BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24618_g1_i1 len=845 path=[2575:0-475 3050:476-476 2162:477-599
744:600-623 3196:624-734 879:735-772 2503:773-844]

Length=845
                                                                      Score     E

ref|XP_010319818.1|  PREDICTED: uncharacterized protein LOC101262104    184   3e-52   
ref|XP_006340480.1|  PREDICTED: uncharacterized protein LOC102581686    183   1e-50   
ref|XP_009616695.1|  PREDICTED: uncharacterized protein LOC104109171    170   1e-45   
ref|XP_009769701.1|  PREDICTED: uncharacterized protein LOC104220515    168   5e-45   
ref|XP_011074762.1|  PREDICTED: uncharacterized protein LOC105159...    163   8e-43   
ref|XP_011074763.1|  PREDICTED: uncharacterized protein LOC105159...    162   9e-43   
emb|CDP18279.1|  unnamed protein product                                162   4e-42   
ref|XP_006359315.1|  PREDICTED: uncharacterized protein LOC102599098    157   1e-41   
ref|XP_009780942.1|  PREDICTED: uncharacterized protein LOC104229912    159   3e-41   
ref|XP_010319314.1|  PREDICTED: uncharacterized protein LOC101248...    154   1e-40   
ref|XP_004237166.1|  PREDICTED: uncharacterized protein LOC101248...    154   1e-40   
ref|XP_011101633.1|  PREDICTED: uncharacterized protein LOC105179...    157   4e-40   
ref|XP_011101637.1|  PREDICTED: uncharacterized protein LOC105179...    156   4e-40   
ref|XP_011101626.1|  PREDICTED: uncharacterized protein LOC105179...    156   5e-40   
ref|XP_009615962.1|  PREDICTED: uncharacterized protein LOC104108...    154   1e-39   
ref|XP_009615961.1|  PREDICTED: uncharacterized protein LOC104108...    154   2e-39   
ref|XP_009776426.1|  PREDICTED: uncharacterized protein LOC104226206    154   2e-39   
ref|XP_010664973.1|  PREDICTED: uncharacterized protein LOC104882...    146   6e-37   
ref|XP_010664972.1|  PREDICTED: uncharacterized protein LOC104882...    146   1e-36   
ref|XP_010664971.1|  PREDICTED: uncharacterized protein LOC104882...    146   1e-36   
gb|EYU17431.1|  hypothetical protein MIMGU_mgv1a008715mg                143   4e-36   
gb|EYU17430.1|  hypothetical protein MIMGU_mgv1a026792mg                140   2e-35   
gb|KDP43027.1|  hypothetical protein JCGZ_25213                         139   4e-34   
ref|XP_006472951.1|  PREDICTED: uncharacterized protein LOC102625994    134   4e-32   
ref|XP_006434426.1|  hypothetical protein CICLE_v10000763mg             133   6e-32   
gb|KDO83662.1|  hypothetical protein CISIN_1g0089082mg                  132   8e-32   
gb|KDO83661.1|  hypothetical protein CISIN_1g0089082mg                  132   9e-32   
gb|KDO83660.1|  hypothetical protein CISIN_1g0089082mg                  132   9e-32   
ref|XP_002306612.2|  PHD finger family protein                          132   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008237627.1|  PREDICTED: uncharacterized protein LOC103336371    130   2e-31   
ref|XP_007199125.1|  hypothetical protein PRUPE_ppa021510mg             129   3e-31   
ref|XP_011001424.1|  PREDICTED: uncharacterized protein LOC105108...    131   3e-31   
ref|XP_011012507.1|  PREDICTED: uncharacterized protein LOC105116...    130   3e-31   
ref|XP_006606157.1|  PREDICTED: uncharacterized protein LOC100796913    129   3e-31   
ref|XP_011001422.1|  PREDICTED: uncharacterized protein LOC105108...    130   3e-31   
ref|XP_011001423.1|  PREDICTED: uncharacterized protein LOC105108...    130   3e-31   
gb|KHN46431.1|  L-type lectin-domain containing receptor kinase S.6     129   7e-31   
ref|XP_007143517.1|  hypothetical protein PHAVU_007G078100g             128   8e-31   
ref|XP_008461941.1|  PREDICTED: uncharacterized protein LOC103500...    127   2e-30   
ref|XP_008461944.1|  PREDICTED: uncharacterized protein LOC103500...    127   2e-30   
ref|XP_006589501.1|  PREDICTED: uncharacterized protein LOC102666082    125   1e-29   
gb|KHN16995.1|  hypothetical protein glysoja_011469                     124   1e-29   
ref|XP_008373265.1|  PREDICTED: uncharacterized protein LOC103436597    123   2e-29   
ref|XP_008461943.1|  PREDICTED: uncharacterized protein LOC103500...    123   5e-29   
gb|EYU17432.1|  hypothetical protein MIMGU_mgv1a010590mg                122   6e-29   
ref|XP_010999804.1|  PREDICTED: uncharacterized protein LOC105107...    123   9e-29   
ref|XP_010999805.1|  PREDICTED: uncharacterized protein LOC105107...    123   1e-28   
ref|XP_002307485.1|  PHD finger family protein                          122   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010245258.1|  PREDICTED: uncharacterized protein LOC104588...    120   3e-28   
ref|XP_010062138.1|  PREDICTED: uncharacterized protein LOC104449...    122   4e-28   
ref|XP_009360762.1|  PREDICTED: uncharacterized protein LOC103951174    118   4e-28   
gb|KCW69205.1|  hypothetical protein EUGRSUZ_F02722                     121   4e-28   
ref|XP_010245256.1|  PREDICTED: uncharacterized protein LOC104588...    120   5e-28   
ref|XP_010245254.1|  PREDICTED: uncharacterized protein LOC104588...    120   5e-28   
ref|XP_010062139.1|  PREDICTED: uncharacterized protein LOC104449...    121   5e-28   
ref|XP_010245255.1|  PREDICTED: uncharacterized protein LOC104588...    120   6e-28   
ref|XP_010245257.1|  PREDICTED: uncharacterized protein LOC104588...    120   6e-28   
ref|XP_010245253.1|  PREDICTED: uncharacterized protein LOC104588...    120   7e-28   
ref|XP_010245252.1|  PREDICTED: uncharacterized protein LOC104588...    120   8e-28   
gb|KGN44494.1|  hypothetical protein Csa_7G318450                       115   1e-27   
ref|XP_009338913.1|  PREDICTED: uncharacterized protein LOC103931215    117   4e-27   
ref|XP_004295161.1|  PREDICTED: uncharacterized protein LOC101308361    117   6e-27   
ref|XP_003536437.1|  PREDICTED: uncharacterized protein LOC100817...    115   2e-26   
gb|KHN16994.1|  hypothetical protein glysoja_011468                     115   2e-26   
ref|XP_004496495.1|  PREDICTED: uncharacterized protein LOC101501...    115   3e-26   
ref|XP_010247257.1|  PREDICTED: uncharacterized protein LOC104590...    116   5e-26   
ref|XP_010247256.1|  PREDICTED: uncharacterized protein LOC104590...    117   6e-26   
ref|XP_004496494.1|  PREDICTED: uncharacterized protein LOC101501...    113   9e-26   
ref|XP_010931048.1|  PREDICTED: uncharacterized protein LOC105052052    114   1e-25   
ref|XP_007019436.1|  Uncharacterized protein TCM_035488                 114   2e-25   
ref|XP_004139676.1|  PREDICTED: uncharacterized protein LOC101213907    108   2e-25   
ref|XP_011023004.1|  PREDICTED: uncharacterized protein LOC105124611    111   6e-25   
ref|XP_008373583.1|  PREDICTED: uncharacterized protein LOC103436904    107   2e-24   
emb|CDP04750.1|  unnamed protein product                                111   2e-24   
ref|XP_003592150.1|  hypothetical protein MTR_1g099270                  110   2e-24   
ref|XP_006854608.1|  hypothetical protein AMTR_s00030p00140460          110   2e-24   
ref|XP_008799746.1|  PREDICTED: uncharacterized protein LOC103714318    112   3e-24   
ref|XP_007152080.1|  hypothetical protein PHAVU_004G100400g             112   5e-24   
ref|XP_009769945.1|  PREDICTED: uncharacterized protein LOC104220...    109   6e-24   
ref|XP_009597717.1|  PREDICTED: uncharacterized protein LOC104093...    110   7e-24   
ref|XP_009597716.1|  PREDICTED: uncharacterized protein LOC104093...    110   7e-24   
