BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24622_g1_i5 len=667 path=[721:0-46 167:47-117 4581:118-120
4584:121-133 4796:134-134 4797:135-154 502:155-184 1836:185-213
911:214-247 1986:248-279 4096:280-282 2021:283-314 3994:315-321
2060:322-365 4472:366-368 2107:369-666]

Length=667
                                                                      Score     E

ref|XP_009802498.1|  PREDICTED: uncharacterized protein LOC104248...    230   2e-70   
emb|CAN65608.1|  hypothetical protein VITISV_042270                     225   2e-69   Vitis vinifera
ref|XP_004231860.1|  PREDICTED: uncharacterized protein LOC101267465    227   3e-69   
ref|XP_006339874.1|  PREDICTED: uncharacterized protein LOC102583668    227   4e-69   
ref|XP_003517309.1|  PREDICTED: uncharacterized protein LOC100800367    226   5e-69   
ref|XP_010270377.1|  PREDICTED: uncharacterized protein LOC104606...    224   2e-68   
ref|XP_003538809.1|  PREDICTED: uncharacterized protein LOC100809304    225   2e-68   
ref|XP_002278310.2|  PREDICTED: uncharacterized protein LOC100268130    225   2e-68   Vitis vinifera
ref|XP_010270372.1|  PREDICTED: uncharacterized protein LOC104606...    224   4e-68   
ref|XP_009613440.1|  PREDICTED: uncharacterized protein LOC104106574    224   6e-68   
ref|XP_007156781.1|  hypothetical protein PHAVU_002G017100g             222   3e-67   
ref|XP_008457752.1|  PREDICTED: uncharacterized protein LOC103497...    221   5e-67   
ref|XP_007047330.1|  Uncharacterized protein isoform 3                  216   2e-66   
ref|XP_007047331.1|  Uncharacterized protein isoform 4                  217   3e-66   
ref|XP_007047329.1|  Uncharacterized protein isoform 2                  218   3e-66   
ref|XP_011099112.1|  PREDICTED: uncharacterized protein LOC105177601    219   3e-66   
ref|XP_007047328.1|  Uncharacterized protein isoform 1                  219   3e-66   
ref|XP_004149691.1|  PREDICTED: uncharacterized protein LOC101209805    218   1e-65   
ref|XP_004494165.1|  PREDICTED: uncharacterized protein LOC101505098    216   7e-65   
ref|XP_008382289.1|  PREDICTED: uncharacterized protein LOC103445096    215   1e-64   
ref|XP_009367316.1|  PREDICTED: uncharacterized protein LOC103956982    215   1e-64   
ref|XP_009343278.1|  PREDICTED: uncharacterized protein LOC103935242    214   3e-64   
ref|XP_007042472.1|  Cyclin delta-3 isoform 3                           210   8e-64   
gb|EYU44419.1|  hypothetical protein MIMGU_mgv1a009413mg                213   1e-63   
emb|CDP02512.1|  unnamed protein product                                213   1e-63   
gb|KDO79155.1|  hypothetical protein CISIN_1g018628mg                   212   2e-63   
gb|KDP31966.1|  hypothetical protein JCGZ_12427                         212   2e-63   
gb|KDO79157.1|  hypothetical protein CISIN_1g018628mg                   212   2e-63   
ref|XP_007042470.1|  Cyclin delta-3 isoform 1                           211   2e-63   
ref|XP_006494452.1|  PREDICTED: uncharacterized protein LOC102619583    212   3e-63   
gb|KDO79156.1|  hypothetical protein CISIN_1g018628mg                   212   3e-63   
ref|XP_008243998.1|  PREDICTED: uncharacterized protein LOC103342178    211   3e-63   
ref|XP_002523632.1|  conserved hypothetical protein                     211   4e-63   Ricinus communis
ref|XP_003625796.1|  hypothetical protein MTR_7g104350                  211   5e-63   
ref|XP_010109798.1|  hypothetical protein L484_005773                   211   5e-63   
ref|XP_004288016.1|  PREDICTED: uncharacterized protein LOC101313639    211   6e-63   
ref|XP_006425930.1|  hypothetical protein CICLE_v10025986mg             210   1e-62   
ref|XP_007042471.1|  Cyclin delta-3 isoform 2                           209   1e-62   
ref|XP_002310717.2|  hypothetical protein POPTR_0007s10820g             209   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007205481.1|  hypothetical protein PRUPE_ppa008139mg             208   6e-62   
ref|XP_010691734.1|  PREDICTED: uncharacterized protein LOC104904991    208   7e-62   
ref|XP_011043516.1|  PREDICTED: uncharacterized protein LOC105138953    207   1e-61   
gb|KHG09679.1|  CTP synthase                                            207   2e-61   
ref|XP_010647729.1|  PREDICTED: uncharacterized protein LOC100250...    205   6e-61   
ref|XP_002282427.2|  PREDICTED: uncharacterized protein LOC100250...    205   8e-61   Vitis vinifera
ref|XP_010028431.1|  PREDICTED: uncharacterized protein LOC104418...    205   8e-61   
gb|KCW55178.1|  hypothetical protein EUGRSUZ_I01131                     204   1e-60   
ref|XP_010028429.1|  PREDICTED: uncharacterized protein LOC104418...    205   1e-60   
ref|XP_010028430.1|  PREDICTED: uncharacterized protein LOC104418...    204   2e-60   
gb|KHG16908.1|  Kinesin-like protein KIF15                              203   5e-60   
gb|KDO59767.1|  hypothetical protein CISIN_1g019515mg                   202   5e-60   
ref|XP_006487040.1|  PREDICTED: uncharacterized protein LOC102617...    202   5e-60   
gb|KDO59759.1|  hypothetical protein CISIN_1g019515mg                   203   5e-60   
ref|XP_006487039.1|  PREDICTED: uncharacterized protein LOC102617...    203   5e-60   
gb|EPS58539.1|  hypothetical protein M569_16274                         199   7e-60   
ref|XP_009415074.1|  PREDICTED: uncharacterized protein LOC103996007    202   1e-59   
ref|XP_010912914.1|  PREDICTED: uncharacterized protein LOC105038740    201   3e-59   
gb|KCW55179.1|  hypothetical protein EUGRSUZ_I01131                     200   8e-59   
ref|XP_006422979.1|  hypothetical protein CICLE_v10030127mg             199   1e-58   
ref|XP_011000799.1|  PREDICTED: uncharacterized protein LOC105108...    197   7e-58   
ref|XP_011000792.1|  PREDICTED: uncharacterized protein LOC105108...    197   1e-57   
ref|XP_002313127.1|  hypothetical protein POPTR_0009s10250g             197   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006855158.1|  hypothetical protein AMTR_s00051p00066360          195   5e-57   
ref|XP_002466006.1|  hypothetical protein SORBIDRAFT_01g049950          195   7e-57   Sorghum bicolor [broomcorn]
ref|XP_006412279.1|  hypothetical protein EUTSA_v10025679mg             194   9e-57   
gb|AGT15925.1|  hypothetical protein SHCRBa_040_O01_F_50                194   1e-56   
gb|AFW89847.1|  hypothetical protein ZEAMMB73_484803                    193   1e-56   
gb|ACN31896.1|  unknown                                                 194   1e-56   Zea mays [maize]
ref|XP_010530762.1|  PREDICTED: uncharacterized protein LOC104807263    194   2e-56   
ref|NP_001132515.1|  hypothetical protein                               193   3e-56   Zea mays [maize]
ref|XP_008808161.1|  PREDICTED: uncharacterized protein LOC103720...    193   4e-56   
ref|XP_008808159.1|  PREDICTED: uncharacterized protein LOC103720...    193   5e-56   
gb|EEC74367.1|  hypothetical protein OsI_09684                          191   9e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001048710.1|  Os03g0109700                                       191   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650962.1|  PREDICTED: uncharacterized protein LOC102709161    191   2e-55   
ref|XP_004986036.1|  PREDICTED: uncharacterized protein LOC101753521    191   3e-55   
ref|XP_002518736.1|  conserved hypothetical protein                     191   4e-55   Ricinus communis
ref|XP_002867136.1|  hypothetical protein ARALYDRAFT_912995             189   6e-55   
ref|XP_003559004.1|  PREDICTED: uncharacterized protein LOC100833623    189   1e-54   
ref|NP_567951.1|  uncharacterized protein                               189   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974678.2|  uncharacterized protein                               189   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30035.1|  hypothetical protein AALP_AA7G209100                    188   2e-54   
ref|XP_010447154.1|  PREDICTED: uncharacterized protein LOC104729...    188   2e-54   
ref|XP_010070363.1|  PREDICTED: uncharacterized protein LOC104457120    188   3e-54   
ref|XP_009138260.1|  PREDICTED: uncharacterized protein LOC103862318    187   4e-54   
ref|XP_010437674.1|  PREDICTED: uncharacterized protein LOC104721...    187   8e-54   
emb|CAA17563.1|  hypothetical protein                                   187   1e-53   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ98894.1|  predicted protein                                      187   1e-53   
ref|XP_008808158.1|  PREDICTED: uncharacterized protein LOC103720...    186   2e-53   
ref|XP_008808157.1|  PREDICTED: uncharacterized protein LOC103720...    186   2e-53   
ref|XP_010447153.1|  PREDICTED: uncharacterized protein LOC104729...    184   9e-53   
ref|XP_010667420.1|  PREDICTED: uncharacterized protein LOC104884...    184   1e-52   
ref|XP_011000807.1|  PREDICTED: uncharacterized protein LOC105108...    183   1e-52   
ref|XP_011000787.1|  PREDICTED: uncharacterized protein LOC105108...    184   2e-52   
ref|XP_011000779.1|  PREDICTED: uncharacterized protein LOC105108...    184   3e-52   
ref|XP_010437673.1|  PREDICTED: uncharacterized protein LOC104721...    182   3e-52   
ref|XP_011000770.1|  PREDICTED: uncharacterized protein LOC105108...    184   3e-52   
ref|XP_010432472.1|  PREDICTED: uncharacterized protein LOC104716744    182   3e-52   
ref|XP_010531250.1|  PREDICTED: uncharacterized protein LOC104807591    182   7e-52   
ref|NP_001190908.1|  uncharacterized protein                            183   9e-52   
ref|NP_850040.1|  uncharacterized protein                               178   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ACR33997.1|  unknown                                                 177   4e-50   Zea mays [maize]
gb|AFW89846.1|  hypothetical protein ZEAMMB73_484803                    178   4e-50   
ref|XP_008658134.1|  PREDICTED: hypothetical protein isoform X1         178   6e-50   
emb|CDY67853.1|  BnaCnng56670D                                          176   1e-49   
emb|CDY46077.1|  BnaA09g42010D                                          176   1e-49   
gb|KFK32748.1|  cyclin delta-3                                          176   2e-49   
ref|XP_009802499.1|  PREDICTED: uncharacterized protein LOC104248...    172   2e-48   
ref|XP_010417089.1|  PREDICTED: uncharacterized protein LOC104702868    173   2e-48   
ref|XP_010429287.1|  PREDICTED: uncharacterized protein LOC104713781    172   2e-48   
ref|XP_002967054.1|  hypothetical protein SELMODRAFT_168968             172   8e-48   
ref|XP_009117283.1|  PREDICTED: uncharacterized protein LOC103842416    171   1e-47   
ref|XP_002960953.1|  hypothetical protein SELMODRAFT_74342              172   1e-47   
ref|XP_006296258.1|  hypothetical protein CARUB_v10025424mg             170   2e-47   
ref|XP_002880495.1|  hypothetical protein ARALYDRAFT_481207             168   1e-46   
ref|XP_006404823.1|  hypothetical protein EUTSA_v10000243mg             166   7e-46   
gb|AFK48141.1|  unknown                                                 157   7e-45   
ref|XP_001777349.1|  predicted protein                                  160   2e-43   
emb|CDX72448.1|  BnaC07g44700D                                          150   7e-40   
ref|XP_001771744.1|  predicted protein                                  150   8e-40   
emb|CAN79542.1|  hypothetical protein VITISV_025321                     149   2e-39   Vitis vinifera
emb|CDY49273.1|  BnaA03g50860D                                          149   2e-39   
gb|AGT16437.1|  hypothetical protein SHCRBa_062_I05_F_60                147   9e-39   
ref|XP_008457753.1|  PREDICTED: uncharacterized protein LOC103497...    144   9e-38   
ref|XP_010667421.1|  PREDICTED: uncharacterized protein LOC104884...    143   1e-37   
gb|AAN61482.1|  Hypothetical protein                                    136   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474424.1|  PREDICTED: uncharacterized protein LOC104753946    130   1e-32   
gb|EMS53122.1|  hypothetical protein TRIUR3_03534                       126   8e-32   
ref|XP_006369766.1|  hypothetical protein POPTR_0001s31190g             119   3e-29   
ref|XP_003625797.1|  hypothetical protein MTR_7g104350                  110   2e-27   
gb|KDO79159.1|  hypothetical protein CISIN_1g018628mg                   110   2e-27   
gb|KDO79158.1|  hypothetical protein CISIN_1g018628mg                   110   2e-27   
ref|XP_006425932.1|  hypothetical protein CICLE_v10025986mg             110   2e-27   
ref|XP_006425931.1|  hypothetical protein CICLE_v10025986mg             110   2e-27   
gb|KDO59760.1|  hypothetical protein CISIN_1g019515mg                 99.4    2e-23   
gb|KDO59761.1|  hypothetical protein CISIN_1g019515mg                 98.2    4e-23   
ref|XP_006284226.1|  hypothetical protein CARUB_v10005385mg           95.5    2e-22   
ref|XP_005650544.1|  hypothetical protein COCSUDRAFT_46456              100   2e-21   
gb|KDP25008.1|  hypothetical protein JCGZ_23991                       95.5    8e-21   
gb|AAC23753.1|  hypothetical protein                                  90.5    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001169944.1|  uncharacterized protein LOC100383842             79.7    1e-14   Zea mays [maize]
ref|XP_008659734.1|  PREDICTED: uncharacterized protein LOC103638669  79.0    2e-13   
gb|AFW81278.1|  hypothetical protein ZEAMMB73_378371                  76.3    2e-12   
gb|KDO79160.1|  hypothetical protein CISIN_1g018628mg                 59.3    3e-12   
ref|XP_006425929.1|  hypothetical protein CICLE_v10025986mg           58.9    4e-12   
gb|AFW85234.1|  putative calcium-dependent lipid-binding (CaLB do...  71.2    7e-11   
gb|KDO59762.1|  hypothetical protein CISIN_1g019515mg                 55.8    1e-10   
ref|XP_001693659.1|  hypothetical protein CHLREDRAFT_143294           66.6    7e-10   Chlamydomonas reinhardtii
gb|KCW55180.1|  hypothetical protein EUGRSUZ_I01132                   51.6    1e-09   
gb|KCW59070.1|  hypothetical protein EUGRSUZ_H01690                   52.8    1e-09   
gb|AFA52591.1|  hypothetical protein                                  66.2    2e-09   
gb|KCW59069.1|  hypothetical protein EUGRSUZ_H01690                   51.2    4e-09   
ref|XP_005707231.1|  hypothetical protein Gasu_19540                  64.3    9e-09   
ref|XP_005833599.1|  hypothetical protein GUITHDRAFT_107402           57.8    2e-07   
emb|CDP19115.1|  unnamed protein product                              56.6    4e-07   
ref|XP_005765908.1|  trypsin                                          58.9    7e-07   
emb|CBN79086.1|  conserved unknown protein                            58.5    7e-07   
gb|EWM29628.1|  cyclin delta-3                                        58.2    7e-07   
ref|XP_001417315.1|  predicted protein                                54.3    2e-05   Ostreococcus lucimarinus CCE9901
ref|XP_003078919.1|  unnamed protein product                          53.5    4e-05   
ref|XP_002286657.1|  predicted protein                                49.7    5e-05   Thalassiosira pseudonana CCMP1335
emb|CEF97668.1|  unnamed product                                      52.4    9e-05   
ref|XP_002504091.1|  predicted protein                                41.2    1e-04   Micromonas commoda
ref|XP_008659088.1|  PREDICTED: probable ADP-ribosylation factor ...  49.3    8e-04   



>ref|XP_009802498.1| PREDICTED: uncharacterized protein LOC104248022 isoform X1 [Nicotiana 
sylvestris]
Length=343

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGR+VEAKDA RGALKSPWWTLGCEY +VAN
Sbjct  205  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRSVEAKDAARGALKSPWWTLGCEYHEVAN  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KEKVT+EGRQ DLKKGK+PAQ+ALDEAAFLLDLASIDGKWDD +ERIA
Sbjct  265  IAEWEDEQIEYIKEKVTEEGRQADLKKGKEPAQVALDEAAFLLDLASIDGKWDDCVERIA  324

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHD+A+FVVYRD
Sbjct  325  ECYKEAGLHDVANFVVYRD  343



>emb|CAN65608.1| hypothetical protein VITISV_042270 [Vitis vinifera]
Length=270

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGFGRPFVFNAEVLL+VGR +EAKDA RGALK+PWWTLGC+YQ+VA+
Sbjct  132  LVTGEFYTKKKHFPGFGRPFVFNAEVLLKVGRTLEAKDAARGALKTPWWTLGCKYQEVAD  191

