRETGADDVTIKILFCGICHSDLHCARNEWGVTNYPIVP  70

Query  242   GHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWD  421
             GHEI G VT VG+NV+ FK GD+VGVG + ASC +CE C+Q  ENYC N+ LTYN I  D
Sbjct  71    GHEIVGTVTKVGNNVSKFKEGDKVGVGVLVASCQKCESCQQGLENYCPNMILTYNSIDRD  130

Query  422   GSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigi  601
             G+ TYGGYS L V D  +V+  P+++P+D  APLLCAG+T++ P+K   +   PGK +G+
Sbjct  131   GTKTYGGYSDLIVVDQHYVLRFPDNMPLDAGAPLLCAGITVYSPMKYYGMT-EPGKHLGV  189

Query  602   igmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSID  781
              G+GGLGH+ VK GKAFG  VTVISTSP K+ EA  +LGAD F++S+D  +++A   ++D
Sbjct  190   AGLGGLGHVAVKIGKAFGLKVTVISTSPKKESEAISKLGADAFLVSSDPAKVKAAMGTMD  249

Query  782   FILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEET  961
             +I+DTVSA HSL P L LLKVNG LV VG P+KP++   F L+  +R V GS +G M+ET
Sbjct  250   YIIDTVSAVHSLAPLLGLLKVNGKLVTVGLPEKPLEVPIFALVGARRLVGGSNVGGMKET  309

Query  962   QEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             QEML+ CAK NI  DIE +  D+IN A +RLAK+DVKYRFVID+ 
Sbjct  310   QEMLDFCAKHNIAADIELVRMDQINTAMERLAKSDVKYRFVIDVG  354



>gb|KDP35308.1| hypothetical protein JCGZ_09467 [Jatropha curcas]
Length=360

 Score =   385 bits (989),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/353 (57%), Positives = 255/353 (72%), Gaps = 2/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D+SG + P+ F RRENG  DVT+KILYCG+CHSDLH  +N+WG   YPV
Sbjct  9     HPQKAFGWAAKDTSGILSPFHFSRRENGVEDVTVKILYCGVCHSDLHACRNEWGFVRYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT +G+NV  FK+GDRVGVG M  SC  CE+C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGTVTKIGNNVKKFKVGDRVGVGVMVGSCKSCEYCNQDLENYCPKMIFTYNSID  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + V +  FV+H P++LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   HDGTRTYGGYSDMIVVNQHFVLHFPDNLPSDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ V+ GKAFG  VTVIS+SP K+ EA  RLGAD F++S+D  +M+A   S
Sbjct  188   GIVGLGGLGHVAVRIGKAFGLRVTVISSSPRKESEALNRLGADAFLVSSDPGKMKAAIGS  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +DFI+DTVSA H+L P L LLK NG L+ +G PDKP++   FPL+ G++ V GS IG ++
Sbjct  248   MDFIIDTVSAVHALAPLLSLLKPNGKLITLGLPDKPLELPIFPLVLGRKLVGGSDIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  D+E I  D+IN A +RL K+DV+YRFVID+ GN  S 
Sbjct  308   ETQEMLDFCAKHNITADVEVIRIDEINTAMERLGKSDVRYRFVIDV-GNSLSQ  359



>ref|XP_010431900.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Camelina 
sativa]
Length=381

 Score =   385 bits (990),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GWAA D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  30    HPNKVFGWAARDKSGVLSPFNFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  89

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN I 
Sbjct  90    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVITGSCQSCESCDQDLENYCPQMAFTYNAIG  149

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS   V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  150   ADGTKNYGGYSDNIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  208

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK  KAFG  VTVIS+SP K++EA  +LGAD F+++TD  +M+A   +
Sbjct  209   GVAGLGGLGHVAVKIAKAFGLKVTVISSSPKKEEEAITQLGADSFLVTTDPQKMKAAIGT  268

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS IG M+
Sbjct  269   MDYIIDTVSAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDIGGMK  328

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DVKYRFVID+A N  S P
Sbjct  329   ETQEMLDFCAKHNITADIELIKMDEINSAMERLAKSDVKYRFVIDVA-NSLSPP  381



>ref|XP_010241689.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 isoform 
X3 [Nelumbo nucifera]
Length=360

 Score =   384 bits (987),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 255/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRENG +DV IKILYCG+CHSDLH+AKNDWG T+YPV
Sbjct  10    HPRKAFGWAARDASGILSPFNFSRRENGIDDVAIKILYCGVCHSDLHLAKNDWGYTMYPV  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGSNVTN K+G+ VGVG M  SC  C+ C+Q  ENYC  +  TYN I 
Sbjct  70    VPGHEIVGVVTEVGSNVTNLKVGEHVGVGAMVGSCKTCQSCQQDLENYCPKMIFTYNSIN  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + V +  FV+  P++LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  130   YDGTKTYGGYSDMVVVNKDFVLRWPDNLPPDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VK GKAFG  VTVISTSP K+ EA ERLGAD FI+S D  +++A   +
Sbjct  189   GVVGLGGLGHIAVKLGKAFGLKVTVISTSPHKEAEATERLGADSFIVSRDPVKVKAALGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLK +G L+ +G PDKP++   FPL+ G++ V GS IG ++
Sbjct  249   MDYIIDTVSAVHPLAPLLGLLKPHGKLITLGLPDKPLELPIFPLVLGRKLVGGSDIGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML  CAK NI  DIE I  D IN A +RLAK DV+YRFVID+A
Sbjct  309   ETQEMLEFCAKHNIAADIELIQMDYINTAMERLAKADVQYRFVIDVA  355



>ref|XP_010241688.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 isoform 
X2 [Nelumbo nucifera]
Length=363

 Score =   385 bits (988),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 255/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRENG +DV IKILYCG+CHSDLH+AKNDWG T+YPV
Sbjct  10    HPRKAFGWAARDASGILSPFNFSRRENGIDDVAIKILYCGVCHSDLHLAKNDWGYTMYPV  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGSNVTN K+G+ VGVG M  SC  C+ C+Q  ENYC  +  TYN I 
Sbjct  70    VPGHEIVGVVTEVGSNVTNLKVGEHVGVGAMVGSCKTCQSCQQDLENYCPKMIFTYNSIN  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + V +  FV+  P++LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  130   YDGTKTYGGYSDMVVVNKDFVLRWPDNLPPDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VK GKAFG  VTVISTSP K+ EA ERLGAD FI+S D  +++A   +
Sbjct  189   GVVGLGGLGHIAVKLGKAFGLKVTVISTSPHKEAEATERLGADSFIVSRDPVKVKAALGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLK +G L+ +G PDKP++   FPL+ G++ V GS IG ++
Sbjct  249   MDYIIDTVSAVHPLAPLLGLLKPHGKLITLGLPDKPLELPIFPLVLGRKLVGGSDIGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML  CAK NI  DIE I  D IN A +RLAK DV+YRFVID+A
Sbjct  309   ETQEMLEFCAKHNIAADIELIQMDYINTAMERLAKADVQYRFVIDVA  355



>ref|XP_010241687.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 isoform 
X1 [Nelumbo nucifera]
Length=364

 Score =   384 bits (987),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 255/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRENG +DV IKILYCG+CHSDLH+AKNDWG T+YPV
Sbjct  10    HPRKAFGWAARDASGILSPFNFSRRENGIDDVAIKILYCGVCHSDLHLAKNDWGYTMYPV  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGSNVTN K+G+ VGVG M  SC  C+ C+Q  ENYC  +  TYN I 
Sbjct  70    VPGHEIVGVVTEVGSNVTNLKVGEHVGVGAMVGSCKTCQSCQQDLENYCPKMIFTYNSIN  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + V +  FV+  P++LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  130   YDGTKTYGGYSDMVVVNKDFVLRWPDNLPPDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VK GKAFG  VTVISTSP K+ EA ERLGAD FI+S D  +++A   +
Sbjct  189   GVVGLGGLGHIAVKLGKAFGLKVTVISTSPHKEAEATERLGADSFIVSRDPVKVKAALGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLK +G L+ +G PDKP++   FPL+ G++ V GS IG ++
Sbjct  249   MDYIIDTVSAVHPLAPLLGLLKPHGKLITLGLPDKPLELPIFPLVLGRKLVGGSDIGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML  CAK NI  DIE I  D IN A +RLAK DV+YRFVID+A
Sbjct  309   ETQEMLEFCAKHNIAADIELIQMDYINTAMERLAKADVQYRFVIDVA  355



>gb|KFK30507.1| hypothetical protein AALP_AA7G271000 [Arabis alpina]
Length=360

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/354 (57%), Positives = 250/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RRENG NDVT+KILYCG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKAFGWAARDKSGVLSPFHFSRRENGENDVTVKILYCGVCHTDLHTVKNDWGFSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG + +SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVITSSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   TDGTKNYGGYSETIVVDQRFVLRFPEGLPSDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SP K+ EA  +LGAD F++S+D  +M+    +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPDKEDEAINKLGADSFLVSSDPRKMKVAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P KP++   FPL+ G++ + GS IG M+
Sbjct  248   MDYIIDTISAEHALYPLLGLLKVNGKLITLGIPAKPLELPIFPLVLGRKMIGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RL K DV+YRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMERLGKADVRYRFVIDVA-NSLSPP  360



>gb|EEE60360.1| hypothetical protein OsJ_13484 [Oryza sativa Japonica Group]
Length=642

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/335 (58%), Positives = 241/335 (72%), Gaps = 29/335 (9%)
 Frame = +2

Query  47    TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTV  226
             T  HTQ VSGWAA D SGKIVP+ FKRRENG +DVTIK+ YCG+CH+DLH   NDWG T+
Sbjct  4     TPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGITM  63

Query  227   YPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYN  406
             YPVVPGHEITG+VT VG+NV  FK+GDRVGVGC+AASCL+CE C++S+ENYC        
Sbjct  64    YPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYC--------  115

Query  407   GIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPg  586
                                D RFVV +P++LP+D AAPLLCAG+T++ P+K + ++    
Sbjct  116   -------------------DKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQADA  156

Query  587   krigiigmgglghlgvkfg--kAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
                 +  +G  G   V     KAFG HVTVISTSP+K++EA+E L AD F++STD  QMQ
Sbjct  157   AGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFVVSTDQKQMQ  216

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A  RS+D+I+DTV+A HSLGP LELLKVNG LVLVGAP+KP++   FPLI GKRTV GS+
Sbjct  217   AMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVSGSM  276

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAF  1045
              G M+ETQEM++IC + NI CDIE ++ D+IN A 
Sbjct  277   TGGMKETQEMMDICGEHNITCDIEIVSTDRINDAL  311



>ref|XP_002300211.1| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
 gb|EEE85016.1| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
Length=362

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/355 (56%), Positives = 258/355 (73%), Gaps = 1/355 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + H     GWAA DSSG + P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + Y
Sbjct  7     VEHPHKAFGWAAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI GIVT +GSNV  FK+ D+VGVG +  SC  CE+C Q  ENYC  +  TYN 
Sbjct  67    PLVPGHEIVGIVTKIGSNVKKFKVDDQVGVGVLVNSCKSCEYCDQDLENYCPKMIFTYNA  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG+ TYGGYS   V D  FV+ +P+S+P D AAPLLCAG+T++ P+K   +   PGK
Sbjct  127   QNHDGTKTYGGYSDTIVVDQHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMT-EPGK  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +GI+G+GGLGH+ VK GKAFG  VTVIS+S  K+ EA +RLGAD F++S+D  +M+A  
Sbjct  186   HLGIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKESEALDRLGADSFLVSSDPEKMKAAF  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS IG 
Sbjct  246   GTMDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ++ETQEML+ CAK NI  D+E I  D+IN A DRLAK+DV+YRFVID+A + + S
Sbjct  306   VKETQEMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSLSQS  360



>gb|ACN40687.1| unknown [Picea sitchensis]
Length=366

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 253/348 (73%), Gaps = 1/348 (0%)
 Frame = +2

Query  68    VSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGH  247
             V GWAA D SG + P  F RR+ G+NDVT K+ YCGICHSDLH  +N+W  ++YP+VPGH
Sbjct  16    VEGWAARDDSGILSPINFTRRKTGSNDVTFKVAYCGICHSDLHQIRNEWKNSMYPMVPGH  75

Query  248   EITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGS  427
             EI G+VT VGS V  F +GDRVGVGCM  SC +C+ C + QE YC    LTYN I  DGS
Sbjct  76    EIVGLVTEVGSEVKKFAVGDRVGVGCMVWSCQQCDSCSEGQEQYCDKTVLTYNAINADGS  135

Query  428   ITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiig  607
              T+GGYS L V + RFVV +PE+LP D AAPLLCAG+T++ P+K   +   PGK +G++G
Sbjct  136   PTFGGYSSLMVCNQRFVVKIPETLPFDAAAPLLCAGITVYSPMKYLQMT-EPGKSLGVVG  194

Query  608   mgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFI  787
             +GGLGH+ VK GKAFG  VTVISTSP K+KEA+E LGAD FI+S D  QMQ   +S+D+I
Sbjct  195   LGGLGHMAVKLGKAFGLRVTVISTSPKKEKEAREVLGADHFIISKDQKQMQDAAKSLDYI  254

Query  788   LDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQE  967
             +DTVSA+H + P + LLKV G LVLVG P+ PI F    +ISG+R V GS IG ++ETQE
Sbjct  255   IDTVSADHPIQPLISLLKVQGKLVLVGLPENPIYFHPAAVISGRRFVGGSSIGGVKETQE  314

Query  968   MLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             ML+ CA+ NI C IE I  D +N A +RL K DVKYRFVI++A + +S
Sbjct  315   MLDFCAEHNISCMIENIPIDYVNTAMERLGKGDVKYRFVINVAESYSS  362



>ref|XP_009387440.1| PREDICTED: probable mannitol dehydrogenase [Musa acuminata subsp. 
malaccensis]
Length=364

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 253/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DS+G + P+ F RR+NG  DVT++ILYCGICHSDLH  KN+W  TVYPV
Sbjct  13    HPRKAFGWAARDSTGVLSPFKFSRRKNGDTDVTLRILYCGICHSDLHCIKNEWANTVYPV  72

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G++T VGS V  FK+GD+ GVGCM  SC  C  CKQ  ENYC  + LTYN I 
Sbjct  73    LPGHEIVGVITDVGSKVNKFKVGDKAGVGCMVNSCRSCPSCKQESENYCGGLILTYNSID  132

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG++TYGGYS   V    FVV  PES+P+D+ APLLCAG+T++ P+K   L   PGK +
Sbjct  133   TDGTMTYGGYSDTIVVKEHFVVRFPESMPLDKGAPLLCAGITVYTPMKYFGL-SEPGKHL  191

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKFGKAFG  VTVISTSPSKQKEA E LGAD F++S D+ Q++A   +
Sbjct  192   GVVGLGGLGHVAVKFGKAFGMKVTVISTSPSKQKEATESLGADAFLVSRDSEQLKAAMGT  251

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I++TVSA H + P + LLK +G +++VGAPDKP+    FPLI G R + GS IG M+
Sbjct  252   MDGIINTVSAVHDIAPLINLLKPHGKMIMVGAPDKPLQLHVFPLIMGGRILAGSCIGGMK  311

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +TQEM++  AK N+  DIE +  D +N A +RLAK DV+YRFVID+A
Sbjct  312   DTQEMIDFAAKHNVSADIELVRIDYVNKAMERLAKGDVRYRFVIDIA  358



>gb|ABK94550.1| unknown [Populus trichocarpa]
Length=362

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 258/355 (73%), Gaps = 1/355 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + H     GWAA DSSG + P+ F RR+NG  DVTIKILYCG+CHSDLH AKN+WG + Y
Sbjct  7     VEHPHKAFGWAAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P++PGHEI GIVT +GSNV  FK+ D+VGVG +  SC  CE+C Q  ENYC  +  TYN 
Sbjct  67    PLIPGHEIVGIVTKIGSNVKKFKVDDQVGVGVLVNSCKSCEYCDQDLENYCPKMIFTYNA  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG+ TYGGYS   V D  FV+ +P+S+P D AAPLLCAG+T++ P+K   +   PGK
Sbjct  127   QNHDGTKTYGGYSDTIVVDQHFVLRIPDSMPADGAAPLLCAGITVYSPMKYYGMT-EPGK  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +GI+G+GGLGH+ VK GKAFG  VTVIS+S  K+ EA +RLGAD F++S+D  +M+A  
Sbjct  186   HLGIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKESEALDRLGADSFLVSSDPEKMKAAF  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D+I+DTVSA H+L P L LLK NG LV +G P+KP++   FPL+ G++ V GS IG 
Sbjct  246   GTMDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ++ETQEML+ CAK NI  D+E I  D+IN A DRLAK+DV+YRFVID+A + + S
Sbjct  306   VKETQEMLDFCAKHNITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSLSQS  360



>ref|XP_009117369.1| PREDICTED: cinnamyl alcohol dehydrogenase 2 [Brassica rapa]
Length=358

 Score =   382 bits (982),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 248/347 (71%), Gaps = 0/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KNDWG + YP++PGHEI
Sbjct  12    GWAANDKSGVLSPFHFSRRENGDNDVTVKILFCGVCHSDLHTIKNDWGFSHYPIIPGHEI  71

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN   +DG+  
Sbjct  72    VGIATTVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPQLVYTYNSRSFDGTRN  131

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS   V D RFV+  P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  132   QGGYSDKIVVDQRFVLSFPDGLPSDSGAPLLCAGITVYSPMKYYGMTEEKGKHLGVSGLG  191

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS SP K+ EA +RLGAD F+++TDA +M+    ++DF+LD
Sbjct  192   GLGHIAVKIGKAFGLKVTVISRSPDKESEAIDRLGADSFLVTTDAQKMKDAIGTMDFVLD  251

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+ETQEML
Sbjct  252   TVSAEHSLLPLFSLLKVNGKLVALGLPEKPLELPIFPLVLGRKMVGGSQIGGMKETQEML  311

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             + CAK NI+ DIE I    IN A DRLAK+DV+YRFVID+A +  S+
Sbjct  312   DFCAKHNIVADIELIKMSNINSAMDRLAKSDVRYRFVIDVANSINSA  358



>gb|KDO60515.1| hypothetical protein CISIN_1g0180941mg [Citrus sinensis]
Length=361

 Score =   382 bits (981),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 252/354 (71%), Gaps = 1/354 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RR  G  DVT K+ +CGICHSDLH+ KN+WG T+YP+
Sbjct  9     HPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V+ FK+GD+VGVGCM  SC  C+ C    ENYC  + +TY   +
Sbjct  69    VPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYANKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS + VAD  FVV +PE  P+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  129   HDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSPSK+ EA ERLGAD F++S D  +MQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAIERLGADSFLVSRDQDEMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LVLVGAP+KP++   F L+ G++ V GS+IG M+
Sbjct  248   MDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGRKIVGGSMIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEM++  AK NI  DIE I  D +N A +RLAK DV+YRFVID+A    S+P
Sbjct  308   ETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANTMKSTP  361



>gb|ABK21490.1| unknown [Picea sitchensis]
Length=366

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/348 (58%), Positives = 252/348 (72%), Gaps = 1/348 (0%)
 Frame = +2

Query  68    VSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGH  247
             V GWAA D SG + P  F RR+ G+NDVT K+ YCGICHSDLH  +N+W  ++YP+VPGH
Sbjct  16    VEGWAARDDSGILSPINFTRRKTGSNDVTFKVAYCGICHSDLHQIRNEWKNSMYPMVPGH  75

Query  248   EITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGS  427
             EI G+VT VGS V  F +GDRVGVGCM  SC +C+ C + QE YC    LTYN I  DGS
Sbjct  76    EIVGLVTEVGSEVKKFAVGDRVGVGCMVWSCQQCDSCSEGQEQYCDKTVLTYNAINADGS  135

Query  428   ITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiig  607
              T+GGYS L V + RFVV +PE+LP D  APLLCAG+T++ P+K   +   PGK +G++G
Sbjct  136   PTFGGYSSLMVCNQRFVVKIPETLPFDAEAPLLCAGITVYSPMKYLQMT-EPGKSLGVVG  194

Query  608   mgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFI  787
             +GGLGH+ VK GKAFG  VTVISTSP K+KEA+E LGAD FI+S D  QMQ   +S+D+I
Sbjct  195   LGGLGHMAVKLGKAFGLRVTVISTSPKKEKEAREVLGADHFIISKDQKQMQDAAKSLDYI  254

Query  788   LDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQE  967
             +DTVSA+H + P + LLKV G LVLVG P+ PI F    +ISG+R V GS IG ++ETQE
Sbjct  255   IDTVSADHPIQPLISLLKVQGKLVLVGLPENPIYFHPAAVISGRRFVGGSSIGGVKETQE  314

Query  968   MLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             ML+ CA+ NI C IE I  D +N A +RL K DVKYRFVI++A + +S
Sbjct  315   MLDFCAEHNISCMIENIPIDYVNTAMERLGKGDVKYRFVINVAESYSS  362



>gb|KHG29850.1| putative mannitol dehydrogenase [Gossypium arboreum]
Length=361

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DS G + P+ F RR  G  DV  K+LYCGICHSDLH+AKN+WGT++YP+
Sbjct  9     HPNKAFGWAARDSYGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMAKNEWGTSIYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GDRVGVGC+  SC  C+ CK + ENYC  + LTY   +
Sbjct  69    VPGHEIAGEVTEVGSEVQKFKVGDRVGVGCLVGSCRSCDSCKDNLENYCPKMVLTYGAKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ITYGGYS   VAD  F+V +P+++P+D AAPLLCAG+T++ PL+   L   P   I
Sbjct  129   YDGTITYGGYSDTMVADEHFIVRIPDNMPLDAAAPLLCAGITVYSPLRYYEL-DRPSLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K+KEA E LGAD F++S D  Q+Q    +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKKEALENLGADSFLVSRDQDQLQGAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H + P L LLK +G LVL+GAP+KP++   FPLI G++ + GS+IG M+
Sbjct  248   LDGIIDTVSAQHPVLPLLALLKSHGKLVLLGAPEKPLELPVFPLIQGRKVIGGSLIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEM++  AK ++  DIE I  D +N A +RL K DVKYRFVID+ GN    P
Sbjct  308   ETQEMIDFAAKHDVKPDIEVIAMDYVNTAMERLLKADVKYRFVIDI-GNTLKIP  360



>ref|XP_006426239.1| hypothetical protein CICLE_v10025933mg [Citrus clementina]
 gb|ESR39479.1| hypothetical protein CICLE_v10025933mg [Citrus clementina]
Length=361

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 252/354 (71%), Gaps = 1/354 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RR  G  DVT K+ +CGICHSDLH+ KN+WG  +YP+
Sbjct  9     HPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V+ FK+GD+VGVGCM  SC  C+ C    ENYC  + +TY   +
Sbjct  69    VPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS   VAD  FVV +PE  P+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  129   HDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSPSK+ EA ERLGAD F++S D  +MQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAVERLGADSFLVSRDQDEMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LVL+GAP+KP++   FPL++G++ V GS+IG ++
Sbjct  248   MDGIIDTVSAVHPLMPLIGLLKSQGKLVLLGAPEKPLELPAFPLLTGRKIVGGSLIGGLK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEM++  AK NI  DIE I  D +N A +RLAK DV+YRFVID+A    S+P
Sbjct  308   ETQEMIDFAAKHNIRADIEVIPADYVNTAMERLAKADVRYRFVIDVANTMKSTP  361



>ref|XP_006466345.1| PREDICTED: probable mannitol dehydrogenase-like [Citrus sinensis]
Length=361

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 252/354 (71%), Gaps = 1/354 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RR  G  DVT K+ +CGICHSDLH+ KN+WG T+YP+
Sbjct  9     HPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V+ FK+GD+VGVGCM  SC  C+ C    ENYC  + +TY   +
Sbjct  69    VPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKVIMTYANKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS + VAD  FVV +PE  P+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  129   HDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSPSK+ EA ERLGAD F++S D  +MQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAIERLGADSFLVSRDQDEMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LVLVGAP+KP++   F L+ G++ V GS+IG M+
Sbjct  248   MDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGRKIVGGSMIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEM++  AK NI  DIE I  D +N A +RLAK DV+YRFVID+A    S+P
Sbjct  308   ETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANTMKSTP  361



>gb|KDO60514.1| hypothetical protein CISIN_1g0180941mg [Citrus sinensis]
Length=361

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 252/354 (71%), Gaps = 1/354 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RR  G  DVT K+ +CGICHSDLH+ KN+WG T+YP+
Sbjct  9     HPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V+ FK+GD+VGVGCM  SC  C+ C    ENYC  + +TY   +
Sbjct  69    VPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYANKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS + VAD  FVV +PE  P+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  129   HDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSPSK+ EA ERLGAD F++S D  +MQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAIERLGADSFLVSRDQDEMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LVLVGAP+KP++   F L+ G++ V GS+IG M+
Sbjct  248   MDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGEKIVGGSMIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEM++  AK NI  DIE I  D +N A +RLAK DV+YRFVID+A    S+P
Sbjct  308   ETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANTMKSTP  361



>ref|XP_008236513.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=361

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 255/360 (71%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             + +T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W
Sbjct  2     VVSTEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNHENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY   + DG+ TYGGYS + VAD  F+V VP+SLP+D AAPLLCAG+T + PL+   L 
Sbjct  122   LTYGSKYLDGTTTYGGYSDVMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA E L AD F++S D  Q
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIEHLHADSFLVSRDQDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V G
Sbjct  241   MQAALGTMDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKIVGG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     SS
Sbjct  301   SCIGGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKSS  360



>ref|XP_006355137.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9-like [Solanum 
tuberosum]
Length=360

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 256/351 (73%), Gaps = 1/351 (0%)
 Frame = +2

Query  62    QVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVP  241
             Q   GWAA D SG + P+ F RRENG +DVT+KI YCGICHSDLH  KN+WG T YP++P
Sbjct  11    QKAFGWAARDPSGILSPFHFSRRENGDDDVTVKIHYCGICHSDLHSLKNEWGFTKYPILP  70

Query  242   GHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWD  421
             GHEI G VT VGS+V  FK+GDRVGVG +  SC  C+ C+QS ENYC N+  TYN    D
Sbjct  71    GHEIVGFVTAVGSSVHKFKVGDRVGVGVIVGSCQTCDICEQSLENYCPNVIFTYNSTDHD  130

Query  422   GSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigi  601
             G+ TYGGYS + V   RFV+  PE+LP D  APLLCAG+T++ P+K   +   PGK +G+
Sbjct  131   GTNTYGGYSDMIVVHQRFVLQFPENLPSDAGAPLLCAGITVYSPMKYYGMT-EPGKHLGV  189

Query  602   igmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSID  781
              G+GGLGH+ VK GKAFG  VTVISTSP K+ EA  +LGAD F+LS+D  +++A   ++D
Sbjct  190   AGLGGLGHIAVKIGKAFGLKVTVISTSPKKEDEAINKLGADAFVLSSDPAKLKAAVNTMD  249

Query  782   FILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEET  961
             +I+DT++A H L P L LLK++G LV +G P+KP++   FPL+ G++ V GS IG M+ET
Sbjct  250   YIIDTIAAVHPLAPLLSLLKMDGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGMKET  309

Query  962   QEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             QEML+ CAK NI  DIE I+ D IN+A +RLA++DVKYRFVID+A + + S
Sbjct  310   QEMLDFCAKHNITADIELISVDNINMAMERLAESDVKYRFVIDIANSLSPS  360



>ref|XP_008338758.1| PREDICTED: probable mannitol dehydrogenase [Malus domestica]
 ref|XP_008361538.1| PREDICTED: LOW QUALITY PROTEIN: probable mannitol dehydrogenase 
[Malus domestica]
Length=358