gb|KHN47277.1|  hypothetical protein glysoja_043087                     110   7e-24   
ref|XP_009769953.1|  PREDICTED: uncharacterized protein LOC104220...    109   8e-24   
ref|XP_009769952.1|  PREDICTED: uncharacterized protein LOC104220...    109   8e-24   
ref|XP_009769951.1|  PREDICTED: uncharacterized protein LOC104220...    109   8e-24   
ref|XP_006393770.1|  hypothetical protein EUTSA_v10011612mg             108   8e-24   
gb|KHN19657.1|  hypothetical protein glysoja_047067                     110   1e-23   
ref|XP_006587258.1|  PREDICTED: uncharacterized protein LOC102669160    110   1e-23   
emb|CDY59127.1|  BnaCnng34380D                                          108   7e-23   
ref|XP_010680252.1|  PREDICTED: uncharacterized protein LOC104895438    105   7e-23   
ref|XP_010530238.1|  PREDICTED: uncharacterized protein LOC104806851    106   7e-23   
ref|XP_011100150.1|  PREDICTED: uncharacterized protein LOC105178383    107   9e-23   
ref|XP_009620783.1|  PREDICTED: uncharacterized protein LOC104112...    105   2e-22   
ref|XP_006582126.1|  PREDICTED: uncharacterized protein LOC102667689    107   2e-22   
ref|XP_009620782.1|  PREDICTED: uncharacterized protein LOC104112...    105   2e-22   
ref|XP_009620781.1|  PREDICTED: uncharacterized protein LOC104112...    105   2e-22   
ref|XP_003619204.1|  PHD-finger family protein expressed                107   2e-22   
ref|XP_009620780.1|  PREDICTED: uncharacterized protein LOC104112...    105   2e-22   
gb|AES75422.2|  hypothetical protein MTR_6g044600                       107   2e-22   
ref|XP_009406063.1|  PREDICTED: uncharacterized protein LOC103989049    104   2e-22   
ref|XP_009147898.1|  PREDICTED: uncharacterized protein LOC103871...    106   3e-22   
gb|EMT00025.1|  hypothetical protein F775_04899                         107   3e-22   
emb|CDY48869.1|  BnaA06g03130D                                          105   3e-22   
ref|XP_006663987.1|  PREDICTED: uncharacterized protein LOC102709...    107   3e-22   
ref|XP_009147897.1|  PREDICTED: uncharacterized protein LOC103871...    106   3e-22   
ref|XP_006663986.1|  PREDICTED: uncharacterized protein LOC102709...    107   4e-22   
ref|XP_004515116.1|  PREDICTED: uncharacterized protein LOC101510...    107   4e-22   
gb|EEC68900.1|  hypothetical protein OsI_37561                          105   4e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001066219.1|  Os12g0161500                                       105   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KEH25789.1|  hypothetical protein MTR_6g034375                       106   6e-22   
gb|KEH25788.1|  hypothetical protein MTR_6g034375                       106   7e-22   
gb|ABA96542.2|  expressed protein                                       105   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362810.1|  PREDICTED: uncharacterized protein LOC102603...    103   1e-21   
ref|XP_006362811.1|  PREDICTED: uncharacterized protein LOC102603...    103   1e-21   
ref|XP_006464615.1|  PREDICTED: uncharacterized protein LOC102607...    102   2e-21   
ref|XP_006427808.1|  hypothetical protein CICLE_v10025832mg             101   2e-21   
gb|KDO58369.1|  hypothetical protein CISIN_1g0167792mg                  101   2e-21   
ref|XP_006464611.1|  PREDICTED: uncharacterized protein LOC102607...    101   3e-21   
ref|XP_006427809.1|  hypothetical protein CICLE_v10025832mg             101   3e-21   
emb|CBI35492.3|  unnamed protein product                              98.6    3e-21   
ref|XP_009785077.1|  PREDICTED: uncharacterized protein LOC104233387    102   4e-21   
ref|XP_003619407.1|  hypothetical protein MTR_6g052260                  100   4e-21   
ref|XP_010237283.1|  PREDICTED: uncharacterized protein LOC100845...    102   2e-20   
ref|XP_010237285.1|  PREDICTED: uncharacterized protein LOC100845...    101   2e-20   
ref|XP_010649403.1|  PREDICTED: uncharacterized protein LOC104879183  94.7    3e-20   
ref|XP_006351039.1|  PREDICTED: uncharacterized protein LOC102604199  99.4    4e-20   
ref|XP_004978327.1|  PREDICTED: uncharacterized protein LOC101754677  99.8    4e-20   
ref|XP_010461428.1|  PREDICTED: uncharacterized protein LOC104742151  99.8    5e-20   
ref|NP_001117432.1|  RING/FYVE/PHD zinc finger-containing protein     98.2    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43663.1|  hypothetical protein MTR_1g099270                     97.4    5e-20   
ref|XP_010270011.1|  PREDICTED: uncharacterized protein LOC104606...    100   9e-20   
ref|XP_010270004.1|  PREDICTED: uncharacterized protein LOC104606...    100   9e-20   
ref|XP_010270010.1|  PREDICTED: uncharacterized protein LOC104606...    100   9e-20   
ref|XP_010270008.1|  PREDICTED: uncharacterized protein LOC104606...    100   9e-20   
ref|XP_010270007.1|  PREDICTED: uncharacterized protein LOC104606...    100   1e-19   
ref|XP_006307521.1|  hypothetical protein CARUB_v10009144mg           97.8    1e-19   
ref|XP_010500118.1|  PREDICTED: uncharacterized protein LOC104777541  99.4    1e-19   
ref|XP_010680257.1|  PREDICTED: uncharacterized protein LOC104895...  99.4    1e-19   
gb|EEE53135.1|  hypothetical protein OsJ_35943                        99.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008461945.1|  PREDICTED: uncharacterized protein LOC103500...  95.5    2e-19   
gb|KCW90978.1|  hypothetical protein EUGRSUZ_A02991                   99.4    2e-19   
ref|NP_001067711.2|  Os11g0292000                                     99.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663990.1|  PREDICTED: uncharacterized protein LOC102710...  99.4    2e-19   
ref|XP_006663991.1|  PREDICTED: uncharacterized protein LOC102710...  99.4    2e-19   
gb|ABA97690.2|  PHD-finger family protein, expressed                  99.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063523.1|  PREDICTED: uncharacterized protein LOC104450...  99.4    2e-19   
ref|XP_010312473.1|  PREDICTED: uncharacterized protein LOC101263...  97.8    2e-19   
gb|KCW90977.1|  hypothetical protein EUGRSUZ_A02991                   99.0    2e-19   
gb|EEC69185.1|  hypothetical protein OsI_38169                        99.0    2e-19   Oryza sativa Indica Group [Indian rice]
gb|EEC74340.1|  hypothetical protein OsI_09634                        99.0    2e-19   Oryza sativa Indica Group [Indian rice]
gb|AAX96031.1|  PHD-finger, putative                                  99.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KCW90976.1|  hypothetical protein EUGRSUZ_A02991                   99.0    2e-19   
ref|XP_010063504.1|  PREDICTED: uncharacterized protein LOC104450...  99.0    2e-19   
ref|XP_010312474.1|  PREDICTED: uncharacterized protein LOC101263...  97.4    2e-19   
ref|XP_010063514.1|  PREDICTED: uncharacterized protein LOC104450...  99.0    2e-19   
gb|EEE51986.1|  hypothetical protein OsJ_33669                        98.6    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010312472.1|  PREDICTED: uncharacterized protein LOC101263...  97.4    2e-19   
ref|XP_010322713.1|  PREDICTED: uncharacterized protein LOC104648063  95.5    2e-19   
ref|XP_010312471.1|  PREDICTED: uncharacterized protein LOC101263...  97.4    2e-19   
gb|KDP26133.1|  hypothetical protein JCGZ_22234                       95.1    3e-19   
ref|XP_010479666.1|  PREDICTED: histone-lysine N-methyltransferas...  96.7    7e-19   