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            MAQWEDEQIE++KEKVT++G+QEDL+KGK PAQIALDEAAFLLDLAS++G WDD++ERIA
Sbjct  192  MAQWEDEQIEYIKEKVTEKGKQEDLQKGKPPAQIALDEAAFLLDLASVEGTWDDFVERIA  251

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA FV+YRD
Sbjct  252  ECYREAGLHDIARFVLYRD  270



>ref|XP_004231860.1| PREDICTED: uncharacterized protein LOC101267465 [Solanum lycopersicum]
Length=344

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEVLL+VGRN+EAKDA RGALKSPWWTLGCEY +VAN
Sbjct  206  LVTGEFYTKKEHFPGFARPFVFNAEVLLKVGRNIEAKDAARGALKSPWWTLGCEYHEVAN  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            MA+WEDEQIE++KEKVT+EGR+ DLKKGK PAQ+ALDEAAFLLDLASIDG WDD  ERIA
Sbjct  266  MAEWEDEQIEYIKEKVTEEGREADLKKGKQPAQVALDEAAFLLDLASIDGSWDDCAERIA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLH++A+FVVYRD
Sbjct  326  ECYKEAGLHEVANFVVYRD  344



>ref|XP_006339874.1| PREDICTED: uncharacterized protein LOC102583668 [Solanum tuberosum]
Length=345

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEVLL+VGRN+EAKDA RGALKSPWWTLGCEY +VAN
Sbjct  207  LVTGEFYTKKEHFPGFARPFVFNAEVLLKVGRNIEAKDAARGALKSPWWTLGCEYHEVAN  266

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            MA+WEDEQIE++KEKVT+EGR+ DLKKGK PAQ+ALDEAAFLLDLASIDG WDD  ERIA
Sbjct  267  MAEWEDEQIEYIKEKVTEEGRETDLKKGKQPAQVALDEAAFLLDLASIDGTWDDCAERIA  326

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLH++A+FVVYRD
Sbjct  327  ECYKEAGLHEVANFVVYRD  345



>ref|XP_003517309.1| PREDICTED: uncharacterized protein LOC100800367 [Glycine max]
 gb|KHN36245.1| hypothetical protein glysoja_003368 [Glycine soja]
Length=346

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFN+EVLLRVGR VEAKDA RGALKSPWWTLGC+YQ VAN
Sbjct  208  LVTGEFYTKKEHFPGFARPFVFNSEVLLRVGRKVEAKDAARGALKSPWWTLGCKYQDVAN  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQW+DEQIE+VKEKVT+EGRQEDLKKGK PAQ+ LDEAAFLLDLASI+G+WD+YLERIA
Sbjct  268  IAQWDDEQIEYVKEKVTEEGRQEDLKKGKAPAQVVLDEAAFLLDLASIEGEWDEYLERIA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLHD+A F++YRD
Sbjct  328  KCYEEAGLHDVAKFILYRD  346



>ref|XP_010270377.1| PREDICTED: uncharacterized protein LOC104606724 isoform X2 [Nelumbo 
nucifera]
Length=326

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGFGRPFVFNAE+LL+VGRN+EAKDA RGALKSPWWTLGC+Y++VA 
Sbjct  188  LVTGEFYTKKEHFPGFGRPFVFNAEILLKVGRNLEAKDAARGALKSPWWTLGCKYEEVAE  247

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EG+QEDLKKGK PAQ++LDEAAFLLDLAS++G W +Y ERIA
Sbjct  248  IAQWEDEQIEYIKEKVTEEGKQEDLKKGKAPAQVSLDEAAFLLDLASVEGTWAEYTERIA  307

Query  611  ECYKDAGLHDIASFVVYR  664
            ECYKDAGLHDIA FV+YR
Sbjct  308  ECYKDAGLHDIARFVLYR  325



>ref|XP_003538809.1| PREDICTED: uncharacterized protein LOC100809304 [Glycine max]
 gb|KHN42098.1| hypothetical protein glysoja_003838 [Glycine soja]
Length=346

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFN+EVLLRVGR VEAKDA RGALKSPWWTLGC+YQ VAN
Sbjct  208  LVTGEFYTKKEHFPGFARPFVFNSEVLLRVGRKVEAKDAARGALKSPWWTLGCKYQDVAN  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQEDLKKGK PAQ+ LDEAAFLLDLASI+G+WD+YLERIA
Sbjct  268  IAQWEDEQIEYIKEKVTEEGRQEDLKKGKAPAQVVLDEAAFLLDLASIEGEWDEYLERIA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL D+A F++YRD
Sbjct  328  KCYEEAGLQDVAKFILYRD  346



>ref|XP_002278310.2| PREDICTED: uncharacterized protein LOC100268130 [Vitis vinifera]
 emb|CBI21392.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGFGRPFVFNAEVLL+VGR +EAKDA RGALK+PWWTLGC+YQ+VA+
Sbjct  209  LVTGEFYTKKKHFPGFGRPFVFNAEVLLKVGRTLEAKDAARGALKTPWWTLGCKYQEVAD  268

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            MAQWEDEQIE++KEKVT++G+QEDL+KGK PAQIALDEAAFLLDLAS++G W+D++ERIA
Sbjct  269  MAQWEDEQIEYIKEKVTEKGKQEDLQKGKPPAQIALDEAAFLLDLASVEGTWNDFVERIA  328

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHDIA FV+YRD
Sbjct  329  ECYKEAGLHDIARFVLYRD  347



>ref|XP_010270372.1| PREDICTED: uncharacterized protein LOC104606724 isoform X1 [Nelumbo 
nucifera]
Length=344

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGFGRPFVFNAE+LL+VGRN+EAKDA RGALKSPWWTLGC+Y++VA 
Sbjct  206  LVTGEFYTKKEHFPGFGRPFVFNAEILLKVGRNLEAKDAARGALKSPWWTLGCKYEEVAE  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EG+QEDLKKGK PAQ++LDEAAFLLDLAS++G W +Y ERIA
Sbjct  266  IAQWEDEQIEYIKEKVTEEGKQEDLKKGKAPAQVSLDEAAFLLDLASVEGTWAEYTERIA  325

Query  611  ECYKDAGLHDIASFVVYR  664
            ECYKDAGLHDIA FV+YR
Sbjct  326  ECYKDAGLHDIARFVLYR  343



>ref|XP_009613440.1| PREDICTED: uncharacterized protein LOC104106574 [Nicotiana tomentosiformis]
Length=348

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRNVEAKDA RGALKSPWWTLGCEY +VAN
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNVEAKDAARGALKSPWWTLGCEYHEVAN  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KEKVT+EGRQ DLKKGK+PAQ+ALDEAAFLLDLASIDG WDD ++RIA
Sbjct  270  IAEWEDEQIEYIKEKVTEEGRQADLKKGKEPAQVALDEAAFLLDLASIDGTWDDCVKRIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGL D+A+FVVYRD
Sbjct  330  ECYREAGLRDVANFVVYRD  348



>ref|XP_007156781.1| hypothetical protein PHAVU_002G017100g [Phaseolus vulgaris]
 gb|ESW28775.1| hypothetical protein PHAVU_002G017100g [Phaseolus vulgaris]
Length=347

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT K HFPGF RPFVFNAEVLLRVGR VEAKDA RGALKSPWWTLGC+Y+ VAN
Sbjct  209  LVTGEFYTNKEHFPGFARPFVFNAEVLLRVGRKVEAKDAARGALKSPWWTLGCKYEDVAN  268

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQW+DEQIE++KEKVT+EGRQEDLKKGK PAQ+ LDEAAFLLDLAS++G+WDDYLERIA
Sbjct  269  IAQWDDEQIEYIKEKVTEEGRQEDLKKGKAPAQVVLDEAAFLLDLASVEGEWDDYLERIA  328

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL D+A F++YRD
Sbjct  329  KCYEEAGLPDVAKFILYRD  347



>ref|XP_008457752.1| PREDICTED: uncharacterized protein LOC103497369 isoform X1 [Cucumis 
melo]
Length=344

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR  EAKDA RGALKSPWWTLGC+Y++VAN
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRKTEAKDAARGALKSPWWTLGCKYEEVAN  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE+ KEKVT+EG+QEDLKKGK PAQ+ALD+AAFLLDLAS+DG WD+Y+ERIA
Sbjct  266  IAQWEDEQIEYFKEKVTEEGKQEDLKKGKAPAQVALDQAAFLLDLASVDGTWDNYVERIA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH+IA+FV+YRD
Sbjct  326  QCYEEAGLHEIATFVLYRD  344



>ref|XP_007047330.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX91487.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=238

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTRK HFPGF RPFVFNAEVLL+VGRN EAKDA RGALKSPWWTLGC+Y +VA 
Sbjct  100  LVTGEFYTRKEHFPGFARPFVFNAEVLLKVGRNPEAKDAARGALKSPWWTLGCKYHEVAC  159

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++ EK+++EGRQEDL KGK P QI+LDEAAFLLDLAS++G WDD LERIA
Sbjct  160  IAEWEDEQIEYITEKLSKEGRQEDLSKGKPPVQISLDEAAFLLDLASVEGTWDDSLERIA  219

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHDIA FV+YRD
Sbjct  220  ECYKEAGLHDIARFVLYRD  238



>ref|XP_007047331.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX91488.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=259

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTRK HFPGF RPFVFNAEVLL+VGRN EAKDA RGALKSPWWTLGC+Y +VA 
Sbjct  121  LVTGEFYTRKEHFPGFARPFVFNAEVLLKVGRNPEAKDAARGALKSPWWTLGCKYHEVAC  180

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++ EK+++EGRQEDL KGK P QI+LDEAAFLLDLAS++G WDD LERIA
Sbjct  181  IAEWEDEQIEYITEKLSKEGRQEDLSKGKPPVQISLDEAAFLLDLASVEGTWDDSLERIA  240

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHDIA FV+YRD
Sbjct  241  ECYKEAGLHDIARFVLYRD  259



>ref|XP_007047329.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX91486.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=315

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTRK HFPGF RPFVFNAEVLL+VGRN EAKDA RGALKSPWWTLGC+Y +VA 
Sbjct  177  LVTGEFYTRKEHFPGFARPFVFNAEVLLKVGRNPEAKDAARGALKSPWWTLGCKYHEVAC  236

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++ EK+++EGRQEDL KGK P QI+LDEAAFLLDLAS++G WDD LERIA
Sbjct  237  IAEWEDEQIEYITEKLSKEGRQEDLSKGKPPVQISLDEAAFLLDLASVEGTWDDSLERIA  296

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHDIA FV+YRD
Sbjct  297  ECYKEAGLHDIARFVLYRD  315



>ref|XP_011099112.1| PREDICTED: uncharacterized protein LOC105177601 [Sesamum indicum]
 ref|XP_011099113.1| PREDICTED: uncharacterized protein LOC105177601 [Sesamum indicum]
 ref|XP_011099114.1| PREDICTED: uncharacterized protein LOC105177601 [Sesamum indicum]
Length=343

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT++ HFPGFGRPFVFNAEVLL+VGRN+EAKD+ R ALKSPWWTLGCEYQ+VA+
Sbjct  205  LVTGEFYTKREHFPGFGRPFVFNAEVLLKVGRNLEAKDSARVALKSPWWTLGCEYQEVAD  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT EGRQEDLKKGK+PAQ++LDEAAFLLDLAS++G WD  LER+A
Sbjct  265  LAQWEDEQIEYIKEKVTDEGRQEDLKKGKEPAQVSLDEAAFLLDLASVEGTWDACLERVA  324

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++AGL DIA+F++YRD
Sbjct  325  SCYREAGLDDIATFILYRD  343



>ref|XP_007047328.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX91485.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=335

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTRK HFPGF RPFVFNAEVLL+VGRN EAKDA RGALKSPWWTLGC+Y +VA 
Sbjct  197  LVTGEFYTRKEHFPGFARPFVFNAEVLLKVGRNPEAKDAARGALKSPWWTLGCKYHEVAC  256

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++ EK+++EGRQEDL KGK P QI+LDEAAFLLDLAS++G WDD LERIA
Sbjct  257  IAEWEDEQIEYITEKLSKEGRQEDLSKGKPPVQISLDEAAFLLDLASVEGTWDDSLERIA  316

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHDIA FV+YRD
Sbjct  317  ECYKEAGLHDIARFVLYRD  335



>ref|XP_004149691.1| PREDICTED: uncharacterized protein LOC101209805 [Cucumis sativus]
 ref|XP_004163271.1| PREDICTED: uncharacterized protein LOC101231261 [Cucumis sativus]
 gb|KGN61985.1| hypothetical protein Csa_2G279220 [Cucumis sativus]
Length=344

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR  EAKDA RGALKSPWWTLGC+Y++VAN
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRKTEAKDAARGALKSPWWTLGCKYEEVAN  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE+ KEKVT+EG+QEDLKKGK PAQ+ALD+AAFLLDLAS+DG WD+Y+ERIA
Sbjct  266  IAQWEDEQIEYFKEKVTEEGKQEDLKKGKAPAQVALDQAAFLLDLASVDGTWDNYVERIA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL +IA+FV+YRD
Sbjct  326  QCYEEAGLLEIATFVLYRD  344



>ref|XP_004494165.1| PREDICTED: uncharacterized protein LOC101505098 [Cicer arietinum]
Length=345

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEVLLRVGR VEAKDA RGALKSPWWTLGC Y+ VAN
Sbjct  207  LVTGEFYTKKEHFPGFARPFVFNAEVLLRVGRKVEAKDAARGALKSPWWTLGCMYRDVAN  266

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQ+DL KGK PAQ+ LDEAAFLLDLASI+G WDDYLE+IA
Sbjct  267  IAQWEDEQIEYIKEKVTEEGRQQDLIKGKAPAQVVLDEAAFLLDLASIEGNWDDYLEQIA  326

Query  611  ECYKDAGLHDIASFVVYR  664
            +CY++AGL+DIA F++++
Sbjct  327  KCYEEAGLNDIAKFILHK  344



>ref|XP_008382289.1| PREDICTED: uncharacterized protein LOC103445096 [Malus domestica]
Length=344

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR VEAKDA RGALKSPWWTLGC YQ+VAN
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRTVEAKDAARGALKSPWWTLGCSYQEVAN  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQ DLKKGK PAQ+ALDEAAFLLDLASIDG WDDY+ ++A
Sbjct  266  IAQWEDEQIEYIKEKVTEEGRQADLKKGKAPAQVALDEAAFLLDLASIDGTWDDYVWQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            + YK+AGL DIA FV+YRD
Sbjct  326  DRYKEAGLQDIAGFVLYRD  344



>ref|XP_009367316.1| PREDICTED: uncharacterized protein LOC103956982 [Pyrus x bretschneideri]
Length=344

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR  EAKDA RGALKSPWWTLGC YQ+VA+
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRTAEAKDAARGALKSPWWTLGCSYQEVAD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQ DLKKGK PAQ+ALDEAAFLLDLASIDG WDDY+E++A
Sbjct  266  IAQWEDEQIEYIKEKVTEEGRQADLKKGKAPAQVALDEAAFLLDLASIDGTWDDYVEQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            + YK+AGL DIA FV+YRD
Sbjct  326  DRYKEAGLRDIAGFVLYRD  344



>ref|XP_009343278.1| PREDICTED: uncharacterized protein LOC103935242 [Pyrus x bretschneideri]
Length=344

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR  EAKDA RGALKSPWWTLGC YQ+VA+
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRTAEAKDAARGALKSPWWTLGCSYQEVAD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQ DLKKGK PAQ+ALDEAAFLLDLASIDG WDDY+E++A
Sbjct  266  IAQWEDEQIEYIKEKVTEEGRQADLKKGKAPAQVALDEAAFLLDLASIDGTWDDYVEQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            + Y++AGL DIA FV+YRD
Sbjct  326  DRYQEAGLQDIAGFVLYRD  344



>ref|XP_007042472.1| Cyclin delta-3 isoform 3 [Theobroma cacao]
 gb|EOX98303.1| Cyclin delta-3 isoform 3 [Theobroma cacao]
Length=256

 Score =   210 bits (535),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K  FPGFGRPFVFNAEVLL+VGR  EAKD+ R ALKSPWWTLGC YQ VA+
Sbjct  118  LVTGEFYTKKELFPGFGRPFVFNAEVLLKVGRTSEAKDSARVALKSPWWTLGCAYQDVAS  177

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQEDLKKGK PAQ+ALDEAAFLLDLASI+G W DY++RIA
Sbjct  178  IAQWEDEQIEYIKEKVTEEGRQEDLKKGKAPAQVALDEAAFLLDLASIEGTWGDYVDRIA  237

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL+ IA F++YRD
Sbjct  238  ECYKEAGLNAIADFILYRD  256



>gb|EYU44419.1| hypothetical protein MIMGU_mgv1a009413mg [Erythranthe guttata]
Length=343

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +++HFPGFGRPFVFNAEVLL+VGR++E+KD+ R ALKSPWWTLGCEYQK A+
Sbjct  205  LVTGEFYIKRDHFPGFGRPFVFNAEVLLKVGRSIESKDSARVALKSPWWTLGCEYQKAAD  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KE+VT EGRQ+DLKKGK+PAQIALDEAAFLLDLAS++G WD  ++R+A
Sbjct  265  LAQWEDEQIEYIKERVTDEGRQDDLKKGKEPAQIALDEAAFLLDLASVEGTWDASVDRVA  324