 Score =   380 bits (976),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 259/359 (72%), Gaps = 1/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA +   H Q   GWAA DSSG + P+ F RREN  +DVTIK+LYCG+CHSDLH AKNDW
Sbjct  1     MAISPEEHPQKAFGWAARDSSGILSPFRFSRRENADDDVTIKVLYCGVCHSDLHSAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEI G+VT  G+NV  FK+GDRVGVG +  SC++CE C+Q  ENYC    
Sbjct  61    GFTNYPVVPGHEIVGVVTKTGNNVDKFKVGDRVGVGVIVGSCMKCETCQQDLENYCPRTI  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYN  + D + TYGGYS + V  +R+V+  P++L  D  APLLCAG+T++ P+K   + 
Sbjct  121   FTYNSHYHDQTKTYGGYSDIIVVHHRYVLRFPDNLAPDAGAPLLCAGITVYSPMKYYGMT  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK +G+ G+GGLGH+ VK GKAFG  VTVIS+SP+K+ EA +RLGAD F+L +D  +
Sbjct  181   -EPGKHLGVAGLGGLGHIAVKIGKAFGLKVTVISSSPAKEDEATKRLGADSFLLLSDPAK  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             ++    ++D+I+DTVSA H+L P + LLK+NG LV VG P+KP++   FPL+ G++ V G
Sbjct  240   LKGAMGTMDYIIDTVSAVHALAPLIGLLKLNGKLVTVGLPNKPLELPIFPLVLGRKLVGG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S IG ++ETQEML+ CAK NI  DIE I  D IN A +RLAK+DV+YRFVID+A + T 
Sbjct  300   SDIGGVKETQEMLDFCAKHNITSDIELIHMDXINTAMERLAKSDVRYRFVIDVANSLTQ  358



>gb|EPS72626.1| 10-hydroxygeraniol oxidoreductase, partial [Genlisea aurea]
Length=355

 Score =   380 bits (975),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 250/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAAHD+SG + P+ F RR  G  DV  K+ YCGICHSDLH  KN+WG + YP+VPGHEI
Sbjct  12    GWAAHDTSGHLSPFHFSRRATGERDVQFKVSYCGICHSDLHSIKNEWGVSRYPMVPGHEI  71

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VGS V+ FK GDRVGVGC+  SC  C  C +  EN+C    LTY  ++ DG++T
Sbjct  72    VGVVTEVGSKVSKFKPGDRVGVGCLVGSCRTCTSCNKDMENHCPTYVLTYGAVYHDGTVT  131

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + VAD  F+V +P+ LP+D AAPLLCAG+T + PLK   L   PG +IG++G+G
Sbjct  132   YGGYSDVMVADEHFIVRIPDGLPLDAAAPLLCAGITTYSPLKYFGL-DKPGLKIGVVGLG  190

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTS SK++EA  RLGAD F++S D HQMQA   ++D ILD
Sbjct  191   GLGHVAVKFAKAFGVDVTVISTSESKKEEALSRLGADSFLISKDQHQMQAATGTLDGILD  250

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK +G L+++GAP+KP++   F L++G++T+ GS IG ++ETQEML
Sbjct  251   TVSATHPIPPLLSLLKPDGKLIMLGAPEKPLEIPVFYLLAGRKTLAGSGIGGLKETQEML  310

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +NVA +RL K DVKYRFVID+A
Sbjct  311   DFAAKHNITADIEVISADYLNVAMERLLKADVKYRFVIDVA  351



>ref|XP_010555305.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Tarenaya 
hassleriana]
Length=358

 Score =   380 bits (975),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DSSG + P+ F RR+NG NDVT+KILYCG+CHSDLH  KN+WG T YP+
Sbjct  9     HPNKAIGWAARDSSGVLSPFHFSRRDNGDNDVTVKILYCGVCHSDLHSLKNEWGFTNYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI + VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGIASKVGKNVTKFKEGDRVGVGVIVNSCQSCETCDQDLENYCPQLIFTYNSYD  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D RFV+  P+ LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   HDGTKTYGGYSDTIVVDQRFVLRFPDGLPPDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVISTSP K+ EA +RLGAD F+++TD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISTSPKKESEAIDRLGADSFLVTTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +DFI+DTVSA H+L P L LLKVNG L+ +G P+KP++   FPL  G++ V GS IG M+
Sbjct  248   MDFIIDTVSAVHALFPLLGLLKVNGKLITLGLPEKPLELPIFPLALGRKMVGGSDIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  + IN AF RL+K+DV+YRFVID+A
Sbjct  308   ETQEMLDFCAKHNIAADIELIKMEDINSAFVRLSKSDVRYRFVIDVA  354



>ref|XP_009350500.1| PREDICTED: probable mannitol dehydrogenase [Pyrus x bretschneideri]
Length=358

 Score =   380 bits (975),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 258/359 (72%), Gaps = 1/359 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             MA +   H Q   GWAA DSSG + P+ F RREN  +DVTIK+LYCG+CHSDLH AKNDW
Sbjct  1     MAISPEEHPQKAFGWAARDSSGILYPFRFSRRENADDDVTIKVLYCGVCHSDLHFAKNDW  60

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G T YPVVPGHEI G+VT  G+NV  FK+GDRVGVG +  SC++CE C+Q  ENYC    
Sbjct  61    GFTNYPVVPGHEIVGVVTKTGNNVDKFKVGDRVGVGVIVGSCMKCETCQQDLENYCPRTI  120

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
              TYN  + D + TYGGYS + V  +R+V+  P++L  D  APLLCAG+T++ P+K   + 
Sbjct  121   FTYNSHYHDQTKTYGGYSDIIVVHHRYVLRFPDNLAPDAGAPLLCAGITVYSPMKYYGMT  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PGK +G+ G+GGLGH+ VK GKAFG  VTVIS+SP+K+ EA  RLGAD F+L +D  +
Sbjct  181   -EPGKHLGVAGLGGLGHIAVKIGKAFGLKVTVISSSPAKEDEATRRLGADSFLLLSDPAK  239

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             ++    ++D+I+DTVSA H+L P + LLK+NG LV VG P+KP++   FPL+ G++ V G
Sbjct  240   LKGGMGTMDYIIDTVSAVHALAPLIGLLKLNGKLVTVGLPNKPLELPIFPLVLGRKLVGG  299

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             S IG ++ETQEML+ CAK NI  DIE I  D IN A +RLAK+DV+YRFVID+A + T 
Sbjct  300   SDIGGVKETQEMLDFCAKHNITSDIELIHMDYINTAMERLAKSDVRYRFVIDVASSLTQ  358



>ref|XP_004307159.1| PREDICTED: probable mannitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=361

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 252/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +  SGWAA DSSG + P++F RRE G  DVT K+LYCGICHSDLH+ KN+WG + YP+
Sbjct  9     HPKKASGWAARDSSGVLSPFSFSRRETGEKDVTFKVLYCGICHSDLHMIKNEWGFSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS+V  FK+GDRVGVGC+  SC  CE C    ENYC    LTY   +
Sbjct  69    VPGHEIVGEVTEVGSSVQKFKVGDRVGVGCIVGSCRSCENCTGHLENYCPKQILTYGAKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + VAD  F+V +P++LP+D AAPLLCAG+T + PL+   L   PG  +
Sbjct  129   YDGTTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA + LGAD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAQHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     +S
Sbjct  308   ETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKAS  360



>ref|XP_010066666.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
 gb|KCW64641.1| hypothetical protein EUGRSUZ_G02223 [Eucalyptus grandis]
Length=360

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 254/341 (74%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D++G + P+ F RR  G NDVT K+LYCGICHSDLH  KN+WG T YPVVPGHEI
Sbjct  15    GWAARDTTGHLSPFRFSRRATGENDVTFKVLYCGICHSDLHNIKNEWGITSYPVVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+ VT FK+GD+VGVGCM  SC  C  CK+  ENYC  + LTY   ++DG+IT
Sbjct  75    VGMVTEVGTKVTKFKVGDKVGVGCMVGSCRSCANCKEDLENYCPKMILTYGAKYYDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS + V+D  FV+ +P++LP+D +APLLCAG+T++ PLK   L    G  +G++G+G
Sbjct  135   HGGYSDIMVSDEHFVIKIPDNLPLDGSAPLLCAGITVYSPLKYYGL-DKAGMHLGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K+KEA   LGAD F++S +  +M+    ++D I+D
Sbjct  194   GLGHMAVKFAKAMGLKVTVISTSPNKKKEATNHLGADAFLVSRNTEEMELAMGTMDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H+L P + L+K NG LV+VGAP+KP++ L FPL+ G++ V GS IG ++ETQEM+
Sbjct  254   TVSAVHALLPLIGLMKTNGKLVMVGAPEKPLELLAFPLLMGRKMVGGSGIGGIKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK+NI+ DIE I  D +N A +RL+K DVKYRFVID+A
Sbjct  314   DFAAKYNIVADIELIPMDYVNTAMERLSKADVKYRFVIDVA  354



>ref|XP_007205415.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
 gb|EMJ06614.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
Length=361

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/354 (55%), Positives = 254/354 (72%), Gaps = 1/354 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             + +T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W
Sbjct  2     VVSTEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY   + DG+ TYGGYS + VAD  F+V VP+SLP+D AAPLLCAG+T + PL+   L 
Sbjct  122   LTYGSKYLDGTTTYGGYSDIMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA + L AD F++S D  Q
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIDHLHADSFLVSRDEDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V G
Sbjct  241   MQAALGTMDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKIVAG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             S +G M+ETQEM++  AK N+  DIE I  D +N A +RLAK DV+YRFVID+ 
Sbjct  301   SCVGGMKETQEMIDFAAKHNVTADIEVIPIDYVNTAMERLAKTDVRYRFVIDIG  354



>ref|XP_003635278.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI33212.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 250/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+AKNDWGT+ YP+
Sbjct  9     HPTKAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWGTSTYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGVGCM  +C  C+ C    ENYC  +  TY+  +
Sbjct  69    VPGHEIVGIVTEVGSKVGKFKVGDRVGVGCMVGACHSCDSCDNDLENYCPKMVFTYSAPY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + VA+ R+VV +P++LP+D  APLLCAG+T++ PL+   L   PG  I
Sbjct  129   HDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF K FG  VTVISTSPSK+KEA E LGAD F++S +  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSREPDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LV+VGAP++P++   FPLI G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKSQGKLVMVGAPNRPLELPVFPLIMGRKVVAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  D+E I  D +N A +RL K DV+YRFVID+     S+
Sbjct  308   ETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVRYRFVIDIGNTLKSA  360



>ref|XP_002530071.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32311.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=360

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 253/353 (72%), Gaps = 2/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D SG + P+ F RREN   DVT+KILYCG+CHSDLH  +N+WG + YP+
Sbjct  9     HPQKAFGWAARDISGILSPFHFSRRENTDEDVTVKILYCGVCHSDLHTCRNEWGFSHYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT  GSNV  FK GDRVGVG +  SC  CE+CKQ  ENYC  +  TYN   
Sbjct  69    VPGHEIVGTVTKTGSNVKKFKAGDRVGVGVIIGSCKSCEYCKQDLENYCPKMMFTYNSHG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS + V D  FVV +P+SLP+D AAPLLCAG+T++ P+K   +   PGK +
Sbjct  129   ADGTKNYGGYSNMIVVDQHFVVRLPDSLPLDAAAPLLCAGITVYSPMKYYGIT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI G+GGLGH+ VK GKAFG  VTVISTS  K+ EA  RLGAD F++S+D  +M+A   +
Sbjct  188   GIAGLGGLGHIAVKIGKAFGLKVTVISTSARKENEAITRLGADAFLISSDPGKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P L LLK NG L+ +G P+KP++   FPL+ G++ V GS IG ++
Sbjct  248   MDYIIDTVSAVHALAPLLSLLKPNGKLITLGLPEKPLELPIFPLVLGRKLVGGSDIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  D+E I  D+IN+A DRLAK+DVKYRFVID+ GN  S 
Sbjct  308   ETQEMLDFCAKHNITADVEVIGMDEINMAMDRLAKSDVKYRFVIDV-GNSLSQ  359



>ref|XP_007205414.1| hypothetical protein PRUPE_ppa007622mg [Prunus persica]
 gb|EMJ06613.1| hypothetical protein PRUPE_ppa007622mg [Prunus persica]
Length=361

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 255/360 (71%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             + +T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W
Sbjct  2     VVSTEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY   + DG+ TYGGYS + VAD  F+V VP+SLP+D AAPLLCAG+T + PL+   L 
Sbjct  122   LTYGSKYLDGTTTYGGYSDIMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA + L AD F++S D  Q
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIDHLHADSFLVSRDQDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V G
Sbjct  241   MQAALGTMDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPAFPLLMGRKIVGG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     SS
Sbjct  301   SCIGGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKSS  360



>ref|XP_010531428.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Tarenaya 
hassleriana]
Length=365

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 253/358 (71%), Gaps = 3/358 (1%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + H     GW A D SG + P  F RR+NG +DVT+KILYCG+CHSDLH  KNDWG T Y
Sbjct  7     MEHPNKALGWGARDKSGVLSPLRFSRRDNGDDDVTVKILYCGVCHSDLHSLKNDWGFTHY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P++PGHEI G+ + VG NVT FK GD VGVG +  SC  CE C+Q  ENYC  +  TYN 
Sbjct  67    PIIPGHEIVGVASKVGKNVTKFKEGDCVGVGVIVNSCQSCETCEQDLENYCPRVVFTYNS  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG++TYGGYS   V D RFV+  PE LP D  APLLCAG+T++ P+K   +   PGK
Sbjct  127   HDRDGTMTYGGYSDTIVVDQRFVLRFPEGLPPDAGAPLLCAGITVYSPMKYYGMTTEPGK  186

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G+ G+GGLGH+ VK GKAFG  VTVIS S +K+ EA +RLGAD F+++TD  +M+A  
Sbjct  187   HLGVAGLGGLGHVAVKIGKAFGLKVTVISRSQAKESEAIDRLGADSFLVTTDPQKMKAAM  246

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++DFI+DTVSA HSL P L LLKVNG LV +G P+KP++   FPL+ G++ V GS IG 
Sbjct  247   GTMDFIIDTVSAVHSLFPLLGLLKVNGKLVTLGLPEKPLELPIFPLVLGRKMVGGSDIGG  306

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN---PTSS  1114
             M+ETQEML+ C K  I  DIE I  D+INVA +RL+++DVKYRFVID+A +   PT+S
Sbjct  307   MKETQEMLDFCGKHGITADIELIKMDEINVAMERLSRSDVKYRFVIDVANSLTQPTAS  364



>ref|XP_002534367.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28018.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=362

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 251/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+TF RRE G  DV+ K+LYCG+CHSDLH+ KN+WGT+ YP+
Sbjct  10    HPRKAFGWAARDQSGVLSPFTFSRRETGEKDVSFKVLYCGMCHSDLHMVKNEWGTSTYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V   K+GD+VGVGCM  SC  C  C +  ENYC  + LTY   +
Sbjct  70    VPGHEIVGVVTEVGSKVEKIKVGDKVGVGCMVGSCRSCNNCNKDLENYCPKMILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + V+D  FVV +P++LP+D  APLLCAG+T++ PLK   L   PG ++
Sbjct  130   YDGTTTYGGYSDIMVSDEHFVVRIPDNLPLDATAPLLCAGITVYSPLKYYGL-DKPGMQL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA ERLGAD F++S D  QM+    +
Sbjct  189   GVVGLGGLGHMAVKFAKAMGAKVTVISTSPNKKQEAIERLGADSFLVSRDQDQMKGAIGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   MDGIIDTVSAMHPLSPLIGLLKSDGKLVLVGAPEKPLELPAFPLIGGRKLVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK +I  DIE I  + +N A +R+ K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKHSITADIEVIPANYVNTAMERMLKADVRYRFVIDIG  355



>ref|NP_001240222.1| uncharacterized protein LOC100809071 [Glycine max]
 gb|ACU21285.1| unknown [Glycine max]
 gb|KHN04904.1| Putative mannitol dehydrogenase [Glycine soja]
Length=362

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 254/349 (73%), Gaps = 1/349 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + H + V GWAA DSSG + P+ F RRE G  D+  K+ YCGICHSDLH+ KN+WG T Y
Sbjct  8     MEHPKKVFGWAARDSSGLLSPFNFSRRETGEKDLVFKVQYCGICHSDLHMLKNEWGNTTY  67

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI G+VT VGS V  FK+GDRVGVGCM  SC  CE C ++ ENYC  + LTY  
Sbjct  68    PLVPGHEIAGVVTEVGSKVQKFKVGDRVGVGCMIGSCRSCESCDENLENYCPKMILTYGV  127

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
              ++DG+IT+GGYS L VAD  FVV +P++LP+D AAPLLCAG+T++ PL+   L   PG 
Sbjct  128   KYFDGTITHGGYSDLMVADEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRYYGL-DKPGL  186

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G++G+GGLGH+ VKF KA G +VTVISTSP+K+KEA E +GAD F++S +  QMQA  
Sbjct  187   NLGVVGLGGLGHMAVKFAKALGANVTVISTSPNKKKEAIENIGADSFVVSREQDQMQAVM  246

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   F L+ G++ V GS IG 
Sbjct  247   GTMDGIIDTVSAVHPLVPLIGLLKPHGKLVMVGAPEKPLELPVFSLLMGRKMVGGSSIGG  306

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             M+ETQEM++  AK  +  DIE I  D +N A +RLAK DVKYRFVID+ 
Sbjct  307   MKETQEMIDFAAKHGVKPDIEVIPIDYVNTAIERLAKADVKYRFVIDIG  355



>ref|XP_002534365.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28016.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=362

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RRE G NDV+ K+LYCG+CHSD+H  KN+WG  VYP+
Sbjct  10    HPKQAFGWAARDESGVLSPFKFSRRETGGNDVSFKVLYCGMCHSDVHNIKNEWGIAVYPM  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY   +
Sbjct  70    VPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDNCSNNLENYCPEMVLTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS   VAD +FVV +P++LP+D AAPLLCAG+T++ PL+   L   PG  +
Sbjct  130   HDGTITYGGYSDNMVADEQFVVRIPDNLPLDAAAPLLCAGITVYSPLRYYGL-DKPGLHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA ERLGAD F++  D  Q+ A   +
Sbjct  189   GVVGLGGLGHMAVKFAKAMGAKVTVISTSPKKKQEAIERLGADSFLVGRDQDQITAAMST  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+D VSA H L P + LLK +G +VLVGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  249   MDGIIDAVSAMHPLLPLIGLLKPHGKMVLVGAPEKPLELPAFPLLMGRKLVGGSAIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM+N  AK  I  DIE I  D +N A +R+ K+DVKYRFVID+A
Sbjct  309   ETQEMMNFAAKHGITADIEVIPIDYVNTAMERMLKSDVKYRFVIDIA  355



>ref|XP_010416928.1| PREDICTED: cinnamyl alcohol dehydrogenase 2 isoform X1 [Camelina 
sativa]
Length=355

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 244/341 (72%), Gaps = 0/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KN WG + YP+VPGHEI
Sbjct  9     GWAAKDKSGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGISRYPIVPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCSKLVFTYNSRSSDGTRN  128

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+  P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  129   QGGYSDVIVVDHRFVLRFPDGLPSDAGAPLLCAGITVYSPMKYYGMTEDSGKHLGVSGLG  188

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DFI+D
Sbjct  189   GLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADAFLVTTDSQKMKDAVGTMDFIMD  248

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LL VNG LV++G P+KP++   FPL+SG++ V GS IG M+ETQEML
Sbjct  249   TVSAEHSLLPLFSLLNVNGKLVMLGLPEKPLELPIFPLVSGRKMVGGSQIGGMKETQEML  308

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
               CAK NI+ DIE I    IN A DRLA++DV+YRFVID+A
Sbjct  309   EFCAKHNIVSDIELIKMSDINSAMDRLARSDVRYRFVIDVA  349



>gb|AEA36767.1| cinnamyl alcohol dehydrogenase [Sinopodophyllum hexandrum]
Length=361

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 253/360 (70%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             +A+    H +   GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+ KN+W
Sbjct  2     VASPEQEHPKKAIGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V N K+GD+VGVGCM  SC  C+ C    ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVQNIKVGDKVGVGCMVGSCRSCDSCADHLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LT++   +DG+ITYGGYS + VAD  F+V +PE+LP+D AAPLLCA +T + PL+   L 
Sbjct  122   LTHSAKNYDGTITYGGYSDIMVADEHFIVRIPENLPLDGAAPLLCARITTYSPLRHFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP K+ EA E L AD F++STD ++
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKALGVKVTVISTSPKKKTEAVEHLHADSFLVSTDQNE  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK  G +V+VGAP+KP++   FPLI G++ + G
Sbjct  241   MQAAMGTMDGIIDTVSAVHPLVPLIGLLKTQGKIVMVGAPEKPLELPVFPLIMGRKIIGG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM+N  AK NI  DIE I  D +N A DRL K DV+YRFVID+     +S
Sbjct  301   SCIGGMKETQEMINFAAKHNITADIEVIPIDYVNTAMDRLVKADVRYRFVIDIGNTLKAS  360



>ref|XP_007205421.1| hypothetical protein PRUPE_ppa007668mg [Prunus persica]
 gb|EMJ06620.1| hypothetical protein PRUPE_ppa007668mg [Prunus persica]
Length=360

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 252/357 (71%), Gaps = 2/357 (1%)
 Frame = +2

Query  44    TTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTT  223
             T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W  +
Sbjct  5     TEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEWDFS  64

Query  224   VYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTY  403
              YP+VPGHEI G+VT VGS V  F +GD+VGVGCM  SC  C+ C  + ENYC    LTY
Sbjct  65    TYPLVPGHEIVGVVTEVGSKVQKFSVGDKVGVGCMVGSCTSCDSCSNNLENYCPKYILTY  124

Query  404   NGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHP  583
                + DG+ITYGGYS   VAD +FV+ VP++LP+D AAPLLCAG+T + PL+   L   P
Sbjct  125   GAKYHDGTITYGGYSDFMVADEKFVIRVPDNLPLDGAAPLLCAGITTYSPLRYYGL-DKP  183

Query  584   gkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQA  763
             G  +G++G+GGLGH+ VKF KA G  VTVISTSP+K+KEA E L AD F++S D  QMQA
Sbjct  184   GMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKKEAIEHLCADSFLVSRDQDQMQA  243

Query  764   KKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVI  943
                ++D I+DTVSA H L P + LLK NG LV+VGAP+KP++   FPL+ G++ V GS I
Sbjct  244   AVGTMDGIIDTVSAVHPLLPLIALLKSNGKLVMVGAPEKPLELPVFPLLLGRKMVAGSNI  303

Query  944   GSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             G M+ETQEM++  AK NI   +E I  D +N+A +RLAK DVKYRFVID+ GN   S
Sbjct  304   GGMKETQEMIDFAAKHNITAQVEVIPIDYLNIAMERLAKTDVKYRFVIDI-GNTLKS  359



>emb|CAN77732.1| hypothetical protein VITISV_036461 [Vitis vinifera]
Length=361

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 256/349 (73%), Gaps = 3/349 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D SG + P+ F RRENG  DVT+KILYCG+CHSDLH  KN+WG T YP+
Sbjct  9     HPQKAFGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNEWGITRYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASC-LECE-FCKQSQENYCKNIQLTYNG  409
             VPGHEI GIV  +G+NV  FK+GDRVGVG +  SC   CE  C+Q  ENYC ++  TYN 
Sbjct  69    VPGHEIVGIVIQLGNNVKKFKMGDRVGVGVLVGSCNATCEQTCQQDLENYCPSMIFTYNS  128

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG+ TYGGYS + V D R+V+ +P+++P+D  APLLCAG+T++ P+K   +   PGK
Sbjct  129   TSQDGTRTYGGYSDIVVVDQRYVLRIPDNMPLDAGAPLLCAGITVYSPMKYYGMT-EPGK  187

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G+ G+GGLGH+ VK GKAFG  VTVISTSP+K+ EA  +LGAD F++ST+  ++QA  
Sbjct  188   HLGVAGLGGLGHVAVKLGKAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEKVQAAL  247

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D+I+DTVSA HSLGP L +LK+NG L+ VG PDKP++   FPL+ G++ + GS IG 
Sbjct  248   GTMDYIIDTVSAIHSLGPLLAMLKLNGKLITVGLPDKPLELPIFPLVMGRKLIGGSDIGG  307

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ++ETQEML+ CAK NI  DIE I  D IN A  RL+K+DVKYRFVID+A
Sbjct  308   IKETQEMLDFCAKHNITADIELIQMDYINTAMKRLSKSDVKYRFVIDVA  356



>ref|XP_011025421.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=360

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 248/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+L+CGICHSDLH+AKN+WGT++YP+
Sbjct  10    HPTKAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWGTSIYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VGVGCM  SC  C+ C    ENYC  + LTY+  +
Sbjct  70    VPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCNNDLENYCPKMILTYSTKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D  FVV +P++LP+D AAPLLCAG+T++ PL+  NL   PG  +
Sbjct  130   HDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA ERLGAD F++S D  +MQA   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALERLGADSFLVSRDQDEMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ++DTVSA H + P + LLK  G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   MDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I+ D +N A +RL K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKNNITADIEVISMDYVNTAMERLLKTDVRYRFVIDIG  355



>gb|AAA99511.1| cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
Length=360

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GW A D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG ++ SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+S +K +EA   LGAD F+++TD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKSGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS +G M+
Sbjct  248   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA-NSLSPP  360



>ref|XP_008236481.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=361

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 251/351 (72%), Gaps = 1/351 (0%)
 Frame = +2

Query  44    TTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTT  223
             T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+WG +
Sbjct  5     TEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEWGFS  64

Query  224   VYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTY  403
              YP+VPGHEI G+VT VGS V  F +GD+VGVGCM  SC  C+ C  + ENYC  + LTY
Sbjct  65    TYPLVPGHEIVGVVTEVGSKVQKFSVGDKVGVGCMVGSCTSCDSCSNNLENYCPKMILTY  124

Query  404   NGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHP  583
                + DG+ TYGGYS   VAD  FVV +P++LP+D AAPLLC+G+T + PL+   L   P
Sbjct  125   GAKYIDGTTTYGGYSDTMVADEHFVVRIPDNLPLDGAAPLLCSGITTYSPLRYFGL-DKP  183

Query  584   gkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQA  763
             G  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA E L AD F++S D  QMQA
Sbjct  184   GMHVGVVGLGGLGHVAVKFAKAMGLKVTVISTSPNKKEEAIEHLHADSFLVSRDQDQMQA  243

Query  764   KKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVI  943
                ++D I+DTVSA HSL P ++LLK +G LV+VGAP+KP++   FPLI G++ V GS I
Sbjct  244   ATGTMDGIIDTVSAFHSLLPLIDLLKSHGKLVMVGAPEKPLELPVFPLILGRKIVAGSNI  303

Query  944   GSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             G M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+A
Sbjct  304   GGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIA  354



>ref|XP_002866841.1| hypothetical protein ARALYDRAFT_912392 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43100.1| hypothetical protein ARALYDRAFT_912392 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GW A D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG T YPV
Sbjct  9     HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYTYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG +A SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVIAGSCQSCESCDQDLENYCPQMSFTYNAIA  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+S  K++EA   LGAD F++++D  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSSKKEEEAINHLGADSFLVTSDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS +G ++
Sbjct  248   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGLK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINSAMERLAKSDVRYRFVIDVA-NSLSPP  360



>ref|NP_195643.1| putative cinnamyl alcohol dehydrogenase 9 [Arabidopsis thaliana]
 sp|P42734.2|CADH9_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase 9; Short=AtCAD9 
[Arabidopsis thaliana]
 gb|AAK43875.1|AF370498_1 cinnamyl-alcohol dehydrogenase CAD1 [Arabidopsis thaliana]
 emb|CAB43648.1| cinnamyl-alcohol dehydrogenase CAD1 [Arabidopsis thaliana]
 emb|CAB80596.1| cinnamyl-alcohol dehydrogenase CAD1 [Arabidopsis thaliana]
 gb|AAL47376.1| cinnamyl-alcohol dehydrogenase CAD1 [Arabidopsis thaliana]
 gb|AAP59429.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE87056.1| putative cinnamyl alcohol dehydrogenase 9 [Arabidopsis thaliana]
Length=360