ref|XP_011101614.1|  PREDICTED: uncharacterized protein LOC105179...  96.3    8e-19   
ref|XP_011101579.1|  PREDICTED: uncharacterized protein LOC105179...  96.3    9e-19   
ref|XP_011101606.1|  PREDICTED: uncharacterized protein LOC105179...  96.3    9e-19   
ref|XP_011101598.1|  PREDICTED: uncharacterized protein LOC105179...  96.3    1e-18   
ref|XP_011101590.1|  PREDICTED: uncharacterized protein LOC105179...  96.3    1e-18   
ref|XP_010237286.1|  PREDICTED: uncharacterized protein LOC100846635  96.7    1e-18   
ref|NP_001233912.1|  E4/E8 binding protein-1                          94.7    1e-18   
ref|XP_003618041.1|  hypothetical protein MTR_5g098320                92.0    1e-18   
ref|XP_008788672.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  96.3    2e-18   
gb|ABA96546.1|  expressed protein                                     95.9    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002309893.2|  hypothetical protein POPTR_0007s03750g           92.4    2e-18   Populus trichocarpa [western balsam poplar]
gb|EEE52811.1|  hypothetical protein OsJ_35311                        95.5    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010259783.1|  PREDICTED: uncharacterized protein LOC104599...  94.7    2e-18   
ref|XP_010259806.1|  PREDICTED: uncharacterized protein LOC104599...  94.4    2e-18   
ref|XP_010259799.1|  PREDICTED: uncharacterized protein LOC104599...  94.7    2e-18   
ref|XP_010259791.1|  PREDICTED: uncharacterized protein LOC104599...  94.7    3e-18   
ref|XP_010680259.1|  PREDICTED: uncharacterized protein LOC104895446  93.2    9e-18   
ref|XP_003567412.2|  PREDICTED: uncharacterized protein LOC100822533  93.2    1e-17   
ref|XP_008662494.1|  PREDICTED: uncharacterized protein LOC103640797  92.4    2e-17   
ref|XP_008661744.1|  PREDICTED: uncharacterized protein LOC100276...  92.0    2e-17   
gb|EMT09239.1|  hypothetical protein F775_08146                       92.0    2e-17   
gb|EMT25501.1|  hypothetical protein F775_04308                       92.0    2e-17   
ref|XP_006664360.1|  PREDICTED: uncharacterized protein LOC102708487  92.4    2e-17   
ref|XP_006837134.1|  hypothetical protein AMTR_s00110p00135600        92.0    3e-17   
gb|EMS56098.1|  Tyrosine-protein kinase BAZ1B                         91.7    3e-17   
emb|CAN63105.1|  hypothetical protein VITISV_029609                   92.4    3e-17   Vitis vinifera
emb|CBI26469.3|  unnamed protein product                              92.0    4e-17   
ref|XP_010662093.1|  PREDICTED: uncharacterized protein LOC100261...  92.0    4e-17   
ref|XP_002270307.3|  PREDICTED: uncharacterized protein LOC100261...  92.0    4e-17   Vitis vinifera
ref|XP_010662091.1|  PREDICTED: uncharacterized protein LOC100261...  92.0    4e-17   
ref|XP_002891271.1|  predicted protein                                90.5    4e-17   
ref|XP_004956435.1|  PREDICTED: uncharacterized protein LOC101759...  91.7    5e-17   
ref|XP_004956434.1|  PREDICTED: uncharacterized protein LOC101759...  91.7    5e-17   
ref|XP_011087298.1|  PREDICTED: uncharacterized protein LOC105168...  89.7    5e-17   
ref|XP_011087297.1|  PREDICTED: uncharacterized protein LOC105168...  90.1    5e-17   
ref|XP_002442849.1|  hypothetical protein SORBIDRAFT_08g003820        90.5    6e-17   Sorghum bicolor [broomcorn]
ref|XP_010322710.1|  PREDICTED: uncharacterized protein LOC104648062  89.0    6e-17   
ref|XP_004977330.1|  PREDICTED: uncharacterized protein LOC101784120  91.3    7e-17   
ref|XP_002442853.1|  hypothetical protein SORBIDRAFT_08g003860        90.9    7e-17   Sorghum bicolor [broomcorn]
ref|XP_004962559.1|  PREDICTED: uncharacterized protein LOC101777...  90.5    7e-17   
ref|XP_009595024.1|  PREDICTED: uncharacterized protein LOC104091...  90.1    8e-17   
ref|XP_010091858.1|  hypothetical protein L484_000507                 90.5    9e-17   
ref|XP_010238691.1|  PREDICTED: uncharacterized protein LOC104584781  90.5    9e-17   
ref|XP_004962558.1|  PREDICTED: uncharacterized protein LOC101777...  90.5    9e-17   
ref|XP_009407037.1|  PREDICTED: uncharacterized protein LOC103989817  90.5    9e-17   
ref|XP_004956348.1|  PREDICTED: uncharacterized protein LOC101756415  90.1    9e-17   
ref|XP_009418602.1|  PREDICTED: uncharacterized protein LOC103998...  90.9    9e-17   
ref|XP_009418603.1|  PREDICTED: uncharacterized protein LOC103998...  90.9    1e-16   
ref|XP_010102093.1|  hypothetical protein L484_001826                 90.1    1e-16   
ref|XP_009392778.1|  PREDICTED: uncharacterized protein LOC103978...  90.9    1e-16   
ref|XP_008459205.1|  PREDICTED: probable GPI-anchored adhesin-lik...  90.5    1e-16   
ref|XP_009392773.1|  PREDICTED: uncharacterized protein LOC103978...  90.5    1e-16   
ref|XP_004962557.1|  PREDICTED: uncharacterized protein LOC101777...  90.1    1e-16   
ref|XP_002325874.2|  PHD finger family protein                        90.5    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008459204.1|  PREDICTED: probable GPI-anchored adhesin-lik...  90.5    1e-16   
ref|XP_009392779.1|  PREDICTED: uncharacterized protein LOC103978...  90.5    1e-16   
ref|XP_008459203.1|  PREDICTED: uncharacterized protein LOC103498...  90.5    1e-16   
ref|XP_002437705.1|  hypothetical protein SORBIDRAFT_10g001106        89.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_010322702.1|  PREDICTED: uncharacterized protein LOC104648061  86.7    2e-16   
ref|XP_011012545.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
ref|XP_011012543.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
ref|XP_011012540.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
ref|XP_011012542.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
ref|XP_011012546.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
gb|EMS52711.1|  hypothetical protein TRIUR3_32732                     89.0    2e-16   
ref|XP_011012541.1|  PREDICTED: uncharacterized protein LOC105116...  89.7    2e-16   
ref|XP_011084637.1|  PREDICTED: uncharacterized protein LOC105166844  89.7    2e-16   
ref|XP_010663251.1|  PREDICTED: uncharacterized protein LOC100854...  89.0    2e-16   
ref|XP_010663250.1|  PREDICTED: uncharacterized protein LOC100854...  89.0    2e-16   
ref|XP_003634298.2|  PREDICTED: uncharacterized protein LOC100854...  89.0    3e-16   
ref|XP_010933485.1|  PREDICTED: uncharacterized protein LOC105053867  89.0    4e-16   
ref|XP_009595025.1|  PREDICTED: uncharacterized protein LOC104091...  88.2    4e-16   
ref|XP_008786315.1|  PREDICTED: uncharacterized protein LOC103704...  89.0    4e-16   
ref|XP_008786313.1|  PREDICTED: uncharacterized protein LOC103704...  89.0    4e-16   
ref|XP_008786314.1|  PREDICTED: uncharacterized protein LOC103704...  89.0    4e-16   
ref|XP_009794402.1|  PREDICTED: uncharacterized protein LOC104241...  87.4    5e-16   
ref|XP_009794401.1|  PREDICTED: uncharacterized protein LOC104241...  87.4    5e-16   
ref|XP_009794403.1|  PREDICTED: uncharacterized protein LOC104241...  87.4    5e-16   
ref|XP_011042293.1|  PREDICTED: uncharacterized protein LOC105138011  87.0    6e-16   
ref|XP_009794400.1|  PREDICTED: uncharacterized protein LOC104241...  87.4    6e-16   
ref|XP_009389328.1|  PREDICTED: uncharacterized protein LOC103975...  88.6    6e-16   
ref|XP_004145410.1|  PREDICTED: uncharacterized protein LOC101208726  88.2    6e-16   