Query  611  ECYKDAGLHDIASFVVYR  664
            ECY++AGLHDIA+F++Y+
Sbjct  325  ECYREAGLHDIATFILYK  342



>emb|CDP02512.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT++ HFPGFGRPFV N+EVLL+VGRN+EAKD+ R ALKSPWWTLGC Y +VA+
Sbjct  205  LVTGEFYTKREHFPGFGRPFVVNSEVLLKVGRNLEAKDSARVALKSPWWTLGCNYHEVAS  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQW+DEQIE++KE+VT+EGRQED+K+GK+PAQ+ALDEAAFLLDLAS++G WDD LERIA
Sbjct  265  IAQWDDEQIEYIKERVTKEGRQEDIKRGKEPAQVALDEAAFLLDLASVEGTWDDNLERIA  324

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLH+IA FV+YR+
Sbjct  325  ECYQEAGLHEIAKFVLYRN  343



>gb|KDO79155.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=337

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ+VA+
Sbjct  199  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQEVAD  258

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQI+++KEKVT EG+QEDL KGK  +Q+ALDEAAFLLDLAS++G WDD  ERIA
Sbjct  259  IAQWEDEQIDYIKEKVTAEGKQEDLNKGKTHSQVALDEAAFLLDLASVEGTWDDSAERIA  318

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGLHDI +FV+YRD
Sbjct  319  ECYEQAGLHDITAFVLYRD  337



>gb|KDP31966.1| hypothetical protein JCGZ_12427 [Jatropha curcas]
Length=346

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGR +EAKDA RGALKSPWWTLGC YQ+VA 
Sbjct  208  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRKLEAKDAARGALKSPWWTLGCRYQEVAQ  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KE+VT+EGRQEDL KGKDPAQIALDEAAFLLDLAS++G WDD  E+IA
Sbjct  268  IAEWEDEQIEYMKERVTEEGRQEDLNKGKDPAQIALDEAAFLLDLASVEGTWDDSSEQIA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
             CYK+AGL D+A F+ YRD
Sbjct  328  ACYKEAGLQDVARFIQYRD  346



>gb|KDO79157.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=353

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ+VA+
Sbjct  215  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQEVAD  274

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQI+++KEKVT EG+QEDL KGK  +Q+ALDEAAFLLDLAS++G WDD  ERIA
Sbjct  275  IAQWEDEQIDYIKEKVTAEGKQEDLNKGKTHSQVALDEAAFLLDLASVEGTWDDSAERIA  334

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGLHDI +FV+YRD
Sbjct  335  ECYEQAGLHDITAFVLYRD  353



>ref|XP_007042470.1| Cyclin delta-3 isoform 1 [Theobroma cacao]
 gb|EOX98301.1| Cyclin delta-3 isoform 1 [Theobroma cacao]
Length=336

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K  FPGFGRPFVFNAEVLL+VGR  EAKD+ R ALKSPWWTLGC YQ VA+
Sbjct  198  LVTGEFYTKKELFPGFGRPFVFNAEVLLKVGRTSEAKDSARVALKSPWWTLGCAYQDVAS  257

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQEDLKKGK PAQ+ALDEAAFLLDLASI+G W DY++RIA
Sbjct  258  IAQWEDEQIEYIKEKVTEEGRQEDLKKGKAPAQVALDEAAFLLDLASIEGTWGDYVDRIA  317

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL+ IA F++YRD
Sbjct  318  ECYKEAGLNAIADFILYRD  336



>ref|XP_006494452.1| PREDICTED: uncharacterized protein LOC102619583 [Citrus sinensis]
Length=348

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ+VA+
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQEVAD  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQI+++KEKVT EG+QEDL KGK  +Q+ALDEAAFLLDLAS++G WDD  ERIA
Sbjct  270  IAQWEDEQIDYIKEKVTAEGKQEDLNKGKTHSQVALDEAAFLLDLASVEGTWDDSAERIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGLHDI +FV+YRD
Sbjct  330  ECYEQAGLHDITAFVLYRD  348



>gb|KDO79156.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=348

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ+VA+
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQEVAD  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQI+++KEKVT EG+QEDL KGK  +Q+ALDEAAFLLDLAS++G WDD  ERIA
Sbjct  270  IAQWEDEQIDYIKEKVTAEGKQEDLNKGKTHSQVALDEAAFLLDLASVEGTWDDSAERIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGLHDI +FV+YRD
Sbjct  330  ECYEQAGLHDITAFVLYRD  348



>ref|XP_008243998.1| PREDICTED: uncharacterized protein LOC103342178 [Prunus mume]
Length=344

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR VEAKDA RGALKSPWWTLGC YQ+VA+
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRTVEAKDAARGALKSPWWTLGCSYQEVAD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT EGRQ DLKKGK PAQ+ALDEAAFLLDLASI+G WDD++E++A
Sbjct  266  IAQWEDEQIEYIKEKVTDEGRQADLKKGKAPAQVALDEAAFLLDLASIEGTWDDHVEQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            + Y++AGL DIA FV+YRD
Sbjct  326  DRYREAGLTDIARFVLYRD  344



>ref|XP_002523632.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38827.1| conserved hypothetical protein [Ricinus communis]
Length=344

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGE+YT+K HFPGF RPFVFNAEVLL++GR +EAKDA RGALKSPWWTLGC YQ+VA 
Sbjct  206  LVTGEYYTKKEHFPGFARPFVFNAEVLLKIGRRLEAKDAARGALKSPWWTLGCRYQQVAQ  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KE+VT EGRQED+ KGKDPAQIALDEAAFLLDLAS++G WDD +ERIA
Sbjct  266  IAEWEDEQIEYIKERVTDEGRQEDVNKGKDPAQIALDEAAFLLDLASVEGTWDDSVERIA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
             CYK+AGL D+A FV +RD
Sbjct  326  ACYKEAGLQDVARFVQHRD  344



>ref|XP_003625796.1| hypothetical protein MTR_7g104350 [Medicago truncatula]
 gb|AES82014.1| cyclin delta-3, putative [Medicago truncatula]
Length=344

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEV+LRVGR VEAKDA RGALKSPWWTLGC Y+ VA+
Sbjct  206  LVTGEFYTKKEHFPGFARPFVFNAEVMLRVGRKVEAKDAARGALKSPWWTLGCMYRDVAD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQW+DEQIE++KEKVT+EGRQEDLKKGK PAQ+ LDEAAFLLDLASI+G WD YLERI 
Sbjct  266  IAQWDDEQIEYIKEKVTEEGRQEDLKKGKAPAQVVLDEAAFLLDLASIEGNWDGYLERIG  325

Query  611  ECYKDAGLHDIASFVVYR  664
            +CY++ GL DIA F++Y+
Sbjct  326  KCYEEGGLDDIAKFILYK  343



>ref|XP_010109798.1| hypothetical protein L484_005773 [Morus notabilis]
 gb|EXC24724.1| hypothetical protein L484_005773 [Morus notabilis]
Length=343

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEVLL+VGR  EAKDA RGALKSPWWTLGC+Y++VAN
Sbjct  205  LVTGEFYTKKEHFPGFARPFVFNAEVLLKVGRTTEAKDAARGALKSPWWTLGCKYEEVAN  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE+ KEKVT+EGRQED+K GK PAQ+ALDEAAFLLDLAS++G WD+ ++RIA
Sbjct  265  IAQWEDEQIEYFKEKVTEEGRQEDIKMGKAPAQVALDEAAFLLDLASVEGTWDESVKRIA  324

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++AGL+DI+ FV+YRD
Sbjct  325  GCYREAGLNDISRFVLYRD  343



>ref|XP_004288016.1| PREDICTED: uncharacterized protein LOC101313639 [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAEVLL+VGR VEAKDA RGALKSPWWTLGC+YQ+VA 
Sbjct  206  LVTGEFYTKKEHFPGFARPFVFNAEVLLKVGRTVEAKDAARGALKSPWWTLGCKYQEVAE  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KE+V++EGRQ DLKKGK PAQ+ALDEAAFLLDLAS++  WD+Y+E++A
Sbjct  266  IAQWEDEQIEYIKERVSEEGRQADLKKGKAPAQVALDEAAFLLDLASVEESWDEYVEQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
             CYK+ GL DIA FV+YRD
Sbjct  326  NCYKEGGLPDIAKFVLYRD  344



>ref|XP_006425930.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
 gb|ESR39170.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
Length=348

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ+VA+
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQEVAD  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWED+QI+++KEKVT EG+QEDL KGK  +Q+ALDEAAFLLDLAS++G WDD  ERIA
Sbjct  270  IAQWEDDQIDYIKEKVTAEGKQEDLNKGKTHSQVALDEAAFLLDLASVEGTWDDSAERIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGLHDI +FV+YRD
Sbjct  330  ECYEQAGLHDITAFVLYRD  348



>ref|XP_007042471.1| Cyclin delta-3 isoform 2, partial [Theobroma cacao]
 gb|EOX98302.1| Cyclin delta-3 isoform 2, partial [Theobroma cacao]
Length=317

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K  FPGFGRPFVFNAEVLL+VGR  EAKD+ R ALKSPWWTLGC YQ VA+
Sbjct  179  LVTGEFYTKKELFPGFGRPFVFNAEVLLKVGRTSEAKDSARVALKSPWWTLGCAYQDVAS  238

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGRQEDLKKGK PAQ+ALDEAAFLLDLASI+G W DY++RIA
Sbjct  239  IAQWEDEQIEYIKEKVTEEGRQEDLKKGKAPAQVALDEAAFLLDLASIEGTWGDYVDRIA  298

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL+ IA F++YRD
Sbjct  299  ECYKEAGLNAIADFILYRD  317



>ref|XP_002310717.2| hypothetical protein POPTR_0007s10820g [Populus trichocarpa]
 gb|EEE91167.2| hypothetical protein POPTR_0007s10820g [Populus trichocarpa]
Length=342

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV GEFYT+K HFPGF RPF FNAEV+L++GR +EAKDA RGALKSPWWTLGC YQ VA 
Sbjct  204  LVIGEFYTKKKHFPGFARPFAFNAEVMLKIGRKLEAKDAARGALKSPWWTLGCRYQDVAQ  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EGRQEDL KGK+P+QIALDEAAFLLDLAS++G WD+  E+IA
Sbjct  264  IAQWEDEQIEYIKEKMTEEGRQEDLNKGKEPSQIALDEAAFLLDLASVEGTWDEAAEQIA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK AGLHD+A F+ YRD
Sbjct  324  ECYKQAGLHDVARFIQYRD  342



>ref|XP_007205481.1| hypothetical protein PRUPE_ppa008139mg [Prunus persica]
 gb|EMJ06680.1| hypothetical protein PRUPE_ppa008139mg [Prunus persica]
Length=344

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR VEAKDA RGALKSPWWTLGC YQ+VA+
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRTVEAKDAARGALKSPWWTLGCSYQEVAD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT EGRQ DLKKGK PAQ+ALDEAAFLLDLASI+G WDD++E++A
Sbjct  266  IAQWEDEQIEYIKEKVTDEGRQADLKKGKAPAQVALDEAAFLLDLASIEGTWDDHVEQVA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            + Y++AGL D A FV YRD
Sbjct  326  DRYREAGLTDFARFVQYRD  344



>ref|XP_010691734.1| PREDICTED: uncharacterized protein LOC104904991 [Beta vulgaris 
subsp. vulgaris]
Length=346

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K+ FPGF RP+VFNA++LL+VGR  EAKDA R +LKSPWWTLGC YQ+VA+
Sbjct  208  LVTGEFYTKKDLFPGFARPYVFNAKILLKVGRVSEAKDAARVSLKSPWWTLGCPYQEVAD  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            MAQWEDEQIE++KEKVT+EGRQEDLKKGK+P Q+ALDEAAFLLDLASI+G WD+ LER+A
Sbjct  268  MAQWEDEQIEYIKEKVTEEGRQEDLKKGKEPIQVALDEAAFLLDLASIEGSWDECLERVA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL  IASFV+YRD
Sbjct  328  ECYKEAGLDKIASFVLYRD  346



>ref|XP_011043516.1| PREDICTED: uncharacterized protein LOC105138953 [Populus euphratica]
 ref|XP_011043517.1| PREDICTED: uncharacterized protein LOC105138953 [Populus euphratica]
 ref|XP_011043518.1| PREDICTED: uncharacterized protein LOC105138953 [Populus euphratica]
Length=342

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVT EFYT+K HFPGF RPF FNAEV+L++GR +EAKDA RGALKSPWWTLGC YQ VA 
Sbjct  204  LVTVEFYTKKKHFPGFARPFAFNAEVMLKIGRKLEAKDAARGALKSPWWTLGCRYQDVAQ  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE VKEK+T+EGRQEDL KGK+P+QIALDEAAFLLDLAS++G WD  +E+IA
Sbjct  264  IAQWEDEQIEHVKEKMTEEGRQEDLNKGKEPSQIALDEAAFLLDLASVEGTWDGAVEQIA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK AGLHD+A F+ YRD
Sbjct  324  ECYKQAGLHDVARFIQYRD  342



>gb|KHG09679.1| CTP synthase [Gossypium arboreum]
Length=338

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTRKNHFPGF RPFVFNAEVLL+VGRN+EAKDA RGALKSPWWTLGC+Y +VA 
Sbjct  200  LVTGEFYTRKNHFPGFARPFVFNAEVLLKVGRNIEAKDAARGALKSPWWTLGCKYHEVAC  259

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W+DEQIE+  EK+T+EGR+EDL KGK   QIALDEAAFLLDLAS++G WD  LERIA
Sbjct  260  IAEWKDEQIEYRTEKMTEEGRREDLNKGKPAFQIALDEAAFLLDLASVEGTWDSSLERIA  319

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGLHD+A F+ Y+D
Sbjct  320  ECYKEAGLHDMARFMQYKD  338



>ref|XP_010647729.1| PREDICTED: uncharacterized protein LOC100250309 isoform X2 [Vitis 
vinifera]
Length=339

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K+ FPGFGRPFVFNAEVLL VGRN EAKDA R ALKSPWWTLGC+Y++VA 
Sbjct  201  LVTGEFYTKKDLFPGFGRPFVFNAEVLLNVGRNSEAKDAARVALKSPWWTLGCKYEEVAC  260

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGR EDLKKGK PAQ+ALDEAAFLLDLAS++G W   LERIA
Sbjct  261  IAQWEDEQIEYIKEKVTEEGRNEDLKKGKAPAQVALDEAAFLLDLASVEGTWAGSLERIA  320

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL++IA F++Y D
Sbjct  321  ECYKEAGLNEIARFILYND  339



>ref|XP_002282427.2| PREDICTED: uncharacterized protein LOC100250309 isoform X1 [Vitis 
vinifera]
 emb|CBI32384.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K+ FPGFGRPFVFNAEVLL VGRN EAKDA R ALKSPWWTLGC+Y++VA 
Sbjct  201  LVTGEFYTKKDLFPGFGRPFVFNAEVLLNVGRNSEAKDAARVALKSPWWTLGCKYEEVAC  260

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKVT+EGR EDLKKGK PAQ+ALDEAAFLLDLAS++G W   LERIA
Sbjct  261  IAQWEDEQIEYIKEKVTEEGRNEDLKKGKAPAQVALDEAAFLLDLASVEGTWAGSLERIA  320

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL++IA F++Y D
Sbjct  321  ECYKEAGLNEIARFILYND  339



>ref|XP_010028431.1| PREDICTED: uncharacterized protein LOC104418712 isoform X3 [Eucalyptus 
grandis]
Length=338

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPF F AE+LLRVGR  EAKDA R ALKSPWWTLGC Y++VA 
Sbjct  200  MVTGEFYTKKDLFPGFGRPFAFYAEILLRVGRASEAKDAARVALKSPWWTLGCGYEEVAQ  259

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EG+QED+KKGK PAQ++LDEAAFLLDLAS++G W DYLERIA
Sbjct  260  IAQWEDEQIEYIKEKVSEEGKQEDIKKGKAPAQVSLDEAAFLLDLASVEGTWSDYLERIA  319

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL +IA F++YRD
Sbjct  320  ECYKEAGLDEIARFILYRD  338



>gb|KCW55178.1| hypothetical protein EUGRSUZ_I01131 [Eucalyptus grandis]
Length=336

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPF F AE+LLRVGR  EAKDA R ALKSPWWTLGC Y++VA 
Sbjct  198  MVTGEFYTKKDLFPGFGRPFAFYAEILLRVGRASEAKDAARVALKSPWWTLGCGYEEVAQ  257

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EG+QED+KKGK PAQ++LDEAAFLLDLAS++G W DYLERIA
Sbjct  258  IAQWEDEQIEYIKEKVSEEGKQEDIKKGKAPAQVSLDEAAFLLDLASVEGTWSDYLERIA  317

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL +IA F++YRD
Sbjct  318  ECYKEAGLDEIARFILYRD  336



>ref|XP_010028429.1| PREDICTED: uncharacterized protein LOC104418712 isoform X1 [Eucalyptus 
grandis]
Length=348