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GW A D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG ++ SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+S +K +EA   LGAD F+++TD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS +G M+
Sbjct  248   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA-NSLSPP  360



>ref|XP_011042531.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=362

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 250/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+ KN+WG T YP+
Sbjct  10    HPKPAFGWAARDQSGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGLTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C+ + ENYC  + LTY   +
Sbjct  70    IPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDTCQNNLENYCSKMILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS   VAD  F+V +P++LP+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTVTYGGYSDSMVADEHFIVRIPDNLPLDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF +A G  VTVISTSP+K++EA E LGAD F++S D  QMQA K +
Sbjct  189   GVVGLGGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAKGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P   LLK +G LVLVGAP+KP++   FPLI+G++TV GS  G ++
Sbjct  249   LDGIIDTVSAVHPLLPLFTLLKSHGKLVLVGAPEKPLEMPVFPLITGRKTVGGSCFGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I  D +N A +R+ K DV+YRFVID+ 
Sbjct  309   ETQEMVDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVG  355



>ref|XP_008236492.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=361

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 255/360 (71%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             + +T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W
Sbjct  2     VVSTEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMGKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY   + DG+ TYGGYS + VAD  F+V VP+SLP+D AAPLLCAG+T + PL+   L 
Sbjct  122   LTYGSKYLDGTTTYGGYSDVMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA E L AD F++S +  Q
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIEHLHADSFLVSRNQDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V G
Sbjct  241   MQAALGTMDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLLGRKIVGG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     SS
Sbjct  301   SCIGGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKSS  360



>ref|XP_004235066.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Solanum 
lycopersicum]
Length=360

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 251/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  62    QVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVP  241
             Q   GWAA D SG + P+ F RRENG +D T+KI YCG+CHSDLH  KN+WG T YP++P
Sbjct  11    QKAFGWAARDPSGVLSPFHFSRRENGNDDATVKIHYCGVCHSDLHTLKNEWGFTKYPILP  70

Query  242   GHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWD  421
             GHEI GIVT VGS+V  FK+GDRVGVG +  SC  C+ C+QS ENYC     TYN    D
Sbjct  71    GHEIVGIVTAVGSSVHKFKVGDRVGVGVIVGSCQTCDICEQSLENYCPKAIFTYNSTDHD  130

Query  422   GSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigi  601
             G+ TYGGYS + V   RFV+  PE+LP D  APLLCAG+T++ P+K   +   PGK +GI
Sbjct  131   GTNTYGGYSDIIVVHQRFVLRFPENLPSDAGAPLLCAGITVYSPMKYYGMT-EPGKHLGI  189

Query  602   igmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSID  781
              G+GGLGH+ VK GKAFG  VTVISTSP K+ EA  +LGAD F+LSTD  + +A   ++D
Sbjct  190   AGLGGLGHIAVKIGKAFGLKVTVISTSPKKEDEAITKLGADAFVLSTDPAKFKAAVNTMD  249

Query  782   FILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEET  961
             +I+DT++A H L P L LLK++G L+ +G P+KP++   FPL+ G++ V GS IG M+ET
Sbjct  250   YIIDTIAAVHPLAPLLSLLKMDGKLITIGLPEKPLELPIFPLVLGRKLVGGSDIGGMKET  309

Query  962   QEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             QEML+ CAK NI  DIE I+ D IN+A +RLAK+DVKYRFVID+A +
Sbjct  310   QEMLDFCAKHNITADIELISVDNINMAMERLAKSDVKYRFVIDIANS  356



>gb|AAA74746.1| cinnamyl-alcohol dehydrogenase, partial [Arabidopsis thaliana]
Length=356

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GW A D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  5     HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  64

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG ++ SC  CE C Q  ENYC  +  TYN I 
Sbjct  65    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIG  124

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  125   SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  183

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+S +K +EA   LGAD F+++TD  +M+A   +
Sbjct  184   GVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGT  243

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS +G M+
Sbjct  244   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMK  303

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DV+YRFVID+A N  S P
Sbjct  304   ETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA-NSLSPP  356



>ref|XP_002272479.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI33198.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 249/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+AKNDWGT+ YP+
Sbjct  9     HPTKAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWGTSTYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGV CM  +C  C+ C    ENYC  +  TY+  +
Sbjct  69    VPGHEIVGIVTEVGSKVGKFKVGDRVGVECMVGACHSCDSCDNDLENYCPKMVFTYSAPY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + VA+ R+VV +P++LP+D  APLLCAG+T++ PL+   L   PG  I
Sbjct  129   HDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF K FG  VTVISTSPSK+KEA E LGAD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSRDPDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LV+VGAP++P++   FPLI G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKSQGKLVMVGAPNRPLELPVFPLIMGRKVVAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  D+E I  D +N A +RL K DV+YRFVID+     S+
Sbjct  308   ETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVRYRFVIDIGNTLKSA  360



>ref|XP_006294485.1| hypothetical protein CARUB_v10023512mg [Capsella rubella]
 gb|EOA27383.1| hypothetical protein CARUB_v10023512mg [Capsella rubella]
Length=355

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 247/341 (72%), Gaps = 0/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RRENG +DVT+KIL+CG+CHSDLH  KN WG + YP+VPGHEI
Sbjct  9     GWAAKDESGFLSPFHFSRRENGEDDVTVKILFCGVCHSDLHTIKNHWGFSRYPIVPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG + +SC  C+ C Q  ENYC  +  TYN    DG+  
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIISSCQSCDSCNQDLENYCSKMVFTYNSRSSDGTRN  128

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+  P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  129   QGGYSDVIVVDHRFVLRFPDGLPSDAGAPLLCAGITVYSPMKYYGMAEESGKHLGVSGLG  188

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGHL VK GKAFG  VTVIS SP K++EA +RLGAD F+++TD+ +M+    ++DFI+D
Sbjct  189   GLGHLAVKIGKAFGLRVTVISRSPEKEREAIDRLGADSFLVTTDSQKMKDAVGTMDFIID  248

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LL VNG LV++G P+KP++   FPL+SG++ V GS IG M+ETQEML
Sbjct  249   TVSAEHSLLPLFGLLNVNGKLVILGFPEKPLELPIFPLVSGRKMVGGSQIGGMKETQEML  308

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
               CAK NI+ DIE I  D IN A +RLA++DV+YRFVID+A
Sbjct  309   EFCAKHNIVSDIELIKMDDINSAMERLARSDVRYRFVIDVA  349



>ref|XP_003612978.1| Mannitol dehydrogenase [Medicago truncatula]
 gb|ACJ84617.1| unknown [Medicago truncatula]
 gb|AES95936.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AFK47984.1| unknown [Medicago truncatula]
Length=361

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 252/349 (72%), Gaps = 1/349 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
               H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+ KN+WG + Y
Sbjct  7     FEHPNKAFGWAARDTSGVLSPFNFSRRETGEKDVAFKVLYCGICHSDLHMIKNEWGMSTY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI GIVT VGS V  FKIGD+VGVGC+  SC  C+ C+++ ENYC     TY+ 
Sbjct  67    PLVPGHEIAGIVTEVGSKVEKFKIGDKVGVGCLVDSCRACQNCEENLENYCPKQTNTYSA  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
              + DGSITYGGYS   VAD  F+VH+P+ LP++ AAPLLCAG+T++ PL+   L   PG 
Sbjct  127   KYSDGSITYGGYSDSMVADEHFIVHIPDGLPLESAAPLLCAGITVYSPLRYFGL-DKPGM  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              IGI+G+GGLGHLGVKF KAFG +VTVISTSP+K+KEA E LGAD F++S D  +MQA  
Sbjct  186   NIGIVGLGGLGHLGVKFAKAFGANVTVISTSPNKEKEAIENLGADSFLISHDQDKMQAAM  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D I+DTVSA+H L P + LLK +G LV+VGAPDKP +    PLI G++T+ GS IG 
Sbjct  246   GTLDGIIDTVSADHPLLPLVGLLKYHGKLVMVGAPDKPPELPHIPLIMGRKTISGSGIGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             M+ETQEM++  AK NI  DIE I  D +N A  RL K DVKYRFV+D+ 
Sbjct  306   MKETQEMIDFAAKHNIKPDIEVIPVDYVNTAMKRLLKADVKYRFVLDIG  354



>gb|AEE69008.1| cinnamyl alcohol dehydrogenase 3 [Camellia sinensis]
Length=361

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 245/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DVT K+LY G+CHSDLH  KN+WG T YP +PGHEI
Sbjct  16    GWAARDTSGVLSPFKFSRRATGETDVTFKVLYSGMCHSDLHTIKNEWGNTNYPSLPGHEI  75

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VGS V  FK+GD+VGVGCM  SC  C+ C    ENYC  + LTYN I++DG+ T
Sbjct  76    VGVVTEVGSKVQKFKVGDKVGVGCMVGSCHSCDNCANDLENYCPKMLLTYNSIYYDGTPT  135

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + VAD  FV+ +P+SLP+D +APLLCAG+T + PLK   L   PG  +G++G+G
Sbjct  136   YGGYSNIMVADEHFVIRIPDSLPLDASAPLLCAGITTYSPLKHFGL-DQPGMHVGVVGLG  194

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH  VKF KAFG  VTVISTSP+K+KEA ERLGAD F+ S D  QMQ    ++D I+D
Sbjct  195   GLGHAAVKFAKAFGVKVTVISTSPNKKKEAIERLGADSFLDSRDPTQMQVVMGTMDGIID  254

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P + LLK +G L+LVGAP+KP++   FPL+ G++ V GS IG ++ETQEM+
Sbjct  255   TVSAPHPLLPLIGLLKSHGKLILVGAPEKPLELPVFPLLMGRKIVAGSCIGGIKETQEMI  314

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I  D +N A +RL K DV+YRFVID+ 
Sbjct  315   DFAAKHNITADIEVIPMDYVNTALERLVKADVRYRFVIDIG  355



>ref|XP_007205416.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
 gb|EMJ06615.1| hypothetical protein PRUPE_ppa007626mg [Prunus persica]
Length=361

 Score =   377 bits (969),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 255/360 (71%), Gaps = 1/360 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             + +T   H +   GWAA DSSG + P+ F RRE G  DV+ K+LYCGICHSDLH+ KN+W
Sbjct  2     VVSTEQEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVSFKVLYCGICHSDLHMVKNEW  61

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
             G++ YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + 
Sbjct  62    GSSTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCANNLENYCPKMI  121

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LTY   + DG+ TYGGYS + VAD  F+V VP+SLP+D AAPLLCAG+T + PL+   L 
Sbjct  122   LTYGSKYLDGTTTYGGYSDIMVADEHFIVRVPDSLPLDGAAPLLCAGITTYSPLRYFGL-  180

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA + L AD F++S D  Q
Sbjct  181   DKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKEEAIDHLHADSFLVSRDEDQ  240

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ + G
Sbjct  241   MQAALGTMDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLMGRKILGG  300

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             S IG M+ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     SS
Sbjct  301   SCIGGMKETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKSS  360



>emb|CDP01607.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 201/361 (56%), Positives = 256/361 (71%), Gaps = 2/361 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVS-GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND  211
             MA T  T   V + GWAA D+SG   P+ F RR  G  DV  K+LYCG+CHSDLH++KN+
Sbjct  1     MAKTPETEHPVKAFGWAARDTSGVFSPFKFSRRATGELDVQFKVLYCGVCHSDLHMSKNE  60

Query  212   WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNI  391
             WG T YPVVPGHEI G+VT VGS V   K+GD+VGVGC+  SC  C+ C Q  ENYC N 
Sbjct  61    WGMTQYPVVPGHEIVGVVTEVGSKVEKVKVGDKVGVGCLVGSCRSCDMCSQDLENYCSNQ  120

Query  392   QLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL  571
              LTY+  F DG+ITYGGYS + VAD  F+V  PE+LP+D  APLLCAG+T + PL+   L
Sbjct  121   TLTYSATFTDGTITYGGYSDVMVADEHFIVRWPENLPLDAGAPLLCAGITTYSPLRYFGL  180

Query  572   VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PG  +GI+G+GGLGH+ VKF KAFG  VTVISTS +K+KEA E+LGAD F+ S D  
Sbjct  181   -DKPGVHVGIVGLGGLGHVAVKFAKAFGAKVTVISTSDNKKKEAMEKLGADAFLNSRDPE  239

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA   +++ I+DTVSA H + P + L+K +G +V+VGAP+KP++F  FPLI G++T+ 
Sbjct  240   QMQAAAGTMNGIIDTVSAVHPVVPLINLVKPHGKVVMVGAPEKPLEFSTFPLIVGRKTLS  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             GS IG ++ETQEM++  AK NIL D+E I  D +N A  RL K DVKYRFVID+  +  S
Sbjct  300   GSCIGGLKETQEMIDFAAKHNILADVEVIPIDYVNTAMARLLKADVKYRFVIDIGSSLKS  359

Query  1112  S  1114
             +
Sbjct  360   A  360



>gb|KFK32866.1| hypothetical protein AALP_AA6G297300 [Arabis alpina]
Length=365

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 248/341 (73%), Gaps = 0/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D+SG + P+ F RR++G NDVT+KIL+CG+CHSDLH+ KNDWG + YP++PGHEI
Sbjct  12    GWAANDTSGILSPFHFSRRDHGDNDVTVKILFCGVCHSDLHMIKNDWGLSHYPLIPGHEI  71

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC     TYN    DG+  
Sbjct  72    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPEFVFTYNSSSPDGTRN  131

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS   V D+RFV+  P+ LP D  APLLCAG+TM+ P+K   +    GK +G+ G+G
Sbjct  132   HGGYSDKIVVDHRFVLSFPDGLPSDSGAPLLCAGITMYSPMKYYGMTEEKGKHLGVNGLG  191

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK  KAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DF++D
Sbjct  192   GLGHIAVKIAKAFGLKVTVISRSSDKEREAIDRLGADSFLVTTDSQKMKEAIGTMDFVMD  251

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TV+A+HSL P + LLKVNG LV VG P+KP++   FPL+ G++ V GS IG M+ETQEML
Sbjct  252   TVAADHSLLPLINLLKVNGKLVTVGLPEKPLELPIFPLVLGRKMVGGSQIGGMKETQEML  311

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             + CAK NI+ DIE I    IN A DRLAK+DV+YRFVID+A
Sbjct  312   DFCAKHNIVADIELIKMSDINSAMDRLAKSDVRYRFVIDVA  352



>sp|Q9ZRF1.1|MTDH_FRAAN RecName: Full=Probable mannitol dehydrogenase; AltName: Full=NAD-dependent 
mannitol dehydrogenase [Fragaria x ananassa]
 gb|AAD10327.1| cinnamyl alcohol dehydrogenase [Fragaria x ananassa]
Length=359

 Score =   377 bits (967),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 248/352 (70%), Gaps = 1/352 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A    H +  SGWAA DSSG + P+ F RRE G  DVT K+LYCGICHSDLH+ KN+WG 
Sbjct  2     AIEQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGF  61

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
             + YP+VPGHEI G VT VGS V  FK+GDRVGVGC+  SC  CE C    ENYC    LT
Sbjct  62    STYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILT  121

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
             Y   ++DGS TYGGYS + VAD  F+V +P++LP+D AAPLLCAG+T + PL+   L   
Sbjct  122   YGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGL-DK  180

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
             PG  +G++G+GGLGH+ VKF KA G  VTVISTSP K++EA + LGAD F++S D  QMQ
Sbjct  181   PGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQ  240

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A   ++D I+DTVSA H L P + LL  +G LV+VGAP+KP++   FPL+ G++ V GS 
Sbjct  241   AAIGTMDGIIDTVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSG  300

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             IG M+ETQEM++  A+ NI  DIE I  D +N A +RL K DV+YRFVID+ 
Sbjct  301   IGGMKETQEMIDFAARHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIG  352



>ref|XP_010429094.1| PREDICTED: cinnamyl alcohol dehydrogenase 3-like [Camelina sativa]
Length=376

 Score =   377 bits (969),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 244/341 (72%), Gaps = 0/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KN WG + YP+VPGHEI
Sbjct  9     GWAAKDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGISRYPIVPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIIGSCESCESCNQDLENYCSKLVFTYNSRSSDGTRN  128

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+  P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  129   QGGYSDVIVVDHRFVLRFPDGLPSDAGAPLLCAGITVYSPMKYYGMTEDSGKHLGVSGLG  188

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DFI+D
Sbjct  189   GLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADAFLVTTDSQKMKDAVGTMDFIMD  248

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LL VNG LV++G P+KP++   FPL+SG++ V GS IG M+ETQEML
Sbjct  249   TVSAEHSLLPLFSLLNVNGKLVMLGLPEKPLELPIFPLVSGRKMVGGSQIGGMKETQEML  308

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
               CAK NI+ DIE I    IN A DRLA++DV+YRFVID+A
Sbjct  309   EFCAKHNIVSDIELIKMSDINSAMDRLARSDVRYRFVIDVA  349



>ref|NP_001289257.1| 8-hydroxygeraniol dehydrogenase-like [Pyrus x bretschneideri]
 gb|AGW45368.1| sinapyl alcohol dehydrogenase [Pyrus x bretschneideri]
Length=362

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 254/358 (71%), Gaps = 1/358 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A  L H     GWAA D+SG + P+ F RR  G  DV  K+LYCGICH+DLH  KN+WG 
Sbjct  4     APELEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNEWGI  63

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
             ++YP+VPGHEI G VT VGS V+  K GD+VGVGCM  +C  CE C  + ENYC  + LT
Sbjct  64    SLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKMILT  123

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
             Y  I+ D ++TYGGYS   VA+ R++V  PE+LP+D  APLLCAG+T++ PLK   L   
Sbjct  124   YGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL-AE  182

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
             PGK +GI+G+GGLGH+GVKF KAFG  VTVISTSPSK+ EA +RLGAD F++S D  QMQ
Sbjct  183   PGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKRLGADAFVVSRDPQQMQ  242

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A   ++D I+DTVSA H + P L LLK +G L+LVG  DKP+D   FPLI G+++V GS 
Sbjct  243   AAIGTLDGIIDTVSAAHPIVPLLGLLKPHGKLILVGVADKPLDLHVFPLIMGRKSVAGSG  302

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             IG M+ETQEM++  AK NI  ++E I+ D +N A +RLAKNDV+YRFVID+     +S
Sbjct  303   IGGMKETQEMIDFAAKHNITAEVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTLAAS  360



>gb|AGU43754.1| cinnamyl alcohol dehydrogenase 6 [Populus tomentosa]
Length=360

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 247/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+AKN+WGT++YP+
Sbjct  10    HPTRAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLYCGICHSDLHMAKNEWGTSMYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VGVGCM  SC  C+ C    ENYC  + LTY+  +
Sbjct  70    VPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCNSDLENYCPKMILTYSTKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D  FVV +P++LP+D AAPLLCAG+T++ PL+  NL   PG  +
Sbjct  130   HDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA E LGAD F++S D  +MQA   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ++DTVSA H + P + LLK  G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   MDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I+ D +N A +RL K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKNNITADIEVISMDYVNTAMERLLKTDVRYRFVIDIG  355



>ref|XP_002313294.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa]
 gb|EEE87249.2| hypothetical protein POPTR_0009s06770g [Populus trichocarpa]
Length=360

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+L+CGICHSDLH+AKN+WGT++YP+
Sbjct  10    HPNKAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWGTSMYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VG+GCM  SC  C+ C  + ENYC  + LTY+  +
Sbjct  70    VPGHEIVGEVTEVGSKVEKFKVGDKVGLGCMVGSCHSCDSCNNNLENYCPKMILTYSTKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D  FVV +P++LP+D AAPLLCAG+T++ PL+  NL   PG  +
Sbjct  130   SDGTTTYGGYSNSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA E LGAD F++S D  +MQA K +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEMQAAKGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ++DTVSA H + P + LLK  G LVLVGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  249   MDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLLMGRKIVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I+ D +N A +RL K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKNNITADIEVISMDYVNTAMERLMKTDVRYRFVIDIG  355



>gb|AAM64913.1| cinnamyl-alcohol dehydrogenase CAD1 [Arabidopsis thaliana]
Length=360

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 253/354 (71%), Gaps = 2/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H   V GW A D SG + P+ F RR+NG NDVT+KIL+CG+CH+DLH  KNDWG + YPV
Sbjct  9     HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GI T VG NVT FK GDRVGVG ++ SC  CE C Q  ENYC  +  TYN I 
Sbjct  69    VPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIG  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS+  V D RFV+  PE+LP D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+S +K +EA   LGAD F+++TD  +M+A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DT+SA H+L P L LLKVNG L+ +G P+KP++   FPL+ G++ V GS +G M+
Sbjct  248   MDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             ETQEML+ CAK NI  DIE I  D+IN A +RLAK+DV+YRFVI++A N  S P
Sbjct  308   ETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVINVA-NSLSPP  360



>ref|XP_002313297.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa]
 gb|EEE87252.2| hypothetical protein POPTR_0009s06740g [Populus trichocarpa]
Length=360

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 247/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G NDV  K+L+CGICHSDLH+AKN+WGT+ YP+
Sbjct  10    HPTKAFGWAARDQSGVLSPFKFSRRSTGENDVRFKVLFCGICHSDLHMAKNEWGTSTYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VGVGCM  SC  C  C    ENYC  + LTY+  +
Sbjct  70    VPGHEIVGEVTEVGSKVEKFKVGDKVGVGCMVGSCHSCGSCNNDLENYCPKMILTYSTKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D  FVV +P++LP+D AAPLLCAG+T++ PL+  NL   PG  +
Sbjct  130   HDGTTTYGGYSDSMVTDEHFVVRIPDNLPLDAAAPLLCAGITVYSPLRFFNL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA E LGAD F++S D  +MQA   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ++DTVSA H + P + LLK  G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   MDGVIDTVSAMHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I+ D +N A +RL+K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKNNITADIEVISMDYVNTAMERLSKTDVRYRFVIDIG  355



>gb|ADK63098.1| cinnamyl alcohol dehydrogenase [Ipomoea batatas]
Length=357

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/356 (57%), Positives = 254/356 (71%), Gaps = 7/356 (2%)
 Frame = +2

Query  35    MAATTLTHTQVVS--GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKN  208
             MAAT+  +   V   GWAA D+SG + P+ F RRE G NDV  K+LYCG+CHSDLH  KN
Sbjct  1     MAATSYENEHPVKACGWAARDTSGVLSPFKFSRRETGENDVQFKVLYCGVCHSDLHQLKN  60

Query  209   DWGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKN  388
             +WG T YP+VPGHEI G+VT VG+ V  FK+GD+VGVGC+  SC +CE C    ENYC  
Sbjct  61    EWGNTTYPIVPGHEIVGVVTKVGTKVEKFKVGDKVGVGCLVGSCGKCENCASDLENYCPG  120

Query  389   IQLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNN  568
                TYN     G++T+GGYS + VAD  FVV  PE+LPM+ AAPLLCAG+T + PL+   
Sbjct  121   CVTTYNAY---GTVTFGGYSDIMVADEHFVVRWPENLPME-AAPLLCAGITTYSPLRYFG  176

Query  569   LVGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDA  748
             L   PG  IG++G+GGLGH+ VKF KAFG  VTVISTS SK++EA ERLGAD F++S D 
Sbjct  177   L-DKPGMHIGVVGLGGLGHMAVKFAKAFGTKVTVISTSASKKEEAIERLGADSFLISCDP  235

Query  749   HQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTV  928
              QMQA   ++D I+DTVSANH++ P L LLK NG LV+VG P+KP+D   FPLI G++ V
Sbjct  236   EQMQAAMNTLDGIIDTVSANHAVVPLLGLLKTNGKLVMVGIPEKPLDLPVFPLIMGRKLV  295

Query  929   KGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
              GS IG ++ETQEML+  +K NI  D+E I  D +N A +RLAK DVKYRFVID+ 
Sbjct  296   AGSGIGGLKETQEMLDFSSKHNITPDVEIIPMDYVNTALERLAKADVKYRFVIDVG  351



>ref|XP_004512560.1| PREDICTED: probable mannitol dehydrogenase-like [Cicer arietinum]
Length=361

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 251/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DSSG + P+ F RRE G  DVT K+LYCGICHSDLH+ KN+WG+++YP+
Sbjct  9     HPKKAFGWAARDSSGVLSPFKFSRRETGEKDVTFKVLYCGICHSDLHMLKNEWGSSIYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VGVGC+  SC  C+ C    ENYC  + LTY+   
Sbjct  69    VPGHEIAGEVTEVGSKVKKFKVGDKVGVGCLVGSCDSCQSCSDDLENYCSKMILTYSAKN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG++TYGGYS   VAD  FV+ +P+ LP+D AAPLLCAG+T++ PLK   L   PG  +
Sbjct  129   VDGTVTYGGYSDTMVADEHFVILIPDGLPLDVAAPLLCAGITVYSPLKYFGL-DKPGLNL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG +VTVISTSP+K+KEA E LGAD F++S +  QMQA   S
Sbjct  188   GVVGLGGLGHMAVKFAKAFGANVTVISTSPNKKKEAIEHLGADSFVVSREQDQMQAVMGS  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
              D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPLI G++ + GS IG ++
Sbjct  248   FDGIIDTVSAMHPLLPLIGLLKNHGKLVMVGAPEKPLELPVFPLIGGRKIIGGSCIGGLK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK ++  DIE +  D IN A +RL K DVKYRFVID+ 
Sbjct  308   ETQEMIDFAAKHDVKPDIEVVPVDYINTAMERLLKGDVKYRFVIDIG  354



>gb|AGY96956.1| mannitol dehydrogenase 1 [Vitis vinifera]
Length=360

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 250/353 (71%), Gaps = 2/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+AKNDWGT+ YP+
Sbjct  9     HPTKAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWGTSTYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGVG M  +C  C+ C    ENYC  +  TY+  +
Sbjct  69    VPGHEIVGIVTEVGSKVGKFKVGDRVGVGFMVGACHSCDSCDNDLENYCPKMVFTYSAPY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + VA+ R+VV +P++LP+D  APLLCAG+T++ PL+   L   PG  I
Sbjct  129   HDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF K FG  VTVISTSPSK+KEA E LGAD F++S +  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSREPDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LV+VGAP++P++   FPLI G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKSQGKLVMVGAPNRPLELPVFPLIMGRKVVAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  D+E I  D +N A +RL K DV+YRFVID+ GN   S
Sbjct  308   ETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVRYRFVIDI-GNTLKS  359



>ref|XP_004288323.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9-like [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   375 bits (962),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 254/353 (72%), Gaps = 2/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q V GWAA D+SG + P+ F RREN   DVTIK+LYCG+CHSDLH  KN+WG T YP+
Sbjct  9     HPQKVFGWAATDTSGSLSPFHFSRRENADGDVTIKVLYCGVCHSDLHSVKNEWGITNYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT  G +VT FK GDRVGVG +  SC  CE C+Q  ENYC  +  TYN + 
Sbjct  69    VPGHEIVGVVTKTGKSVTKFKEGDRVGVGVIVGSCNTCEPCQQDLENYCPKVIFTYNSLN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              D + TYGGYS + V D+R+V+  P++LP D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   HDKTKTYGGYSDMIVVDHRYVLRFPDNLPPDSGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVISTSP+K++EA  RLGAD F++STD  Q++A   +
Sbjct  188   GVAGLGGLGHIAVKIGKAFGLKVTVISTSPAKEEEAINRLGADSFVVSTDPAQLKAAMAT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P + LLK+NG L+ VG P+ P++   FPL+ G++ V GS  G ++
Sbjct  248   MDYIIDTVSAVHALAPLIGLLKLNGKLITVGLPNMPLELPIFPLVLGRKLVGGSDFGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEML+ CAK NI  +IE I  D IN A +RLAK DV+YRFVID+ GN  S 
Sbjct  308   ETQEMLDFCAKHNITSEIELIKMDYINTAMERLAKADVRYRFVIDV-GNSLSQ  359