ref|XP_009389331.1|  PREDICTED: uncharacterized protein LOC103975...  88.2    6e-16   
ref|XP_009389330.1|  PREDICTED: uncharacterized protein LOC103975...  88.2    6e-16   
ref|XP_009389329.1|  PREDICTED: uncharacterized protein LOC103975...  88.2    6e-16   
gb|KGN61722.1|  hypothetical protein Csa_2G233010                     88.2    7e-16   
ref|XP_007029696.1|  RING/FYVE/PHD zinc finger superfamily protei...  88.2    7e-16   
ref|XP_007029695.1|  RING/FYVE/PHD zinc finger superfamily protei...  88.2    7e-16   
gb|EMT02054.1|  Tyrosine-protein kinase BAZ1B                         87.8    7e-16   
gb|KHN31130.1|  hypothetical protein glysoja_012780                   84.7    8e-16   
ref|XP_007029689.1|  RING/FYVE/PHD zinc finger superfamily protei...  87.8    8e-16   
ref|XP_007029692.1|  RING/FYVE/PHD zinc finger superfamily protei...  87.8    8e-16   
ref|XP_007029690.1|  RING/FYVE/PHD zinc finger superfamily protei...  87.8    8e-16   
ref|XP_008799389.1|  PREDICTED: uncharacterized protein LOC103714...  87.8    8e-16   
ref|XP_004985203.1|  PREDICTED: uncharacterized protein LOC101776...  87.8    8e-16   
ref|XP_008799386.1|  PREDICTED: uncharacterized protein LOC103714...  87.8    9e-16   
ref|XP_006578797.1|  PREDICTED: uncharacterized protein LOC102668229  85.1    9e-16   
ref|XP_008799388.1|  PREDICTED: uncharacterized protein LOC103714...  87.8    9e-16   
gb|AFW75260.1|  hypothetical protein ZEAMMB73_797679                  87.8    9e-16   
ref|XP_008799384.1|  PREDICTED: uncharacterized protein LOC103714...  87.8    9e-16   
ref|XP_008799387.1|  PREDICTED: uncharacterized protein LOC103714...  87.8    9e-16   
ref|XP_004985204.1|  PREDICTED: uncharacterized protein LOC101776...  87.4    1e-15   
ref|XP_008238272.1|  PREDICTED: uncharacterized protein LOC103336...  87.0    1e-15   
ref|XP_008648742.1|  PREDICTED: uncharacterized protein LOC103629...  87.4    1e-15   
ref|XP_008648744.1|  PREDICTED: uncharacterized protein LOC103629...  87.4    1e-15   
ref|XP_008238271.1|  PREDICTED: uncharacterized protein LOC103336...  87.0    1e-15   
emb|CAN64336.1|  hypothetical protein VITISV_001809                   87.4    1e-15   Vitis vinifera
ref|XP_010275231.1|  PREDICTED: uncharacterized protein LOC104610...  87.4    1e-15   
ref|XP_010275224.1|  PREDICTED: uncharacterized protein LOC104610...  87.0    2e-15   
ref|XP_010239099.1|  PREDICTED: uncharacterized protein LOC104584949  85.5    2e-15   
ref|XP_010275225.1|  PREDICTED: uncharacterized protein LOC104610...  87.0    2e-15   
ref|XP_010275228.1|  PREDICTED: uncharacterized protein LOC104610...  87.0    2e-15   
ref|XP_010671078.1|  PREDICTED: uncharacterized protein LOC104887...  86.7    2e-15   
ref|XP_010275226.1|  PREDICTED: uncharacterized protein LOC104610...  87.0    2e-15   
ref|XP_010275227.1|  PREDICTED: uncharacterized protein LOC104610...  87.0    2e-15   
gb|KFK29538.1|  hypothetical protein AALP_AA7G147200                  84.3    2e-15   
ref|XP_010671076.1|  PREDICTED: uncharacterized protein LOC104887...  87.0    2e-15   
ref|XP_010926918.1|  PREDICTED: uncharacterized protein LOC105049...  86.3    2e-15   
ref|XP_010671077.1|  PREDICTED: uncharacterized protein LOC104887...  86.7    2e-15   
ref|XP_007208845.1|  hypothetical protein PRUPE_ppa025567mg           85.9    2e-15   
ref|XP_008806830.1|  PREDICTED: uncharacterized protein LOC103719390  86.3    2e-15   
ref|XP_009769637.1|  PREDICTED: uncharacterized protein LOC104220...  86.7    2e-15   
ref|XP_009397137.1|  PREDICTED: uncharacterized protein LOC103982...  86.7    2e-15   
ref|XP_009348940.1|  PREDICTED: uncharacterized protein LOC103940...  86.7    2e-15   
ref|XP_009769635.1|  PREDICTED: uncharacterized protein LOC104220...  86.7    2e-15   
ref|XP_009769636.1|  PREDICTED: uncharacterized protein LOC104220...  86.3    2e-15   
ref|XP_009397135.1|  PREDICTED: uncharacterized protein LOC103982...  86.3    2e-15   
gb|EEE58579.1|  hypothetical protein OsJ_09901                        86.3    2e-15   
ref|NP_001049364.1|  Os03g0213600                                     86.3    2e-15   
ref|XP_009769638.1|  PREDICTED: uncharacterized protein LOC104220...  86.3    3e-15   
ref|XP_009769639.1|  PREDICTED: uncharacterized protein LOC104220...  86.3    3e-15   
ref|XP_008382210.1|  PREDICTED: uncharacterized protein LOC103445...  86.3    3e-15   
ref|XP_008382216.1|  PREDICTED: uncharacterized protein LOC103445...  86.3    3e-15   
gb|EEC74754.1|  hypothetical protein OsI_10513                        85.9    3e-15   
ref|XP_010926917.1|  PREDICTED: uncharacterized protein LOC105049...  85.9    3e-15   
ref|XP_008382230.1|  PREDICTED: uncharacterized protein LOC103445...  86.3    3e-15   
ref|XP_009348938.1|  PREDICTED: uncharacterized protein LOC103940...  86.3    3e-15   
ref|XP_009361136.1|  PREDICTED: uncharacterized protein LOC103951...  85.9    3e-15   
ref|XP_009361134.1|  PREDICTED: uncharacterized protein LOC103951...  85.9    3e-15   
ref|XP_002966498.1|  hypothetical protein SELMODRAFT_439529           85.9    3e-15   
ref|XP_002982340.1|  hypothetical protein SELMODRAFT_445123           85.9    3e-15   
ref|XP_010935007.1|  PREDICTED: uncharacterized protein LOC105055018  85.9    3e-15   
ref|XP_010663595.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    3e-15   
ref|XP_009361135.1|  PREDICTED: uncharacterized protein LOC103951...  85.9    3e-15   
ref|XP_010663589.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    3e-15   
ref|XP_008376934.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.9    3e-15   
ref|XP_010663582.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    3e-15   
ref|XP_006494938.1|  PREDICTED: uncharacterized protein LOC102623...  85.9    4e-15   
emb|CBI33889.3|  unnamed protein product                              85.9    4e-15   
ref|XP_010663585.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    4e-15   
ref|XP_006494936.1|  PREDICTED: uncharacterized protein LOC102623...  85.9    4e-15   
gb|KDO47996.1|  hypothetical protein CISIN_1g000388mg                 85.9    4e-15   
ref|XP_010663573.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    4e-15   
gb|KDO47995.1|  hypothetical protein CISIN_1g000388mg                 85.9    4e-15   
ref|XP_010663576.1|  PREDICTED: uncharacterized protein LOC100243...  85.9    4e-15   
ref|XP_011044443.1|  PREDICTED: uncharacterized protein LOC105139...  85.9    4e-15   
ref|XP_011044441.1|  PREDICTED: uncharacterized protein LOC105139...  85.9    4e-15   
ref|XP_011044440.1|  PREDICTED: uncharacterized protein LOC105139...  85.9    4e-15   
ref|XP_006494937.1|  PREDICTED: uncharacterized protein LOC102623...  85.9    4e-15   
ref|XP_002319244.2|  hypothetical protein POPTR_0013s07550g           85.9    4e-15   
ref|XP_011044442.1|  PREDICTED: uncharacterized protein LOC105139...  85.9    4e-15   
gb|KHN39855.1|  Bromodomain adjacent to zinc finger domain protei...  85.5    4e-15   
ref|XP_006590859.1|  PREDICTED: uncharacterized protein LOC100784...  85.5    4e-15   
ref|XP_006590862.1|  PREDICTED: uncharacterized protein LOC100784...  85.5    4e-15   
ref|XP_006590863.1|  PREDICTED: uncharacterized protein LOC100784...  85.5    4e-15   
ref|XP_006590866.1|  PREDICTED: uncharacterized protein LOC100784...  85.5    5e-15   
ref|XP_002535114.1|  hypothetical protein RCOM_2156040                85.1    5e-15   