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPF F AE+LLRVGR  EAKDA R ALKSPWWTLGC Y++VA 
Sbjct  210  MVTGEFYTKKDLFPGFGRPFAFYAEILLRVGRASEAKDAARVALKSPWWTLGCGYEEVAQ  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EG+QED+KKGK PAQ++LDEAAFLLDLAS++G W DYLERIA
Sbjct  270  IAQWEDEQIEYIKEKVSEEGKQEDIKKGKAPAQVSLDEAAFLLDLASVEGTWSDYLERIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL +IA F++YRD
Sbjct  330  ECYKEAGLDEIARFILYRD  348



>ref|XP_010028430.1| PREDICTED: uncharacterized protein LOC104418712 isoform X2 [Eucalyptus 
grandis]
Length=348

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPF F AE+LLRVGR  EAKDA R ALKSPWWTLGC Y++VA 
Sbjct  210  MVTGEFYTKKDLFPGFGRPFAFYAEILLRVGRASEAKDAARVALKSPWWTLGCGYEEVAQ  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EG+QED+KKGK PAQ++LDEAAFLLDLAS++G W DYLERIA
Sbjct  270  IAQWEDEQIEYIKEKVSEEGKQEDIKKGKAPAQVSLDEAAFLLDLASVEGTWSDYLERIA  329

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+AGL +IA F++YRD
Sbjct  330  ECYKEAGLDEIARFILYRD  348



>gb|KHG16908.1| Kinesin-like protein KIF15 [Gossypium arboreum]
Length=343

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQK---  421
            LVTGEFYT+K+ FPGFGRPFVFNAEVLL+VGR  EAKD+ R ALKSPWWTLGC YQ    
Sbjct  201  LVTGEFYTKKDLFPGFGRPFVFNAEVLLKVGRTSEAKDSARVALKSPWWTLGCTYQARNF  260

Query  422  -VANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYL  598
             VA++AQWEDEQIE++KEKV++EGRQEDLKKGK   Q+ALDEAAFLLDLASIDG W DYL
Sbjct  261  DVASIAQWEDEQIEYIKEKVSEEGRQEDLKKGKALPQVALDEAAFLLDLASIDGTWGDYL  320

Query  599  ERIAECYKDAGLHDIASFVVYRD  667
            +RIAECYK+AGL +IA+F++YRD
Sbjct  321  DRIAECYKEAGLGEIANFILYRD  343



>gb|KDO59767.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
 gb|KDO59768.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
Length=318

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+ VA+
Sbjct  180  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYEAVAS  239

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EG+QEDLKKGK PAQIALDEAAFLLDL SI+G W D LERIA
Sbjct  240  IAQWEDEQIEYIKEKITEEGKQEDLKKGKAPAQIALDEAAFLLDLGSIEGTWADSLERIA  299

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+ GL +IA F++YRD
Sbjct  300  ECYKEGGLDEIARFILYRD  318



>ref|XP_006487040.1| PREDICTED: uncharacterized protein LOC102617893 isoform X2 [Citrus 
sinensis]
 ref|XP_006487041.1| PREDICTED: uncharacterized protein LOC102617893 isoform X3 [Citrus 
sinensis]
Length=318

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+ VA+
Sbjct  180  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYEAVAS  239

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EG+QEDLKKGK PAQIALDEAAFLLDL SI+G W D LERIA
Sbjct  240  IAQWEDEQIEYIKEKITEEGKQEDLKKGKAPAQIALDEAAFLLDLGSIEGTWADSLERIA  299

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+ GL +IA F++YRD
Sbjct  300  ECYKEGGLDEIARFILYRD  318



>gb|KDO59759.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
Length=340

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+ VA+
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYEAVAS  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EG+QEDLKKGK PAQIALDEAAFLLDL SI+G W D LERIA
Sbjct  262  IAQWEDEQIEYIKEKITEEGKQEDLKKGKAPAQIALDEAAFLLDLGSIEGTWADSLERIA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+ GL +IA F++YRD
Sbjct  322  ECYKEGGLDEIARFILYRD  340



>ref|XP_006487039.1| PREDICTED: uncharacterized protein LOC102617893 isoform X1 [Citrus 
sinensis]
Length=340

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+ VA+
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYEAVAS  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EG+QEDLKKGK PAQIALDEAAFLLDL SI+G W D LERIA
Sbjct  262  IAQWEDEQIEYIKEKITEEGKQEDLKKGKAPAQIALDEAAFLLDLGSIEGTWADSLERIA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECYK+ GL +IA F++YRD
Sbjct  322  ECYKEGGLDEIARFILYRD  340



>gb|EPS58539.1| hypothetical protein M569_16274, partial [Genlisea aurea]
Length=215

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVT EFYT+K+HFPGFGRPFVFNAEVLL+VGR +EA+D+ R ALKSPWWTLGC YQ+VA+
Sbjct  77   LVTAEFYTKKDHFPGFGRPFVFNAEVLLKVGRGLEARDSARVALKSPWWTLGCRYQEVAD  136

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A W+DEQIE++KEKVT+EGR+ED+ KGK+  Q+ LDEAAFLLDLAS++G WD+ LER+ 
Sbjct  137  IALWDDEQIEYIKEKVTEEGRKEDMMKGKEAGQVFLDEAAFLLDLASVEGAWDECLERVG  196

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++ GLH IA+F++YRD
Sbjct  197  ECYREVGLHHIAAFILYRD  215



>ref|XP_009415074.1| PREDICTED: uncharacterized protein LOC103996007 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415075.1| PREDICTED: uncharacterized protein LOC103996007 [Musa acuminata 
subsp. malaccensis]
Length=353

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            ++TGEFYT KNHFPGFGRPF FNA++LL+VGR +EAKDA RG+LKSPWWTLG +YQ+VA 
Sbjct  216  MITGEFYT-KNHFPGFGRPFAFNAQLLLKVGRKLEAKDAARGSLKSPWWTLGFKYQEVAE  274

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIEF+KEKVT+EGRQEDLKKGK P Q+ALDEAAFLLDLASIDG WD+ ++R+A
Sbjct  275  IAEWEDEQIEFIKEKVTEEGRQEDLKKGKAPEQVALDEAAFLLDLASIDGTWDEVVDRVA  334

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY +AGL DIA F++YR+
Sbjct  335  ECYMEAGLCDIAKFILYRE  353



>ref|XP_010912914.1| PREDICTED: uncharacterized protein LOC105038740 [Elaeis guineensis]
Length=352

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTR NHFPGFGRPF+F+AE+LL+VGR +EAKDA RGALKSPWWTLGC YQ+ A 
Sbjct  215  LVTGEFYTR-NHFPGFGRPFIFHAELLLKVGRKLEAKDAARGALKSPWWTLGCTYQEAAE  273

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KEKVT+EG+QEDLKKGK P Q+ALDEAAFLLDLAS+DG WD+ ++++A
Sbjct  274  IAEWEDEQIEYIKEKVTEEGKQEDLKKGKAPEQVALDEAAFLLDLASVDGTWDEAVDQVA  333

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY+ AGL+DIA F++Y++
Sbjct  334  ECYRVAGLNDIARFILYKE  352



>gb|KCW55179.1| hypothetical protein EUGRSUZ_I01131 [Eucalyptus grandis]
Length=339

 Score =   200 bits (508),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPF F AE+LLRVGR  EAKDA R ALKSPWWTLGC Y++VA 
Sbjct  198  MVTGEFYTKKDLFPGFGRPFAFYAEILLRVGRASEAKDAARVALKSPWWTLGCGYEEVAQ  257

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIalde---aaflldlaSIDGKWDDYLE  601
            +AQWEDEQIE++KEKV++EG+QED+KKGK PAQ++      AAFLLDLAS++G W DYLE
Sbjct  258  IAQWEDEQIEYIKEKVSEEGKQEDIKKGKAPAQVSRVSLDEAAFLLDLASVEGTWSDYLE  317

Query  602  RIAECYKDAGLHDIASFVVYRD  667
            RIAECYK+AGL +IA F++YRD
Sbjct  318  RIAECYKEAGLDEIARFILYRD  339



>ref|XP_006422979.1| hypothetical protein CICLE_v10030127mg [Citrus clementina]
 gb|ESR36219.1| hypothetical protein CICLE_v10030127mg [Citrus clementina]
Length=340

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+ VA+
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYEAVAS  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEK+T+EG+QEDLKKGK PAQIALDEAAFLLDLASI+G W   LERIA
Sbjct  262  IAQWEDEQIEYIKEKITEEGKQEDLKKGKAPAQIALDEAAFLLDLASIEGTWAGSLERIA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+ GL +IA F++YRD
Sbjct  322  DCYKEGGLDEIARFILYRD  340



>ref|XP_011000799.1| PREDICTED: uncharacterized protein LOC105108231 isoform X5 [Populus 
euphratica]
Length=339

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFVF AE+L +VGR  EAKDA R ALKSPWWTLGC YQ+VA 
Sbjct  201  MVTGEFYTKKDLFPGFGRPFVFYAEILKKVGRTSEAKDAARVALKSPWWTLGCAYQEVAG  260

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EGRQEDLKKGK  AQIALDEAAFLLDLASI G WD+ LERIA
Sbjct  261  IAQWEDEQIEYIKEKVSEEGRQEDLKKGKAAAQIALDEAAFLLDLASIKGTWDNVLERIA  320

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AG  +IA F++Y+D
Sbjct  321  ECYREAGFDEIARFILYKD  339



>ref|XP_011000792.1| PREDICTED: uncharacterized protein LOC105108231 isoform X4 [Populus 
euphratica]
Length=347

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFVF AE+L +VGR  EAKDA R ALKSPWWTLGC YQ+VA 
Sbjct  209  MVTGEFYTKKDLFPGFGRPFVFYAEILKKVGRTSEAKDAARVALKSPWWTLGCAYQEVAG  268

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EGRQEDLKKGK  AQIALDEAAFLLDLASI G WD+ LERIA
Sbjct  269  IAQWEDEQIEYIKEKVSEEGRQEDLKKGKAAAQIALDEAAFLLDLASIKGTWDNVLERIA  328

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AG  +IA F++Y+D
Sbjct  329  ECYREAGFDEIARFILYKD  347



>ref|XP_002313127.1| hypothetical protein POPTR_0009s10250g [Populus trichocarpa]
 gb|EEE87082.1| hypothetical protein POPTR_0009s10250g [Populus trichocarpa]
Length=339

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFVF AE+L +VGR  EAKDA R ALKSPWWTLGC YQ+VA 
Sbjct  201  MVTGEFYTKKDLFPGFGRPFVFYAEILKKVGRTSEAKDAARVALKSPWWTLGCAYQEVAG  260

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KE+V++EGRQEDLKKGK  AQIALDEAAFLLDLASI G WD+ LERIA
Sbjct  261  IAQWEDEQIEYIKERVSEEGRQEDLKKGKAAAQIALDEAAFLLDLASIKGTWDNVLERIA  320

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AG  +IA F++Y+D
Sbjct  321  ECYREAGFDEIARFILYKD  339



>ref|XP_006855158.1| hypothetical protein AMTR_s00051p00066360 [Amborella trichopoda]
 gb|ERN16625.1| hypothetical protein AMTR_s00051p00066360 [Amborella trichopoda]
Length=343

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV+GEFY +K HFPGFGRPFVFNAEVLL+VGRN+EAKDA R ALKSPWWTLGC+Y+ VA 
Sbjct  205  LVSGEFYAKKEHFPGFGRPFVFNAEVLLKVGRNLEAKDAARVALKSPWWTLGCKYEHVAE  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE+++E+VT+EGR+EDLKKGK PAQ+ALD+AAFL+DLAS+DG W +  +++A
Sbjct  265  IAQWEDEQIEYIRERVTEEGRREDLKKGKAPAQVALDQAAFLMDLASVDGTWLEIEDQVA  324

Query  611  ECYKDAGLHDIASFVVYR  664
            +CY++AGL +IA F++++
Sbjct  325  DCYEEAGLPEIARFILHK  342



>ref|XP_002466006.1| hypothetical protein SORBIDRAFT_01g049950 [Sorghum bicolor]
 gb|EER93004.1| hypothetical protein SORBIDRAFT_01g049950 [Sorghum bicolor]
Length=347

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFY+R + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  210  LITGEFYSR-DQFPGFGRPFVFNAEILKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  268

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQ+EF++EKVT+EG++EDLKKGK P Q+ LDEAAFL+DLAS+DG WD+ ++RIA
Sbjct  269  LAGWEDEQLEFIREKVTEEGKREDLKKGKAPEQVVLDEAAFLMDLASVDGNWDEVVDRIA  328

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA+F+ YR+
Sbjct  329  ECYREAGLHDIANFIAYRE  347



>ref|XP_006412279.1| hypothetical protein EUTSA_v10025679mg [Eutrema salsugineum]
 gb|ESQ53732.1| hypothetical protein EUTSA_v10025679mg [Eutrema salsugineum]
Length=332

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYTRK+ FPGFGRPFV+ A +L ++GRN EAKDA R ALKSPWWTLGC Y++VA+
Sbjct  192  MVTGEFYTRKDLFPGFGRPFVYYANILQKLGRNSEAKDAARVALKSPWWTLGCPYEEVAS  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV++EGR EDLKKGKDP Q+ALD AAFLLDLASI+G W + ++ IA
Sbjct  252  IAQWEDEQIEFIREKVSEEGRFEDLKKGKDPIQVALDVAAFLLDLASIEGTWSESVDHIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLHDI+ FV+Y D
Sbjct  312  KCYEEAGLHDISKFVLYTD  330



>gb|AGT15925.1| hypothetical protein SHCRBa_040_O01_F_50 [Saccharum hybrid cultivar 
R570]
Length=347

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFY+R + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  210  LITGEFYSR-DQFPGFGRPFVFNAEILKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  268

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQ+EF++EKVT+EG++EDLKKGK P Q+ LDEAAFL+DLAS+DG WD+ ++RIA
Sbjct  269  LAGWEDEQLEFIREKVTEEGKREDLKKGKAPEQVVLDEAAFLMDLASVDGNWDEVVDRIA  328

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA+F+ YR+
Sbjct  329  ECYREAGLHDIANFIAYRE  347



>gb|AFW89847.1| hypothetical protein ZEAMMB73_484803 [Zea mays]
Length=297

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  160  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  218

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+ LDEAAFL+DLAS+DG WD+ ++RIA
Sbjct  219  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVILDEAAFLMDLASVDGNWDEVVDRIA  278

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA+F+ YR+
Sbjct  279  ECYREAGLHDIANFIAYRE  297



>gb|ACN31896.1| unknown [Zea mays]
Length=333

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  196  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  254

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+ LDEAAFL+DLAS+DG WD+ ++RIA
Sbjct  255  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVILDEAAFLMDLASVDGNWDEVVDRIA  314

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA+F+ YR+
Sbjct  315  ECYREAGLHDIANFIAYRE  333



>ref|XP_010530762.1| PREDICTED: uncharacterized protein LOC104807263 [Tarenaya hassleriana]
Length=333

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+   FPGFGRPFV+ A +LL VGR+ EAKDA R ALKSPWWTLGC Y++VA+
Sbjct  195  MVTGEFYTKNALFPGFGRPFVYYANILLXVGRSSEAKDAARVALKSPWWTLGCPYEEVAS  254

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE++KEKV++EGR+EDLKKGK P Q++LD AAFLLDLASI+G W D +++IA
Sbjct  255  IAQWEDEQIEYMKEKVSEEGRREDLKKGKAPIQVSLDVAAFLLDLASIEGTWSDSVDQIA  314

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY +AGLH+IA F++YRD
Sbjct  315  ECYAEAGLHEIARFILYRD  333



>ref|NP_001132515.1| hypothetical protein [Zea mays]
 gb|ACF81383.1| unknown [Zea mays]
 gb|AFW89845.1| hypothetical protein ZEAMMB73_484803 [Zea mays]
Length=344

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  207  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+ LDEAAFL+DLAS+DG WD+ ++RIA
Sbjct  266  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVILDEAAFLMDLASVDGNWDEVVDRIA  325

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGLHDIA+F+ YR+
Sbjct  326  ECYREAGLHDIANFIAYRE  344



>ref|XP_008808161.1| PREDICTED: uncharacterized protein LOC103720295 isoform X4 [Phoenix 
dactylifera]
Length=346

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTR NHFPGFGRPF+ +A +LL+VGR +EAKDA RGALKSPWWTLGC YQ+ A 
Sbjct  209  LVTGEFYTR-NHFPGFGRPFIVHAVLLLKVGRKLEAKDAARGALKSPWWTLGCTYQEAAE  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KEKVT+EGRQEDLKKGK   Q+ALDEAAFLLDLAS+DG WD  ++R+A
Sbjct  268  IAEWEDEQIEYIKEKVTEEGRQEDLKKGKAREQVALDEAAFLLDLASVDGTWDKAVDRVA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGL+DIA F++ ++
Sbjct  328  ECYREAGLNDIARFILCKE  346



>ref|XP_008808159.1| PREDICTED: uncharacterized protein LOC103720295 isoform X3 [Phoenix 
dactylifera]
Length=350

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYTR NHFPGFGRPF+ +A +LL+VGR +EAKDA RGALKSPWWTLGC YQ+ A 
Sbjct  213  LVTGEFYTR-NHFPGFGRPFIVHAVLLLKVGRKLEAKDAARGALKSPWWTLGCTYQEAAE  271