>gb|AFQ36034.1| cinnamyl alcohol dehydrogenase [Fragaria x ananassa]
Length=359

 Score =   375 bits (962),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 248/353 (70%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +  SGWAA DSSG + P+ F RRE G  DVT K+LYCGICHSDLH+ KN+WG + Y +
Sbjct  7     HPKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYSL  66

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GDRVGVGC+  SC  CE C    ENYC    LTY   +
Sbjct  67    VPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKY  126

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DGS TYGGYS + VAD  F+V +P++LP+D AAPLLCAG+T + PL+   L   PG  +
Sbjct  127   YDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGL-DKPGMHV  185

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA + LGAD F++S D  QMQA   +
Sbjct  186   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKEEEALKHLGADSFLVSRDQDQMQAAIGT  245

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LL  +G LV+VGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  246   MDGIIDTVSAQHPLLPLIGLLNSHGELVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMK  305

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK NI  DIE I  D +N A +RL K DV+YRFVID+     +S
Sbjct  306   ETQEMIDFAAKHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLKAS  358



>ref|XP_002322761.2| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEF04522.2| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=362

 Score =   375 bits (962),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+ KN+WG T YP+
Sbjct  10    HPKPAFGWAARDQSGVLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGVTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY   +
Sbjct  70    IPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDSCDNNLENYCSKMILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS   VAD  F+V +P +LP+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTVTYGGYSDNMVADEHFIVRIPNNLPLDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF +A G  VTVISTSP+K++EA E LGAD F++S D  QMQA   +
Sbjct  189   GIVGLGGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LVLVGAP+KP++   FPLI+G++TV GS +G ++
Sbjct  249   LDGIIDTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVFPLITGRKTVGGSCVGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I  D +N A +R+ K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVG  355



>gb|AFK47110.1| unknown [Lotus japonicus]
Length=363

 Score =   375 bits (962),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 256/355 (72%), Gaps = 1/355 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             + H +   GWAA DSSG + P+ F RRE G  DVT K+LYCGICHSDLH+ KN+WG++VY
Sbjct  7     MEHPKKAFGWAARDSSGVLSPFKFSRRETGEKDVTFKVLYCGICHSDLHMIKNEWGSSVY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI G+VT VGS V  FK+GDRVGVGCM  SC  C+ C  + ENYC  + LTY  
Sbjct  67    PLVPGHEIAGVVTEVGSKVQKFKVGDRVGVGCMVNSCRSCQSCADNLENYCPKMILTYAA  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG++TYGGYS L V+D  FV+ +P++LP++ AAPLLCAG+T++ PLK   L   PG 
Sbjct  127   KNVDGTVTYGGYSDLMVSDEDFVIRIPDNLPLEAAAPLLCAGITVYSPLKYYGL-DKPGL  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G++G+GGLGH+ VKF KA G  VTVISTSP+K+ EA E+LGAD F++S +  QM+A  
Sbjct  186   HVGVVGLGGLGHMAVKFAKALGAKVTVISTSPNKKTEAIEKLGADSFVVSREQDQMKAVM  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              + D I+DTVSA H L P + LLK +G LV+VGAP+KP++   F L+ G++T+ GS+IG 
Sbjct  246   GTFDGIIDTVSAVHPLLPLISLLKPHGKLVMVGAPEKPLEVPVFSLLGGRKTIAGSMIGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ++ETQEM++  AK ++  +IE I  D +N A +RL K DVKYRFVID+     +S
Sbjct  306   IKETQEMIDFAAKHDVKPEIEVIPMDYVNTAMERLLKADVKYRFVIDIGNTLKAS  360



>ref|XP_003612973.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95931.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   375 bits (962),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/353 (56%), Positives = 251/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRE G  DV  K+L+CGICHSDLH+AKN+WG+T YPV
Sbjct  9     HPKQAFGWAARDTSGVLSPFKFSRRETGEKDVAFKVLFCGICHSDLHMAKNEWGSTTYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHE+ G VT VGS V N K+GDRVGVGCM  SC  C+ C +  ENYC  +  TY+   
Sbjct  69    VPGHEVAGEVTEVGSKVKNIKVGDRVGVGCMVGSCHSCQSCGEDLENYCSKMIQTYSSKN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS   V D  F+V +P++L +D AAPLLCAG+T++ P+K       PG  I
Sbjct  129   VDGTITYGGYSDTMVVDEHFIVRIPDALSLDAAAPLLCAGITVYSPMKHFGF-DKPGLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTV+STSP+K+KEA ERLGAD F++S +  QM+A   +
Sbjct  188   GVVGLGGLGHMAVKFAKAFGVKVTVVSTSPNKKKEAIERLGADSFVVSREQDQMKAVMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
              D I+DTVSA H L P L LLK NG LV+VGAP+KP++F  F LI G++T+ GS+IG M+
Sbjct  248   FDGIIDTVSALHPLMPLLGLLKNNGKLVMVGAPEKPLEFPVFSLIVGRKTIGGSMIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK  +  DIE +  D +N A +RL K DVKYRFVID+     +S
Sbjct  308   ETQEMIDFAAKHGVKPDIEVVPVDYVNTAMERLVKADVKYRFVIDIGNTMKAS  360



>ref|XP_010095885.1| putative mannitol dehydrogenase [Morus notabilis]
 gb|EXB62435.1| putative mannitol dehydrogenase [Morus notabilis]
Length=364

 Score =   375 bits (962),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 251/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRE G  DVT K+LYCGICHSDLH+ KN+WG + YP+
Sbjct  9     HPKKAFGWAARDTSGLLSPFHFSRRETGEKDVTFKVLYCGICHSDLHMVKNEWGNSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGCM  +C  CE C    ENYC  + LTY+  +
Sbjct  69    VPGHEIVGVVTEVGSKVQKFKVGDKVGVGCMVGACRSCESCANDLENYCPKMILTYSATY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + VAD  F+V +P++LP+D  APLLCAG+T++ PLK   L   PG  +
Sbjct  129   YDGTTTYGGYSDVMVADEHFIVRIPDNLPLDAGAPLLCAGITVYSPLKYFGL-DKPGLHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF KA G  VTVISTSP+K+KEA E LGAD F++S D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKKEAIEHLGADSFLVSRDQDEMKAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V GS  G M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKPHGKLVMVGAPEKPLELPVFPLLMGRKIVGGSCNGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  ++E I  D +N A +RL K DV+YRFVID+A
Sbjct  308   ETQEMIDFAAKHNIRAEVEVIPMDYVNTAMERLLKADVRYRFVIDIA  354



>emb|CDX76968.1| BnaC08g35540D [Brassica napus]
Length=358

 Score =   374 bits (961),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 246/347 (71%), Gaps = 0/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RRENG +DVT+KIL+CG+CHSDLH  KNDWG + YP++PGHEI
Sbjct  12    GWAANDKSGVLSPFHFSRRENGDDDVTVKILFCGVCHSDLHTIKNDWGFSHYPIIPGHEI  71

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  72    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPQLVYTYNSRSSDGTRN  131

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS   V D RFV+  P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  132   QGGYSDKIVVDQRFVLSFPDGLPSDSGAPLLCAGITVYSPMKYYGMTDEKGKHLGVSGLG  191

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K+ EA +RLGAD F+++TD+ +M+    ++DF+LD
Sbjct  192   GLGHIAVKIGKAFGLKVTVISRSSDKESEAIDRLGADSFLVTTDSQKMKDSFGTMDFVLD  251

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+ETQEML
Sbjct  252   TVSAEHSLLPLFSLLKVNGKLVALGLPEKPLELPIFPLVLGRKMVGGSQIGGMKETQEML  311

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             + CAK NI+ DIE I    IN A DRLAK+DV+YRFVID+A +  S+
Sbjct  312   DFCAKHNIVADIELIKMSDINSAMDRLAKSDVRYRFVIDVANSINSA  358



>ref|XP_010052660.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
 gb|KCW76731.1| hypothetical protein EUGRSUZ_D01087 [Eucalyptus grandis]
Length=360

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 252/340 (74%), Gaps = 1/340 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D++G + P+ F RR  G  DVT K+LYCGICHSDLH  KN+WG T YPVVPGHEI
Sbjct  15    GWAARDTTGHLSPFRFSRRATGEKDVTFKVLYCGICHSDLHNIKNEWGITSYPVVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+ VT FK+GD+VGVGCM  SC  C  CK+  ENYC  + LTY   ++DG+IT
Sbjct  75    VGMVTEVGTKVTKFKVGDKVGVGCMVGSCRSCANCKEDLENYCPEMILTYGAKYYDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS + V+D  FV+ +P++LP++ +APLLCAG+T++ PLK   L    G  +G++G+G
Sbjct  135   HGGYSDIMVSDEHFVIKIPDNLPLEGSAPLLCAGITVYSPLKYYGL-DKAGMHLGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K+KEA + LGAD F++S +  +M+    +ID I+D
Sbjct  194   GLGHMAVKFAKAMGLKVTVISTSPNKKKEAMDHLGADAFLVSRNTKEMELAMGTIDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H+L P + LLK NG LV+VGAP+KP++ L FPL+ G++ V GS IG ++ETQEM+
Sbjct  254   TVSAVHALLPVIGLLKTNGKLVMVGAPEKPLELLAFPLLMGRKMVGGSGIGGIKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             +  AK NI+ DIE I  D +N A +RL+K DVKYRFVID+
Sbjct  314   DFAAKHNIVADIELIPMDYVNTAMERLSKADVKYRFVIDI  353



>ref|XP_003635434.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CAN79856.1| hypothetical protein VITISV_014752 [Vitis vinifera]
 emb|CBI18800.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 194/353 (55%), Positives = 247/353 (70%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+AKNDWG + YP+
Sbjct  9     HPTKAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWGMSTYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGVGC+  +C  C+ C    ENYC  +  TY+  +
Sbjct  69    VPGHEIVGIVTEVGSKVGKFKVGDRVGVGCVVGACHSCDICDNDLENYCPKMIFTYSAPY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + VA+ R+VV +P++LP+D  APLLCAG+T++ PL+   L   PG  I
Sbjct  129   HDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF K FG  VTVISTSPSK+KEA E LGAD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSRDPDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LV+VG P++P++   FPL+ G++ V GS  G M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKFQGKLVMVGGPNRPLELPVFPLLMGRKVVAGSCTGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  D+E I  D +N A +RL K DVKYRFVID+     S+
Sbjct  308   ETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVKYRFVIDIGNTLKSA  360



>ref|XP_003517258.1| PREDICTED: probable mannitol dehydrogenase [Glycine max]
Length=359

 Score =   374 bits (960),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 252/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             A   + H +   GWAA DSSG + P+ F RRE G  DV  ++LYCGICHSDLH  KN+WG
Sbjct  3     AQAEIEHPRKAFGWAARDSSGLLSPFNFCRREPGEKDVAFRVLYCGICHSDLHSIKNEWG  62

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
             T++YP+VPGHE+ G+VT VGS V  FK+GD+VGVGC+  SC  C+ C  + ENYC     
Sbjct  63    TSIYPMVPGHEVAGVVTEVGSKVEKFKVGDKVGVGCLVDSCRTCQNCCDNLENYCPQSTF  122

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TY   + DG+ITYGGYS   VAD  FVV +P+ LP+D AAPLLCAG+T++ PL+   L  
Sbjct  123   TYGAKYRDGTITYGGYSDSMVADEHFVVRIPDRLPLDAAAPLLCAGITVYSPLRYYGL-D  181

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
              PG  +G++G+GGLGH+ VKF KAFG  VTVISTSP+K++EA + LGAD F++S D  QM
Sbjct  182   KPGLHVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKEEAIQNLGADSFLISRDQDQM  241

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             QA   ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL++G++ V G+
Sbjct  242   QAAMGTLDGIIDTVSAVHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLAGRKIVAGT  301

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +IG + ETQEM++  AK N+  DIE I  D +N A +RL K DVKYRFVID+ 
Sbjct  302   LIGGLMETQEMIDFAAKHNVKPDIEVIPMDYVNTAMERLLKADVKYRFVIDIG  354



>ref|XP_010472167.1| PREDICTED: cinnamyl alcohol dehydrogenase 3-like isoform X1 [Camelina 
sativa]
Length=374

 Score =   374 bits (961),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 239/341 (70%), Gaps = 3/341 (1%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA + SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KN WG + YP+VPGHEI
Sbjct  10    GWAAKNESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGISRYPIVPGHEI  69

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  70    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCSKLVFTYNSRSSDGTRN  129

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+  P+ LP D  APLLCAG+T++ P+K     G        +G+ 
Sbjct  130   QGGYSDVIVVDHRFVLRFPDGLPSDAGAPLLCAGITVYSPMK---YYGMTEDSGKHLGVS  186

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DFI+D
Sbjct  187   GLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADAFLVTTDSQKMKDAVGTMDFIMD  246

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LL VNG LV++G P+KP++   FPL+SG++ V GS IG M+ETQEML
Sbjct  247   TVSAEHSLLPLFSLLNVNGKLVMLGLPEKPLELPIFPLVSGRKMVGGSQIGGMKETQEML  306

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
               CAK NI+ DIE I    IN A DRLA++DV+YRFVID+A
Sbjct  307   EFCAKHNIVSDIELIKMSDINSAMDRLARSDVRYRFVIDVA  347



>ref|XP_007158345.1| hypothetical protein PHAVU_002G144800g [Phaseolus vulgaris]
 gb|ESW30339.1| hypothetical protein PHAVU_002G144800g [Phaseolus vulgaris]
Length=362

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 248/352 (70%), Gaps = 1/352 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A  + H +   GWAA D SG + P+ F RRE    DV  K+LYCGICHSDLH+AKN+WG 
Sbjct  5     AAEVEHPRKAFGWAARDPSGLLSPFNFSRRETAEKDVAFKVLYCGICHSDLHMAKNEWGF  64

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
             + YP+VPGHE+ G+VT VGS V  FK+GD+VGVGC+  SC  C+ C +  ENYC    LT
Sbjct  65    STYPLVPGHEVVGVVTQVGSKVEKFKVGDKVGVGCLVDSCRTCQSCSEDLENYCPQYTLT  124

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
             Y   + DG+ITYGGYS   V D  FVV +P+ LP+D AAPLLCAG+T++ PL+   L   
Sbjct  125   YGAKYKDGTITYGGYSDSMVVDEHFVVRIPDGLPLDAAAPLLCAGITVYSPLRYFAL-DK  183

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
             PG  +G++G+GGLGH+ VKF KAFG  VTVISTSP K++EA + LGAD F++S D  +MQ
Sbjct  184   PGLHVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPHKKEEAIQHLGADSFLISRDHDEMQ  243

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
                 ++D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+SG++ V GS 
Sbjct  244   GANGTLDGIIDTVSAFHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLSGRKIVAGSG  303

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             IG M+ETQEM++  AK N+  DIE I  D +N A +RL K DVKYRFVID+ 
Sbjct  304   IGGMKETQEMMDFAAKHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIG  355



>gb|ACC63874.1| cinnamyl alcohol dehydrogenase [Populus trichocarpa]
Length=362

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 247/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCASDLENYCPKMILTYASIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA + LGAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNLGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++TV GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKTVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>gb|EYU45817.1| hypothetical protein MIMGU_mgv1a008879mg [Erythranthe guttata]
Length=360

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 247/346 (71%), Gaps = 1/346 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H  V  GW A D+SG   P  F RR  G NDV  K+LYCG+CHSDLH+AKN+WG + YP+
Sbjct  9     HPIVAYGWGAKDTSGVFSPLKFSRRATGENDVQFKVLYCGVCHSDLHMAKNEWGLSHYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VG+ V    +GD+VGVGC+  SC +C  CK   ENYC     TY+ ++
Sbjct  69    VPGHEIVGEVTEVGAKVKKVNVGDKVGVGCLVGSCRDCGQCKSDLENYCPKQVQTYSWVY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS L VAD  F++  P++ P+D  APLLCAGVT + PL+   L   PG  +
Sbjct  129   TDGTITYGGYSNLMVADEHFIIRWPDNFPLDIGAPLLCAGVTTYSPLRHFGL-DKPGLSV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF KAFG  VTVISTS SK+KEA E  GADEF++S D  QMQA   +
Sbjct  188   GIVGLGGLGHVAVKFAKAFGTKVTVISTSLSKKKEAIENFGADEFLVSRDQEQMQAAAGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ILDTVSA H + P + LLK NG L+LVGAP+KP++   FPLI+G++++ GS IG ++
Sbjct  248   LDGILDTVSAVHPIMPLINLLKPNGKLILVGAPEKPLELPVFPLITGRKSISGSAIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             ETQEM++  AK NIL D+E I  D +N A DRLAK+DVKYRFVID+
Sbjct  308   ETQEMIDFAAKHNILPDVEMIPIDYLNTAMDRLAKSDVKYRFVIDV  353



>ref|XP_003635436.1| PREDICTED: probable mannitol dehydrogenase isoform X2 [Vitis 
vinifera]
 ref|XP_002266559.2| PREDICTED: probable mannitol dehydrogenase isoform X1 [Vitis 
vinifera]
Length=360

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+ KN+WG++ YP+
Sbjct  9     HPTKAFGWAATDPSGVLSPFKFSRRATGEKDVRFKVLYCGICHSDLHMVKNEWGSSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V   K+GD+VGVGCM  +C  C+ C    ENYC  + LTY   +
Sbjct  69    VPGHEIVGIVTEVGSKVEKLKVGDKVGVGCMVGACHSCDNCANDLENYCPKMILTYGATY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + VA+ R+VV  P++LP+D  APLLCAG+T++ PL+       PG  I
Sbjct  129   YDGTTTYGGYSDVMVAEERYVVRFPDNLPLDAGAPLLCAGITVYSPLQHFGFT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTSPSK+KEA E LGAD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAFGVKVTVISTSPSKKKEATEHLGADSFLVSRDPDQMQAALGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV+VGAPD+P++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLFPLIGLLKSHGKLVMVGAPDRPLELPIFPLLMGRKIVAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++   K NI  D+E I+ D +N A +RL K DV+YRFVID+ 
Sbjct  308   ETQEMIDFAGKHNITADVEVISIDYVNTAMERLQKADVRYRFVIDIG  354



>ref|XP_008384197.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Malus domestica]
Length=362

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 251/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DV  K+LYCGICH+DLH  KN+WG ++YP+VPGHEI
Sbjct  15    GWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNEWGISLYPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V+  K GD+VGVGCM  +C  CE C  + ENYC  + LTY  I+ D ++T
Sbjct  75    VGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKMILTYGSIYADRTVT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R++V  PE+LP+D  APLLCAG+T++ PLK   L   PGK +GI+G+G
Sbjct  135   YGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL-AEPGKHVGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+GVKF KAFG  VTVISTSPSK+ EA ++LGAD F +S D  QMQA   ++D I+D
Sbjct  194   GLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFXVSRDPQQMQAAIGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK +G L+LVG P+KP+D   FPLI G+++V GS IG M+ETQEM+
Sbjct  254   TVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIMGRKSVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             +  AK NI  D+E I+ D +N A +RLAKNDV+YRFVID+     +S
Sbjct  314   DFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTLAAS  360



>emb|CDY13791.1| BnaA09g42930D [Brassica napus]
Length=358

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 246/347 (71%), Gaps = 0/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KNDWG + YP++PGHEI
Sbjct  12    GWAANDKSGVLSPFHFSRRENGDNDVTVKILFCGVCHSDLHTIKNDWGFSHYPIIPGHEI  71

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN   +DG+  
Sbjct  72    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPQLVYTYNSRSFDGTRN  131

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS   V D RFV+   + LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  132   QGGYSDKIVVDQRFVLSFLDGLPSDSGAPLLCAGITVYSPMKYYGMTEEKGKHLGVSGLG  191

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K+ EA +RLGAD F+++TDA +M+    ++DF+LD
Sbjct  192   GLGHIAVKIGKAFGLKVTVISRSSEKESEAIDRLGADSFLVTTDAQKMKDAIGTMDFVLD  251

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P   LLKVNG LV +G P+KP++   FPL+ G++ V GS IG M+ETQEML
Sbjct  252   TVSAEHSLLPLFSLLKVNGKLVALGLPEKPLELPIFPLVLGRKMVGGSQIGGMKETQEML  311

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             + CAK +I+ DIE I    IN A DRLAK+DV+YRFVID+A +  S+
Sbjct  312   DFCAKHSIVADIELIKISDINSAMDRLAKSDVRYRFVIDVANSINSA  358



>ref|XP_007211488.1| hypothetical protein PRUPE_ppa007678mg [Prunus persica]
 gb|EMJ12687.1| hypothetical protein PRUPE_ppa007678mg [Prunus persica]
Length=359

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 254/352 (72%), Gaps = 1/352 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RREN  +DVTIK+LYCG+CHSD+H  KN+WG T YP+
Sbjct  9     HPEKAFGWAARDTSGILSPFRFSRRENADDDVTIKVLYCGVCHSDVHSVKNEWGFTNYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT  G NV  FK+GDRVGVG +  SC++CE C Q  ENYC     TYN + 
Sbjct  69    VPGHEIVGVVTKAGKNVEKFKVGDRVGVGVIVGSCMKCETCDQDLENYCPRTIFTYNSLD  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              D + TYGGYS + V  +R+V+  P++L +D  APLLCAG+T++ P+K   +   PGK +
Sbjct  129   HDRTKTYGGYSDMIVVHHRYVLRFPDNLALDAGAPLLCAGITVYSPMKYYGMT-EPGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SP K+ EA +RLGAD F+LS+D  +++A   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPGKEDEAVKRLGADSFLLSSDPAKLKAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H+L P + LLK+NG LV VG PDKP++   FPL+ G++ V GS IG ++
Sbjct  248   MDYIIDTVSAVHALAPLIGLLKLNGKLVTVGLPDKPLELPIFPLVLGRKLVGGSDIGGVK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             ETQEML+ CAK NI  DIE I  D IN A +R+AK+DV+YRFVID+  + T 
Sbjct  308   ETQEMLDFCAKHNITSDIELIRMDYINTAMERIAKSDVRYRFVIDVGNSLTQ  359



>ref|XP_006379103.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa]
 gb|ERP56900.1| hypothetical protein POPTR_0009s06780g [Populus trichocarpa]
Length=360

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 247/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+L+CGICHSDLH+AKN+WGT  YP+
Sbjct  10    HPTKAFGWAARDQSGVLSPFKFSRRSTGEKDVRFKVLFCGICHSDLHMAKNEWGTATYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V  FK+GD+VGVGC+  SC  C+ C  + ENYC  + LTY+  +
Sbjct  70    VPGHEIVGEVTEVGSKVEKFKVGDKVGVGCLVGSCHSCDSCNNNLENYCPKMILTYSTKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V D  FV+ +P++LP+D AAPLLCAG+T++ PL+  NL   PG  +
Sbjct  130   HDGTTTYGGYSDSMVTDEHFVIRIPDNLPLDAAAPLLCAGITVYSPLRFFNL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K++EA E LGAD F++S D  +MQA   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPKKKQEALEHLGADSFLVSRDQDEMQAAVGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D ++DTVSA H + P + LLK  G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   MDGVIDTVSAIHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIMGRKIVGGSTIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I+ D +N A +RL+K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKNNITADIEVISMDYVNTAMERLSKTDVRYRFVIDIG  355



>ref|XP_009767330.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like isoform X1 [Nicotiana 
sylvestris]
 emb|CAO99126.1| putative cinnamyl alcohol dehydrogenase [Nicotiana tabacum]
 gb|ADD81207.1| sinapyl alcohol dehydrogenase 4 [Nicotiana tabacum]
Length=359

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 249/341 (73%), Gaps = 2/341 (1%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DV  K++YCGICHSDLH  KN+W T++YP+VPGHE+
Sbjct  15    GWAARDTSGVLSPFNFSRRATGEKDVQFKVMYCGICHSDLHQLKNEWSTSIYPMVPGHEV  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VGS V  FK+GD+VGVGC+  SC +CE C  + ENYC    +TYNGI+ DG+ T
Sbjct  75    AGVVTDVGSKVEKFKVGDKVGVGCLVGSCRKCENCDNNLENYCPGQIMTYNGIYIDGTTT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + V D  +VVH PE+LPM+ AAPLLCAG+T + PLK   L   PG  IG++G+G
Sbjct  135   YGGYSNIMVTDEHYVVHWPENLPME-AAPLLCAGITTYSPLKYFGL-DKPGMHIGVVGLG  192

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTS SK++EA  RLGAD F++S D  QMQA   S+D I+D
Sbjct  193   GLGHMAVKFAKAFGTKVTVISTSASKKQEAIGRLGADSFLVSRDPDQMQAAAGSLDGIID  252

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V GS IG ++ETQEM+
Sbjct  253   TVSAIHPLLPLINLLKTHGKLVMVGAPEKPLELPVFPLLLGRKLVAGSAIGGIKETQEMV  312

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  D+E +  D +N A DRL K+DVKYRFV+D+ 
Sbjct  313   DFAAKHNITPDVEVVPMDYVNTALDRLLKSDVKYRFVLDVG  353



>ref|XP_002309270.2| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
 gb|EEE92793.2| mannitol dehydrogenase 1 family protein [Populus trichocarpa]
Length=360

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 248/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR     DV  K+LYCGICHSDLH+AKN+WG T YP+
Sbjct  10    HPKQAFGWAARDQSGVLSPFKFSRRATAEKDVAFKVLYCGICHSDLHMAKNEWGVTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY    
Sbjct  70    VPGHEIVGIVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDSCHDNLENYCPKMILTYGAKN  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ITYGGYS L VA+  F+V +P++L +D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTITYGGYSDLMVAEEHFIVRIPDNLSLDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA E LGAD F++S+D  QMQ+   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKQEAVENLGADSFLVSSDQGQMQSAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H + P   LLK +G LVLVGAP+KP++   FPLI G++ V GS IG M+
Sbjct  249   LDGIIDTVSAVHPMLPLFTLLKSHGKLVLVGAPEKPLELPVFPLIGGRKMVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  D+E I  D +N A +R+ K DV+YRFVID+A
Sbjct  309   ETQEMIDFAAKHNITADVEVIPMDYVNTAMERMLKGDVRYRFVIDVA  355



>ref|XP_009419520.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 257/355 (72%), Gaps = 3/355 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG+  P+ F RR NG  DVTIKILYCG+CHSDLHVA+N+W  T YPV
Sbjct  20    HPRKAFGWAARDASGRFSPFVFSRRNNGDEDVTIKILYCGMCHSDLHVARNEWARTAYPV  79

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLE--CEFCKQSQENYCKNIQLTYNG  409
             VPGHEI G+VT VG +V  FK+GDRVGVGCM  SC    C  C+Q  EN+C  +  TYN 
Sbjct  80    VPGHEIVGMVTQVGGSVQKFKVGDRVGVGCMVNSCRSGSCHGCQQGLENHCPGLVFTYNS  139

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
             +  DG++TYGGYS + V D  FV+  PE++P D  APLLCAG+T++ P+K + L   PGK
Sbjct  140   VNVDGTMTYGGYSDMIVVDQHFVIRFPENMPSDSGAPLLCAGITVYAPMKYHGL-DQPGK  198

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G++G+GGLGH+ V+FGKA G  VTVIS+SP K+KEA ERLGAD+F++S+D  +MQA  
Sbjct  199   HLGVVGLGGLGHVAVRFGKALGMKVTVISSSPGKEKEATERLGADDFLVSSDPGRMQAAM  258

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D I+DTVSA H + P + LLK  G +++ GAP+KP+    F LI G++++ G+ IG 
Sbjct  259   GTMDGIIDTVSAVHDVTPLMFLLKTRGKMIMAGAPEKPLQLDAFSLIIGEKSIAGTCIGG  318

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ++ETQEM++  A+ NI  DIE ++ D++N A +RL+K DV+YRFVID+    T++
Sbjct  319   VKETQEMIDFAAEHNITADIELVSMDRVNEAMERLSKGDVRYRFVIDIGNTLTAA  373