ref|XP_009601822.1|  PREDICTED: uncharacterized protein LOC104097...  85.5    6e-15   
ref|XP_009601826.1|  PREDICTED: uncharacterized protein LOC104097...  85.1    6e-15   
ref|XP_009601825.1|  PREDICTED: uncharacterized protein LOC104097...  85.1    6e-15   
ref|XP_009601823.1|  PREDICTED: uncharacterized protein LOC104097...  85.1    6e-15   
ref|XP_009601827.1|  PREDICTED: uncharacterized protein LOC104097...  85.1    7e-15   
ref|XP_010941237.1|  PREDICTED: uncharacterized protein LOC105059...  85.1    7e-15   
ref|XP_009601824.1|  PREDICTED: uncharacterized protein LOC104097...  85.1    7e-15   
ref|XP_010941238.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    8e-15   
ref|XP_010087452.1|  DnAJ-like protein                                84.7    8e-15   
ref|XP_010941234.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    8e-15   
ref|XP_010941235.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    8e-15   
ref|XP_010941236.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    9e-15   
gb|EMT16754.1|  Bromodomain adjacent to zinc finger domain protei...  84.3    9e-15   
gb|EMT30778.1|  hypothetical protein F775_03347                       84.3    1e-14   
ref|XP_007131493.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_007131490.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_007131489.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_007131492.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_007131491.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_007131494.1|  hypothetical protein PHAVU_011G017900g           84.3    1e-14   
ref|XP_010237933.1|  PREDICTED: uncharacterized protein LOC100836488  83.6    1e-14   
ref|XP_010318850.1|  PREDICTED: uncharacterized protein LOC104646591  82.4    1e-14   
ref|XP_002468281.1|  hypothetical protein SORBIDRAFT_01g042960        83.6    2e-14   
ref|XP_006345130.1|  PREDICTED: uncharacterized protein LOC102592770  79.3    2e-14   
ref|XP_008796292.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  83.2    2e-14   
emb|CDY49643.1|  BnaC09g41210D                                        83.2    2e-14   
ref|XP_004511407.1|  PREDICTED: serine-rich adhesin for platelets...  83.2    3e-14   
gb|EMS52193.1|  hypothetical protein TRIUR3_19369                     82.8    3e-14   
ref|XP_004511404.1|  PREDICTED: serine-rich adhesin for platelets...  83.2    3e-14   
ref|XP_007157085.1|  hypothetical protein PHAVU_002G041700g           83.2    3e-14   
ref|XP_006662092.1|  PREDICTED: uncharacterized protein LOC102719988  82.8    3e-14   
ref|XP_004516586.1|  PREDICTED: serine-rich adhesin for platelets...  82.8    3e-14   
ref|XP_009395441.1|  PREDICTED: uncharacterized protein LOC103980...  82.8    3e-14   
ref|NP_001050382.1|  Os03g0421000                                     81.6    3e-14   
tpg|DAA46436.1|  TPA: hypothetical protein ZEAMMB73_035751            82.8    4e-14   
ref|XP_009395440.1|  PREDICTED: uncharacterized protein LOC103980...  82.8    4e-14   
ref|XP_008658642.1|  PREDICTED: uncharacterized protein LOC103637710  82.8    4e-14   
ref|XP_002442855.1|  hypothetical protein SORBIDRAFT_08g003890        82.0    4e-14   
ref|XP_010680181.1|  PREDICTED: uncharacterized protein LOC104895...  82.0    5e-14   
gb|KDP39546.1|  hypothetical protein JCGZ_02566                       82.4    5e-14   
ref|XP_010680172.1|  PREDICTED: uncharacterized protein LOC104895...  82.0    5e-14   
ref|XP_010680189.1|  PREDICTED: uncharacterized protein LOC104895...  82.0    5e-14   
ref|XP_006589502.1|  PREDICTED: uncharacterized protein LOC100817...  79.7    5e-14   
ref|NP_186939.2|  RING/FYVE/PHD zinc finger-related protein           82.0    5e-14   
ref|XP_002882257.1|  hypothetical protein ARALYDRAFT_477535           82.0    6e-14   
ref|XP_004307841.1|  PREDICTED: uncharacterized protein LOC101314703  82.0    6e-14   
ref|XP_006847740.1|  hypothetical protein AMTR_s00149p00102010        82.0    6e-14   
ref|XP_002442850.1|  hypothetical protein SORBIDRAFT_08g003830        81.6    6e-14   
gb|EYU19754.1|  hypothetical protein MIMGU_mgv1a000792mg              81.6    6e-14   
ref|XP_010680196.1|  PREDICTED: uncharacterized protein LOC104895...  81.6    7e-14   
ref|XP_002526135.1|  hypothetical protein RCOM_0137170                80.1    7e-14   
ref|NP_001066220.1|  Os12g0161700                                     78.6    7e-14   
ref|XP_001777945.1|  predicted protein                                81.6    8e-14   
gb|EYU23799.1|  hypothetical protein MIMGU_mgv1a023369mg              77.4    8e-14   
ref|XP_009348939.1|  PREDICTED: uncharacterized protein LOC103940...  81.6    9e-14   
ref|XP_004983579.1|  PREDICTED: uncharacterized protein LOC101781733  81.6    9e-14   
ref|XP_010919892.1|  PREDICTED: uncharacterized protein LOC105043...  81.6    9e-14   
ref|XP_010919895.1|  PREDICTED: uncharacterized protein LOC105043...  81.6    9e-14   
gb|EMS51722.1|  hypothetical protein TRIUR3_00232                     81.3    9e-14   
ref|XP_002514661.1|  conserved hypothetical protein                   80.9    9e-14   
ref|XP_009348941.1|  PREDICTED: uncharacterized protein LOC103940...  81.3    1e-13   
ref|XP_009348935.1|  PREDICTED: uncharacterized protein LOC103940...  81.3    1e-13   
ref|XP_006582560.1|  PREDICTED: uncharacterized protein LOC102661850  78.2    1e-13   
gb|AAF26970.1|AC018363_15  unknown protein                            80.5    1e-13   
ref|XP_010235020.1|  PREDICTED: uncharacterized protein LOC100844587  80.5    2e-13   
emb|CDX69433.1|  BnaA10g17820D                                        80.5    2e-13   
emb|CDP13021.1|  unnamed protein product                              79.7    2e-13   
ref|XP_010420369.1|  PREDICTED: uncharacterized protein LOC104705960  80.1    2e-13   
ref|XP_008659918.1|  PREDICTED: uncharacterized protein LOC103638903  80.1    2e-13   
gb|EMS54694.1|  hypothetical protein TRIUR3_13451                     80.1    2e-13   
ref|XP_010318291.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    2e-13   
ref|XP_010318292.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    2e-13   
ref|XP_010318294.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    2e-13   
ref|XP_010318293.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    3e-13   
ref|XP_010318298.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    3e-13   
ref|XP_004235271.1|  PREDICTED: uncharacterized protein LOC101244...  80.1    3e-13   
ref|XP_010453830.1|  PREDICTED: uncharacterized protein LOC104735701  79.7    3e-13   
gb|EPS73829.1|  hypothetical protein M569_00926                       77.4    3e-13   
ref|XP_008234529.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
ref|XP_008234528.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
gb|KEH17765.1|  RING/FYVE/PHD zinc finger protein, putative           79.7    3e-13   
gb|KEH17766.1|  RING/FYVE/PHD zinc finger protein, putative           79.7    3e-13   
ref|XP_008234525.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
ref|XP_008234527.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
gb|KEH17764.1|  RING/FYVE/PHD zinc finger protein, putative           79.7    3e-13   
ref|XP_008234526.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
ref|XP_008234524.1|  PREDICTED: uncharacterized protein LOC103333...  79.7    3e-13   