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE++KEKVT+EGRQEDLKKGK   Q+ALDEAAFLLDLAS+DG WD  ++R+A
Sbjct  272  IAEWEDEQIEYIKEKVTEEGRQEDLKKGKAREQVALDEAAFLLDLASVDGTWDKAVDRVA  331

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGL+DIA F++ ++
Sbjct  332  ECYREAGLNDIARFILCKE  350



>gb|EEC74367.1| hypothetical protein OsI_09684 [Oryza sativa Indica Group]
Length=320

 Score =   191 bits (486),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  183  LITGEFYTR-DQFPGFGRPFVFNAEILKRVGRTTEAKDSARVALKSPWWTLGCSYEEAAE  241

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKV++EG++EDLKKGK P Q+ LDEAAFL+DLAS+DG WDD ++RIA
Sbjct  242  LAGWEDEQIEFIREKVSEEGKREDLKKGKAPEQVVLDEAAFLMDLASVDGNWDDVVDRIA  301

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++AGL DIA F+ YR+
Sbjct  302  GCYREAGLDDIAKFIAYRE  320



>ref|NP_001048710.1| Os03g0109700 [Oryza sativa Japonica Group]
 gb|ABF93579.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10624.1| Os03g0109700 [Oryza sativa Japonica Group]
 dbj|BAG94458.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58184.1| hypothetical protein OsJ_09123 [Oryza sativa Japonica Group]
Length=345

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  208  LITGEFYTR-DQFPGFGRPFVFNAEILKRVGRTTEAKDSARVALKSPWWTLGCSYEEAAE  266

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKV++EG++EDLKKGK P Q+ LDEAAFL+DLAS+DG WDD ++RIA
Sbjct  267  LAGWEDEQIEFIREKVSEEGKREDLKKGKAPEQVVLDEAAFLMDLASVDGNWDDVVDRIA  326

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++AGL DIA F+ YR+
Sbjct  327  GCYREAGLDDIAKFIAYRE  345



>ref|XP_006650962.1| PREDICTED: uncharacterized protein LOC102709161 [Oryza brachyantha]
Length=330

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  193  LITGEFYTR-DQFPGFGRPFVFNAEILKRVGRTTEAKDSARVALKSPWWTLGCSYEEAAE  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKVT+EG+++DLKKGK P Q+ LDEAAFL+DLAS+DG WDD ++RIA
Sbjct  252  LAGWEDEQIEFIREKVTEEGKRDDLKKGKAPEQVVLDEAAFLMDLASVDGNWDDVVDRIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++AGL DIA F+ YR+
Sbjct  312  GCYREAGLDDIAKFIAYRE  330



>ref|XP_004986036.1| PREDICTED: uncharacterized protein LOC101753521 [Setaria italica]
Length=346

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFY+R + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  209  LITGEFYSR-DQFPGFGRPFVFNAEILKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKVT+EG++EDLKKGK P Q+ LDEAAFL+DLA +DG WDD ++RIA
Sbjct  268  LAGWEDEQIEFIREKVTEEGKREDLKKGKAPEQVVLDEAAFLMDLACVDGNWDDVVDRIA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AGL D+A F+ YR+
Sbjct  328  ECYREAGLDDVAKFIAYRE  346



>ref|XP_002518736.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43661.1| conserved hypothetical protein [Ricinus communis]
Length=373

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYTRK+ FPGFGRPFVF AE+L +V R  EAKDA R ALKSPWWTLGC YQ+ A+
Sbjct  235  MVTGEFYTRKDLFPGFGRPFVFYAEILQKVRRTSEAKDAARVALKSPWWTLGCAYQEAAS  294

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIE+VKEKV++EG++EDLKKGK  AQIALDEAAFLLDLASI+G W D  ERIA
Sbjct  295  IAQWEDEQIEYVKEKVSEEGKREDLKKGKAAAQIALDEAAFLLDLASIEGTWADVTERIA  354

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY +AG +DIA F++Y+D
Sbjct  355  ECYIEAGFNDIAKFILYKD  373



>ref|XP_002867136.1| hypothetical protein ARALYDRAFT_912995 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43395.1| hypothetical protein ARALYDRAFT_912995 [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRN EAKDA R ALKSPWWTLGC Y++VA+
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNSEAKDAARVALKSPWWTLGCPYEEVAS  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDLKKGK P Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  252  IAQWEDEQIEFIREKVSDEGRFEDLKKGKAPIQVALDVAAFLLDLASIEGTWSESLNHIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH I++FV+Y D
Sbjct  312  KCYEEAGLHHISNFVLYTD  330



>ref|XP_003559004.1| PREDICTED: uncharacterized protein LOC100833623 [Brachypodium 
distachyon]
Length=346

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFN+ +L RVGR  EAK++ R ALKSPWW+LGC Y++ A 
Sbjct  209  LITGEFYTR-DQFPGFGRPFVFNSHILKRVGRTSEAKESARVALKSPWWSLGCRYEEAAE  267

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKVT+EG+++DLKKGK P Q+ LDEAAFL+DLA++DG WDD ++RIA
Sbjct  268  LAGWEDEQIEFIREKVTEEGKRDDLKKGKAPEQVVLDEAAFLMDLATVDGNWDDVVDRIA  327

Query  611  ECYKDAGLHDIASFVVYRD  667
            ECY++AG+HDIA F+ YR+
Sbjct  328  ECYREAGIHDIAKFIAYRE  346



>ref|NP_567951.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK48971.1|AF370544_1 cyclin delta-3 [Arabidopsis thaliana]
 gb|AAM10060.1| cyclin delta-3 [Arabidopsis thaliana]
 dbj|BAF01023.1| cyclin delta-3 [Arabidopsis thaliana]
 gb|AEE86319.1| uncharacterized protein AT4G34090 [Arabidopsis thaliana]
Length=330

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRNVEAKDA R AL+SPWWTLGC Y++VA+
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNVEAKDAARVALRSPWWTLGCPYEEVAS  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  252  IAQWEDEQIEFIREKVSDEGRFEDLHKGKAPIQVALDVAAFLLDLASIEGTWSESLNHIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH I++FV+Y D
Sbjct  312  KCYEEAGLHHISNFVLYTD  330



>ref|NP_974678.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86320.1| uncharacterized protein AT4G34090 [Arabidopsis thaliana]
Length=331

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRNVEAKDA R AL+SPWWTLGC Y++VA+
Sbjct  193  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNVEAKDAARVALRSPWWTLGCPYEEVAS  252

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  253  IAQWEDEQIEFIREKVSDEGRFEDLHKGKAPIQVALDVAAFLLDLASIEGTWSESLNHIA  312

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH I++FV+Y D
Sbjct  313  KCYEEAGLHHISNFVLYTD  331



>gb|KFK30035.1| hypothetical protein AALP_AA7G209100 [Arabis alpina]
Length=329

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            ++TGEFY+R + FPGFGRPFV+ A +L +VGRN EAKDA R ALKSPWWTLGC Y++VA+
Sbjct  191  MITGEFYSRTDLFPGFGRPFVYYANILQKVGRNSEAKDAARVALKSPWWTLGCPYEEVAS  250

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDLKKGKDP Q++LD AAFLLDLASI+G W + L+ IA
Sbjct  251  IAQWEDEQIEFIREKVSDEGRFEDLKKGKDPIQVSLDVAAFLLDLASIEGTWSESLDHIA  310

Query  611  ECYKDAGLHDIASFVVYRD  667
             CY++ GLH I+ F++Y+D
Sbjct  311  TCYEEGGLHHISKFLLYKD  329



>ref|XP_010447154.1| PREDICTED: uncharacterized protein LOC104729832 isoform X2 [Camelina 
sativa]
Length=330

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRN EAKDA R ALKSPWWTLGC Y+ VA+
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNSEAKDAARVALKSPWWTLGCPYKDVAS  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + L +IA
Sbjct  252  IAQWEDEQIEFIREKVSDEGRLEDLTKGKAPVQVALDVAAFLLDLASIEGTWSESLNQIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGLH I++FV+Y +
Sbjct  312  KCYKEAGLHHISNFVLYTE  330



>ref|XP_010070363.1| PREDICTED: uncharacterized protein LOC104457120 [Eucalyptus grandis]
 gb|KCW59068.1| hypothetical protein EUGRSUZ_H01690 [Eucalyptus grandis]
Length=356

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVT EFYT+K +FPGF RPFVFNA +LL+VGR +EAKDA RGALK PWW+LGC+Y+ VA 
Sbjct  218  LVTAEFYTKKENFPGFARPFVFNAVLLLKVGRCLEAKDAARGALKLPWWSLGCKYEDVAE  277

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+WEDEQIE +KEK+T+ GR+EDL KGK P QIALDEAAFL+DLAS+ G WDD ++RI 
Sbjct  278  IAEWEDEQIERIKEKITERGREEDLMKGKPPVQIALDEAAFLMDLASVKGTWDDSVDRIG  337

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLHDIA FV Y++
Sbjct  338  KCYEEAGLHDIAQFVRYQE  356



>ref|XP_009138260.1| PREDICTED: uncharacterized protein LOC103862318 [Brassica rapa]
Length=329

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYTRK+ FPGFGRPFV+ A +L +VGR+ EAK+A R ALKSPWWTLGC Y++VA+
Sbjct  189  MVTGEFYTRKDLFPGFGRPFVYYANILQKVGRDSEAKEAARVALKSPWWTLGCPYEEVAS  248

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDLKKGKDP Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  249  IAQWEDEQIEFIREKVSDEGRFEDLKKGKDPIQVALDVAAFLLDLASIEGTWSESLHHIA  308

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL D+++F++Y D
Sbjct  309  KCYEEAGLKDMSNFILYTD  327



>ref|XP_010437674.1| PREDICTED: uncharacterized protein LOC104721401 isoform X2 [Camelina 
sativa]
Length=330

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRN EAKDA R ALKSPWWTLGC Y+ VA+
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNSEAKDAARVALKSPWWTLGCPYEDVAS  251

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + L +IA
Sbjct  252  IAQWEDEQIEFIREKVSDEGRLEDLTKGKAPVQVALDVAAFLLDLASIEGTWSESLNQIA  311

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH I++FV+Y +
Sbjct  312  KCYEEAGLHHISNFVLYTE  330



>emb|CAA17563.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80126.1| hypothetical protein [Arabidopsis thaliana]
Length=377

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRNVEAKDA R AL+SPWWTLGC Y++VA+
Sbjct  239  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNVEAKDAARVALRSPWWTLGCPYEEVAS  298

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  299  IAQWEDEQIEFIREKVSDEGRFEDLHKGKAPIQVALDVAAFLLDLASIEGTWSESLNHIA  358

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH I++FV+Y D
Sbjct  359  KCYEEAGLHHISNFVLYTD  377



>dbj|BAJ98894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFN+EV  RVGR  EAK++ R ALKSPWWTLGC Y++ A 
Sbjct  220  LITGEFYTR-DQFPGFGRPFVFNSEVQKRVGRTSEAKESARVALKSPWWTLGCRYEEAAE  278

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A WEDEQIEF++EKV++EG+Q+DLKKGK P Q+ LDEAAFL+DLA++DG WD+ ++RIA
Sbjct  279  LAGWEDEQIEFIREKVSEEGKQDDLKKGKAPEQVVLDEAAFLMDLATVDGNWDEVVDRIA  338

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AG+HDIA F+ YR+
Sbjct  339  DCYREAGIHDIAKFIAYRE  357



>ref|XP_008808158.1| PREDICTED: uncharacterized protein LOC103720295 isoform X2 [Phoenix 
dactylifera]
Length=353

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 8/146 (5%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ----  418
            LVTGEFYTR NHFPGFGRPF+ +A +LL+VGR +EAKDA RGALKSPWWTLGC YQ    
Sbjct  209  LVTGEFYTR-NHFPGFGRPFIVHAVLLLKVGRKLEAKDAARGALKSPWWTLGCTYQLHAS  267

Query  419  ---KVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWD  589
               + A +A+WEDEQIE++KEKVT+EGRQEDLKKGK   Q+ALDEAAFLLDLAS+DG WD
Sbjct  268  PAQEAAEIAEWEDEQIEYIKEKVTEEGRQEDLKKGKAREQVALDEAAFLLDLASVDGTWD  327

Query  590  DYLERIAECYKDAGLHDIASFVVYRD  667
              ++R+AECY++AGL+DIA F++ ++
Sbjct  328  KAVDRVAECYREAGLNDIARFILCKE  353



>ref|XP_008808157.1| PREDICTED: uncharacterized protein LOC103720295 isoform X1 [Phoenix 
dactylifera]
Length=357

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 8/146 (5%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ----  418
            LVTGEFYTR NHFPGFGRPF+ +A +LL+VGR +EAKDA RGALKSPWWTLGC YQ    
Sbjct  213  LVTGEFYTR-NHFPGFGRPFIVHAVLLLKVGRKLEAKDAARGALKSPWWTLGCTYQLHAS  271

Query  419  ---KVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWD  589
               + A +A+WEDEQIE++KEKVT+EGRQEDLKKGK   Q+ALDEAAFLLDLAS+DG WD
Sbjct  272  PAQEAAEIAEWEDEQIEYIKEKVTEEGRQEDLKKGKAREQVALDEAAFLLDLASVDGTWD  331

Query  590  DYLERIAECYKDAGLHDIASFVVYRD  667
              ++R+AECY++AGL+DIA F++ ++
Sbjct  332  KAVDRVAECYREAGLNDIARFILCKE  357



>ref|XP_010447153.1| PREDICTED: uncharacterized protein LOC104729832 isoform X1 [Camelina 
sativa]
Length=335

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 5/144 (3%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-----LRVGRNVEAKDAVRGALKSPWWTLGCEY  415
            +VTGEFYT+K+ FPGFGRPFV+ A +L      RVGRN EAKDA R ALKSPWWTLGC Y
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKILICRVGRNSEAKDAARVALKSPWWTLGCPY  251

Query  416  QKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDY  595
            + VA++AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + 
Sbjct  252  KDVASIAQWEDEQIEFIREKVSDEGRLEDLTKGKAPVQVALDVAAFLLDLASIEGTWSES  311

Query  596  LERIAECYKDAGLHDIASFVVYRD  667
            L +IA+CYK+AGLH I++FV+Y +
Sbjct  312  LNQIAKCYKEAGLHHISNFVLYTE  335



>ref|XP_010667420.1| PREDICTED: uncharacterized protein LOC104884469 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=340

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K HFPGFGRP  FNA++LL++GR++EA+ A RGALKSPWWTLG +YQ+VA 
Sbjct  202  LVTGEFYAKKQHFPGFGRPSAFNAQILLKIGRDLEAQGAARGALKSPWWTLGFQYQEVAE  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A W+DEQI +VK+K+T+EG+QEDLK GK+ AQ+ALD+AAFLLDLAS++G WDD+++RI 
Sbjct  262  IANWKDEQICYVKKKLTEEGKQEDLKNGKELAQLALDQAAFLLDLASVEGNWDDFVDRIG  321

Query  611  ECYKDAGLHDIASFVVYR  664
            ECYK+A LH +A F+ Y+
Sbjct  322  ECYKEASLHGMARFIAYK  339



>ref|XP_011000807.1| PREDICTED: uncharacterized protein LOC105108231 isoform X6 [Populus 
euphratica]
Length=314

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 31/170 (18%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-------------------------------LR  337
            +VTGEFYT+K+ FPGFGRPFVF AE+L                                R
Sbjct  145  MVTGEFYTKKDLFPGFGRPFVFYAEILKKFVEIFSEHFHVFQVLHFFFSQPNLFNYFLFR  204

Query  338  VGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGK  517
            VGR  EAKDA R ALKSPWWTLGC YQ+VA +AQWEDEQIE++KEKV++EGRQEDLKKGK
Sbjct  205  VGRTSEAKDAARVALKSPWWTLGCAYQEVAGIAQWEDEQIEYIKEKVSEEGRQEDLKKGK  264

Query  518  DPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
              AQIALDEAAFLLDLASI G WD+ LERIAECY++AG  +IA F++Y+D
Sbjct  265  AAAQIALDEAAFLLDLASIKGTWDNVLERIAECYREAGFDEIARFILYKD  314



>ref|XP_011000787.1| PREDICTED: uncharacterized protein LOC105108231 isoform X3 [Populus 
euphratica]
Length=355

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 31/170 (18%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-------------------------------LR  337
            +VTGEFYT+K+ FPGFGRPFVF AE+L                                R
Sbjct  186  MVTGEFYTKKDLFPGFGRPFVFYAEILKKFVEIFSEHFHVFQVLHFFFSQPNLFNYFLFR  245

Query  338  VGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGK  517
            VGR  EAKDA R ALKSPWWTLGC YQ+VA +AQWEDEQIE++KEKV++EGRQEDLKKGK
Sbjct  246  VGRTSEAKDAARVALKSPWWTLGCAYQEVAGIAQWEDEQIEYIKEKVSEEGRQEDLKKGK  305

Query  518  DPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
              AQIALDEAAFLLDLASI G WD+ LERIAECY++AG  +IA F++Y+D
Sbjct  306  AAAQIALDEAAFLLDLASIKGTWDNVLERIAECYREAGFDEIARFILYKD  355