>ref|XP_010647499.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI41109.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 248/353 (70%), Gaps = 2/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+AKNDWG + YP+
Sbjct  9     HPTKAFGWAATDTSGVLSPFKFSRRETGEKDVRFKVLYCGICHSDLHMAKNDWGMSTYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGVGC+  +C  C+ C    ENYC  +  TY+  +
Sbjct  69    VPGHEIVGIVTEVGSKVGKFKVGDRVGVGCVVGACHSCDICDNDLENYCPKMIFTYSAPY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS + VA+ R+VV +P++LP+D  APLLCAG+T++ PL+   L   PG  I
Sbjct  129   HDGTTTYGGYSDVMVAEERYVVRIPDNLPLDAGAPLLCAGITVYSPLQHFGLT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF K FG  VTVISTSPSK+KEA E LGAD F++S +  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKGFGVKVTVISTSPSKKKEAIEHLGADYFLVSREPDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK  G LV+VG P++P++   FPL+ G++ V GS  G M+
Sbjct  248   MDGIIDTVSAVHPLLPLIGLLKFQGKLVMVGGPNRPLELPVFPLLMGRKVVAGSCTGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++   K NI  D+E I  D +N A +RL K DVKYRFVID+ GN   S
Sbjct  308   ETQEMIDFAGKHNITADVEVIPMDYVNTAMERLEKADVKYRFVIDI-GNTLKS  359



>ref|XP_010095884.1| putative mannitol dehydrogenase [Morus notabilis]
 gb|EXB62434.1| putative mannitol dehydrogenase [Morus notabilis]
Length=362

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 250/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RRE G  DV  K+LYCGICHSDLH+ KN+WG + YP+
Sbjct  9     HPKKAFGWAARDTSGLLSPFHFSRRETGEKDVAFKVLYCGICHSDLHMIKNEWGNSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGCM  +C  CE C    ENYC  + LTY   +
Sbjct  69    VPGHEIVGVVTEVGSKVQKFKVGDKVGVGCMVGACRSCESCANDLENYCSKMILTYGVTY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + VAD  F+V +P++LP+D  APLLCAG+T++ PLK   L   PG  +
Sbjct  129   YDGTTTYGGYSDVMVADEHFIVRIPDNLPLDAGAPLLCAGITVYSPLKYFGL-DKPGLHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF KA G  VTVISTSP+K+KEA E LGAD F++S D  +M+A   +
Sbjct  188   GIVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKKEAIEHLGADSFLVSRDQDEMKAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLICLLKPHGKLVMVGAPEKPLELPIFPLLMGRKIVAGSGIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  ++E I  D +N A +RL K DV+YRFVID+A
Sbjct  308   ETQEMIDFAAKHNITAEVEVIPMDYVNTAMERLLKADVRYRFVIDIA  354



>ref|XP_011097456.1| PREDICTED: 8-hydroxygeraniol dehydrogenase [Sesamum indicum]
Length=360

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 247/340 (73%), Gaps = 1/340 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG   P+ F RR  G +DV  K++YCG+CHSDLH+ KN+WG T YP+VPGHEI
Sbjct  15    GWAARDTSGSFSPFKFSRRATGEHDVQFKVMYCGVCHSDLHMVKNEWGFTQYPIVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GIVT VGS V  FK+GD+VGVGC+  SC EC+ C    ENYC    LTY+  + DG+IT
Sbjct  75    VGIVTEVGSKVEKFKVGDKVGVGCLVGSCRECDQCASDLENYCPKQILTYSAPYTDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS L VAD  FVV  PE+LP+D  APLLCAG+T + PL+   L   PG  +G++G+G
Sbjct  135   YGGYSNLMVADEHFVVRWPENLPLDIGAPLLCAGITTYSPLRHFGL-DKPGLNVGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTS SK+KEA E LGAD+F++S +  +MQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGTTVTVISTSLSKKKEAIENLGADKFLVSRNPEEMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H++ P L LLK +G L+ VGAP+KP++   F LI G++ + GS IG ++ETQEM+
Sbjct  254   TVSATHAVAPLLSLLKPHGKLICVGAPEKPLELPVFSLIMGRKLIAGSAIGGLKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             +  AK NIL D+E I  D +N A +RL K+DVKYRFVID+
Sbjct  314   DFAAKHNILPDVEIIPIDYVNTAMERLLKSDVKYRFVIDI  353



>ref|XP_010040581.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
Length=360

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/340 (56%), Positives = 252/340 (74%), Gaps = 1/340 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D++G + P+ F RR  G  DVT K+LYCGICHSDLH  KN+WG T YPVVPG+E 
Sbjct  15    GWAARDTTGHLSPFRFSRRATGEKDVTFKVLYCGICHSDLHNIKNEWGITSYPVVPGYEF  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
             +G+VT VG+ VT FK+GD+VGVGCM  SC  C  CK+  ENYC  + LTY   ++DG+IT
Sbjct  75    SGMVTEVGTKVTKFKVGDKVGVGCMVGSCRSCANCKEDLENYCPEMILTYGAKYYDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS + V+D  FV+ +P++LP++ +APLLCAG+T++ PLK   L    G  +G++G+G
Sbjct  135   HGGYSDIMVSDEHFVIKIPDNLPLEGSAPLLCAGITVYSPLKYYGL-DKAGMHLGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K+KEA + LGAD F++S D  +M+    ++D I+D
Sbjct  194   GLGHMAVKFAKAMGLKVTVISTSPNKKKEAMDHLGADAFLVSRDTEEMELAMGTMDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H+L P + LLK NG LV+VGAP+KP++ L FPL+ G++ V GS IG ++ETQEM+
Sbjct  254   TVSAVHALLPLIGLLKTNGKLVMVGAPEKPLELLAFPLLMGRKMVGGSGIGGIKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             +  AK NI+ DIE I  D +N A +RL+K DVKYRFVID+
Sbjct  314   DFAAKHNIVADIELIPMDYVNTAMERLSKADVKYRFVIDI  353



>gb|AAW45741.1| sinapyl alcohol dehydrogenase-like protein [Populus tremula x 
Populus tremuloides]
Length=362

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 247/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY+ I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYSSIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA + LGAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNLGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>ref|XP_004512563.1| PREDICTED: probable mannitol dehydrogenase-like [Cicer arietinum]
Length=361

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 252/354 (71%), Gaps = 3/354 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H++   GWAA D+SG + P+ F RR+ G  DVT K+LYCGICHSDLH AKNDWGTT YP+
Sbjct  9     HSKKAFGWAARDTSGVLSPFNFSRRKTGEKDVTFKVLYCGICHSDLHKAKNDWGTTHYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHE+ GIVT VGS V  FKIGDRVGVGC+  SC  CE C  + ENYC    LT     
Sbjct  69    VPGHEVVGIVTEVGSKVRKFKIGDRVGVGCLVDSCQSCENCANNLENYCPQFTLTDGSKN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ TYGGYS   V+D  FV ++P+ LP+D AAPLLCAG+T++ PL+   L   PG  I
Sbjct  129   SDGTTTYGGYSDSMVSDEHFVFNIPDVLPLDVAAPLLCAGITVYSPLRYFGL-DKPGLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VKF KAFG +VTVISTSP KQ EA + LGAD F++S D  Q +    S
Sbjct  188   GVAGLGGLGHMAVKFAKAFGAYVTVISTSPYKQNEAIQHLGADSFLISRDQDQTKVAMGS  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DT+SA+H L P + LLK +G LV+VGAP+KP++   FPL++G++ V GS+IG ++
Sbjct  248   LDGIIDTISADHPLLPLIGLLKSHGKLVMVGAPEKPLELHVFPLLAGRKIVAGSLIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG--NPTS  1111
             ETQEM++  A+ N+  DIE I  D +N A DRLAK DVKYRFVID+     PTS
Sbjct  308   ETQEMIDFAAQNNVKPDIEVIPIDYVNTAMDRLAKADVKYRFVIDIGNTLKPTS  361



>ref|NP_179765.1| cinnamyl alcohol dehydrogenase 2 [Arabidopsis thaliana]
 sp|Q9SJ25.1|CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2; Short=AtCAD2 
[Arabidopsis thaliana]
 gb|AAD20393.1| putative cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAP59430.1| cinnamyl alcohol dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AEC07217.1| cinnamyl alcohol dehydrogenase 2 [Arabidopsis thaliana]
Length=376

 Score =   372 bits (955),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 248/350 (71%), Gaps = 3/350 (1%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KN WG + YP++PGHEI
Sbjct  9     GWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDG-SI  430
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG S 
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTSR  128

Query  431   TYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigm  610
               GGYS + V D+RFV+ +P+ LP D  APLLCAG+T++ P+K   +    GKR+G+ G+
Sbjct  129   NQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGMTKESGKRLGVNGL  188

Query  611   gglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFIL  790
             GGLGH+ VK GKAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DFI+
Sbjct  189   GGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTDSQKMKEAVGTMDFII  248

Query  791   DTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEM  970
             DTVSA H+L P   LLKVNG LV +G P+KP+D   F L+ G++ V GS IG M+ETQEM
Sbjct  249   DTVSAEHALLPLFSLLKVNGKLVALGLPEKPLDLPIFSLVLGRKMVGGSQIGGMKETQEM  308

Query  971   LNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN--PTSS  1114
             L  CAK  I+ DIE I    IN A DRLAK+DV+YRFVID+A +  P SS
Sbjct  309   LEFCAKHKIVSDIELIKMSDINSAMDRLAKSDVRYRFVIDVANSLLPESS  358



>ref|XP_002322822.1| mannitol dehydrogenase family protein [Populus trichocarpa]
 gb|EEF04583.1| mannitol dehydrogenase family protein [Populus trichocarpa]
Length=362

 Score =   372 bits (954),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 246/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCASDLENYCPKMILTYASIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA + LGAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNLGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>ref|XP_007048215.1| Cinnamyl alcohol dehydrogenase 9 isoform 1 [Theobroma cacao]
 gb|EOX92372.1| Cinnamyl alcohol dehydrogenase 9 isoform 1 [Theobroma cacao]
Length=359

 Score =   372 bits (954),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA DSSG + P+ F RRENG +DVT+KI YCG+CHSDLH  +NDWG T YPV
Sbjct  9     HPQKALGWAARDSSGTLSPFHFSRRENGDDDVTVKIFYCGVCHSDLHTVRNDWGFTRYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+ T VG+NVT FK  DRVGVG M  SC  CE C+Q  ENYC  +  TYN   
Sbjct  69    VPGHEIVGVATKVGNNVTKFKASDRVGVGVMVGSCKTCECCQQDLENYCPRVIFTYNSHN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+I YGGYS + V D R+VV  P++LPMD  APLLCAG+T++ P+K   +    GK +
Sbjct  129   PDGTINYGGYSDMIVVDQRYVVRFPDNLPMDAGAPLLCAGITVYSPMKYYGMT-DAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK  KAFG  VTVIS+SPSK+ EA  RLGAD F++S+D  +M++   +
Sbjct  188   GVAGLGGLGHVAVKIAKAFGLKVTVISSSPSKESEAINRLGADSFLVSSDPSKMKSAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLKVNG LV VG P+K ++   FPL+ G++ + GS  G M+
Sbjct  248   MDYIIDTVSAVHPLLPLLTLLKVNGKLVTVGLPNKSLELPIFPLVLGRKLIGGSDAGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  D IN A +RLAK+DV+YRFVID+A
Sbjct  308   ETQEMLDFCAKHNISADIELIRMDNINTAMERLAKSDVRYRFVIDVA  354



>dbj|BAN91672.1| cinnamyl alcohol dehydrogenase 3 [Carthamus tinctorius]
Length=360

 Score =   372 bits (954),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 244/343 (71%), Gaps = 1/343 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             G+AA D+SG + P+TF RR  G  DV  K+LYCGICHSDLH AKN+WG TVYPVVPGHEI
Sbjct  15    GYAARDTSGTLSPFTFSRRATGDKDVRFKVLYCGICHSDLHFAKNEWGMTVYPVVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GIVT VGS V  FKIGD+VGVGC+  SC  CE C    ENYC    LTY   ++DG+ T
Sbjct  75    VGIVTEVGSQVEKFKIGDKVGVGCLVGSCTSCESCTNDLENYCPKQILTYGLPYFDGTRT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VAD  FV+  PE+LP+D  APLLCAG+T + PL+   L   PG ++G++G+G
Sbjct  135   YGGYSDHMVADEHFVLRWPENLPLDTGAPLLCAGITTYSPLRYFGL-DKPGVKVGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK  KAFG  VTV ST+P+K++EA E L AD FI+S D  QMQ+   ++D I+D
Sbjct  194   GLGHVAVKMAKAFGAEVTVFSTTPNKKQEALEGLKADHFIVSKDPEQMQSAASTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L +LK +G LVLVGAP+KP++   F LI G++ V GS IG ++ETQEML
Sbjct  254   TVSATHPIAPLLTVLKPHGKLVLVGAPEKPLELAAFSLIMGRKIVAGSAIGGLKETQEML  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             +  AK  +  DIE I  D +N A DR+ K+DV+YRFVID+A +
Sbjct  314   DFAAKHGVTADIEVIPIDYVNTAMDRILKSDVRYRFVIDVANS  356



>gb|KHG20287.1| putative mannitol dehydrogenase [Gossypium arboreum]
Length=364

 Score =   372 bits (954),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 247/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+TF RR  G  DV  K+LYCGICHSDLH  KN+WG + YP+VPGHEI
Sbjct  15    GWAARDPSGHLSPFTFSRRVTGEEDVRFKVLYCGICHSDLHSIKNEWGFSNYPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V   K+GD+VGVGCM  +C  C+ C    ENYC  + LTYNGI++DG+IT
Sbjct  75    VGEVTEVGSKVEKVKVGDKVGVGCMVGACHSCDSCTNDLENYCPKLILTYNGIYYDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+VV +P+ +P+D AAPLLCAG+T++ PLK   L G PGK IGI+G+G
Sbjct  135   YGGYSDSMVANERYVVRIPDGMPLDSAAPLLCAGITVYSPLKYFGL-GEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSPSK+ EA E LGAD F++S D  ++QA   + D I+D
Sbjct  194   GLGHVAVKFAKALGSKVTVISTSPSKKAEALEHLGADSFLVSPDQDELQAAMGTFDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK +G L++VGAP +P++   F LI G++T+ GS IG M+ETQEM+
Sbjct  254   TVSATHPIMPLLGLLKSHGKLIMVGAPSEPLELPVFSLIIGRKTMAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RL + DV+YRFVID+ 
Sbjct  314   DFAAKHNIRADIEVISMDYVNKAMERLEQADVRYRFVIDIG  354



>ref|XP_011004094.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Populus euphratica]
Length=362

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 246/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFYFSRRATGEEDVRFKVLYCGICHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYTSIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA + LGAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNLGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>gb|AGU43756.1| cinnamyl alcohol dehydrogenase 2 [Populus tomentosa]
Length=362

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 246/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYASIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA + LGAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNLGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>ref|XP_006851411.1| hypothetical protein AMTR_s00040p00069200 [Amborella trichopoda]
 gb|ERN12992.1| hypothetical protein AMTR_s00040p00069200 [Amborella trichopoda]
Length=1047

 Score =   391 bits (1005),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 258/349 (74%), Gaps = 1/349 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D+SG + P+ F RR NG  DVT+KI+YCGICHSDLH  +NDWG T+YP+
Sbjct  10    HPQQAFGWAARDTSGILSPFKFSRRANGEEDVTMKIVYCGICHSDLHFIRNDWGNTIYPI  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGSNV  FK+GD+VGVGCM  +C  CE C++S EN C  + LTYN I 
Sbjct  70    VPGHEIAGIVTEVGSNVKEFKVGDKVGVGCMVGACHTCEPCEKSLENQCPKMILTYNSID  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +D ++TYGGYS   V   R+V+ +PE+LP+D AAPLLCAG+T++ P+K   L   PGK +
Sbjct  130   YDSTMTYGGYSDKLVVHKRYVIRLPENLPLDAAAPLLCAGITVYSPMKYFGL-AEPGKHL  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF KAFG  +TVIS+SPSK+KEA + LGAD+F++S D  QMQA   +
Sbjct  189   GIVGLGGLGHVAVKFAKAFGVKITVISSSPSKEKEAIDMLGADKFLVSHDPEQMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+ILDTVSA H L P L LLK NG L++VG P+KP++   FPLI G++ + GS IG M+
Sbjct  249   MDYILDTVSAEHPLVPLLSLLKTNGKLIMVGLPEKPLELPAFPLILGRKLIGGSHIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             ETQEM++   K NI  DIE I  D +N A +RLA  DV+YRFVID+A +
Sbjct  309   ETQEMIDFAGKHNITADIEVIKIDYVNTAMERLANADVRYRFVIDVANS  357



>emb|CDP01602.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   383 bits (984),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 253/343 (74%), Gaps = 1/343 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RRE G  DV I ILYCGICH+DLH AKN+WG++ YP+VPGHEI
Sbjct  380   GWAARDVSGFLSPFNFSRRETGEKDVQINILYCGICHTDLHCAKNEWGSSKYPIVPGHEI  439

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT  G  VT FK+GD+ GVGCM  SCL CE C  + ENYCK I LTYN ++ DG+ T
Sbjct  440   MGVVTETGGKVTKFKVGDKAGVGCMVGSCLSCENCSNNLENYCKKIILTYNSVYHDGTPT  499

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + VA+  FVV +P++LP+D  APLLCAG+T + PLK   L   PG  IGI+G+G
Sbjct  500   YGGYSDILVANEHFVVRIPDNLPLDAGAPLLCAGITTYSPLKYFGL-DKPGMHIGIVGLG  558

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  +TVISTS  K+KEA E LGAD F++STD  QM+A   S+D ILD
Sbjct  559   GLGHIAVKFAKAFGVKITVISTSLHKKKEALEHLGADSFLVSTDKDQMKAAMDSMDGILD  618

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P + LLK +G LV+VGAPD+P++   FP+++G++ + GS IG M+ETQEML
Sbjct  619   TVSAVHPLLPLISLLKSHGKLVMVGAPDRPLELPVFPMLAGRKILAGSGIGGMKETQEML  678

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             +  A+ NI+ DIE I  D +N A +RL++ DVKYRFVID+A +
Sbjct  679   DFAAEHNIVADIEIIPMDYVNTAMERLSRADVKYRFVIDVANS  721


 Score =   372 bits (954),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 252/355 (71%), Gaps = 2/355 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVS-GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND  211
             MA T  T   V + GWAA D+SG   P+ F RR  G  DV  K+LYCG+CHSDLH++KN+
Sbjct  1     MAKTPETEHPVKAFGWAARDTSGVFSPFNFSRRATGEKDVQFKVLYCGVCHSDLHMSKNE  60

Query  212   WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNI  391
             WG T YP+VPGHEI G+VT VGS V   K+GD+VGVGC+  SC  C+ C Q  ENYC   
Sbjct  61    WGVTQYPIVPGHEIVGVVTEVGSKVEKVKVGDKVGVGCLVGSCRSCDMCSQDLENYCSKQ  120

Query  392   QLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL  571
              LTY+  + DG+ITYGGYS + VAD  F+V  PE+LP+D  APLLCAG+T + PL+   L
Sbjct  121   ILTYSATYTDGTITYGGYSDVMVADEHFIVRWPENLPLDAGAPLLCAGITTYSPLRYFGL  180

Query  572   VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PG  +GI+G+GGLGH+GVKF KAFG  VTVISTS +K+KEA E+LGAD FI S D  
Sbjct  181   -DKPGMHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSENKRKEAIEKLGADAFINSRDPE  239

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA   ++D I+DTVSA H + P + L+K +G +V+VG P+KP++F  F LI G++T+ 
Sbjct  240   QMQAAAGTMDGIIDTVSAVHPVVPLMNLVKPHGKVVMVGVPEKPLEFSAFSLIMGRKTLS  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             GS IG ++ETQEM++  AK NIL D+E I  D IN A +RL K DVKYRFVID+ 
Sbjct  300   GSGIGGLKETQEMVDFAAKHNILADVEVIPMDYINTAMERLLKTDVKYRFVIDIG  354



>ref|NP_179780.1| cinnamyl alcohol dehydrogenase-like protein 3 [Arabidopsis thaliana]
 sp|Q9SJ10.1|CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3; Short=AtCAD3 
[Arabidopsis thaliana]
 gb|AAD20406.1| putative cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAP59431.1| cinnamyl alcohol dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AEC07235.1| cinnamyl alcohol dehydrogenase-like protein 3 [Arabidopsis thaliana]
Length=375

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 247/349 (71%), Gaps = 2/349 (1%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RRENG NDVT+KIL+CG+CHSDLH  KN WG + YP++PGHEI
Sbjct  9     GWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTRN  128

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+ +P+ LP D  APLLCAG+T++ P+K   +    GKR+G+ G+G
Sbjct  129   QGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGMTKESGKRLGVNGLG  188

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS S  K++EA +RLGAD F+++TD+ +M+    ++DFI+D
Sbjct  189   GLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTDSQKMKEAVGTMDFIID  248

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H+L P   LLKV+G LV +G  +KP+D   FPL+ G++ V GS IG M+ETQEML
Sbjct  249   TVSAEHALLPLFSLLKVSGKLVALGLLEKPLDLPIFPLVLGRKMVGGSQIGGMKETQEML  308

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN--PTSS  1114
               CAK  I+ DIE I    IN A DRL K+DV+YRFVID+A +  P SS
Sbjct  309   EFCAKHKIVSDIELIKMSDINSAMDRLVKSDVRYRFVIDVANSLLPESS  357



>ref|XP_002878570.1| hypothetical protein ARALYDRAFT_320022 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54829.1| hypothetical protein ARALYDRAFT_320022 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 243/343 (71%), Gaps = 0/343 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA+D SG + P+ F RREN  NDVT+KI +CG+CHSDLH  KN WG + YPVVPGHEI
Sbjct  9     GWAANDESGVLSPFHFSRRENCENDVTVKIFFCGVCHSDLHTIKNHWGISRYPVVPGHEI  68

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GI T VG NVT FK GDRVGVG +  SC  CE C Q  ENYC  +  TYN    DG+  
Sbjct  69    VGIATKVGKNVTKFKEGDRVGVGVIIGSCESCESCNQDLENYCPEVVFTYNSRSSDGTRN  128

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V D+RFV+ +P+ LP D  APLLCAG+T++ P+K   +    GK +G+ G+G
Sbjct  129   QGGYSDVIVVDHRFVLSIPDGLPSDAGAPLLCAGITVYSPMKYYGMAEESGKHLGVNGLG  188

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTV+S S  K++EA +RLGAD F+++TD+ +M+    +IDFI+D
Sbjct  189   GLGHIAVKIGKAFGLRVTVMSRSSEKEREAIDRLGADSFLVTTDSQKMKDATGTIDFIID  248

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H+L P   LLKV+G LV +G P+KP++   FPL+ G+  V GS IG M+ETQEML
Sbjct  249   TVSAEHALLPLFSLLKVSGKLVALGLPEKPLELPIFPLVLGRNMVGGSQIGGMKETQEML  308

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
               CAK NI+ DIE I    IN A DRLAK+DV+YRFVID+A +
Sbjct  309   EFCAKHNIVSDIELIKMSDINSAMDRLAKSDVRYRFVIDVANS  351



>ref|XP_007207965.1| hypothetical protein PRUPE_ppa016455mg [Prunus persica]
 gb|EMJ09164.1| hypothetical protein PRUPE_ppa016455mg [Prunus persica]
Length=360

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 248/353 (70%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DSSG + P+ F RRE G  DVT K+LYCGICH+DLH+ KNDWG + YP+
Sbjct  9     HPKKAFGWAARDSSGVLSPFNFSRRETGEKDVTFKVLYCGICHTDLHMVKNDWGFSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGC+  SC  C+ C  + ENYC    LTY   +
Sbjct  69    VPGHEIVGVVTEVGSKVEKFKVGDKVGVGCVVGSCQSCDNCANNLENYCPKYILTYGAKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              D +ITYGGYS   VAD  FV+ VP++LP+D AAPLLCAG+T +  L+   L   PG  +
Sbjct  129   HDVTITYGGYSDFMVADEHFVICVPDNLPLDGAAPLLCAGITTYSALRYYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K+KEA E L AD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKALGVRVTVISTSPNKKKEAIEHLRADLFLVSRDQDQMQAAVGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK NG LV+VGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLIALLKSNGKLVMVGAPEKPLELPVFPLLMGRKMVAGSNIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK NI   +E I  D +N A +RLAK DVKYRFVID+     S+
Sbjct  308   ETQEMIDFAAKHNITAQVEVIPVDYLNTAMERLAKTDVKYRFVIDVGNTLKST  360



>gb|AAQ20892.1| 10-hydroxygeraniol oxidoreductase [Camptotheca acuminata]
Length=360

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 244/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P TF RR  G  DV  K++YCGICHSDLH  +N+WG+T+YP++PGHEI
Sbjct  15    GWAASDTSGVLSPLTFSRRATGEKDVKFKVMYCGICHSDLHCLRNEWGSTIYPIIPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GIVT VGS V  FK+GD+VGVGCM  SC  C  C  + ENYC  +  TY+ I+ DG++T
Sbjct  75    AGIVTEVGSKVEKFKVGDKVGVGCMVGSCRSCNDCDNNIENYCPKMMFTYSSIYHDGTVT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + V D  FVV  P++LP+D  APLLCAG+T + PL+   L   PG  +G++G+G
Sbjct  135   YGGYSDIMVTDEHFVVRWPDNLPLDSGAPLLCAGITTYSPLRYYGL-DKPGMNLGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTS +K++EA ERLGAD F++S D  QMQA   ++D ILD
Sbjct  194   GLGHVAVKFAKALGVKVTVISTSLNKKEEAIERLGADSFLVSRDPDQMQAAAGTLDGILD  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P L L+K +G LVLVGAP+KP++    PL+ G++ V GS +G M+ETQEML
Sbjct  254   TVSATHPLLPLLGLIKSHGKLVLVGAPEKPLELPVMPLLMGRKIVGGSNMGGMKETQEML  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  D+E +  D +N A  RL K DV+YRFV+D+A
Sbjct  314   DFAAKHNITADVEVVPMDYVNTAMKRLEKGDVRYRFVLDIA  354



>ref|XP_002279718.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 [Vitis vinifera]
 emb|CBI37635.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 253/349 (72%), Gaps = 1/349 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D SG + P+ F RREN  +DVT+++L+CG+CH+DLH  KNDWG T YP+
Sbjct  9     HPQKAFGWAARDPSGILSPFHFSRRENSPDDVTVRVLFCGVCHTDLHSIKNDWGFTRYPI  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHE TGIVT +G NV  FK+GD+VGVG M  SC  CE CKQ  ENYC  +   YN I+
Sbjct  69    IPGHEFTGIVTKLGKNVKKFKLGDKVGVGVMVGSCRSCESCKQGLENYCPKMMFAYNSIY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS + V D  FV+  P++LP+   APLLCAG+T++ P+K   +    GK +
Sbjct  129   HDGTKNYGGYSNMVVVDQHFVLRFPDNLPLAAGAPLLCAGITVYSPMKYYGMT-QAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFGH VT+IS SP+K+ +A +RLGAD F+LSTD  +M+A   +
Sbjct  188   GVSGLGGLGHVAVKIGKAFGHKVTIISASPNKKDDAIKRLGADAFLLSTDPTKMKAALGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTV+A H LGP L LLKVNG L+ +G P+KP++   FPL+ G++ V GS IGS +
Sbjct  248   MDYIIDTVAAVHPLGPLLGLLKVNGKLITLGLPEKPLELPIFPLVLGRKLVGGSNIGSTK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             ETQEML  CAK NI  DIE I  D IN A +RLAK+DV+YRFVID+AG+
Sbjct  308   ETQEMLEFCAKHNITADIEMIRMDYINTAMERLAKSDVRYRFVIDVAGS  356



>ref|XP_007158342.1| hypothetical protein PHAVU_002G144500g [Phaseolus vulgaris]
 gb|ESW30336.1| hypothetical protein PHAVU_002G144500g [Phaseolus vulgaris]
Length=361