ref|XP_006590425.1|  PREDICTED: uncharacterized protein LOC100806...  79.7    3e-13   
emb|CDP04918.1|  unnamed protein product                              79.7    3e-13   
emb|CDX78703.1|  BnaA03g06150D                                        79.7    3e-13   
ref|XP_009131554.1|  PREDICTED: uncharacterized protein LOC103856...  79.7    3e-13   
ref|XP_009131553.1|  PREDICTED: uncharacterized protein LOC103856...  79.7    3e-13   
gb|EMT12217.1|  hypothetical protein F775_04667                       79.7    3e-13   
gb|KHN46480.1|  Bromodomain adjacent to zinc finger domain protei...  79.7    4e-13   
ref|XP_011028191.1|  PREDICTED: uncharacterized protein LOC105128...  79.3    4e-13   
ref|XP_010525303.1|  PREDICTED: uncharacterized protein LOC104803125  79.7    4e-13   
ref|XP_011028190.1|  PREDICTED: uncharacterized protein LOC105128...  79.3    4e-13   
gb|EEE51448.1|  hypothetical protein OsJ_32548                        79.3    4e-13   
gb|EEC67485.1|  hypothetical protein OsI_34741                        79.3    4e-13   
ref|XP_006592006.1|  PREDICTED: dentin sialophosphoprotein-like       79.3    5e-13   
gb|ABG22377.1|  PHD-finger family protein, expressed                  76.6    5e-13   
gb|ABG66280.1|  expressed protein                                     79.3    5e-13   
ref|XP_003610802.1|  Bromodomain adjacent to zinc finger domain p...  79.0    5e-13   
emb|CDX70705.1|  BnaC03g07890D                                        79.0    5e-13   
gb|KEH27368.1|  RING/FYVE/PHD zinc finger protein, putative           79.0    6e-13   
gb|AAL86490.1|AC077693_29  putative DNA-binding protein, 5'-partial   78.6    6e-13   
ref|XP_007220350.1|  hypothetical protein PRUPE_ppa000413m1g          78.6    6e-13   
ref|XP_010502787.1|  PREDICTED: uncharacterized protein LOC104779...  78.6    7e-13   
ref|XP_010502637.1|  PREDICTED: uncharacterized protein LOC104779...  78.6    8e-13   
ref|XP_007137700.1|  hypothetical protein PHAVU_009G148400g           75.9    8e-13   
ref|XP_010492581.1|  PREDICTED: uncharacterized protein LOC104769950  78.6    8e-13   
gb|KDO83663.1|  hypothetical protein CISIN_1g0089082mg                77.8    8e-13   
ref|XP_010502712.1|  PREDICTED: uncharacterized protein LOC104779...  78.2    8e-13   
emb|CDP18118.1|  unnamed protein product                              74.3    8e-13   
ref|XP_010502842.1|  PREDICTED: uncharacterized protein LOC104779...  78.2    8e-13   
ref|XP_002442856.1|  hypothetical protein SORBIDRAFT_08g003900        78.2    8e-13   
gb|EEE51692.1|  hypothetical protein OsJ_33055                        77.8    9e-13   
ref|XP_001765518.1|  predicted protein                                78.6    9e-13   
ref|NP_001065815.1|  Os11g0160100                                     77.8    9e-13   
ref|XP_002439272.1|  hypothetical protein SORBIDRAFT_09g003580        78.2    9e-13   
ref|XP_008657008.1|  PREDICTED: uncharacterized protein LOC103636...  77.4    1e-12   
ref|XP_008657001.1|  PREDICTED: uncharacterized protein LOC103636...  77.4    1e-12   
gb|EEC67722.1|  hypothetical protein OsI_35207                        77.8    1e-12   
ref|XP_007039510.1|  Uncharacterized protein isoform 6                77.8    1e-12   
ref|XP_010237272.1|  PREDICTED: uncharacterized protein LOC104584403  77.4    1e-12   
ref|XP_007039505.1|  Uncharacterized protein isoform 1                78.2    1e-12   
ref|XP_004984011.1|  PREDICTED: uncharacterized protein LOC101753925  77.4    1e-12   
ref|XP_010228977.1|  PREDICTED: uncharacterized protein LOC100846885  77.8    1e-12   
ref|XP_007039507.1|  Uncharacterized protein isoform 3                77.8    1e-12   
ref|XP_007039509.1|  Uncharacterized protein isoform 5                77.8    1e-12   
ref|XP_007039508.1|  Uncharacterized protein isoform 4                77.8    1e-12   
ref|XP_006437427.1|  hypothetical protein CICLE_v10033462mg           77.8    1e-12   
gb|ABA91581.2|  PHD-finger family protein, expressed                  77.4    1e-12   
ref|XP_007039506.1|  Uncharacterized protein isoform 2                77.8    1e-12   
ref|XP_002464896.1|  hypothetical protein SORBIDRAFT_01g028420        77.8    1e-12   
gb|KHN35157.1|  Bromodomain adjacent to zinc finger domain protei...  77.8    1e-12   
ref|XP_010485621.1|  PREDICTED: uncharacterized protein LOC104763913  77.4    2e-12   
ref|XP_010463721.1|  PREDICTED: uncharacterized protein LOC104744...  77.0    2e-12   
ref|XP_006400205.1|  hypothetical protein EUTSA_v10012458mg           77.0    2e-12   
ref|XP_006400206.1|  hypothetical protein EUTSA_v10012458mg           77.0    2e-12   
ref|XP_010463720.1|  PREDICTED: uncharacterized protein LOC104744...  77.0    2e-12   
gb|KHN17820.1|  hypothetical protein glysoja_029128                   75.9    2e-12   
gb|EMS58183.1|  Bromodomain adjacent to zinc finger domain protei...  76.6    3e-12   
ref|XP_010319546.1|  PREDICTED: uncharacterized protein LOC104646790  72.0    3e-12   
ref|XP_006347606.1|  PREDICTED: uncharacterized protein LOC102589...  76.6    3e-12   
ref|XP_006347601.1|  PREDICTED: uncharacterized protein LOC102589...  76.6    3e-12   
ref|XP_006347600.1|  PREDICTED: uncharacterized protein LOC102589...  76.6    3e-12   
ref|XP_006347603.1|  PREDICTED: uncharacterized protein LOC102589...  76.6    3e-12   
ref|XP_006347602.1|  PREDICTED: uncharacterized protein LOC102589...  76.6    3e-12   
gb|EPS71521.1|  hypothetical protein M569_03238                       75.9    3e-12   
ref|XP_006385644.1|  hypothetical protein POPTR_0003s08970g           76.3    3e-12   
ref|XP_006385645.1|  hypothetical protein POPTR_0003s08970g           76.3    3e-12   
ref|XP_004154159.1|  PREDICTED: uncharacterized protein LOC101211560  75.9    5e-12   
tpg|DAA44064.1|  TPA: hypothetical protein ZEAMMB73_585196            75.5    5e-12   
gb|KHN13038.1|  hypothetical protein glysoja_027326                   75.5    5e-12   
ref|XP_006300137.1|  hypothetical protein CARUB_v10016366mg           75.9    5e-12   
ref|XP_006590609.1|  PREDICTED: uncharacterized protein LOC102669922  75.5    5e-12   
ref|XP_008645702.1|  PREDICTED: uncharacterized protein LOC100383...  75.9    5e-12   
ref|XP_008645697.1|  PREDICTED: uncharacterized protein LOC100383...  75.9    5e-12   
emb|CAC01832.1|  putative protein                                     75.5    6e-12   
ref|NP_197170.3|  RING/FYVE/PHD zinc finger-containing protein        75.5    6e-12   
ref|XP_010919894.1|  PREDICTED: uncharacterized protein LOC105043...  75.9    6e-12   
ref|XP_010919891.1|  PREDICTED: uncharacterized protein LOC105043...  75.5    7e-12   
ref|XP_010919893.1|  PREDICTED: uncharacterized protein LOC105043...  75.5    7e-12   
ref|XP_006664358.1|  PREDICTED: uncharacterized protein LOC102707638  72.0    8e-12   
ref|XP_004511790.1|  PREDICTED: uncharacterized protein LOC101505...  75.1    9e-12   
ref|XP_003602571.1|  hypothetical protein MTR_3g095800                73.6    9e-12   
gb|EMT04460.1|  hypothetical protein F775_02434                       75.1    9e-12   
ref|XP_004511789.1|  PREDICTED: uncharacterized protein LOC101505...  75.1    9e-12   
gb|EYU31268.1|  hypothetical protein MIMGU_mgv1a018424mg              72.0    1e-11   
ref|XP_004511792.1|  PREDICTED: uncharacterized protein LOC101505...  74.7    1e-11   
ref|XP_009121463.1|  PREDICTED: uncharacterized protein LOC103846310  74.7    1e-11   