>ref|XP_011000779.1| PREDICTED: uncharacterized protein LOC105108231 isoform X2 [Populus 
euphratica]
Length=370

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 31/170 (18%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-------------------------------LR  337
            +VTGEFYT+K+ FPGFGRPFVF AE+L                                R
Sbjct  201  MVTGEFYTKKDLFPGFGRPFVFYAEILKKFVEIFSEHFHVFQVLHFFFSQPNLFNYFLFR  260

Query  338  VGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGK  517
            VGR  EAKDA R ALKSPWWTLGC YQ+VA +AQWEDEQIE++KEKV++EGRQEDLKKGK
Sbjct  261  VGRTSEAKDAARVALKSPWWTLGCAYQEVAGIAQWEDEQIEYIKEKVSEEGRQEDLKKGK  320

Query  518  DPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
              AQIALDEAAFLLDLASI G WD+ LERIAECY++AG  +IA F++Y+D
Sbjct  321  AAAQIALDEAAFLLDLASIKGTWDNVLERIAECYREAGFDEIARFILYKD  370



>ref|XP_010437673.1| PREDICTED: uncharacterized protein LOC104721401 isoform X1 [Camelina 
sativa]
Length=335

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 118/144 (82%), Gaps = 5/144 (3%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-----LRVGRNVEAKDAVRGALKSPWWTLGCEY  415
            +VTGEFYT+K+ FPGFGRPFV+ A +L      RVGRN EAKDA R ALKSPWWTLGC Y
Sbjct  192  MVTGEFYTKKDLFPGFGRPFVYYANILQKILICRVGRNSEAKDAARVALKSPWWTLGCPY  251

Query  416  QKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDY  595
            + VA++AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + 
Sbjct  252  EDVASIAQWEDEQIEFIREKVSDEGRLEDLTKGKAPVQVALDVAAFLLDLASIEGTWSES  311

Query  596  LERIAECYKDAGLHDIASFVVYRD  667
            L +IA+CY++AGLH I++FV+Y +
Sbjct  312  LNQIAKCYEEAGLHHISNFVLYTE  335



>ref|XP_011000770.1| PREDICTED: uncharacterized protein LOC105108231 isoform X1 [Populus 
euphratica]
Length=378

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 31/170 (18%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-------------------------------LR  337
            +VTGEFYT+K+ FPGFGRPFVF AE+L                                R
Sbjct  209  MVTGEFYTKKDLFPGFGRPFVFYAEILKKFVEIFSEHFHVFQVLHFFFSQPNLFNYFLFR  268

Query  338  VGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGK  517
            VGR  EAKDA R ALKSPWWTLGC YQ+VA +AQWEDEQIE++KEKV++EGRQEDLKKGK
Sbjct  269  VGRTSEAKDAARVALKSPWWTLGCAYQEVAGIAQWEDEQIEYIKEKVSEEGRQEDLKKGK  328

Query  518  DPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
              AQIALDEAAFLLDLASI G WD+ LERIAECY++AG  +IA F++Y+D
Sbjct  329  AAAQIALDEAAFLLDLASIKGTWDNVLERIAECYREAGFDEIARFILYKD  378



>ref|XP_010432472.1| PREDICTED: uncharacterized protein LOC104716744 [Camelina sativa]
Length=336

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 118/144 (82%), Gaps = 5/144 (3%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL-----LRVGRNVEAKDAVRGALKSPWWTLGCEY  415
            +VTGEFYT+K+ FPGFGRPFV+ A +L      RVGRN EAKDA R ALKSPWWTLGC Y
Sbjct  193  MVTGEFYTKKDLFPGFGRPFVYYANILQKILICRVGRNSEAKDAARVALKSPWWTLGCPY  252

Query  416  QKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDY  595
            + VA++AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W + 
Sbjct  253  EDVASIAQWEDEQIEFIREKVSDEGRLEDLTKGKAPVQVALDVAAFLLDLASIEGTWSES  312

Query  596  LERIAECYKDAGLHDIASFVVYRD  667
            L +IA+CY++AGLH I++FV+Y +
Sbjct  313  LNQIAKCYEEAGLHHISNFVLYTE  336



>ref|XP_010531250.1| PREDICTED: uncharacterized protein LOC104807591 [Tarenaya hassleriana]
Length=338

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFY +K +FPGF RPF FNAEVLL++GR++EAKDA RGALKS WWTLGCEY+ VA 
Sbjct  200  LVAAEFYAKKGNFPGFARPFAFNAEVLLKIGRSLEAKDAARGALKSSWWTLGCEYENVAR  259

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W ++QIE  KE+VT+EGRQ DL++GK  AQ +LD+AAFLLDLAS++G WD+ LE IA
Sbjct  260  IAEWGNKQIEEYKERVTEEGRQRDLERGKPAAQASLDKAAFLLDLASLEGIWDESLELIA  319

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL DIA+FV+YRD
Sbjct  320  QCYKEAGLTDIANFVLYRD  338



>ref|NP_001190908.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86321.1| uncharacterized protein AT4G34090 [Arabidopsis thaliana]
Length=390

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 6/145 (4%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVL------LRVGRNVEAKDAVRGALKSPWWTLGCE  412
            +VTGEFYT+K+ FPGFGRPFV+ A +L       RVGRNVEAKDA R AL+SPWWTLGC 
Sbjct  246  MVTGEFYTKKDLFPGFGRPFVYYANILQKFILIRRVGRNVEAKDAARVALRSPWWTLGCP  305

Query  413  YQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDD  592
            Y++VA++AQWEDEQIEF++EKV+ EGR EDL KGK P Q+ALD AAFLLDLASI+G W +
Sbjct  306  YEEVASIAQWEDEQIEFIREKVSDEGRFEDLHKGKAPIQVALDVAAFLLDLASIEGTWSE  365

Query  593  YLERIAECYKDAGLHDIASFVVYRD  667
             L  IA+CY++AGLH I++FV+Y D
Sbjct  366  SLNHIAKCYEEAGLHHISNFVLYTD  390



>ref|NP_850040.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM14060.1| unknown protein [Arabidopsis thaliana]
 gb|AAM76747.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM91667.1| unknown protein [Arabidopsis thaliana]
 gb|AAX55123.1| hypothetical protein At2g23370 [Arabidopsis thaliana]
 gb|AEC07448.1| uncharacterized protein AT2G23370 [Arabidopsis thaliana]
Length=340

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GRN+EAKDA RGALKS WWTLGC Y+++A 
Sbjct  202  LVATEFYTKRGNFPGFARPFAFNAKVLLKLGRNLEAKDAARGALKSSWWTLGCRYEEIAQ  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KE+VT EG+Q D+ +GK  AQ +LDEAAFLL+LAS++G WD+ LER+A
Sbjct  262  IAEWGEEQIAQYKERVTGEGKQRDIDRGKPMAQASLDEAAFLLNLASLEGTWDESLERVA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV+YRD
Sbjct  322  QCYKEAGLNDIAKFVLYRD  340



>gb|ACR33997.1| unknown [Zea mays]
Length=328

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 115/170 (68%), Gaps = 32/170 (19%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  160  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  218

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflld----------------  562
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+A +    L                  
Sbjct  219  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVADESLLNLSHDRVQLFLGWLHCLCCS  278

Query  563  ---------------laSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
                           LAS+DG WD+ ++RIAECY++AGLHDIA+F+ YR+
Sbjct  279  GALQVILDEAAFLMDLASVDGNWDEVVDRIAECYREAGLHDIANFIAYRE  328



>gb|AFW89846.1| hypothetical protein ZEAMMB73_484803 [Zea mays]
Length=364

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 115/170 (68%), Gaps = 32/170 (19%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  196  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  254

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflld----------------  562
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+A +    L                  
Sbjct  255  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVADESLLNLSHDRVQLFLGWLHCLCCS  314

Query  563  ---------------laSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
                           LAS+DG WD+ ++RIAECY++AGLHDIA+F+ YR+
Sbjct  315  GALQVILDEAAFLMDLASVDGNWDEVVDRIAECYREAGLHDIANFIAYRE  364



>ref|XP_008658134.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=375

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 115/170 (68%), Gaps = 32/170 (19%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFYTR + FPGFGRPFVFNAE+  RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  207  LITGEFYTR-DQFPGFGRPFVFNAEIFKRVGRTSEAKDSARVALKSPWWTLGCSYEEAAE  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflld----------------  562
            +A WEDEQ+EF++EKVT+EG++EDLK+GK P Q+A +    L                  
Sbjct  266  LAGWEDEQLEFIREKVTEEGKREDLKRGKAPEQVADESLLNLSHDRVQLFLGWLHCLCCS  325

Query  563  ---------------laSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
                           LAS+DG WD+ ++RIAECY++AGLHDIA+F+ YR+
Sbjct  326  GALQVILDEAAFLMDLASVDGNWDEVVDRIAECYREAGLHDIANFIAYRE  375



>emb|CDY67853.1| BnaCnng56670D [Brassica napus]
Length=342

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGALKS WWTLGC Y+++A 
Sbjct  204  LVAAEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALKSSWWTLGCRYEEIAR  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KEKVT EGRQ D+ +GK  AQ + DEA  LLDLAS++G WD+  ER+A
Sbjct  264  IAEWGEEQIVQYKEKVTGEGRQRDISRGKPRAQASYDEAGLLLDLASLEGTWDESRERVA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYKDAGL+D+A+FV+YRD
Sbjct  324  QCYKDAGLNDMANFVLYRD  342



>emb|CDY46077.1| BnaA09g42010D [Brassica napus]
Length=342

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA VLL++GR++EAKDA RGALKS WWTLGC Y+++A 
Sbjct  204  LVAAEFYTKRGNFPGFARPFAFNARVLLKLGRSLEAKDAARGALKSSWWTLGCRYEEIAR  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KEKVT EGRQ D+ +GK  AQ + DEA  LLDLAS++G WD+  ER+A
Sbjct  264  IAEWGEEQIVQYKEKVTGEGRQRDISRGKPRAQASYDEAGLLLDLASLEGTWDESRERVA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYKDAGL+D+A+FV+YRD
Sbjct  324  QCYKDAGLNDMANFVLYRD  342



>gb|KFK32748.1| cyclin delta-3 [Arabis alpina]
Length=342

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPG  RPF FNA+VLL++GR++EAKDA RGALKS WWTLGC+Y+++A 
Sbjct  204  LVASEFYTKRGNFPGSARPFAFNAKVLLKLGRSLEAKDAARGALKSSWWTLGCKYEEIAR  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W DEQI   KE+VT EGRQ D+ +GK  AQ +LDEAAFLLDLAS++G WDD LER+A
Sbjct  264  IAEWGDEQIVQYKERVTGEGRQRDIDRGKPRAQASLDEAAFLLDLASLEGTWDDSLERVA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV++RD
Sbjct  324  QCYKEAGLNDIAKFVLHRD  342



>ref|XP_009802499.1| PREDICTED: uncharacterized protein LOC104248022 isoform X2 [Nicotiana 
sylvestris]
Length=316

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGR+VEAKDA RGALKSPWWTLGCEY +VAN
Sbjct  205  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRSVEAKDAARGALKSPWWTLGCEYHEVAN  264

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQ  529
            +A+WEDEQIE++KEKVT+EGRQ DLKKGK+PAQ
Sbjct  265  IAEWEDEQIEYIKEKVTEEGRQADLKKGKEPAQ  297



>ref|XP_010417089.1| PREDICTED: uncharacterized protein LOC104702868 [Camelina sativa]
Length=340

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGAL S WWTLGC Y+++A 
Sbjct  202  LVAAEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALTSSWWTLGCRYEEIAR  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KE++T EGRQ D+++GK  +Q  LDEA+FLL+LAS++G WD+ L+R+A
Sbjct  262  IAEWGEEQIVKYKERITGEGRQRDIERGKPMSQAFLDEASFLLNLASLEGTWDESLDRVA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV+YRD
Sbjct  322  QCYKEAGLNDIAKFVLYRD  340



>ref|XP_010429287.1| PREDICTED: uncharacterized protein LOC104713781 [Camelina sativa]
Length=340

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGAL S WWTLGC Y+++A 
Sbjct  202  LVAAEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALTSSWWTLGCRYEEIAQ  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KE++T EGRQ D+++GK  +Q  LDEA+FLL+LAS++G WD+ L+R+A
Sbjct  262  IAEWGEEQIVKYKERITGEGRQRDIERGKPMSQAFLDEASFLLNLASLEGTWDESLDRVA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV+YRD
Sbjct  322  QCYKEAGLNDIAKFVLYRD  340



>ref|XP_002967054.1| hypothetical protein SELMODRAFT_168968 [Selaginella moellendorffii]
 gb|EFJ31653.1| hypothetical protein SELMODRAFT_168968 [Selaginella moellendorffii]
Length=360

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY  K HFPGFGRP VFNAE++L++GR  EAKDA R ALKSPWWTLGCEY+ VA 
Sbjct  220  LVTGEFYVTKKHFPGFGRPLVFNAELMLKIGRKSEAKDAARIALKSPWWTLGCEYKTVAE  279

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A W DE++E+++EK+T+EGR+E+L KGK P Q+ALD+AAFLLDL ++DG WD+  E++A
Sbjct  280  IAGWGDEKVEYMREKMTEEGRKEELNKGKAPEQVALDQAAFLLDLGTVDGNWDEISEKLA  339

Query  611  ECYKDAGLHDIASFVVYRD  667
              Y +AGL  IA FV  + 
Sbjct  340  SFYTEAGLDTIAKFVALQS  358



>ref|XP_009117283.1| PREDICTED: uncharacterized protein LOC103842416 [Brassica rapa]
Length=342

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGALKS WWTLGC Y+++A 
Sbjct  204  LVAAEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALKSSWWTLGCRYEEIAL  263

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KEK+T E RQ D+ +GK  AQ + DEA  LLDLAS++G WD+  ER+A
Sbjct  264  IAEWGEEQIVQYKEKLTGERRQRDISRGKPRAQASYDEAGLLLDLASLEGTWDESRERVA  323

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYKDAGL+D+A+FV+YRD
Sbjct  324  QCYKDAGLNDMANFVLYRD  342



>ref|XP_002960953.1| hypothetical protein SELMODRAFT_74342, partial [Selaginella moellendorffii]
 gb|EFJ38492.1| hypothetical protein SELMODRAFT_74342, partial [Selaginella moellendorffii]
Length=378

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY  K HFPGFGRP VFNAE++L++GR  EAKDA R ALKSPWWTLGCEY+ VA 
Sbjct  169  LVTGEFYVTKKHFPGFGRPLVFNAELMLKIGRKSEAKDAARIALKSPWWTLGCEYETVAE  228

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A W DE++E+++EK+T+EGR+E+L KGK P Q+ALD+AAFLLDL ++DG WD+  E++A
Sbjct  229  IAGWGDEKVEYMREKMTEEGRKEELNKGKAPEQVALDQAAFLLDLGTVDGNWDEISEKLA  288

Query  611  ECYKDAGLHDIASFVVYRD  667
              Y +AGL  IA FV  + 
Sbjct  289  SFYTEAGLDTIAKFVALQS  307



>ref|XP_006296258.1| hypothetical protein CARUB_v10025424mg [Capsella rubella]
 gb|EOA29156.1| hypothetical protein CARUB_v10025424mg [Capsella rubella]
Length=340

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGAL S WWTLGC Y+++A+
Sbjct  202  LVAAEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALTSSWWTLGCRYEEIAH  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W +EQI   KE++T EGRQ D+ +GK  +Q  LDEAAFLL+LAS++G W++ L+R+A
Sbjct  262  IAEWGEEQIVKYKERITGEGRQRDIDRGKPISQAYLDEAAFLLNLASLEGTWEESLDRVA  321

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV+YRD
Sbjct  322  QCYKEAGLNDIAKFVLYRD  340



>ref|XP_002880495.1| hypothetical protein ARALYDRAFT_481207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56754.1| hypothetical protein ARALYDRAFT_481207 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  EFYT++ +FPGF RPF FNA+VLL++GR++EAKDA RGALKS WWTLG  Y+++A 
Sbjct  203  LVATEFYTKRGNFPGFARPFAFNAKVLLKLGRSLEAKDAARGALKSSWWTLGYRYEEIAR  262

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A+W DEQI   KE+VT EG+Q D+ +GK  AQ +LDEAAFLL+LAS++G WD+ L+ +A
Sbjct  263  IAEWGDEQIAQYKERVTGEGKQRDIDRGKPMAQASLDEAAFLLNLASLEGTWDESLDLVA  322

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CYK+AGL+DIA FV+YRD
Sbjct  323  QCYKEAGLNDIAKFVLYRD  341



>ref|XP_006404823.1| hypothetical protein EUTSA_v10000243mg [Eutrema salsugineum]
 gb|ESQ46276.1| hypothetical protein EUTSA_v10000243mg [Eutrema salsugineum]
Length=327

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 11/150 (7%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLL-----------RVGRNVEAKDAVRGALKSPWW  397
            LV  EFYT++ +FPGF RPF FNA+VLL           R+GR++EAKDA RGALKS WW
Sbjct  178  LVAAEFYTKRGNFPGFARPFAFNAKVLLKFKSLRPLLVCRLGRSLEAKDAARGALKSSWW  237