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 248/353 (70%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D+SG + P+ F RR  G NDV  K+LYCGICHSDLH+ KN+WG +VYP+
Sbjct  9     HPNKAFGWAAQDTSGHLSPFKFSRRATGENDVAFKVLYCGICHSDLHMLKNEWGVSVYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHE+ G+VT VG NV  FK+GD+VGVGCM  SC  CE C +  ENYC  + LTYN  +
Sbjct  69    VPGHEVAGLVTEVGKNVQKFKVGDKVGVGCMVGSCHSCESCSEDLENYCPKMILTYNAKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS   V D +F + +P++LP+D AAPLLCAG+T++ PLK   L   PG  I
Sbjct  129   VDGTITYGGYSDSMVVDEQFAIRIPDNLPLDAAAPLLCAGITVYSPLKYYGL-DKPGLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP K+KEA E +GAD F++S +  +M A   +
Sbjct  188   GVVGLGGLGHMAVKFAKALGVKVTVISTSPGKKKEAIENMGADSFVVSREQDEMMAVMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
              D I+DTVSANH L P + LLK +G LV+VGAP+KP++   F L+ G++ + GS +G ++
Sbjct  248   FDGIIDTVSANHPLVPLIGLLKPHGKLVMVGAPEKPLEVPAFSLLMGRKMIAGSAMGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK  +  DIE I  D +N A +RL K DVKYRFVID+     +S
Sbjct  308   ETQEMVDFAAKHGVKPDIEVIGMDYVNTAMERLLKADVKYRFVIDIGNTLKAS  360



>ref|XP_002276703.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI40784.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/347 (54%), Positives = 252/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DV +K+LYCGICH+DLH +KN+WG+  YP+VPGHE+
Sbjct  29    GWAARDNSGHLSPFNFSRRSTGEEDVRLKVLYCGICHTDLHNSKNEWGSASYPLVPGHEV  88

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V  FK+GD+VGVG +  +C  C+ C    ENYC  + LTY  ++ DG++T
Sbjct  89    VGTVTEVGSKVKKFKVGDKVGVGSLVGACHSCDDCSHDLENYCPKLILTYGSLYHDGTMT  148

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+V+ +P+++P+D+ APLLCAG+T++ PLK   L   PG  IGI+G+G
Sbjct  149   YGGYSDTMVANERYVIRIPDNMPLDKGAPLLCAGITVYSPLKYYGL-NEPGMHIGIVGLG  207

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSP+K+KEA E LGAD F++S D  QMQ    ++D I+D
Sbjct  208   GLGHIAVKFAKAFGCKVTVISTSPAKKKEAIEHLGADMFLVSRDEQQMQGAMGTMDGIID  267

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P ++LLK  G LV++GAPD+P++   FPLI G+++V GS+ G ++ETQEM+
Sbjct  268   TVSAIHPLLPLIDLLKSQGKLVMLGAPDQPLELPAFPLILGRKSVGGSLTGGLKETQEMI  327

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             +  AK +I  DIE I+ D IN A +RLAK DV+YRFVID+     +S
Sbjct  328   DFAAKHDIKSDIEVISMDYINTAMERLAKGDVRYRFVIDIGNTLAAS  374



>gb|ABK96585.1| unknown [Populus trichocarpa x Populus deltoides]
Length=362

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR  G  DV   +LYCGICHSDLH+ KN+WG T YP+
Sbjct  10    HPKPAFGWAARDQSGVLSPFKFSRRATGEKDVAFTVLYCGICHSDLHMVKNEWGVTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC    LTY   +
Sbjct  70    IPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDSCDNNLENYCSKKILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS   VAD  F+V +P +LP+D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTVTYGGYSDNMVADEHFIVRIPNNLPLDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF +A G  VTVISTSP+K++EA E LGAD F++S D  QMQA   +
Sbjct  189   GIVGLGGLGHVAVKFARAMGVKVTVISTSPNKKQEALENLGADSFLVSRDQDQMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LVLVGAP+KP++   FPLI+G++TV GS  G ++
Sbjct  249   LDGIIDTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVFPLITGRKTVGGSCFGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  DIE I  D +N A +R+ K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAKHNITADIEVIPMDYVNTAMERVLKADVRYRFVIDVG  355



>pdb|1YQD|A Chain A, Sinapyl Alcohol Dehydrogenase Complexed With Nadp+
 pdb|1YQD|B Chain B, Sinapyl Alcohol Dehydrogenase Complexed With Nadp+
 pdb|1YQX|A Chain A, Sinapyl Alcohol Dehydrogenase At 2.5 Angstrom Resolution
 pdb|1YQX|B Chain B, Sinapyl Alcohol Dehydrogenase At 2.5 Angstrom Resolution
Length=366

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 245/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCG+CHSDLH  KNDWG ++YP+VPGHEI
Sbjct  19    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKNDWGFSMYPLVPGHEI  78

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  79    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYASIYHDGTIT  138

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  139   YGGYSNHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  197

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA +  GAD F++S D  QMQA   ++D I+D
Sbjct  198   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQEQMQAAAGTLDGIID  257

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  258   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  317

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  318   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  358



>ref|XP_011047124.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=360

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 247/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR     DV  K+LYCGICHSDLH+AKN+WG T YP+
Sbjct  10    HPKQAFGWAARDQSGLLSPFKFSRRATAEKDVAFKVLYCGICHSDLHMAKNEWGVTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY    
Sbjct  70    VPGHEIVGIVTEVGSKVDKFKVGDKVGVGCMVGSCHSCDSCHDNLENYCPKMILTYGARN  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS L VA+  F+V +P+++ +D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   HDGTITYGGYSDLMVAEEHFIVRIPDNISLDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF KA G  VTVISTSP+K++EA E LGAD F++S D  QMQ+   +
Sbjct  189   GIVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKQEAVENLGADSFLVSRDQDQMQSAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P   LLK +G LVLVGAP+KP++   FPLI+G++ V GS IG M+
Sbjct  249   LDGIIDTVSAVHPLLPLFTLLKSHGKLVLVGAPEKPLELPVFPLIAGRKMVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  D+E I  D +N A +R+ K DV+YRFVID+A
Sbjct  309   ETQEMIDFAAKHNITADVEVIPMDYVNTAMERMLKGDVRYRFVIDVA  355



>ref|XP_003612984.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95942.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=362

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 250/359 (70%), Gaps = 1/359 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A    H +   GWAA DSSG + P+ F RRE G  DV  K+LYCGICH+DLH+ KN+WG 
Sbjct  5     AKVFEHPKKAFGWAARDSSGVLSPFNFSRRETGEKDVAFKVLYCGICHTDLHMMKNEWGN  64

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
             ++YP+VPGHE+ GIVT VGS V  FK+GD+VGVG M  SC  CE C +  ENYC    +T
Sbjct  65    SIYPLVPGHELAGIVTEVGSKVEKFKVGDKVGVGYMVDSCRSCENCAEDLENYCPQQTVT  124

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
                 + DGS+TYGGYS   VAD  FV+ +P+SLP+D A PLLCAGVT++ PL+   L   
Sbjct  125   CGAKYRDGSVTYGGYSDSMVADEHFVIRIPDSLPLDVAGPLLCAGVTVYSPLRHFQL-DK  183

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
             PG  IG++G+GGLGH+ VKF KAFG +VTVISTSPSK+KEA E LGAD F++S D  QMQ
Sbjct  184   PGMNIGVVGLGGLGHMAVKFAKAFGANVTVISTSPSKEKEAIEHLGADSFLVSRDPDQMQ  243

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A   +++ I+DTVSA+H + P + LLK NG LV+VG   KP++   F L+ G++ V GS+
Sbjct  244   AAMGTLNGIIDTVSASHPILPLIGLLKSNGKLVMVGGVAKPLELPVFSLLGGRKLVAGSL  303

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             IG ++ETQEM++  A+ N+  DIE +  D +N A +RL K DVKYRFVID+      SP
Sbjct  304   IGGIKETQEMIDFAAEHNVTPDIEVVPIDYVNTAMERLEKADVKYRFVIDIGNTLKPSP  362



>gb|AGU43758.1| cinnamyl alcohol dehydrogenase 5 [Populus tomentosa]
Length=360

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR     DV  K+LYCG+CHSDLH+AKN+WG T YP+
Sbjct  10    HPKQAFGWAARDQSGLLSPFKFSRRATAEKDVAFKVLYCGMCHSDLHMAKNEWGVTQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY   +
Sbjct  70    VPGHEIVGIVTEVGSKVEKFKVGDKVGVGCMVGSCRSCDSCHDNLENYCPKMILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS L VA+  F+V +P++L ++  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTTTYGGYSDLMVAEEHFIVRIPDNLSLEAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA E LGAD F++S D  QMQ+   +
Sbjct  189   GVVGLGGLGHVAVKFAKAMGVKVTVISTSPNKKQEAVEILGADSFLVSRDQDQMQSAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H + P   LLK +G LVLVGAP+KP++   FPLI G++ V GS IG M 
Sbjct  249   LDGIIDTVSAVHPMVPLFTLLKSHGKLVLVGAPEKPLELPAFPLIMGRKMVGGSCIGGMT  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI  D+E I  D +N A +R+ K DV+YRFVID+A
Sbjct  309   ETQEMIDFAAKHNITADVEVIPMDYVNTAMERILKGDVRYRFVIDIA  355



>gb|AAK58693.1|AF273256_1 sinapyl alcohol dehydrogenase [Populus tremuloides]
Length=362

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 245/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P+ F RR  G  DV  K+LYCG+CHSDLH  KNDWG ++YP+VPGHEI
Sbjct  15    GWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKNDWGFSMYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V    +GD+VGVGC+  +C  CE C    ENYC  + LTY  I+ DG+IT
Sbjct  75    VGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYASIYHDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R+++  P+++P+D  APLLCAG+T++ PLK   L   PGK IGI+G+G
Sbjct  135   YGGYSDHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK++EA +  GAD F++S D  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQEQMQAAAGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P   LLK +G L+LVGAP+KP++   F LI+G++ V GS IG M+ETQEM+
Sbjct  254   TVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAKNDV+YRFVID+ 
Sbjct  314   DFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG  354



>ref|XP_010680374.1| PREDICTED: probable mannitol dehydrogenase [Beta vulgaris subsp. 
vulgaris]
Length=360

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 244/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA DSSG + P+ F RR  G  DVT K+LY GICHSDLH  KN+WG   YP 
Sbjct  9     HPQKAFGWAARDSSGILSPFNFSRRATGEQDVTFKVLYSGICHSDLHFIKNEWGNASYPA  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VGS V NFK+GD+VGVGCM  +C  C+ C ++ ENYC    LTY   +
Sbjct  69    VPGHEIVGEVTEVGSKVKNFKVGDKVGVGCMVGACRSCDSCDKNLENYCPKAILTYGSTY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + V D  F V +PE++ +D  APLLCAG+T++ PLK   L    G  I
Sbjct  129   YDGTTTYGGYSDIMVVDEHFAVRIPENMSLDATAPLLCAGITVYSPLKYFEL-DKAGLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTSP+K+ EA  RLGAD F++S D  Q+QA   +
Sbjct  188   GVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKDEAVNRLGADSFLVSRDPQQLQAAVGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + +LK +G LV+VGAPD+P++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAAHPLLPLIGMLKTHGKLVMVGAPDRPLELPIFPLLMGRKIVAGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK +I  DIE +  D +N A +RL K+DV+YRFVID+A
Sbjct  308   ETQEMIDFAAKHDIKADIELVPADYVNTAMERLLKSDVRYRFVIDIA  354



>gb|KHN04905.1| Putative mannitol dehydrogenase [Glycine soja]
Length=359

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 251/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             A   + H +   GWAA DSSG + P+ F RRE G  DV  ++LYCGICHSDLH  KN+WG
Sbjct  3     AQAEIEHPRKAFGWAARDSSGLLSPFNFCRREPGEKDVAFRVLYCGICHSDLHSIKNEWG  62

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
             T++YP+VPGHE+ G+VT VGS V  FK+GD+VGVGC+  SC  C+ C  + ENYC     
Sbjct  63    TSIYPMVPGHEVAGVVTEVGSKVEKFKVGDKVGVGCLVDSCRTCQNCCDNLENYCPQSTF  122

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TY   + DG+ITYGGYS   VA+  FVV +P+ LP+D AAPLLCAG+T++ PL+   L  
Sbjct  123   TYGAKYRDGTITYGGYSDSMVAEEHFVVRIPDRLPLDAAAPLLCAGITVYSPLRYYGL-D  181

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
              PG  +G++G+GGLGH+ VKF KAFG  VTVISTSP+K++EA + LGAD F++S D  Q+
Sbjct  182   KPGLHVGVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKEEAIQNLGADSFLISRDQDQV  241

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             QA   + D I+DTVSA H L P + LLK +G +V+VGAP+KP++   FPL++G++ V G+
Sbjct  242   QAAMGTFDGIIDTVSAVHPLLPLIGLLKSHGKIVMVGAPEKPLELPVFPLLAGRKIVAGT  301

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +IG + ETQEM++  AK N+  DIE I  D +N A +RL K DVKYRFVID+ 
Sbjct  302   LIGGLMETQEMIDFAAKHNVKPDIEVIPMDYVNTAMERLLKADVKYRFVIDIG  354



>ref|NP_001147726.1| LOC100281336 [Zea mays]
 gb|ACG28500.1| mannitol dehydrogenase [Zea mays]
Length=421

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/356 (55%), Positives = 253/356 (71%), Gaps = 2/356 (1%)
 Frame = +2

Query  32    PMAAT-TLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKN  208
             PMA T T THT      AAHDSSG + P T  RR  G +DV IKILYCG+CHSDLH  KN
Sbjct  60    PMAPTPTPTHTAAAVALAAHDSSGHLAPLTITRRSTGDDDVAIKILYCGMCHSDLHSIKN  119

Query  209   DWGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKN  388
             +W    YP+VPGHEI G+VT VG NVT+FK GDRVGVGCM  SC  C  C +  EN C+ 
Sbjct  120   EWHNATYPMVPGHEIAGVVTEVGKNVTSFKAGDRVGVGCMVNSCQSCGSCDEDFENSCRA  179

Query  389   IQLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNN  568
             +  TYN +  DG++TYGGYS   V   RFVV  P+++P+DR APLLCAG+T++ P+K + 
Sbjct  180   VIFTYNSVDRDGTVTYGGYSSSVVVHERFVVRFPDAMPLDRGAPLLCAGITVYSPMKYHG  239

Query  569   LVGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDA  748
             L   PGK +G++G+GGLGH+ VKF KAFG  VTVISTSP K++EA +RLGAD F++S DA
Sbjct  240   L-NVPGKHVGVMGLGGLGHVAVKFAKAFGAKVTVISTSPGKKQEALDRLGADAFVVSKDA  298

Query  749   HQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTV  928
              +M+A   ++D I++TVSAN +L PY+ LLK NG +++VG P KP++   F LI G +T+
Sbjct  299   EEMKAAASTMDGIINTVSANLTLAPYMGLLKPNGKMIMVGLPTKPLEIPPFDLIIGNKTL  358

Query  929   KGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
              GS IG M +TQEM+N+ AK  +  DIE +  D +N A +RLAK DV+YRFVID+ 
Sbjct  359   AGSCIGGMRDTQEMINVAAKHGVTTDIELVAADYVNTAMERLAKADVRYRFVIDIG  414



>gb|AFW57003.1| putative cinnamyl-alcohol dehydrogenase family protein [Zea mays]
Length=359

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 250/352 (71%), Gaps = 1/352 (0%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGT  220
             A T THT      AAHDSSG + P T  RR  G +DV IKILYCG+CHSDLH  KN+W  
Sbjct  2     APTPTHTAAAVALAAHDSSGHLAPLTITRRSTGDDDVAIKILYCGMCHSDLHSIKNEWHN  61

Query  221   TVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLT  400
               YP+VPGHEI G+VT VG NVT+FK GDRVGVGCM  SC  C  C +  EN C+ +  T
Sbjct  62    ATYPMVPGHEIAGVVTEVGKNVTSFKAGDRVGVGCMVNSCQSCGSCDEDFENSCRAVIFT  121

Query  401   YNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGH  580
             YN +  DG++TYGGYS   V   RFVV  P+++P+DR APLLCAG+T++ P+K + L   
Sbjct  122   YNSVDRDGTVTYGGYSSSVVVHERFVVRFPDAMPLDRGAPLLCAGITVYSPMKYHGL-NV  180

Query  581   PgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQ  760
             PGK +G++G+GGLGH+ VKF KAFG  VTVISTSP K++EA +RLGAD F++S DA +M+
Sbjct  181   PGKHVGVMGLGGLGHVAVKFAKAFGAKVTVISTSPGKKQEALDRLGADAFVVSKDAEEMK  240

Query  761   AKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSV  940
             A   ++D I++TVSAN +L PY+ LLK NG +++VG P KP++   F LI G +T+ GS 
Sbjct  241   AAASTMDGIINTVSANLTLAPYMGLLKPNGKMIMVGLPTKPLEIPPFDLIIGNKTLAGSC  300

Query  941   IGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             IG M +TQEM+N+ AK  +  DIE +  D +N A +RLAK DV+YRFVID+ 
Sbjct  301   IGGMRDTQEMINVAAKHGVTADIELVAADYVNTAMERLAKADVRYRFVIDIG  352



>ref|XP_009364795.1| PREDICTED: probable mannitol dehydrogenase [Pyrus x bretschneideri]
Length=361

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/353 (56%), Positives = 247/353 (70%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA DSSG + P  F RR+ G  DV  K+LYCGICHSDLH+ KN+WG++VYP+
Sbjct  9     HPNKAFGWAARDSSGVLSPLKFSRRKTGEKDVRFKVLYCGICHSDLHMVKNEWGSSVYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G+VT VGS V  F +GD+VGVGCM  SC  C+ C    ENYC  + LTY    
Sbjct  69    IPGHEIVGVVTEVGSKVQKFNVGDKVGVGCMVGSCRSCDSCNNHLENYCPKMILTYGTRN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS + VAD  F+V +P++LP+D AAPLLCAG+T + PL+   L   PG  +
Sbjct  129   LDGTITYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGHL VKF KA G  VTVISTSP+K++EA E L AD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHLAVKFAKAMGVKVTVISTSPNKKEEAIEHLHADSFLVSRDQDQMQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV+VGAP+KP++   FPLI G++ V GS IG M+
Sbjct  248   LDGIIDTVSALHPLVPLIGLLKSHGKLVMVGAPEKPLELPVFPLIMGRKIVGGSCIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK  I  DIE I  D +N A +RL K DV+YRFVID+     SS
Sbjct  308   ETQEMIDFSAKHKITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTLISS  360



>ref|XP_003612986.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95944.1| cinnamyl alcohol dehydrogenase family protein [Medicago truncatula]
Length=363

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 248/348 (71%), Gaps = 1/348 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RRE G  DV  K+LYCGICHSDLH+ +N+WG T YP+VPGHE+
Sbjct  17    GWAARDSSGVLSPFHFFRRETGEKDVAFKVLYCGICHSDLHIMQNEWGKTTYPLVPGHEL  76

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
             TG+VT VGS V  FK+GD+VGVG M  SC  CE C    ENYC     T+NG   DG+IT
Sbjct  77    TGVVTEVGSKVKKFKVGDKVGVGYMVDSCRSCENCADDIENYCTKYTQTFNGKSRDGTIT  136

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGG+S   VAD  FV+ +P+SLP+D A PLLCAGVT++ PL+   L   PG  IG++G+G
Sbjct  137   YGGFSDSMVADEHFVIRIPDSLPLDGAGPLLCAGVTVYSPLRHFGL-DKPGMNIGVVGLG  195

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSP K+KEA E LGAD F++S D  QMQA   +++ I+D
Sbjct  196   GLGHMAVKFAKAFGAKVTVISTSPKKEKEAIEHLGADSFLVSRDPEQMQAATSTLNGIID  255

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA+H + P + LLK NG LV+VGA  KP++   F L+ G++++ GS+IG ++ETQEM+
Sbjct  256   TVSASHPVVPLIGLLKSNGKLVMVGAVAKPLELPIFSLLGGRKSIAGSLIGGIKETQEMI  315

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSSP  1117
             +  AK N+  +IE +  D +N A +RL K DVKYRFVID+  +   SP
Sbjct  316   DFAAKHNVTPEIEVVPIDYVNTAMERLVKGDVKYRFVIDIGNSLKPSP  363



>gb|AFY63474.1| geraniol dehydrogenase [Perilla setoyensis]
Length=360

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 245/354 (69%), Gaps = 2/354 (1%)
 Frame = +2

Query  35    MAATTLT-HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND  211
             MA T  T H     GWAA D+SG + P+ F RR+ G  DV  K+LYCG+CHSDLH+ KN+
Sbjct  1     MAKTPETEHPLKAFGWAARDNSGTLSPFNFSRRDTGERDVQFKVLYCGVCHSDLHMVKNE  60

Query  212   WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNI  391
             WG T YPVVPGHEI G+VT VGS V   K GD+VGVG +  SC +C+ C    ENYC   
Sbjct  61    WGVTHYPVVPGHEIVGVVTEVGSKVEKVKAGDKVGVGVIVGSCRQCDQCSNDLENYCSKQ  120

Query  392   QLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL  571
              LTY   + DG+IT GGYS + VAD  F++  PE+LP+D  APLLCAG+T + PL+   L
Sbjct  121   ILTYGAPYIDGTITRGGYSNIMVADEHFIIRWPENLPLDAGAPLLCAGITTYSPLRYYGL  180

Query  572   VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PG  +G+ G+GGLGH+ VKF KAFG  VTVISTS  K+KEA E LG DEF++S+D  
Sbjct  181   -DKPGLSVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLGKKKEAIEHLGVDEFLVSSDPQ  239

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA   ++D I+DTVSA H L P + LLK +G L++VGAP KP+    F LI G++TV 
Sbjct  240   QMQAAVGTLDGIIDTVSAEHPLAPLMSLLKPHGKLIVVGAPQKPLQLHAFSLIQGRKTVA  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             GS IG M+ETQEM++  AK NI+ D+E I  D IN A DRL K+DVKYRFVID+
Sbjct  300   GSGIGGMKETQEMIDFAAKKNIIPDVEVIPIDYINTAMDRLLKSDVKYRFVIDV  353



>ref|XP_008236460.1| PREDICTED: probable mannitol dehydrogenase [Prunus mume]
Length=360

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA DSSG + P+ F RRE G  DVT K+LYCGICH+DLH+ KNDWG++ YP+
Sbjct  9     HPKKAFGWAARDSSGVLSPFNFSRRETGEKDVTFKVLYCGICHTDLHMVKNDWGSSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGC+  SC  C+ C  + ENYC    LTY    
Sbjct  69    VPGHEIVGVVTEVGSKVEKFKVGDKVGVGCVVGSCQSCDNCANNLENYCPKYILTYGAKN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGGYS   VAD  FV+ VP++LP+D AAPLLCAG+T +  L+   L   PG  +
Sbjct  129   HDGTITYGGYSDFMVADEHFVIRVPDNLPLDGAAPLLCAGITTYSALRYYGL-DKPGMHV  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTS +K++EA E L AD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKALGVRVTVISTSLNKKEEAIEHLRADSFLVSLDQDQMQAAVGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK NG LV+VGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPSIALLKPNGKLVMVGAPEKPLELPVFPLLMGRKMVAGSNIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK NI   +E I  D +N A +RLAK DV+YRFVID+ 
Sbjct  308   ETQEMIDFAAKHNITAQVEVIPIDYLNTAMERLAKTDVRYRFVIDVG  354



>ref|XP_007047728.1| Cinnamyl alcohol dehydrogenase 6 [Theobroma cacao]
 gb|EOX91885.1| Cinnamyl alcohol dehydrogenase 6 [Theobroma cacao]
Length=362

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 248/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DV  K+LYCGICHSDLH  KN+WG ++YP+VPGHEI
Sbjct  15    GWAARDASGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHNIKNEWGLSIYPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V   ++GD+VGVGCM  +C  CE C  + ENYC  + LTYNGI++DG++T
Sbjct  75    VGEVTEVGSKVKKVRVGDKVGVGCMVGACHSCESCANNLENYCPKVILTYNGIYYDGTMT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGY+   VA+ R+VV +P+ +P+D AAPLLCAG+T++ PLK   L G  GK IGI+G+G
Sbjct  135   YGGYADSMVANERYVVQIPDGMPLDAAAPLLCAGITVYSPLKYFGL-GEAGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K+ +A E LGAD F++S D  +MQA   S D I+D
Sbjct  194   GLGHVAVKFAKALGSKVTVISTSPNKKTDALEHLGADSFLVSRDQGEMQAAMGSFDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK +G L++VGAP +P++   F LI G++T+ GS IG M+ETQEM+
Sbjct  254   TVSAVHPIMPLLGLLKSHGKLIMVGAPYEPLELPVFSLIIGRKTMAGSGIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RL K DV+YRFVID+ 
Sbjct  314   DFAAKHNIKADIEVISMDYVNKAMERLGKGDVRYRFVIDIG  354



>gb|KHG24369.1| putative cinnamyl alcohol dehydrogenase 9 -like protein [Gossypium 
arboreum]
Length=359

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 253/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             + Q   GWAA D+SG + P+ F RRENG +DVT+KILYCG+CHSDLH  +N+WG T YPV
Sbjct  9     NQQEAFGWAATDNSGILSPFNFSRRENGDDDVTLKILYCGVCHSDLHTLRNEWGFTFYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI+G+VT VG NVT F IGDRVGVG +  SC  CE C+Q  ENYC  I  TYN   
Sbjct  69    VPGHEISGVVTKVGKNVTKFNIGDRVGVGVLVGSCKTCECCEQDLENYCPRIIFTYNSYN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS + V D R+V+  P++LP+D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   PDGTKNYGGYSDMIVVDQRYVLRFPDNLPLDAGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VTVIS+SP K+ EA  RLGAD F++S D  +M++   +
Sbjct  188   GVAGLGGLGHVAVKIGKAFGLKVTVISSSPQKESEAINRLGADSFLVSNDPAKMKSAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLKVNG LV VG P+KP++   FPL+ G++ + GS +G M+
Sbjct  248   MDYIIDTVSAVHPLLPLLSLLKVNGKLVTVGLPNKPLELPVFPLVMGRKLIGGSDVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  ++IN A +RLAK+DV+YRFVID+A
Sbjct  308   ETQEMLDFCAKHNITADIELIRIEEINTAMERLAKSDVRYRFVIDVA  354



>gb|ABZ01816.1| cinnamyl alcohol dehydrogenase [Gossypium hirsutum]
 gb|ACJ11737.1| mannitol dehydrogenase [Gossypium hirsutum]
Length=359

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 252/347 (73%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             + Q   GWAA D+SG + P+ F RRENG +DVT+KILYCG+CHSDLH  +NDWG + YPV
Sbjct  9     NQQKAFGWAATDNSGILSPFNFSRRENGDDDVTLKILYCGVCHSDLHTLRNDWGFSFYPV  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI+G+VT VG NVT F IGDRVGVG +  SC  CE C+Q  ENYC  I  TYN   
Sbjct  69    VPGHEISGVVTKVGKNVTKFNIGDRVGVGVLVGSCKTCECCEQDLENYCPRIIFTYNSYN  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+  YGGYS + V D R+V+  P++LP+D  APLLCAG+T++ P+K   +    GK +
Sbjct  129   PDGTKNYGGYSDMIVVDQRYVLRFPDNLPLDAGAPLLCAGITVYSPMKYYGMT-EAGKHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G+ G+GGLGH+ VK GKAFG  VT IS+SP K+ EA  RLGAD F++S D  +M++   +
Sbjct  188   GVSGLGGLGHVAVKIGKAFGLKVTAISSSPQKESEAINRLGADSFLVSNDPEKMKSAIGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D+I+DTVSA H L P L LLKVNG LV VG P+KP++   FPL+ G++ + GS +G M+
Sbjct  248   MDYIIDTVSAVHPLLPLLSLLKVNGKLVTVGLPNKPLELPVFPLVMGRKLIGGSDVGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEML+ CAK NI  DIE I  ++IN A +RLAK+DV+YRFVID+A
Sbjct  308   ETQEMLDFCAKHNITADIELIRIEEINTAMERLAKSDVRYRFVIDVA  354