>ref|XP_010319818.1| PREDICTED: uncharacterized protein LOC101262104 [Solanum lycopersicum]
Length=324

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = -1

Query  743  ACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLP  564
            A  E  LP+++ IWRG F I  K+Y+  DGL AHL V+A +KVY+EA  FP +LQLEMLP
Sbjct  162  AGQERALPLVDFIWRGSFNILNKEYETFDGLLAHLSVKACQKVYEEASLFPALLQLEMLP  221

Query  563  VSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
             S VWP+SF  S PTD NI LYFF +  +C  +F  LVE M+ E LA++A + N+ELL+F
Sbjct  222  KSDVWPKSFTISEPTDDNIALYFFPSDTRCEKEFDQLVEQMIGEELALRATVTNAELLVF  281

Query  383  TSVELPLIYWRFQGEFYLWGLF---RDS  309
            TS ELPL+YWRFQG++YLWG+F   RDS
Sbjct  282  TSTELPLLYWRFQGKYYLWGVFKAKRDS  309



>ref|XP_006340480.1| PREDICTED: uncharacterized protein LOC102581686 [Solanum tuberosum]
Length=435

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -1

Query  743  ACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLP  564
            A  E  LP+++ IWRG F I  K+Y+  DGL AHL V+A +KVY+EA  FP +LQLEMLP
Sbjct  273  AGQERALPLVDFIWRGSFNILNKEYETFDGLLAHLSVKACQKVYEEASLFPALLQLEMLP  332

Query  563  VSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
             S VWP+SF  S PTD NI LYFF +  +C  +F  LVE M+ E LA++A + N+ELL+F
Sbjct  333  KSDVWPKSFTISEPTDDNIALYFFPSDTRCEKEFDQLVEQMIGEELALRATVTNAELLVF  392

Query  383  TSVELPLIYWRFQGEFYLWGLFR  315
            TS ELPL+YWRFQG++YLWG+F+
Sbjct  393  TSTELPLLYWRFQGKYYLWGVFK  415



>ref|XP_009616695.1| PREDICTED: uncharacterized protein LOC104109171 [Nicotiana tomentosiformis]
Length=434

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  749  LAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            +   HE   PV + IWRG F I  K Y+   GL AHL V+A +KV++EAK FPP+L+LEM
Sbjct  229  IHGVHEQAQPVYDPIWRGGFNIWNKKYEKFGGLVAHLSVKACQKVFEEAKLFPPLLRLEM  288

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            LP S +WP+SF+TS P+D NI +YFF    +    F  LVE M+ E+LA++AV+ N+ELL
Sbjct  289  LPKSDIWPKSFNTSEPSDDNIAMYFFPLDARHVGYFDHLVEEMIGEQLALRAVVTNAELL  348

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +FTS ELPL++WRFQG+ YLWG+FR
Sbjct  349  VFTSTELPLLHWRFQGKHYLWGIFR  373



>ref|XP_009769701.1| PREDICTED: uncharacterized protein LOC104220515 [Nicotiana sylvestris]
Length=426

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -1

Query  749  LAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            +    E   PV +  WRG F I  K Y+IL GL AHL V+A +KV++EAK FPP+L LEM
Sbjct  221  IHGVQEQAQPVYDPSWRGGFYIWNKKYEILGGLVAHLSVKACQKVFEEAKLFPPLLNLEM  280

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            LP S +WP+SF+TS P+D NI LYFF    +    F  LVE M+ E+LA++AV+ N+ELL
Sbjct  281  LPKSDIWPKSFNTSEPSDANIALYFFPLDARHVMDFDHLVEEMIGEQLALRAVVTNAELL  340

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +FTS ELPL++WRFQG+ YLWG+FR
Sbjct  341  VFTSTELPLLHWRFQGKHYLWGVFR  365



>ref|XP_011074762.1| PREDICTED: uncharacterized protein LOC105159407 isoform X1 [Sesamum 
indicum]
Length=466

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI  IWRG F I  +  D+LDG  AHL  RA +KVY+EA  F P+L LE LP   VWP+
Sbjct  270  PVITPIWRGSFSIWNEKDDVLDGFVAHLSSRACQKVYEEACQFQPVLHLEKLPRPYVWPK  329

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF+TS P+ +NI LYFF ++ +    F  LV+ MM   LAM+AVL+N+ELL+FTS +LPL
Sbjct  330  SFETSEPSAENIALYFFPSEIRYERAFDHLVDEMMHNELAMRAVLQNAELLVFTSTQLPL  389

Query  362  IYWRFQGEFYLWGLFR  315
             YWRFQ ++YLWG+FR
Sbjct  390  QYWRFQDKYYLWGVFR  405



>ref|XP_011074763.1| PREDICTED: uncharacterized protein LOC105159407 isoform X2 [Sesamum 
indicum]
Length=458

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI  IWRG F I  +  D+LDG  AHL  RA +KVY+EA  F P+L LE LP   VWP+
Sbjct  262  PVITPIWRGSFSIWNEKDDVLDGFVAHLSSRACQKVYEEACQFQPVLHLEKLPRPYVWPK  321

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF+TS P+ +NI LYFF ++ +    F  LV+ MM   LAM+AVL+N+ELL+FTS +LPL
Sbjct  322  SFETSEPSAENIALYFFPSEIRYERAFDHLVDEMMHNELAMRAVLQNAELLVFTSTQLPL  381