Query  398  TLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSID  577
            TLGC Y+++A +A+W +E+I   KE+VT EGR+ D+ +GK  AQ + DEA +LLDLAS++
Sbjct  238  TLGCRYEEIARIAEWGEEKIVQYKERVTGEGRKRDIDRGKPRAQASFDEAGYLLDLASLE  297

Query  578  GKWDDYLERIAECYKDAGLHDIASFVVYRD  667
            G WD+ LER+A+CYK+AGL DIA+FV+YRD
Sbjct  298  GTWDESLERVAQCYKEAGLEDIANFVLYRD  327



>gb|AFK48141.1| unknown [Medicago truncatula]
Length=113

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  329  LLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLK  508
            +LRVGR VEAKDA RGALKSPWWTLGC Y+ VA++AQW+DEQIE++KEKVT+EGRQEDLK
Sbjct  1    MLRVGRKVEAKDAARGALKSPWWTLGCMYRDVADIAQWDDEQIEYIKEKVTEEGRQEDLK  60

Query  509  KGKDPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYR  664
            KGK PAQ+ LDEAAFLLDLASI+G WD YLERI +CY++ GL DIA F++Y+
Sbjct  61   KGKAPAQVVLDEAAFLLDLASIEGNWDGYLERIGKCYEEGGLDDIAKFILYK  112



>ref|XP_001777349.1| predicted protein [Physcomitrella patens]
 gb|EDQ57879.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVT E+Y  K HFPGFGRPFVFNAE++L+VGR +EAKDA R AL+SPWWTLG  Y  VAN
Sbjct  215  LVTAEYYASKKHFPGFGRPFVFNAELMLKVGRKLEAKDAARCALRSPWWTLGSWYADVAN  274

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A W +EQIEF++E++T+EGR+EDL KGK   Q+A+D+AAFLLDLA+++G WD   E++A
Sbjct  275  IAGWGEEQIEFMRERLTEEGRREDLLKGKSLEQVAVDQAAFLLDLAAVEGTWDAVREQLA  334

Query  611  ECYKDAGLHDIASFV  655
            + YK+ G  DI+ F+
Sbjct  335  DYYKEGGFDDISRFI  349



>emb|CDX72448.1| BnaC07g44700D [Brassica napus]
Length=317

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 107/139 (77%), Gaps = 15/139 (11%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYTRK+ FPGFGRPFV+ A +L +VGR+ EAK+A R               +VA+
Sbjct  192  MVTGEFYTRKDLFPGFGRPFVYYANILQKVGRDSEAKEAAR---------------EVAS  236

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDLKKGKDP Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  237  IAQWEDEQIEFIREKVSDEGRFEDLKKGKDPIQVALDVAAFLLDLASIEGTWSESLHHIA  296

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL DI++F++Y D
Sbjct  297  KCYEEAGLKDISNFILYTD  315



>ref|XP_001771744.1| predicted protein [Physcomitrella patens]
 gb|EDQ63352.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGE+Y  K HFPGFGRP+VFNAE++L+VGR  EA+DA R AL+SPWWTLG  Y  VA 
Sbjct  210  LVTGEYYASKRHFPGFGRPYVFNAELMLKVGRKKEARDAARCALRSPWWTLGSSYADVAR  269

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +A   + QI+ ++E+ + EGRQEDL KGK   Q+A+D+A  LLDLA+++  WDD  E++A
Sbjct  270  IANCGESQIKLMRERASDEGRQEDLLKGKSLEQVAVDQAGVLLDLAAVECTWDDVREQLA  329

Query  611  ECYKDAGLHDIASFV  655
              YK+ GL DI+ FV
Sbjct  330  SHYKEGGLEDISRFV  344



>emb|CAN79542.1| hypothetical protein VITISV_025321 [Vitis vinifera]
Length=318

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 23/140 (16%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAE-VLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVA  427
            LVTGEFYT+K+ FPGFGRPFVFNAE V++ VGR+                      Q+VA
Sbjct  201  LVTGEFYTKKDLFPGFGRPFVFNAEGVVISVGRD----------------------QEVA  238

Query  428  NMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERI  607
             +AQWEDEQIE++KEKVT+EGR EDLKKGK PAQ+ALDEAAFLLDLAS++G W D LERI
Sbjct  239  CIAQWEDEQIEYIKEKVTEEGRNEDLKKGKAPAQVALDEAAFLLDLASVEGTWADSLERI  298

Query  608  AECYKDAGLHDIASFVVYRD  667
            AECYK+AGL++IA F++Y D
Sbjct  299  AECYKEAGLNEIARFILYND  318



>emb|CDY49273.1| BnaA03g50860D [Brassica napus]
Length=317

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 107/139 (77%), Gaps = 15/139 (11%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFYTRK+ FPGFGRPFV+ A +L +VGR+ EAK+A R               +VA+
Sbjct  192  MVTGEFYTRKDLFPGFGRPFVYYANILQKVGRDSEAKEAAR---------------EVAS  236

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
            +AQWEDEQIEF++EKV+ EGR EDLKKGKDP Q+ALD AAFLLDLASI+G W + L  IA
Sbjct  237  IAQWEDEQIEFIREKVSDEGRFEDLKKGKDPIQVALDVAAFLLDLASIEGTWSESLHHIA  296

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGL D+++F++Y D
Sbjct  297  KCYEEAGLKDMSNFILYTD  315



>gb|AGT16437.1| hypothetical protein SHCRBa_062_I05_F_60 [Saccharum hybrid cultivar 
R570]
Length=330

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+TGEFY+R + FPGFGRPFVFNAE+L RVGR  EAKD+ R ALKSPWWTLGC Y++ A 
Sbjct  233  LITGEFYSR-DQFPGFGRPFVFNAEILKRVGRKSEAKDSARVALKSPWWTLGCSYEEAAE  291

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQI  532
            +A WEDEQ+EF++EKVT+EG++EDLKKGK P Q+
Sbjct  292  LAGWEDEQLEFIREKVTEEGKREDLKKGKAPEQV  325



>ref|XP_008457753.1| PREDICTED: uncharacterized protein LOC103497369 isoform X2 [Cucumis 
melo]
Length=307

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 91/139 (65%), Gaps = 37/139 (27%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFYT+K HFPGF RP+VFNAEVLL+VGR  EAKDA RGALKSPWWTLGC+Y+   +
Sbjct  206  LVTGEFYTKKEHFPGFARPYVFNAEVLLKVGRKTEAKDAARGALKSPWWTLGCKYEVALD  265

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYLERIA  610
             A +                                     LLDLAS+DG WD+Y+ERIA
Sbjct  266  QAAF-------------------------------------LLDLASVDGTWDNYVERIA  288

Query  611  ECYKDAGLHDIASFVVYRD  667
            +CY++AGLH+IA+FV+YRD
Sbjct  289  QCYEEAGLHEIATFVLYRD  307



>ref|XP_010667421.1| PREDICTED: uncharacterized protein LOC104884469 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=298

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LVTGEFY +K HFPGFGRP  FNA++LL++GR++EA+ A RGALKSPWWTLG +YQ+VA 
Sbjct  202  LVTGEFYAKKQHFPGFGRPSAFNAQILLKIGRDLEAQGAARGALKSPWWTLGFQYQEVAE  261

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQI  532
            +A W+DEQI +VK+K+T+EG+QEDLK GK+ AQ+
Sbjct  262  IANWKDEQICYVKKKLTEEGKQEDLKNGKELAQL  295



>gb|AAN61482.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=299

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 100/143 (70%), Gaps = 25/143 (17%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEY----Q  418
            L+TGEFYTR + FPGFGRPFVFNAE+L R+                      C Y     
Sbjct  178  LITGEFYTR-DQFPGFGRPFVFNAEILKRLSL--------------------CSYATYEH  216

Query  419  KVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYL  598
            + A +A WEDEQIEF++EKV++EG++EDLKKGK P Q+ LDEAAFL+DLAS+DG WDD +
Sbjct  217  EAAELAGWEDEQIEFIREKVSEEGKREDLKKGKAPEQVVLDEAAFLMDLASVDGNWDDVV  276

Query  599  ERIAECYKDAGLHDIASFVVYRD  667
            +RIA CY++AGL DIA F+ YR+
Sbjct  277  DRIAGCYREAGLDDIAKFIAYRE  299



>ref|XP_010474424.1| PREDICTED: uncharacterized protein LOC104753946 [Camelina sativa]
Length=297

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  335  RVGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKG  514
            R+GR++EAKDA RGAL S WWTLGC Y+++A +A+W +EQI   KE++T EGRQ D+++G
Sbjct  187  RLGRSLEAKDAARGALTSSWWTLGCRYEEIARIAEWGEEQIVKYKERITGEGRQRDIERG  246

Query  515  KDPAQIaldeaaflldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
            K  +Q  LDEA+FLL+LAS++G WD+ L+R+A+CYK+AGL+DIA FV+YRD
Sbjct  247  KPMSQAFLDEASFLLNLASLEGTWDESLDRVAQCYKEAGLNDIAKFVLYRD  297



>gb|EMS53122.1| hypothetical protein TRIUR3_03534 [Triticum urartu]
Length=224

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 108/159 (68%), Gaps = 20/159 (13%)
 Frame = +2

Query  248  PLVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVE-------------------AKDAV  370
             L+T EFYTR + FPGFGRPFVFN+EV  R    +                    ++++ 
Sbjct  67   ALITSEFYTR-DQFPGFGRPFVFNSEVQKRFTYILICSYVKKVYCKKYVKNDIFFSQNSY  125

Query  371  RGALKSPWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaa  550
             G L+     +  + ++ A +A WEDEQIEF++EKV++EG+Q+DLKKGK P Q+ LDEAA
Sbjct  126  WGILEYLMKYIENDKEEAAELAGWEDEQIEFIREKVSEEGKQDDLKKGKAPEQVVLDEAA  185

Query  551  flldlaSIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
            FL+DLA++DG WD+ ++RIA+CY++AG+HDIA F+ YR+
Sbjct  186  FLMDLATVDGNWDEVVDRIADCYREAGIHDIAQFIAYRE  224



>ref|XP_006369766.1| hypothetical protein POPTR_0001s31190g [Populus trichocarpa]
 gb|ERP66335.1| hypothetical protein POPTR_0001s31190g [Populus trichocarpa]
Length=202

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +VTGEFY +K  FPGFGRPFV   E+L R GR  E   A R ALKSPWWTLG      A 
Sbjct  102  MVTGEFYIKKGLFPGFGRPFVSYGEILQRAGRTSEV--AARVALKSPWWTLGS-----AG  154

Query  431  MAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQ  529
             AQWEDEQIE++KEKV++EGRQEDLKKGK  AQ
Sbjct  155  SAQWEDEQIEYIKEKVSEEGRQEDLKKGKAAAQ  187



>ref|XP_003625797.1| hypothetical protein MTR_7g104350 [Medicago truncatula]
Length=262

 Score =   110 bits (275),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFYT+K HFPGF RPFVFNAEV+LRVGR VEAKDA RGALKSPWWTLGC Y+
Sbjct  206  LVTGEFYTKKEHFPGFARPFVFNAEVMLRVGRKVEAKDAARGALKSPWWTLGCMYR  261


 Score = 39.7 bits (91),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGDDL  251
            VG+FPDV+ERK+K+HFD+GD +
Sbjct  182  VGIFPDVLERKVKRHFDEGDQV  203



>gb|KDO79159.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=304

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQ  265


 Score = 39.3 bits (90),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>gb|KDO79158.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=271

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQ  265


 Score = 39.3 bits (90),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>ref|XP_006425932.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
 gb|ESR39172.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
Length=271

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQ  265


 Score = 39.3 bits (90),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>ref|XP_006425931.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
 gb|ESR39171.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
Length=267

 Score =   110 bits (275),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFYT+K HFPGF RPFVFNAE+LL+VGRN+EAKDA RGALK PWWTLGC+YQ
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLKVGRNLEAKDAARGALKLPWWTLGCKYQ  265


 Score = 39.3 bits (90),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>gb|KDO59760.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
Length=268

 Score = 99.4 bits (246),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVA  427
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+  A
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYESPA  260


 Score = 37.0 bits (84),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+E K+ QHF++GD
Sbjct  178  VGLFPDVLEHKVTQHFEQGD  197



>gb|KDO59761.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
Length=274

 Score = 98.2 bits (243),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            LVTGEFY +K+ FPGFGRPFVFNAE++L+VGR  EAKD+ R ALKSPWWTLGC Y+
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKVGRISEAKDSARVALKSPWWTLGCAYE  257


 Score = 37.0 bits (84),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+E K+ QHF++GD
Sbjct  178  VGLFPDVLEHKVTQHFEQGD  197



>ref|XP_006284226.1| hypothetical protein CARUB_v10005385mg [Capsella rubella]
 gb|EOA17124.1| hypothetical protein CARUB_v10005385mg [Capsella rubella]
Length=293

 Score = 95.5 bits (236),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQ  418
            +VTGEFYT+K+ FPGFGRPFV+ A +L +VGRN EAKDA R ALKSPWWTLGC Y+
Sbjct  221  MVTGEFYTKKDLFPGFGRPFVYYANILQKVGRNSEAKDAARVALKSPWWTLGCSYE  276


 Score = 37.0 bits (84),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPD++ERK+ +HFD+GD
Sbjct  168  VGLFPDLLERKVLRHFDEGD  187



>ref|XP_005650544.1| hypothetical protein COCSUDRAFT_46456 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26000.1| hypothetical protein COCSUDRAFT_46456 [Coccomyxa subellipsoidea 
C-169]
Length=369

 Score =   100 bits (248),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 84/142 (59%), Gaps = 6/142 (4%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L+T E+YT KNHFPG+ RPF FNA +   + RN EA+D  R AL+ PWWTL   + + A 
Sbjct  227  LITAEWYTSKNHFPGWARPFEFNAHLYNSISRNEEARDGARIALRFPWWTLSGGFHETAA  286

Query  431  MAQWEDEQIEF-----VKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSI-DGKWDD  592
            +AQ  D   E      ++  + +EG    +   + P Q+A+DEA  LL+  +  +G WD 
Sbjct  287  LAQLPDTAAEVRKALDMQSSINKEGIPPGVAAARSPNQVAMDEADHLLNCVAAGEGDWDS  346

Query  593  YLERIAECYKDAGLHDIASFVV  658
              + +AE Y++AGL  +A FV+
Sbjct  347  VRQPLAEKYREAGLSAVADFVL  368


 Score = 30.0 bits (66),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGDDL  251
             G++PDV+ER    H  KGD +
Sbjct  203  AGMYPDVVERLAMNHVQKGDQM  224



>gb|KDP25008.1| hypothetical protein JCGZ_23991 [Jatropha curcas]
Length=271

 Score = 95.5 bits (236),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQK  421
            +VTGEFYT+K+ FPGFGRPFVF AEVL +VGR  EAKDA R ALKSPWWTLGC Y++
Sbjct  199  MVTGEFYTKKDLFPGFGRPFVFYAEVLKKVGRISEAKDAARVALKSPWWTLGCAYEQ  255


 Score = 32.0 bits (71),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPD++ERK+  HF++ D
Sbjct  175  VGLFPDLLERKVTCHFEQED  194



>gb|AAC23753.1| hypothetical protein [Arabidopsis thaliana]
Length=177

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  389  PWWTLGCEYQKVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldla  568
            P ++L  + Q++A +A+W +EQI   KE+VT EG+Q D+ +GK  AQ +LDEAAFLL+LA
Sbjct  85   PSFSLVNDPQEIAQIAEWGEEQIAQYKERVTGEGKQRDIDRGKPMAQASLDEAAFLLNLA  144

Query  569  SIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
            S++G WD+ LER+A+CYK+AGL+DIA FV+YRD
Sbjct  145  SLEGTWDESLERVAQCYKEAGLNDIAKFVLYRD  177



>ref|NP_001169944.1| uncharacterized protein LOC100383842 [Zea mays]
 gb|ACN35322.1| unknown [Zea mays]
Length=272

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L T EFY R   FPGFGR FVFNAE+L RVGR  EAKD+ R ALKS W TLGC +++ A 
Sbjct  148  LYTKEFYCRVQ-FPGFGRTFVFNAEILKRVGRTSEAKDSSRVALKSSWGTLGCSHEEAAE  206

Query  431  MAQWED  448
            +A   D
Sbjct  207  LASLVD  212



>ref|XP_008659734.1| PREDICTED: uncharacterized protein LOC103638669 [Zea mays]
Length=679

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            L T EFY R   FPGFGR  VFNAE+L RVG   EAKD+ R ALKSPW TLGC +++ A 
Sbjct  481  LYTREFYCRV-QFPGFGRTLVFNAEILKRVGCTSEAKDSSRVALKSPWETLGCSHEEAAE  539

Query  431  MAQWED  448
            +A   D
Sbjct  540  LASLLD  545



>gb|AFW81278.1| hypothetical protein ZEAMMB73_378371 [Zea mays]
Length=736

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVANM  433
            FPGFGRP+VFNAE++ RV    EAKD+ R ALKS WWTLGC Y++ A +
Sbjct  451  FPGFGRPYVFNAEMIKRVKHTSEAKDSARAALKSTWWTLGCSYEEDAEL  499



>gb|KDO79160.1| hypothetical protein CISIN_1g018628mg [Citrus sinensis]
Length=275