>ref|XP_006411831.1| hypothetical protein EUTSA_v10025540mg [Eutrema salsugineum]
 gb|ESQ53284.1| hypothetical protein EUTSA_v10025540mg [Eutrema salsugineum]
Length=362

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 248/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RRE G  +V +K+LYCGICHSDLH  KN+W ++VYP+VPGHEI
Sbjct  15    GWAARDSSGHLSPFAFSRRETGEEEVRVKVLYCGICHSDLHCLKNEWHSSVYPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G V+ +G  V+ F IGD++GVGC+  SC  CE C++ QENYC     TYNG+ +DG++ 
Sbjct  75    VGEVSEIGRKVSKFNIGDKIGVGCIVDSCRTCESCREDQENYCTKAVATYNGVHYDGTVN  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   V D R+ V +P +LP+  AAPLLCAG++M+ P+K   L G PGK +GI+G+G
Sbjct  135   YGGYSDHVVVDERYAVKIPHTLPLASAAPLLCAGISMYSPMKYFGLAG-PGKHVGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+GV+F KAFG  VTV+S++  K K+A E LGAD F+ STD  QMQA   ++D I+D
Sbjct  194   GLGHIGVRFAKAFGTKVTVVSSTVGKCKDALENLGADGFLASTDDDQMQAAMGTMDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVS +HS+ P + LLK NG LVL+GA +KP D   F LI G+++V GS IG M+ETQEM+
Sbjct  254   TVSVSHSVLPLIGLLKSNGKLVLLGATEKPFDLPAFSLIMGRKSVAGSAIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  A+  I  DIE I+ D +N A DRLAK DV+YRFVID+A
Sbjct  314   DFAAEHGIKADIEVISMDYVNTAMDRLAKGDVRYRFVIDIA  354



>ref|XP_003612989.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95947.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 252/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H++   GWAA DSSG + P+ F RRE    DV +++LYCGICHSDLH AKN+WGTT YP+
Sbjct  9     HSKKAFGWAARDSSGVLSPFNFSRREICEKDVALRVLYCGICHSDLHKAKNEWGTTNYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V  FK+GDRVGVGC+  SC  C+ C  + ENYC  + LT    +
Sbjct  69    VPGHEIVGIVTEVGSKVKKFKVGDRVGVGCLVDSCHSCQNCVDNLENYCPQLTLTDGSKY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ T+GG+S   V+D  FV  +P+ LP+D AAPLLCAG+T++ PL+   L   P   I
Sbjct  129   SDGTSTHGGFSDSMVSDEHFVFRIPDQLPLDAAAPLLCAGITVYSPLRHFGL-DKPDMNI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG +VTVISTSP K+KEA E L AD F++S D  QM+A   +
Sbjct  188   GVVGLGGLGHMAVKFAKAFGANVTVISTSPKKEKEALEHLRADSFLISRDPKQMKAATAT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA+H L P + LLK +G LV+VGAP+KP++   FPL++G++ V GS+IG ++
Sbjct  248   LDGIIDTVSADHPLLPLIGLLKSHGKLVMVGAPEKPLELPVFPLLAGRKIVAGSLIGGIK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  A+ N+  DIE I  D +N A +RL K DVKYRFVID+     SS
Sbjct  308   ETQEMIDFAAEHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIGNTLKSS  360



>ref|XP_010911601.1| PREDICTED: probable mannitol dehydrogenase [Elaeis guineensis]
Length=368

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 254/359 (71%), Gaps = 1/359 (0%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             A+    H +   GWAA D+SG + P++F RR N  +DVTIKILYCGICHSDLH  KN+W 
Sbjct  11    ASPETEHPRKAFGWAARDTSGVLSPFSFSRRNNRDDDVTIKILYCGICHSDLHCIKNEWT  70

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
               +YP+VPGHEI G+VT VGSNV  FK+GD+VGVG +  SC  C+ CKQ  ENYC    L
Sbjct  71    NAIYPIVPGHEIVGVVTEVGSNVHKFKVGDKVGVGGLVNSCRSCDSCKQGFENYCPRFIL  130

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TYN I  DG++TYGGYS   V D  FVV +P+++ +D+ APLLCAG+T++ PLK   L  
Sbjct  131   TYNAIDTDGTMTYGGYSDTIVVDEHFVVRIPDTMALDKCAPLLCAGITVYSPLKYFGL-N  189

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
               GK +G++G+GGLGH+ VKF KAFG  VTV+S+SP K+KEA E LGAD FI+S++  QM
Sbjct  190   EAGKHVGVVGLGGLGHVAVKFAKAFGAKVTVVSSSPKKEKEAIENLGADAFIVSSNPKQM  249

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             QA   ++D I+DTVSA H L P L LLK  G +++VGAP+KP++   F LI G + + GS
Sbjct  250   QAAMGTMDGIIDTVSAVHPLTPLLFLLKAQGKMIMVGAPEKPLELPAFSLIMGGKIIAGS  309

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
               G M++TQEML+  AK N+  +IE I  D +N A +RLAK DV+YRFVID+A   T++
Sbjct  310   GGGGMKDTQEMLDFAAKHNVTAEIELIGMDYVNKAMERLAKADVRYRFVIDIANTLTTA  368



>ref|XP_006466346.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Citrus sinensis]
Length=393

 Score =   368 bits (945),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 244/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RRE G  DV +K+LYCGICH+DLH  KN+WG +++P+VPGHEI
Sbjct  46    GWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLHNIKNEWGFSLFPMVPGHEI  105

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V   K+GD+VGVGCM  +C  CE C    ENYC  +  TY  I  DG+IT
Sbjct  106   AGEVTEVGSKVRKVKVGDKVGVGCMVGACHSCESCANDLENYCPKVIPTYTSINTDGTIT  165

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   VA+ R++V  P+S+P+D AAPLLCAG+T++ PLK   L    GK +GI+G+G
Sbjct  166   YGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFEL-AEQGKHVGIVGLG  224

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK+ EA E LGAD F+ S D  Q+Q    ++D I+D
Sbjct  225   GLGHVAVKFAKAFGAKVTVISTSPSKKTEALEHLGADSFLNSRDPDQLQGAMGTLDGIID  284

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK  G LVLVGAPDKP++     LI G++TV GS IG M+ETQEM+
Sbjct  285   TVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSIGGMKETQEMI  344

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAK DV+YRFVID+A
Sbjct  345   DFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIA  385



>ref|XP_007047730.1| Geraniol dehydrogenase 1 [Theobroma cacao]
 gb|EOX91887.1| Geraniol dehydrogenase 1 [Theobroma cacao]
Length=365

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 243/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D+SG + P+ F RR     DV  K+LYCGICHSDLH  KN+WG ++YP+
Sbjct  11    HPKEAIGWAARDASGHLSPFKFYRRATAEKDVAFKVLYCGICHSDLHSIKNEWGMSIYPL  70

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G VT VGS V  F +GDRVGVGC+  SC   + C  + ENYC  + LTY G +
Sbjct  71    LPGHEIIGEVTEVGSEVAKFNVGDRVGVGCLVGSCRSFDNCANNLENYCPQMILTYAGEY  130

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DGSITYGGYS   VAD  FVV +P++LP+D AAPLLCAG+ ++ PL+   L   PG   
Sbjct  131   YDGSITYGGYSNTMVADEHFVVGIPDNLPLDAAAPLLCAGIAVYSPLRYYGL-DKPGLHA  189

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+ GLGHL VKF KA G  VTVISTSP+K+KEA E LGAD F++S    Q+QA   +
Sbjct  190   GVVGLSGLGHLAVKFAKAMGAKVTVISTSPNKKKEAIENLGADSFLISGQQDQLQAAMGT  249

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA HSL P + LLK +  L+L+G PDKP++   FPLI G++ V  S IG M+
Sbjct  250   MDGIIDTVSAPHSLLPLIGLLKSHAKLILLGVPDKPLELPVFPLILGRKAVAASAIGGMQ  309

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM+N  A+ ++  DIE I  D +N+A +RLAK DVKYRFVID+ 
Sbjct  310   ETQEMINFAAQHDLKPDIEVIPVDYVNIAMERLAKGDVKYRFVIDIG  356



>gb|KDP29760.1| hypothetical protein JCGZ_18695 [Jatropha curcas]
Length=362

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 249/353 (71%), Gaps = 1/353 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D +G + P+ F RR  G  DV  K+LYCG+CHSDLH+ KN+WG + YP+
Sbjct  10    HPNQSFGWAARDQTGHLSPFKFSRRATGEKDVAFKVLYCGMCHSDLHMVKNEWGFSTYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VTVVGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY   +
Sbjct  70    VPGHEIVGVVTVVGSKVEKFKVGDKVGVGCMVGSCRSCDNCTNNLENYCPEMILTYGAKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS   V D  FVV +P+ LP+D AAPLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTTTYGGYSDSMVVDEHFVVRIPDVLPLDAAAPLLCAGITVYSPLRYYGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVISTSP+K++EA +RLGAD F++S D  +++A   +
Sbjct  189   GVVGLGGLGHMAVKFAKAMGVKVTVISTSPAKKQEAVDRLGADSFLVSRDQDEIKAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LVLVGAP+KP++   FPL+ G++ V GS IG M+
Sbjct  249   MDGIIDTVSAMHPLLPLIGLLKSSGKLVLVGAPEKPLELPVFPLLMGRKLVGGSGIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTSS  1114
             ETQEM++  AK  I  DIE I  + +N A DR+ K DV+YRFVID+A    S+
Sbjct  309   ETQEMVDFAAKNGITPDIEVIPIEYVNTAMDRMLKADVRYRFVIDIANTIMST  361



>ref|XP_010680373.1| PREDICTED: probable mannitol dehydrogenase [Beta vulgaris subsp. 
vulgaris]
Length=361

 Score =   366 bits (940),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 240/347 (69%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D+SG + P+ F RR  G  DVT K+LY GICHSDLH  KN+WG   YP 
Sbjct  9     HPQKAFGWAARDTSGVLSPFNFSRRATGEQDVTFKVLYVGICHSDLHFVKNEWGNASYPA  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G VT VG  V  FK+GD+VGVGCM  SC  C+ C ++ ENYC  + LTY   +
Sbjct  69    VPGHEIVGEVTEVGKKVQKFKVGDKVGVGCMVGSCRSCDNCDKNLENYCSKMLLTYGSTY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS + V D  F V +P ++ +D  APLLCAG+T++ PLK   L   PG  I
Sbjct  129   YDGTMTYGGYSNIMVVDEHFAVLIPNNMALDATAPLLCAGITVYSPLKYFGL-DKPGLHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  V VISTSPSK+ EA  RLGAD F++S D  Q+QA   S
Sbjct  188   GVVGLGGLGHMAVKFAKAFGVKVMVISTSPSKKDEAINRLGADSFLVSRDPDQIQAAVGS  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTV+A H L P + +LK  G LVLVGAPDKP++   FPLI G++ V GS IG M 
Sbjct  248   LDAIIDTVAAVHPLLPLISMLKTEGKLVLVGAPDKPLELPAFPLILGRKMVVGSGIGGMN  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM+N  AK +I  DIE I  D +N A +R+ K DV+YRFVID+A
Sbjct  308   ETQEMINFAAKHDIKSDIEVIPMDYVNTAMERVLKADVRYRFVIDIA  354



>ref|XP_008460921.1| PREDICTED: probable mannitol dehydrogenase [Cucumis melo]
Length=358

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 247/348 (71%), Gaps = 3/348 (1%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             LTH     GWAA DSSG + P+ F RRENG +DV+IK+LYCG+CHSDLH+ KNDWG+T Y
Sbjct  9     LTHKAF--GWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWGSTDY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI G+VT VG NV  FK GD VGVG +  SC  CE CKQ  E+YC  ++ TYN 
Sbjct  67    PIVPGHEIVGVVTSVGKNVKRFKAGDEVGVGVIVGSCRNCENCKQDLESYCPKMEYTYNS  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
                DG+  YGGYS   V D  FVV  P++L +D  APLLCAG+T++ P+K   +   PGK
Sbjct  127   PGVDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMT-EPGK  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
              +G+ G+GGLGH+ VKFGKAFG  VTVISTS  K++EA +RLGAD F++STD  Q++A  
Sbjct  186   HLGVAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSTDPEQLKAAM  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D+ILDT+SA H L P + LL +NG LV VG P+KP++     L SG+R V GS  G 
Sbjct  246   GTMDYILDTISAVHPLDPLISLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGSNFGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             ++ETQEML+ C K NI  +IE I  D IN A +RLAK DVKYRFVID+
Sbjct  306   LKETQEMLDFCGKHNITAEIELIKMDDINSAMERLAKADVKYRFVIDI  353



>ref|XP_011025422.1| PREDICTED: probable mannitol dehydrogenase [Populus euphratica]
Length=376

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 244/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P  F RR  G  DV +K+L+CGICH+DLH+AKN+WGT+ YP+VPGHEI
Sbjct  32    GWAARDQSGVLSPLRFSRRSMGEKDVRLKVLFCGICHTDLHMAKNEWGTSTYPLVPGHEI  91

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V  F++GD+VGVG M  SC  C+ C  + ENYC  + +TY   + DG+ T
Sbjct  92    VGQVTGVGSKVEKFRVGDKVGVGGMIGSCHSCDSCSNNLENYCSEVIITYGAKYQDGTTT  151

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + V D  F+VH+P++L +D AAPLLCAG+T+F PL+   L   PG  +G++G+G
Sbjct  152   YGGYSDIMVVDEHFIVHIPDNLSLDAAAPLLCAGITVFSPLRFYGL-DKPGMHVGVVGLG  210

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K++EA E LGAD F++S D  QMQA   ++D ++D
Sbjct  211   GLGHVAVKFAKAMGVKVTVISTSPNKKQEALEHLGADSFLVSRDQGQMQAATGTMDGVID  270

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P + LLK  G LVLVGAP+KP++   FPLI G++ V GS  G M+ETQEM+
Sbjct  271   TVSAIHPILPLISLLKTQGKLVLVGAPEKPLELPVFPLIVGRKIVGGSAGGGMQETQEMI  330

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RL K DV+YRFVID+ 
Sbjct  331   DFAAKNNITADIELISMDYVNTAMERLLKTDVRYRFVIDIG  371



>gb|KDP29800.1| hypothetical protein JCGZ_18735 [Jatropha curcas]
Length=362

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/353 (54%), Positives = 250/353 (71%), Gaps = 3/353 (1%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D +G + P+ F RR  G  DV  K+LYCG+CHSDLH+ KN+WG++ YP+
Sbjct  10    HPKPAFGWAARDQTGHLSPFKFSRRATGEKDVAFKVLYCGMCHSDLHMLKNEWGSSTYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC  + LTY   +
Sbjct  70    VPGHEIVGVVTEVGSQVEKFKVGDKVGVGCMVGSCRSCDNCTNNLENYCPQMILTYGVKY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS    AD  F+V +P+ LP+D AAPLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTTTYGGYSDSMGADEHFIVRIPDGLPLDAAAPLLCAGITVYSPLRYYGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKFGKA G  VTVISTSP K++EA  RLGAD F++S D  Q++A   +
Sbjct  189   GVVGLGGLGHMAVKFGKAMGVKVTVISTSPHKKEEAIGRLGADSFLVSRDQDQIKAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G +VLVGAP+KP+D   FPLI G++ V GS IG M+
Sbjct  249   MDGIIDTVSATHPLYPLIGLLKSHGKIVLVGAPEKPLDLPVFPLIMGRKIVGGSCIGGMK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAG--NPT  1108
             ETQEM++  A+  I  D+E I  D +N A +RL K DV+YRFVID+A   NPT
Sbjct  309   ETQEMIDFAAEHGIRADVEVIGIDYVNTALERLLKADVRYRFVIDVANTINPT  361



>gb|AFY63473.1| geraniol dehydrogenase [Perilla citriodora]
Length=360

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 246/354 (69%), Gaps = 2/354 (1%)
 Frame = +2

Query  35    MAATTLTHTQVVS-GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND  211
             MA T  T   V + GWAA D+SG + P+ F RR+ G  DV  K+LYCG+CHS LH+ KN+
Sbjct  1     MAKTPETEHPVKAFGWAARDNSGTLSPFNFSRRDTGERDVQFKVLYCGVCHSGLHMVKNE  60

Query  212   WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNI  391
             WG T YPVVPGHEI G+VT VGS V   K GD+VGVG +  SC +C+ C    ENYC   
Sbjct  61    WGVTHYPVVPGHEIVGVVTEVGSKVEKVKAGDKVGVGVIVGSCRQCDQCSNDLENYCSKQ  120

Query  392   QLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNL  571
              LTY   + DG+IT GGYS + VAD  F++  PE+LP+D  APLLCAG+T + PL+   L
Sbjct  121   ILTYGAPYIDGTITRGGYSNIMVADEHFIIRWPENLPLDAGAPLLCAGITTYSPLRYYGL  180

Query  572   VGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAH  751
                PG  +G+ G+GGLGH+ VKF KAFG  VTVISTS  K+KEA E LG DEF++S+D  
Sbjct  181   -DKPGLSVGVNGLGGLGHVAVKFAKAFGTKVTVISTSLGKKKEAIEHLGVDEFLVSSDPQ  239

Query  752   QMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVK  931
             QMQA   ++D I+DTVSA H L P + LLK +G L++VGAP+KP+    F LI G++TV 
Sbjct  240   QMQAAVGTLDGIIDTVSAEHPLVPLMSLLKPHGKLIVVGAPEKPLQLHAFSLIQGRKTVA  299

Query  932   GSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             GS IG M+ETQEM++  AK NI+ D+E I  D IN A DRL K+DVKYRFVID+
Sbjct  300   GSAIGGMKETQEMIDFAAKKNIIPDVEVIPIDYINTAMDRLLKSDVKYRFVIDV  353



>ref|XP_010027970.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
 gb|KCW54623.1| hypothetical protein EUGRSUZ_I00570 [Eucalyptus grandis]
Length=360

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 244/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H Q   GWAA D SG + P+ F RR  G  DV  K+ +CGICHSDLH  +N+WG + YP+
Sbjct  9     HPQAAFGWAARDPSGLLSPFKFSRRTTGEKDVKFKVFFCGICHSDLHSVRNEWGFSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G V  VGS V  FK GD+VGVGC+  SC  C+ C    ENYC  + LTY  ++
Sbjct  69    VPGHEIVGEVVEVGSKVEKFKAGDKVGVGCLVGSCGSCDSCHDQLENYCPKMILTYGAMY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG++T+GGYS + V D  F +  P+++P+D  APLLCAG+T++ P+K   L  HPG  +
Sbjct  129   HDGTMTHGGYSNMMVVDEHFAIKFPQNMPLDAGAPLLCAGITVYSPMKFFGL-DHPGIHL  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KA G  VTVIS+SP K++EA +RLGAD F++S+D +Q+QA   +
Sbjct  188   GLVGLGGLGHVAVKFAKAMGVKVTVISSSPGKREEALQRLGADAFLISSDTNQVQAAMGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H + P + LLK NG LVLVGAPD+P++   FPLI G++ V GS IG ++
Sbjct  248   MDGIIDTVSAVHPILPLIGLLKQNGKLVLVGAPDRPLELPVFPLIFGRKIVAGSCIGGIQ  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  AK  I  DIE I+ D +N A DRLAK DVKYRFVID+ 
Sbjct  308   ETQEMIDFAAKHKITADIEVISIDYVNTAMDRLAKGDVKYRFVIDIG  354



>gb|EYU24070.1| hypothetical protein MIMGU_mgv1a009042mg [Erythranthe guttata]
Length=355

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 247/345 (72%), Gaps = 1/345 (0%)
 Frame = +2

Query  62    QVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVP  241
             Q   G AA D+SG + P+ F RRENGA+DVT+KILYCGICHSDLH A N+WG T YP+VP
Sbjct  6     QKAFGLAATDTSGVLSPFNFSRRENGADDVTVKILYCGICHSDLHSATNEWGFTKYPIVP  65

Query  242   GHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWD  421
             GHE+ G V   G NV  FK+GDRVGVG +  SC +C+ C+Q  ENYC  + LTYN    D
Sbjct  66    GHEMVGEVIKTGENVEKFKVGDRVGVGVLVGSCKKCDLCEQDLENYCPELILTYNNTDRD  125

Query  422   GSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigi  601
             G++TYGG+S + V D  FV+  P++LP    APLLCAG+T++ P+K   +   PGK +G+
Sbjct  126   GTMTYGGFSDIIVVDQHFVLRFPDNLPSAGGAPLLCAGITVYSPMKYYGMT-EPGKHLGV  184

Query  602   igmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSID  781
              G+GGLGH+ VK GKAFG  VTVISTSP K+ EA E LGAD+F++S+D  Q++A   ++D
Sbjct  185   AGLGGLGHIAVKLGKAFGLKVTVISTSPKKKAEAIENLGADDFLVSSDPVQLKAATGTMD  244

Query  782   FILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEET  961
             FI+DT++  H L P+L+LLKVNG L+ VG PDKP++   FPL+ G++ V GS  G M+E 
Sbjct  245   FIIDTIAVMHHLTPFLDLLKVNGKLITVGLPDKPLELAIFPLVLGRKLVGGSNNGGMKEV  304

Query  962   QEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             QEML+ C +  +  D+E I  D +N A +RLAK DV+YRFVID+A
Sbjct  305   QEMLDFCGEHGVTADVEVIRMDYVNTAMERLAKADVRYRFVIDVA  349



>ref|XP_007206542.1| hypothetical protein PRUPE_ppa018829mg [Prunus persica]
 gb|EMJ07741.1| hypothetical protein PRUPE_ppa018829mg [Prunus persica]
Length=364

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 250/357 (70%), Gaps = 6/357 (2%)
 Frame = +2

Query  41    ATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKND---  211
             +T   H +   GWAA DSSG + P+ F RRE G  DVT K+ YCGICHSDLH+ KN+   
Sbjct  2     STEQEHPKKAFGWAARDSSGVLSPFNFSRRETGEKDVTFKVAYCGICHSDLHLIKNELES  61

Query  212   --WGTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCK  385
               WG + YP+VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C  + ENYC 
Sbjct  62    TEWGASTYPLVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCMVGSCHSCDNCANNLENYCP  121

Query  386   NIQLTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDN  565
                 T+ G + DG+ TYGGYS + VAD  FVV++P++LP+D AAPLLCAG+T + PL+  
Sbjct  122   RWIPTFGGKYHDGTTTYGGYSDIMVADEHFVVNIPDNLPLDGAAPLLCAGITTYSPLRYF  181

Query  566   NLVGHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTD  745
              L   PG  +G+ G+GGLGH+ VKF KA G  VTVISTSP K++EA + L AD F++S D
Sbjct  182   GL-DKPGMHVGVAGLGGLGHVAVKFAKAMGVKVTVISTSPGKEEEAIKHLHADLFLVSRD  240

Query  746   AHQMQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRT  925
               QMQA   ++D I+DTVSANH L PY++LLK +G LV+VGAP+K  +   FPL+ G++ 
Sbjct  241   EDQMQAAMGTMDGIIDTVSANHPLLPYIDLLKSHGKLVMVGAPEKRPELPVFPLLMGRKI  300

Query  926   VKGSVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             V GS +G M+ETQEM++  AK N+  DIE I  D +N A +RLAK DV+YRFVID+ 
Sbjct  301   VAGSCVGGMKETQEMIDFAAKHNVTADIEVIPIDYVNTAMERLAKTDVRYRFVIDIG  357



>ref|XP_002868956.1| hypothetical protein ARALYDRAFT_490819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45215.1| hypothetical protein ARALYDRAFT_490819 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/341 (55%), Positives = 248/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RR+ G  +V +K+LYCGICHSDLH  KN+W ++ YP+VPGHEI
Sbjct  16    GWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSTYPLVPGHEI  75

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G V+ +GS V+ F +GD+VGVGC+  SC  C+ C++ QENYC     TYNG+  DG+I 
Sbjct  76    VGEVSEIGSKVSKFNLGDKVGVGCIIDSCRTCQSCREDQENYCTKAVATYNGVHHDGTIN  135

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   V D R+ V +P +LP+  AAPLLCAG++M+ P+K   L G P K IGI+G+G
Sbjct  136   YGGYSDHIVVDERYAVKIPHTLPLASAAPLLCAGISMYSPMKYFGLAG-PDKHIGIVGLG  194

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+GV+F KAFG  VTVIS++  K K+A E LGAD F++STD  QM+A   ++D I+D
Sbjct  195   GLGHIGVRFAKAFGTKVTVISSTTGKSKDALETLGADGFLVSTDEDQMKAATGTMDGIID  254

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA+HS+ P + LLK NG LVL+GA +KP D   F LI G++++ GS IG M+ETQEM+
Sbjct  255   TVSASHSISPLIGLLKSNGKLVLLGATEKPFDISAFSLILGRKSIAGSGIGGMKETQEMI  314

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  A+  I  +IE I+ D +N A DRLAK DV+YRFVID+A
Sbjct  315   DFAAEHGIKAEIEIISMDYVNTAIDRLAKGDVRYRFVIDIA  355



>ref|XP_006466347.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Citrus sinensis]
Length=362

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 245/341 (72%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RRE G  DV +K+LYCGICH+DL   KN+WG +++P+VPGHEI
Sbjct  15    GWAARDSSGHLSPFNFSRRETGDEDVRLKVLYCGICHTDLANIKNEWGFSLFPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT VGS V   K+GD+VGVGCM  +C  CE C    ENYC  + LTY+ I  DG+IT
Sbjct  75    AGEVTEVGSKVRKVKVGDKVGVGCMVGACHSCESCANDLENYCPKMILTYSSINTDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS   VA+ R++V  P+S+P+D AAPLLCAG+T++ PLK   L    GK +GI+G+G
Sbjct  135   FGGYSDHMVANERYIVRFPDSMPLDAAAPLLCAGITVYSPLKYFGL-AEQGKHVGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTSPSK+ EA E LGAD F+ S D  Q+Q    ++D I+D
Sbjct  194   GLGHVAVKFAKAFGAKVTVISTSPSKKTEALEHLGADSFLNSRDPDQLQGAMGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK  G LVLVGAPDKP++     LI G++TV GS IG M+ETQEM+
Sbjct  254   TVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSIGGMKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  DIE I+ D +N A +RLAK DV+YRFVID+A
Sbjct  314   DFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIA  354



>ref|NP_001064659.2| Os10g0430200 [Oryza sativa Japonica Group]
 sp|Q337Y2.1|CADH3_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase 3; Short=OsCAD3 
[Oryza sativa Japonica Group]
 gb|ABB47655.1| mannitol dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ16157.1| hypothetical protein OsJ_31603 [Oryza sativa Japonica Group]
 dbj|BAG91230.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93975.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF26573.2| Os10g0430200 [Oryza sativa Japonica Group]
Length=366

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 245/345 (71%), Gaps = 1/345 (0%)
 Frame = +2

Query  62    QVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVP  241
             Q   G AA DSSG + P+   RR  G +DV IKIL+CGICHSDLH  KN+W  ++YP+VP
Sbjct  14    QQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCIKNEWKHSIYPLVP  73

Query  242   GHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWD  421
             GHEI G+VT VG NVT FK GDRVGVGCM  SC  CE C    EN+C     TYN +  D
Sbjct  74    GHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHCPEGVFTYNSVDKD  133

Query  422   GSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigi  601
             G++TYGGYS + V   RFVV  PE++P+D  APLLCAG+T++ P+K + L   PGK +G+
Sbjct  134   GTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKYHGL-NAPGKHVGV  192

Query  602   igmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSID  781
             +G+GGLGH+ VKF +AFG  VTVIS+SP K++EA ERLGAD F++S+ A +M+A + ++D
Sbjct  193   LGLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSSAEEMEAARSTMD  252

Query  782   FILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEET  961
              +++TVSAN  + PYL LLK NG ++LVG P+ P++   F L+ G RT+ GS IG M +T
Sbjct  253   GVINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRTLAGSNIGGMADT  312

Query  962   QEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             QEM+ + AK  +  DIE I  D +N A +RLAK DV+YRFVID+ 
Sbjct  313   QEMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVG  357



>sp|Q2KNL6.1|GEDH1_OCIBA RecName: Full=Geraniol dehydrogenase 1; Short=ObaGEDH1 [Ocimum 
basilicum]
 gb|AAX83107.1| geraniol dehydrogenase [Ocimum basilicum]
Length=360

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 240/340 (71%), Gaps = 1/340 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG   P+ F RR  G  DV  ++LYCG+CHSDLH+ KN+WG T YP+VPGHEI
Sbjct  15    GWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              GIVT VGS V   KIGD+VGVG +  SC +C+ C    ENYC    LTY   + DG+I 
Sbjct  75    VGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIA  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + VAD  F++  PE+ P+D  APLLCAG+T + PLK   L   PG R+G+ G+G
Sbjct  135   RGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGL-DKPGLRVGVNGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTS SK++EA + LG DEF++STD  QMQA   ++D I+D
Sbjct  194   GLGHVAVKFAKAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H + P L LLK +G L++VG PDKP+    FPLI G+RT+ GS IG ++ETQEM+
Sbjct  254   TVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGRRTIAGSGIGGLKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
             +  AK NI+ D+E I  D IN A DRL K+DVKYRFVID+
Sbjct  314   DFAAKNNIVADVEVIPIDYINTAMDRLLKSDVKYRFVIDV  353



>ref|XP_010056832.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
 gb|KCW73708.1| hypothetical protein EUGRSUZ_E02319 [Eucalyptus grandis]
Length=360

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 248/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RR     DVT K+LYCGICHSDLH  KN+WG T YPV+PGHEI
Sbjct  15    GWAARDSSGHLSPFKFSRRATQEKDVTFKVLYCGICHSDLHNVKNEWGITSYPVIPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+ VT FK+GD+VGVGCM  SC  C  CK + ENYC  + LTY   ++DG+IT
Sbjct  75    VGVVTEVGAKVTKFKVGDKVGVGCMVGSCRSCANCKDNLENYCPKMILTYGTKYYDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS + V D  F + +P++LP+D +A +LCAG+T++ PLK   L    G  +G++G+G
Sbjct  135   HGGYSDIMVLDEHFGIKIPDNLPLDGSALILCAGITVYSPLKYYGL-DKAGMHLGVVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KA G  VTVISTSP+K+KEA E LGADEF++S +  +MQ    ++D I+D
Sbjct  194   GLGHMAVKFAKAMGLKVTVISTSPNKKKEAMEHLGADEFLVSRNTEEMQFAMDTMDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA HSL P + LLK NG LV+VGAP+KP++    PL+ G++ V GS IG ++ETQEM+
Sbjct  254   TVSAVHSLLPLIGLLKNNGKLVMVGAPEKPLELPIMPLLLGRKIVGGSNIGGIKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI+ DIE I  D +N A +RL+K DVKYRFVID+A
Sbjct  314   DFAAKHNIVADIEVIPMDYVNTAMERLSKADVKYRFVIDIA  354



>ref|XP_003635435.1| PREDICTED: probable mannitol dehydrogenase [Vitis vinifera]
 emb|CBI18801.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 243/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H     GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+ KN+WG + YP+
Sbjct  9     HPTKAFGWAASDPSGVLSPFKFSRRATGEKDVRFKVLYCGICHSDLHMLKNEWGFSTYPL  68

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI GIVT VGS V   K+GD+VGVGC+  +C  C+ C    ENYC    LTY   +
Sbjct  69    VPGHEIVGIVTEVGSKVEKLKVGDKVGVGCLVGACHSCDNCANDLENYCPKNILTYGATY  128

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG+ TYGGYS + VA+ R+VV  PE+LP+D  APLLCAG+T++ PL+       PG  I
Sbjct  129   YDGTTTYGGYSDVMVAEERYVVRFPENLPLDAGAPLLCAGITVYSPLQHFGFT-KPGMHI  187

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTS SK+KEA E LGAD F++S D  QMQA   +
Sbjct  188   GVVGLGGLGHVAVKFAKAFGVKVTVISTSTSKKKEATEHLGADSFLVSRDPDQMQAALGT  247

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P ++LLK +G LV+VGAP++P++   FPL+ G++ V GS IG M+
Sbjct  248   MDGIIDTVSAVHPLLPLIDLLKSHGKLVMVGAPNRPLELPIFPLLMGRKIVAGSNIGGMK  307

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++   K NI  D+E +  D +N A +RL K DV+YRFVID+ 
Sbjct  308   ETQEMIDFAGKHNITADVEVVPMDYVNTALERLEKADVRYRFVIDIG  354



>ref|NP_001241491.1| uncharacterized protein LOC100819684 [Glycine max]
 gb|ACU18344.1| unknown [Glycine max]
 gb|KHN34042.1| Putative mannitol dehydrogenase [Glycine soja]
Length=360

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 256/343 (75%), Gaps = 1/343 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RRENG +DVT+KIL+CG+CHSDLH  KNDWG T YPVVPGHEI
Sbjct  15    GWAASDTSGTLAPFHFSRRENGVDDVTLKILFCGVCHSDLHTLKNDWGFTTYPVVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+NV NFK+GD+VGVG +  SC ECE C+Q  E+YC     TYN  ++DG+ T
Sbjct  75    VGVVTKVGNNVKNFKVGDKVGVGVIVESCKECESCQQDLESYCPRPVFTYNSPYYDGTRT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V   R+V+  PE+LP+D  APLLCAG+T++ P+K   +   PGK +G+ G+G
Sbjct  135   KGGYSNIMVVHQRYVLRFPENLPLDAGAPLLCAGITVYSPMKYYGMT-EPGKHLGVAGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ +K  KAFG  VTVIS+SP+KQ EA +RLGAD F++S+D  +M+    ++D+I+D
Sbjct  194   GLGHVAIKLAKAFGLKVTVISSSPNKQAEAIDRLGADSFLVSSDPAKMKVALGTMDYIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             T+SA HSL P L LLK+NG LV VG P+KP++   FPL++G++ + GS  G ++ETQEML
Sbjct  254   TISAVHSLIPLLGLLKLNGKLVTVGLPNKPLELPIFPLVAGRKLIGGSNFGGIKETQEML  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             + CAK NI  DIE I  D+IN A +RL+K DVKYRFVID+A +
Sbjct  314   DFCAKHNITADIELIKMDQINTAMERLSKADVKYRFVIDVANS  356



>ref|XP_009801633.1| PREDICTED: 8-hydroxygeraniol dehydrogenase-like [Nicotiana sylvestris]
Length=359

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 247/341 (72%), Gaps = 2/341 (1%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RR  G  DV  K++YCGICHSDLH  KN+W  ++YP+VPGHEI
Sbjct  15    GWAARDTSGILSPFNFSRRATGKKDVQFKVMYCGICHSDLHQLKNEWSNSIYPMVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VGS V  FK+GD+VGVG    SC +CE C  + ENYC    +T NG + DG+IT
Sbjct  75    VGVVTEVGSKVEKFKVGDKVGVGYFVESCRKCENCSNNLENYCPGQIMTTNGTYSDGTIT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + ++D  +VVH P++LPM +AAPLLCAG+T + PLK   L   PG  IG++G+G
Sbjct  135   YGGYSDIMISDEHYVVHWPDNLPM-KAAPLLCAGITTYSPLKYFGL-DKPGMHIGVVGLG  192

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VKF KAFG  VTVISTS SK++EA ERLGAD F++S D  QMQA   S+D I+D
Sbjct  193   GLGHMAVKFAKAFGTKVTVISTSTSKKQEAIERLGADSFLVSRDPDQMQAATGSLDGIID  252

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P + LLK +G LV+VGAP+KP++   FPL+ G++ V GS IG ++ETQEM+
Sbjct  253   TVSAIHPLLPLINLLKTHGKLVMVGAPEKPLELPVFPLLLGRKLVAGSAIGGIKETQEMV  312

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  AK NI  D+E +  D +N A DRL K+DVKYRFV+D+ 
Sbjct  313   DFAAKHNITPDVEVVPMDYVNRALDRLLKSDVKYRFVLDVG  353



>ref|NP_001241232.1| uncharacterized protein LOC100795575 [Glycine max]
 gb|ACU19058.1| unknown [Glycine max]
 gb|KHN29145.1| Putative mannitol dehydrogenase [Glycine soja]
Length=356

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 258/346 (75%), Gaps = 1/346 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D+SG + P+ F RRENG +DVT+KIL+CG+CHSDLH  KNDWG T YPVVPGHEI
Sbjct  11    GWAASDTSGTLAPFHFSRRENGVDDVTLKILFCGVCHSDLHTLKNDWGFTTYPVVPGHEI  70

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+NV NFK+GD+VGVG +  SC ECE C+Q  ENYC     TYN  ++DG+ T
Sbjct  71    VGVVTEVGNNVKNFKVGDKVGVGVIVESCKECENCQQDLENYCPRPVFTYNSPYYDGTRT  130

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
              GGYS + V   R+V+  PE+LP+D  APLLCAG+T++ P+K   +   PGK +G+ G+G
Sbjct  131   QGGYSNIVVVHQRYVLRFPENLPLDAGAPLLCAGITVYSPMKYYGMT-EPGKHLGVAGLG  189

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ +K  KAFG  VTVIS+SP+KQ EA +RLGAD F++S+D  +M+A   ++D+I+D
Sbjct  190   GLGHVAIKLAKAFGLKVTVISSSPNKQAEAIDRLGADFFLVSSDPAKMKAALGTMDYIID  249

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             T+SA HSL P L LLK+NG LV VG P+KP++   FPL++G++ + GS  G ++ETQEML
Sbjct  250   TISAVHSLIPLLGLLKLNGKLVTVGLPNKPLELPIFPLVAGRKLIGGSNFGGLKETQEML  309

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGNPTS  1111
             + C K NI  DIE I  D+IN A +RL++ DVKYRFVID+A + +S
Sbjct  310   DFCGKHNITADIELIKMDQINTAMERLSRADVKYRFVIDVASSFSS  355



>ref|XP_010054512.1| PREDICTED: probable mannitol dehydrogenase [Eucalyptus grandis]
Length=407

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/341 (55%), Positives = 248/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D++G + P+ F RR  G NDVT K+LYCGICHSDLH  KN+WG T YPVVPGHEI
Sbjct  62    GWAARDTTGHLSPFRFSRRATGENDVTFKVLYCGICHSDLHNIKNEWGITSYPVVPGHEI  121

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G+VT VG+ VT FK+GD+VGVGCM  SC  C  CK+  ENYC  + LTY   ++DG+ T
Sbjct  122   VGMVTDVGTKVTKFKVGDKVGVGCMVGSCRSCANCKEDLENYCPEMILTYGAKYYDGTTT  181

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             +GGYS + V+D   V+ +P++LP+D +APLLCAG+T++ PLK   L    G  +G++G+G
Sbjct  182   HGGYSDIMVSDEHSVIKIPDNLPLDGSAPLLCAGITVYSPLKYYGL-DKAGMHLGVVGLG  240

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GL H+ VKF KA G  VTVISTSP+K+KEA +RLGAD F++S    +M     ++D I+D
Sbjct  241   GLEHMAVKFAKAMGLKVTVISTSPNKKKEAMDRLGADAFLVSRSTEEMGLAMGTMDGIID  300

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             T SA H+L P + LLKVNG LV+VGAP+KP + L FPL+ G++ V  S IG ++ETQEM+
Sbjct  301   TASAVHALLPVIGLLKVNGKLVMVGAPEKPPEPLAFPLLIGRKMVGESAIGGIKETQEMI  360

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             +  A+ NI+ DIE I  D +N A +RL+K DVKYRFVID+A
Sbjct  361   DFAAEHNIVADIELIPMDYVNTAMERLSKADVKYRFVIDIA  401



>ref|XP_004171787.1| PREDICTED: probable mannitol dehydrogenase-like [Cucumis sativus]
Length=358

 Score =   364 bits (934),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 248/352 (70%), Gaps = 3/352 (1%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             +   LTH     GWAA DSSG + P+ F RRENG +DV+IK+LYCG+CHSDLH+ KNDWG
Sbjct  5     SGNELTHKAF--GWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWG  62

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
             +T YPVVPGHEI G+VT VG NV  FK GD VGVG +  SC  CE CKQ  E+YC  ++ 
Sbjct  63    STDYPVVPGHEIVGVVTSVGKNVKKFKAGDEVGVGVIVGSCRSCENCKQDLESYCPKMEY  122

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TYN    DG+  YGGYS   V D  FVV  P++L +D  APLLCAG+T++ P+K   +  
Sbjct  123   TYNSPGVDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMT-  181

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
              PGK +G+ G+GGLGH+ VKFGKAFG  VTVISTS  K++EA +RLGAD F++S+D  Q+
Sbjct  182   EPGKHLGVAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSSDPEQL  241

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             +A   ++D+ILDT+SA H L P + LL +NG LV VG P+KP++     L SG+R V GS
Sbjct  242   KAAMGTMDYILDTISAVHPLDPLIRLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGS  301

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
               G ++ETQEML+ C K NI  +IE I  + IN A +RLAK DVKYRFVID+
Sbjct  302   NFGGLKETQEMLDFCGKHNITAEIELIKMNDINSAMERLAKADVKYRFVIDI  353



>ref|XP_004151454.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9-like [Cucumis 
sativus]
 gb|KGN62126.1| hypothetical protein Csa_2G300950 [Cucumis sativus]
Length=358

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 248/352 (70%), Gaps = 3/352 (1%)
 Frame = +2

Query  38    AATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWG  217
             +   LTH     GWAA DSSG + P+ F RRENG +DV+IK+LYCG+CHSDLH+ KNDWG
Sbjct  5     SGNELTHKTF--GWAARDSSGLLSPFHFSRRENGDDDVSIKVLYCGVCHSDLHMLKNDWG  62

Query  218   TTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQL  397
             +T YPVVPGHEI G+VT VG NV  FK GD VGVG +  SC  CE CKQ  E+YC  ++ 
Sbjct  63    STDYPVVPGHEIVGVVTSVGKNVKKFKAGDEVGVGVIVGSCRSCENCKQDLESYCPKMEY  122

Query  398   TYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVG  577
             TYN    DG+  YGGYS   V D  FVV  P++L +D  APLLCAG+T++ P+K   +  
Sbjct  123   TYNSPGVDGTKNYGGYSDKIVVDQHFVVRFPKNLALDAGAPLLCAGITVYSPMKHFGMT-  181

Query  578   HPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQM  757
              PGK +G+ G+GGLGH+ VKFGKAFG  VTVISTS  K++EA +RLGAD F++S+D  Q+
Sbjct  182   EPGKHLGVAGLGGLGHVAVKFGKAFGLKVTVISTSSRKKEEAIDRLGADAFVVSSDPEQL  241

Query  758   QAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGS  937
             +A   ++D+ILDT+SA H L P + LL +NG LV VG P+KP++     L SG+R V GS
Sbjct  242   KAAMGTMDYILDTISAVHPLDPLIRLLNLNGKLVAVGLPNKPVELSIGILASGRRVVAGS  301

Query  938   VIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDM  1093
               G ++ETQEML+ C K NI  +IE I  + IN A +RLAK DVKYRFVID+
Sbjct  302   NFGGLKETQEMLDFCGKHNITAEIELIKMNDINSAMERLAKADVKYRFVIDI  353



>emb|CDX69347.1| BnaC01g01060D [Brassica napus]
Length=362

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 249/341 (73%), Gaps = 1/341 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA DSSG + P+ F RRE G  +V +K+LYCG+CHSDLH  KN+W +++YP+VPGHEI
Sbjct  15    GWAARDSSGHLSPFVFSRRETGEEEVRVKVLYCGLCHSDLHCLKNEWHSSIYPLVPGHEI  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G VT +G  V+ F IGD++GVGC+  SC  CE C++ QENYC     TYNG+ +DG++ 
Sbjct  75    VGEVTEIGRKVSKFSIGDKIGVGCVVDSCRACESCREDQENYCTKSVATYNGVHYDGTVN  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS   V D R+ V +P +LP+  AAPLLCAG++M+ P+K   L G PGK IGI+G+G
Sbjct  135   YGGYSDHIVVDERYAVKIPHTLPLASAAPLLCAGISMYSPMKYFGLAG-PGKHIGIVGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+GV+F KAFG  VTV+S++  K K+A E  GAD F++STD  QMQA   ++D I+D
Sbjct  194   GLGHIGVRFAKAFGSKVTVVSSTAGKSKDALEIFGADGFLVSTDEDQMQAAMGTMDGIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA+H + P + LLK +G LVL+GA +KP D   F LI G++++ GS IG ++ETQEM+
Sbjct  254   TVSASHPILPLIGLLKPSGKLVLLGATEKPFDLHAFSLILGRKSIAGSAIGGIKETQEMI  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             N  A+  I  +IETI+ + +N A DRLAK DV+YRFVID+A
Sbjct  314   NFAAEHGIKAEIETISMEYVNTAMDRLAKGDVRYRFVIDIA  354



>gb|AHX58273.1| cinnamyl alcohol dehydrogenase 7 [Populus tomentosa]
Length=362

 Score =   364 bits (934),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 243/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RR  G  DV  K+LYCGICHSDLH+ KN+WG T YP+
Sbjct  10    HPKPAFGWAARDQSGLLSPFKFSRRATGEKDVAFKVLYCGICHSDLHMVKNEWGATQYPL  69

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             +PGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C+ C+   ENYC    LTY   +
Sbjct  70    IPGHEIVGVVTEVGSEVEKFKVGDKVGVGCMVGSCRTCDSCQNDLENYCSKKILTYGARY  129

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
             +DG++TYGGYS   VAD  F+V +P++LP D  APLLCAG+T++ PL+   L   PG  +
Sbjct  130   YDGTVTYGGYSDSMVADEHFIVRIPDNLPPDAGAPLLCAGITVYSPLRYFGL-DKPGMHV  188

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             GI+G+GGLGH+ VKF +A G  VTVISTSP K++EA E LGAD F++S D  QMQA   +
Sbjct  189   GIVGLGGLGHVAVKFARAMGVKVTVISTSPDKKQEALENLGADSFLVSRDQDQMQAAMGT  248

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LVLVGAP+KP++    PLI G++TV GS  G ++
Sbjct  249   LDGIIDTVSAVHPLLPLVALLKSHGKLVLVGAPEKPLELPVSPLIIGRKTVGGSCFGGIK  308

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQEM++  A+  I  DIE I  D +N A +R+ K DV+YRFVID+ 
Sbjct  309   ETQEMIDFAAEHKITADIEVIPMDYVNTAMERVLKTDVRYRFVIDVG  355



>ref|XP_003612977.1| Cinnamyl alcohol dehydrogenase [Medicago truncatula]
 gb|AES95935.1| cinnamyl alcohol dehydrogenase-like protein [Medicago truncatula]
Length=361

 Score =   364 bits (934),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 247/349 (71%), Gaps = 1/349 (0%)
 Frame = +2

Query  50    LTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVY  229
             L H     GWAA D+SG + P+ F RRE G  DV  KILYCGICHSD+H+AKN+WG + Y
Sbjct  7     LEHPNKAFGWAARDTSGVLSPFNFSRRETGEKDVAFKILYCGICHSDVHMAKNEWGISTY  66

Query  230   PVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNG  409
             P+VPGHEI GIVT VGS V  F +GD+VGVG M  SC  C+ C  + ENYC     T   
Sbjct  67    PLVPGHEIVGIVTKVGSKVEKFNVGDKVGVGYMVDSCRSCQNCVDNLENYCPTFTFTCGA  126

Query  410   IFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgk  589
              + DG+ TYGGYS   VAD  FVVH+P+ LP++ AAPLLCAG+T++ PL+   L   PG 
Sbjct  127   KYRDGTSTYGGYSDSLVADENFVVHIPDGLPLEAAAPLLCAGITVYSPLRYYGL-DKPGL  185

Query  590   rigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKK  769
             RIG++G+GGLGH+ VKF KAFG  VTVISTSP+K+KEA E LGAD F++S D  +MQ+  
Sbjct  186   RIGVVGLGGLGHMAVKFAKAFGAIVTVISTSPNKEKEAIEHLGADSFLISRDQEKMQSAL  245

Query  770   RSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGS  949
              ++D I+DTVSANH + P + LLK +G LV+VG PDKP++   FPLI G++ V GS IG 
Sbjct  246   GTLDGIIDTVSANHPILPLIGLLKSHGKLVMVGVPDKPLEIPVFPLILGRKLVAGSNIGG  305

Query  950   MEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ++ETQEML+  AK ++  DIE +  D +N A +RL K DVKYRFV+D+ 
Sbjct  306   IKETQEMLDFAAKHSVKPDIEVVPVDYVNTAIERLLKADVKYRFVLDIG  354



>ref|XP_010025539.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 9 isoform 
X1 [Eucalyptus grandis]
 gb|KCW62241.1| hypothetical protein EUGRSUZ_H04903 [Eucalyptus grandis]
Length=359

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 197/343 (57%), Positives = 252/343 (73%), Gaps = 1/343 (0%)
 Frame = +2

Query  74    GWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPVVPGHEI  253
             GWAA D SG + P  F RRENG  DVTIKIL+CG+CHSDLHVAKN+WG T YPVVPGHE+
Sbjct  15    GWAARDKSGLLSPLCFSRRENGDEDVTIKILFCGVCHSDLHVAKNEWGFTNYPVVPGHEM  74

Query  254   TGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIFWDGSIT  433
              G V  VGS+V  FK+G+RVGVG +  SC +CE C+Q  ENYC     TYN  + DG+ T
Sbjct  75    VGTVMKVGSDVKKFKVGERVGVGVIVGSCKKCESCQQDLENYCPQTIFTYNSHYTDGTKT  134

Query  434   YGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkrigiigmg  613
             YGGYS + V D R+V+  P++LP++  APLLCAG+T++ P+K   +   PGK +G+ G+G
Sbjct  135   YGGYSDMIVVDERYVLRFPDNLPLEGGAPLLCAGITVYSPMKYYGMT-EPGKHLGVAGLG  193

Query  614   glghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRSIDFILD  793
             GLGH+ VK GKAFG  VTVIS+SP K+ EA ERLGAD F++++D  +M+A   ++D+I+D
Sbjct  194   GLGHVAVKMGKAFGLKVTVISSSPKKETEAIERLGADSFLVTSDPAKMKAALGTMDYIID  253

Query  794   TVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSMEETQEML  973
             TVSA H L P L LLK+NG LV VG PDKP++   FPL+ G++ V GS IG M+ETQEML
Sbjct  254   TVSAVHPLLPLLSLLKLNGKLVTVGLPDKPLELPIFPLVLGRKLVGGSDIGGMKETQEML  313

Query  974   NICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMAGN  1102
             + CAK  I  D+E I  D IN A +RLAK+DV+YRFVID+A +
Sbjct  314   DFCAKHGIAADVEVIQMDYINTAMERLAKSDVRYRFVIDVASS  356



>ref|XP_007158344.1| hypothetical protein PHAVU_002G144700g [Phaseolus vulgaris]
 gb|ESW30338.1| hypothetical protein PHAVU_002G144700g [Phaseolus vulgaris]
Length=358

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 243/347 (70%), Gaps = 1/347 (0%)
 Frame = +2

Query  56    HTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDWGTTVYPV  235
             H +   GWAA D SG + P+ F RRE G  DV  K+LYCGICHSDLH AKN+WGT+ YP+
Sbjct  6     HPRKAFGWAARDPSGLLTPFHFSRRETGEKDVAFKVLYCGICHSDLHFAKNEWGTSTYPL  65

Query  236   VPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQLTYNGIF  415
             VPGHEI G+VT VGS V  FK+GD+VGVGCM  SC  C  C  + ENYC    LTY+  +
Sbjct  66    VPGHEIAGVVTEVGSKVVKFKVGDKVGVGCMVDSCHTCLNCVDNLENYCPQYTLTYSAKY  125

Query  416   WDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLVGHPgkri  595
              DG+ITYGG+S   V D  FV+ +P+ LP++ AAPLLCAG+T+F PL+   L   PG  +
Sbjct  126   RDGTITYGGFSDSMVVDEHFVIRIPDGLPLEAAAPLLCAGITVFSPLRYFAL-DKPGLNV  184

Query  596   giigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQMQAKKRS  775
             G++G+GGLGH+ VKF KAFG  VTVISTSP+K+KEA + LGAD FI+S D  QMQA   +
Sbjct  185   GVVGLGGLGHMAVKFAKAFGAKVTVISTSPNKKKEAMQHLGADSFIISRDPDQMQAANGT  244

Query  776   IDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKGSVIGSME  955
             +D I+DTVSA H L P + LLK +G LV VGAP+KP++     LI G++ V GS IG M+
Sbjct  245   LDGIIDTVSAVHPLLPLIGLLKSHGKLVAVGAPEKPLELSIISLILGRKIVAGSKIGGMK  304

Query  956   ETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             ETQE+++     N+  DIE I  D +N A +RL K DVKYRFVID+ 
Sbjct  305   ETQEIMDFAVLHNVKPDIEIIPIDYVNTAMERLLKADVKYRFVIDIG  351



>gb|AFQ59973.1| nerol dehydrogenase [Persicaria minor]
Length=366

 Score =   364 bits (934),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 245/354 (69%), Gaps = 1/354 (0%)
 Frame = +2

Query  35    MAATTLTHTQVVSGWAAHDSSGKIVPYTFKRRENGANDVTIKILYCGICHSDLHVAKNDW  214
             M   T  HT    GWAA D SG + P+TF RR  G  DVT K+LYCGICHSDLH  KN+W
Sbjct  3     MGNGTEEHTVKAVGWAARDPSGHLSPFTFSRRATGELDVTFKVLYCGICHSDLHYIKNEW  62

Query  215   GTTVYPVVPGHEITGIVTVVGSNVTNFKIGDRVGVGCMAASCLECEFCKQSQENYCKNIQ  394
               T+YP +PGHEI G VT VGS V  FK+GD+VGVGC+  SC  C  C    ENYC N  
Sbjct  63    SNTIYPALPGHEIVGEVTEVGSKVNKFKVGDKVGVGCIVGSCHSCPNCNNHLENYCPNRI  122

Query  395   LTYNGIFWDGSITYGGYSKLHVADYRFVVHVPESLPMDRAAPLLCAGVTMFCPLKDNNLV  574
             LT+   ++DG++ +GGYS L V    F V +P++LP+D AAPLLCAG+T++ PL+   L 
Sbjct  123   LTFGSRYYDGTLNHGGYSDLMVVQEHFAVRIPDALPLDSAAPLLCAGITVYSPLRYYGL-  181

Query  575   GHPgkrigiigmgglghlgvkfgkAFGHHVTVISTSPSKQKEAKERLGADEFILSTDAHQ  754
               PG  +G++G+GGLGH+ VKF KAFG  VTV+STSP+K+++A   LGA  FILSTDA Q
Sbjct  182   DKPGLHVGVVGLGGLGHMAVKFAKAFGVKVTVVSTSPAKKEDAISGLGAHSFILSTDAEQ  241

Query  755   MQAKKRSIDFILDTVSANHSLGPYLELLKVNGTLVLVGAPDKPIDFLCFPLISGKRTVKG  934
             MQA   ++D I+DTVSA+H L P + LLK +G LV+VG P KP++   FPL+ G++ V G
Sbjct  242   MQAAVGTMDGIIDTVSASHPLPPLISLLKSHGKLVMVGDPPKPLELPVFPLLLGRKMVAG  301

Query  935   SVIGSMEETQEMLNICAKFNILCDIETITPDKINVAFDRLAKNDVKYRFVIDMA  1096
             S IG M+ETQEM++  AK  +  D+E I  D +N A  R++K+DVKYRFVID+ 
Sbjct  302   SAIGGMKETQEMIDFAAKEGVRADVEVIPMDYVNTAMQRVSKSDVKYRFVIDIG  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3699094222096