 Score = 59.3 bits (142),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLR  337
            LVTGEFYT+K HFPGF RPFVFNAE+LL+
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLK  238


 Score = 39.3 bits (90),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>ref|XP_006425929.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
 gb|ESR39169.1| hypothetical protein CICLE_v10025986mg [Citrus clementina]
Length=255

 Score = 58.9 bits (141),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLR  337
            LVTGEFYT+K HFPGF RPFVFNAE+LL+
Sbjct  210  LVTGEFYTKKEHFPGFARPFVFNAEILLK  238


 Score = 38.9 bits (89),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+ERK+ QHF KGD
Sbjct  186  VGLFPDVLERKVMQHFAKGD  205



>gb|AFW85234.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=806

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  293  GFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQK  421
            GFGRP+VF AE+L RV R  EAKD+ R ALKSPWWTLGC Y++
Sbjct  490  GFGRPYVFIAEMLKRVRRTSEAKDSARVALKSPWWTLGCSYEE  532



>gb|KDO59762.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
 gb|KDO59763.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
 gb|KDO59764.1| hypothetical protein CISIN_1g019515mg [Citrus sinensis]
Length=237

 Score = 55.8 bits (133),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRV  340
            LVTGEFY +K+ FPGFGRPFVFNAE++L++
Sbjct  202  LVTGEFYAKKDLFPGFGRPFVFNAEIMLKL  231


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPDV+E K+ QHF++GD
Sbjct  178  VGLFPDVLEHKVTQHFEQGD  197



>ref|XP_001693659.1| hypothetical protein CHLREDRAFT_143294 [Chlamydomonas reinhardtii]
 gb|EDP08913.1| predicted protein [Chlamydomonas reinhardtii]
Length=371

 Score = 66.6 bits (161),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 70/149 (47%), Gaps = 16/149 (11%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            +V  E+Y R  HF G+ RP+ F +++ +++GR  E +D  R  L+ PWW+L   +  VA 
Sbjct  222  MVAAEWYMRNGHFVGWARPYEFASDLFMQLGRGEEGRDMARMGLRLPWWSLRAPFPAVAT  281

Query  431  MAQW--EDEQIEFVK------------EKVTQEGRQEDLKKGKDPAQIaldeaaflldla  568
             A    E +++ ++              K  Q  R+   K  K  A          +   
Sbjct  282  TAALPVEADRVMYLLSEEAAAAASATVNKTFQAYREP--KTTKQLALERATALMNRVVAG  339

Query  569  SIDGKWDDYLERIAECYKDAGLHDIASFV  655
              +G +D   E++A  Y +AGL D+A+F+
Sbjct  340  EAEGGYDGIREQLAAAYSEAGLSDVANFI  368


 Score = 23.9 bits (50),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
             G++PDV E+    H  +GD
Sbjct  198  AGMYPDVCEQLALGHLARGD  217



>gb|KCW55180.1| hypothetical protein EUGRSUZ_I01132 [Eucalyptus grandis]
Length=251

 Score = 51.6 bits (122),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLL  334
            +VTGEFYT+K+ FPGFGRPF F AE+LL
Sbjct  210  MVTGEFYTKKDLFPGFGRPFAFYAEILL  237


 Score = 37.7 bits (86),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGDDL  251
            VG+FPDV+ERK+ +HFD+GD +
Sbjct  186  VGMFPDVLERKVTRHFDEGDKV  207



>gb|KCW59070.1| hypothetical protein EUGRSUZ_H01690 [Eucalyptus grandis]
Length=261

 Score = 52.8 bits (125),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNV  352
            LVT EFYT+K +FPGF RPFVFNA +LL+   N+
Sbjct  218  LVTAEFYTKKENFPGFARPFVFNAVLLLKFVNNL  251


 Score = 36.6 bits (83),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPD++ERK   HF+KGD
Sbjct  194  VGLFPDILERKAMNHFEKGD  213



>gb|AFA52591.1| hypothetical protein [Vaucheria litorea]
Length=355

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 77/129 (60%), Gaps = 6/129 (5%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRV-GRNVEAKDAVRGALKSPWWTLG---CEYQKVANMAQWEDE-  451
            FPG+G P+ F ++ L R+ GR++EA+DA + A++ P WTL     E + +  +  + +E 
Sbjct  225  FPGWGYPYAFYSKTLSRMKGRHLEARDAAKVAMRCPLWTLTLDKAELKSIFELGGYGNEI  284

Query  452  QIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSID-GKWDDYLERIAECYKDA  628
             +E +  ++ ++ +++   +GK P QIALD AA ++D   +  G W D  E +   YK+A
Sbjct  285  DVEVLHRRMAEDVQEDKKNEGKQPVQIALDRAAHVMDAVVVGRGTWGDVREELYGLYKEA  344

Query  629  GLHDIASFV  655
            G+  +A FV
Sbjct  345  GMSHLAEFV  353



>gb|KCW59069.1| hypothetical protein EUGRSUZ_H01690 [Eucalyptus grandis]
Length=251

 Score = 51.2 bits (121),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRV  340
            LVT EFYT+K +FPGF RPFVFNA +LL +
Sbjct  218  LVTAEFYTKKENFPGFARPFVFNAVLLLNL  247


 Score = 36.6 bits (83),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VGLFPD++ERK   HF+KGD
Sbjct  194  VGLFPDILERKAMNHFEKGD  213



>ref|XP_005707231.1| hypothetical protein Gasu_19540 [Galdieria sulphuraria]
 gb|EME30711.1| hypothetical protein Gasu_19540 [Galdieria sulphuraria]
Length=360

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEF-  463
            FPG+GR   F++ VL ++ R  EA+DA R AL+ P WTL  +  +V  +A ++  +  F 
Sbjct  233  FPGWGRSRYFHSCVLQKLNRMQEARDAARAALQLPLWTLNYDVFQVGYVAGFQSPESSFP  292

Query  464  -VKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSI-DGKWDDYLERIAECYKDAGLH  637
             +  K+  + R +D++ GK   Q+ALD AAFLLD+  + +  + D  + +A+ Y++A L 
Sbjct  293  QIYRKLANDKRYKDIENGKPKEQVALDRAAFLLDVTFLENNSYQDIKDSLAQLYEEAHLP  352

Query  638  DIASFV  655
            D+A FV
Sbjct  353  DVARFV  358



>ref|XP_005833599.1| hypothetical protein GUITHDRAFT_107402 [Guillardia theta CCMP2712]
 gb|EKX46619.1| hypothetical protein GUITHDRAFT_107402 [Guillardia theta CCMP2712]
Length=389

 Score = 57.8 bits (138),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 16/147 (11%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVAN  430
            LV  E   +  H  G+G  + F A +  ++GR  EAKDA + AL  P WTLG + ++V+ 
Sbjct  241  LVAAERSAKIQH--GWGSGYRFQALLYTKLGREKEAKDAAKLALMMPLWTLGEQVEEVSR  298

Query  431  MAQWEDEQIEFVKEKV------------TQEGRQEDLKKGKDPAQIaldeaaflldlaSI  574
             A   D  ++  K+K+            +Q      L+K K+ A +   +          
Sbjct  299  QAGEAD--VKAFKQKIAEMSKSTRTIEMSQACHGHPLEKAKEEAMLERADDIMNEVCLGT  356

Query  575  DGKWDDYLERIAECYKDAGLHDIASFV  655
               WDD   ++AE Y   G  D+ASFV
Sbjct  357  YKGWDDVRSQLAEIYMGGGRMDLASFV  383


 Score = 25.0 bits (53),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VG FPD+ E     H ++GD
Sbjct  217  VGAFPDLYEELALHHLERGD  236



>emb|CDP19115.1| unnamed protein product [Coffea canephora]
Length=140

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  569  SIDGKWDDYLERIAECYKDAGLHDIASFVVYRD  667
            S++G WDD L+RIAECY++AGLH+IA FV+YR+
Sbjct  108  SVEGTWDDNLDRIAECYQEAGLHEIAKFVLYRN  140



>ref|XP_005765908.1| trypsin [Emiliania huxleyi CCMP1516]
 gb|EOD13479.1| trypsin [Emiliania huxleyi CCMP1516]
Length=701

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 49/134 (37%), Positives = 73/134 (54%), Gaps = 13/134 (10%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCEYQKVANMAQWEDEQIEF-  463
            F  +GRPF F+A +L  + R+ EA+D  R AL  P WTLG    +V  +A    E++   
Sbjct  563  FEQWGRPFAFHARLLRSLDRSEEARDVARHALSLPLWTLGDSLDEVCKIAGSSTEELAAS  622

Query  464  ----VKEKVTQEGRQEDLKKGKD---PAQIaldeaaflldlaSIDGK---WDDYLERIAE  613
                 + ++T E R  D   G D   P +IAL+ AA LLD+A++ G    W+     +AE
Sbjct  623  LAIRARGELTPEQRARD--NGMDTRTPREIALERAACLLDIATLPGSEKTWESVRPELAE  680

Query  614  CYKDAGLHDIASFV  655
             Y +AG+ D ++FV
Sbjct  681  RYSEAGMSDFSAFV  694



>emb|CBN79086.1| conserved unknown protein [Ectocarpus siliculosus]
Length=376

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRVGRN-VEAKDAVRGALKSPWWTLGC---EYQKVANMAQWED-E  451
            F G+GRP+   A VL ++ R  +EAKDA + +L+ P WT+     + ++V  +A +ED  
Sbjct  245  FVGWGRPYGHYARVLAKMDRREMEAKDAAKVSLRCPCWTISPNSKDLEEVVKIAGYEDMA  304

Query  452  QIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGK-WDDYLERIAECYKDA  628
             +  + E +  + + + + +GK P Q+ALD AA L+D  +   K WD   E +AE Y   
Sbjct  305  SVLTMYEGMAADEQPDKINEGKSPMQVALDRAAHLMDAVAFGHKDWDGVREELAERYDQG  364

Query  629  GLHDIASFV  655
            G+ DIA FV
Sbjct  365  GIPDIARFV  373



>gb|EWM29628.1| cyclin delta-3 [Nannochloropsis gaditana]
Length=363

 Score = 58.2 bits (139),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 82/143 (57%), Gaps = 10/143 (7%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRV-GRNVEAKDAVRGALKSPWWTLG---CEYQ  418
            LVT E     N F G+G+P++    +L  + GR +E +DA   AL++P WT+     + +
Sbjct  221  LVTAE--KAYNTFNGWGQPYMEYCRLLQGMKGRELEMRDAAFAALRTPLWTVADDDGDLE  278

Query  419  KVANMAQWEDEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDG----KW  586
             V N A+   E+      K+ ++ R +++K+GK P Q+ALD AA+L+D A + G     W
Sbjct  279  MVLNAAKSSREKAADKFWKLYEDERLQEVKQGKLPEQVALDRAAYLMDAALVGGNGIRSW  338

Query  587  DDYLERIAECYKDAGLHDIASFV  655
             D    +AE Y++AG+ ++A FV
Sbjct  339  SDVRPPLAELYREAGMRELADFV  361


 Score = 22.3 bits (46),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VG FPDV +   + H  KGD
Sbjct  197  VGSFPDVYKFLTEFHMSKGD  216



>ref|XP_001417315.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95608.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=356

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 96/200 (48%), Gaps = 36/200 (18%)
 Frame = +2

Query  122  SLGKGNAFRS---QFPVYIKGLIISWPVS-------RCNRAEN*AAF*QGG*PLVTGEFY  271
            SL    AF++   +F VY+   I  +P S          R +  +A       L+T + Y
Sbjct  164  SLHAHGAFKTSGKEFDVYVTTQIGKFPSSMEGLVRRHLKRNDEQSA-------LITCDLY  216

Query  272  TRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCE--YQKVANMAQWE  445
              K  F  +G P VF +++  ++GR+ EA+DA R AL++PW T+G      ++ ++A W 
Sbjct  217  --KATFGDWGAPHVFISDLYSKLGRDEEARDAARQALQTPWSTIGGRDAITRMIDVAGWS  274

Query  446  DEQIEFVKEKVTQ---------EGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYL  598
             + +  +KE +           +G + + +  ++  ++ LD+ A     +S         
Sbjct  275  GKTVAEIKEVLESRRGPSAAAFDGPKSEKQLAREEGELLLDQIAAGEIESST------VN  328

Query  599  ERIAECYKDAGLHDIASFVV  658
            +R+AECY +AG   +A F++
Sbjct  329  QRLAECYMNAGKPALAKFIM  348



>ref|XP_003078919.1| unnamed protein product [Ostreococcus tauri]
Length=386

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 7/142 (5%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCE--YQKV  424
            L+T + Y  K+ F  +G    F A++   +GR  EA+DA R AL++PW T+G +   +++
Sbjct  200  LITCDLY--KSTFGEWGSSHAFVADLYNDLGRGEEARDAARNALQTPWATVGGDKTIKRM  257

Query  425  ANMAQWEDEQIEFVKEKV-TQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYL-  598
             ++A W  + +  +KE + T+ G       G    +    E A LL      G+ +    
Sbjct  258  LDLAGWSGKTVTEIKEVLETRRGPNAAAFDGPKSEKQLAREEAELLLDQVAAGEIESATV  317

Query  599  -ERIAECYKDAGLHDIASFVVY  661
             +R+AECY  AG   +A FV++
Sbjct  318  NQRLAECYMKAGNSTLAKFVMF  339



>ref|XP_002286657.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED96298.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=405

 Score = 49.7 bits (117),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (57%), Gaps = 15/137 (11%)
 Frame = +2

Query  287  FPGFGRPFVFNAEVLLRVG-RNVEAKDAVRGALKSPWWTLGC---EYQKVANMAQWED--  448
            F GFG  F F +++L  +  R+ EA+DA R  ++ P  ++G    ++ +V+ MAQ+    
Sbjct  267  FGGFGSTFAFYSKLLASLPQRSEEARDAARMCVRMPLPSMGLTREDFAQVSKMAQFATPI  326

Query  449  -------EQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGK-WDDYLER  604
                   E++    EKV ++  +ED    K   QIA+DEA +LLD+A + G+ + D  E+
Sbjct  327  DTTDDAMEKMLHFYEKV-RDREKEDNSGDKTAKQIAMDEANYLLDVACLTGQSYGDVREK  385

Query  605  IAECYKDAGLHDIASFV  655
            IAE Y  AG+ ++A FV
Sbjct  386  IAEIYSGAGMDEMAEFV  402


 Score = 24.3 bits (51),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 11/20 (55%), Gaps = 0/20 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGD  245
            VG FPD+ E     H  +GD
Sbjct  233  VGPFPDLYETMANNHLARGD  252



>emb|CEF97668.1| unnamed product [Ostreococcus tauri]
Length=345

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALKSPWWTLGCE--YQKV  424
            L+T + Y  K+ F  +G    F A++   +GR  EA+DA R AL++PW T+G +   +++
Sbjct  200  LITCDLY--KSTFGEWGSSHAFVADLYNDLGRGEEARDAARNALQTPWATVGGDKTIKRM  257

Query  425  ANMAQWEDEQIEFVKEKV-TQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDYL-  598
             ++A W  + +  +KE + T+ G       G    +    E A LL      G+ +    
Sbjct  258  LDLAGWSGKTVTEIKEVLETRRGPNAAAFDGPKSEKQLAREEAELLLDQVAAGEIESATV  317

Query  599  -ERIAECYKDAGLHDIASFVV  658
             +R+AECY  AG   +A FV+
Sbjct  318  NQRLAECYMKAGNSTLAKFVM  338



>ref|XP_002504091.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65349.1| predicted protein [Micromonas sp. RCC299]
Length=375

 Score = 41.2 bits (95),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 65/141 (46%), Gaps = 8/141 (6%)
 Frame = +2

Query  251  LVTGEFYTRKNHFPGFGRPFVFNAEVLLRVGRNVEAKDAVRGALK-SPWWTLGCEYQKVA  427
            LVT + Y  K  F G+GRP  + ++V    GR+ EA+DA R AL    W T G   +++ 
Sbjct  233  LVTCDLY--KATFEGWGRPHWYLSQVYADAGRHEEARDAARFALTDCQWSTAGAPLEQLL  290

Query  428  NMAQWE----DEQIEFVKEKVTQEGRQEDLKKGKDPAQIaldeaaflldlaSIDGKWDDY  595
                W     DE   F++ +      Q D  K  D      + A  L  + + + +  + 
Sbjct  291  ERCGWGGQSVDETKTFIETRRGPAAEQFDGPK-SDKQLAEEEAAVLLDKVYAGEMRLGEI  349

Query  596  LERIAECYKDAGLHDIASFVV  658
             +R+A+CY D+    +A  V+
Sbjct  350  TQRLAKCYMDSDNGALAKLVM  370


 Score = 31.6 bits (70),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  186  VGLFPDVIERKIKQHFDKGDD  248
            VG FPDV+E+  ++H DKGD+
Sbjct  209  VGKFPDVMEQLARRHLDKGDE  229



>ref|XP_008659088.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Zea mays]
Length=306

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  326  VLLRVGRNVEAKDAVRGALKSPWWTLGCEYQK  421
            +L RV R  EAKD+ R ALKSPWWTLGC Y++
Sbjct  1    MLKRVRRTSEAKDSARVALKSPWWTLGCSYEE  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984917279386