Query  362  IYWRFQGEFYLWGLFR  315
             YWRFQ ++YLWG+FR
Sbjct  382  QYWRFQDKYYLWGVFR  397



>emb|CDP18279.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 108/175 (62%), Gaps = 14/175 (8%)
 Frame = -1

Query  797  IGSFNQPRVG---CNTQAQLAACH----------EPGLPVINIIWRGCFKICYKDY-DIL  660
            + S N P+ G   C   +QLA+ H          E  +P I  IWRG F I  KDY +  
Sbjct  414  VSSANLPQKGAEECLEGSQLASGHLENNLTVDNREQAVPRIEPIWRGNFVILNKDYQEFD  473

Query  659  DGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKK  480
            DGL AHL  +A EKVY+EA   P  L+LEML     WP+SF  S P+D NI LYFF   K
Sbjct  474  DGLVAHLSSKACEKVYEEAILLPSALELEMLAKMDCWPKSFQKSQPSDDNIALYFFPLDK  533

Query  479  KCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +    F  LVE MM + LAMKA+++N+ELLIF S ELPL YWRFQG++YLWG+FR
Sbjct  534  RSEGLFDCLVEEMMDQELAMKAIVKNAELLIFASNELPLSYWRFQGKYYLWGVFR  588



>ref|XP_006359315.1| PREDICTED: uncharacterized protein LOC102599098 [Solanum tuberosum]
Length=344

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -1

Query  749  LAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            + A  E   PV++ IWRG F I  K+Y   DGL AHL V+A +KV++EAK F  +L LEM
Sbjct  139  IHAVVEQAQPVLDPIWRGSFNIWNKEYKTFDGLVAHLSVKACQKVFEEAKLFSLLLHLEM  198

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            LP S +WP+SF+T  P D NI LYFF +  +    F  L+E M+ E  A++AV+ N+ELL
Sbjct  199  LPKSDIWPKSFNTLEPRDDNIALYFFPSDARYEQDFDHLIEEMIGEEFALRAVMTNAELL  258

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +FTS ELPL  WRFQ + YLWG+FR
Sbjct  259  VFTSTELPLHNWRFQHKHYLWGVFR  283



>ref|XP_009780942.1| PREDICTED: uncharacterized protein LOC104229912 [Nicotiana sylvestris]
Length=472

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 10/157 (6%)
 Frame = -1

Query  785  NQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKE  606
            N+P+ G   +AQ         P+I+ IWRG F I  K+Y+   G  AHL V+A +KV++E
Sbjct  265  NEPKHGGQDRAQ---------PLIDFIWRGSFNIWNKEYETFYG-QAHLSVKACQKVFEE  314

Query  605  AKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERL  426
            A   P  LQLEMLP S +WP+SF  S PTD NI LYFF +  +    F  LVE M+   L
Sbjct  315  ASLLPASLQLEMLPKSDLWPKSFTISEPTDDNIALYFFPSDIRWEKVFDQLVEKMISNEL  374

Query  425  AMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            A++A++ N+ELL+FTS ELPL+YWRFQG+ YLWG+FR
Sbjct  375  ALRAIVTNAELLVFTSTELPLLYWRFQGKHYLWGVFR  411



>ref|XP_010319314.1| PREDICTED: uncharacterized protein LOC101248666 isoform X2 [Solanum 
lycopersicum]
Length=341

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -1

Query  749  LAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            + A  E   PV++ IWRG F I  K+Y   DGL AHL V+A +KV++EAK F  +L LEM
Sbjct  136  IHAVVEQAQPVLDPIWRGGFTIWNKEYKTFDGLVAHLSVKACQKVFEEAKLFSLLLHLEM  195

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            LP S +WP+SF+T  P   NI LYFF +  +    F  L+E M+ E LA++AV+ N+ELL
Sbjct  196  LPKSDIWPKSFNTLEPRVDNIALYFFPSDARYEQDFDHLIEEMIGEELALRAVMTNAELL  255

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +FTS ELPL  WRFQ + YLWG+FR
Sbjct  256  VFTSTELPLQNWRFQHKHYLWGVFR  280



>ref|XP_004237166.1| PREDICTED: uncharacterized protein LOC101248666 isoform X1 [Solanum 
lycopersicum]
Length=344

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -1

Query  749  LAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            + A  E   PV++ IWRG F I  K+Y   DGL AHL V+A +KV++EAK F  +L LEM
Sbjct  139  IHAVVEQAQPVLDPIWRGGFTIWNKEYKTFDGLVAHLSVKACQKVFEEAKLFSLLLHLEM  198

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            LP S +WP+SF+T  P   NI LYFF +  +    F  L+E M+ E LA++AV+ N+ELL
Sbjct  199  LPKSDIWPKSFNTLEPRVDNIALYFFPSDARYEQDFDHLIEEMIGEELALRAVMTNAELL  258

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +FTS ELPL  WRFQ + YLWG+FR
Sbjct  259  VFTSTELPLQNWRFQHKHYLWGVFR  283



>ref|XP_011101633.1| PREDICTED: uncharacterized protein LOC105179671 isoform X2 [Sesamum 
indicum]
Length=564

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI  IW G F I  K YDILDGL AH+  +A  KVY  A  F P++ LEMLP S VWP+
Sbjct  366  PVIVPIWSGSFNIWNKKYDILDGLIAHMSSKACGKVYDAACQFQPVIHLEMLPRSDVWPK  425

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF TS P+  NI LYFF++    R  + +LV+ MM + LA+K +++N+ELLIFTS ELPL
Sbjct  426  SFQTSEPSGDNIALYFFSSVISKRV-YQNLVKEMMHKELALKGIMQNAELLIFTSTELPL  484

Query  362  IYWRFQGEFYLWGLFR  315
            +YW FQG+ YLWG+FR
Sbjct  485  LYWTFQGKHYLWGVFR  500



>ref|XP_011101637.1| PREDICTED: uncharacterized protein LOC105179671 isoform X3 [Sesamum 
indicum]
Length=562

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI  IW G F I  K YDILDGL AH+  +A  KVY  A  F P++ LEMLP S VWP+
Sbjct  364  PVIVPIWSGSFNIWNKKYDILDGLIAHMSSKACGKVYDAACQFQPVIHLEMLPRSDVWPK  423

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF TS P+  NI LYFF++    R  + +LV+ MM + LA+K +++N+ELLIFTS ELPL
Sbjct  424  SFQTSEPSGDNIALYFFSSVISKRV-YQNLVKEMMHKELALKGIMQNAELLIFTSTELPL  482

Query  362  IYWRFQGEFYLWGLFR  315
            +YW FQG+ YLWG+FR
Sbjct  483  LYWTFQGKHYLWGVFR  498



>ref|XP_011101626.1| PREDICTED: uncharacterized protein LOC105179671 isoform X1 [Sesamum 
indicum]
Length=585

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI  IW G F I  K YDILDGL AH+  +A  KVY  A  F P++ LEMLP S VWP+
Sbjct  387  PVIVPIWSGSFNIWNKKYDILDGLIAHMSSKACGKVYDAACQFQPVIHLEMLPRSDVWPK  446

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF TS P+  NI LYFF++    R  + +LV+ MM + LA+K +++N+ELLIFTS ELPL
Sbjct  447  SFQTSEPSGDNIALYFFSSVISKRV-YQNLVKEMMHKELALKGIMQNAELLIFTSTELPL  505

Query  362  IYWRFQGEFYLWGLFR  315
            +YW FQG+ YLWG+FR
Sbjct  506  LYWTFQGKHYLWGVFR  521



>ref|XP_009615962.1| PREDICTED: uncharacterized protein LOC104108592 isoform X2 [Nicotiana 
tomentosiformis]
Length=484

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG F I  K+Y+   G  AHL V+A +KV++EA   P  LQLEMLP S +WP+
Sbjct  290  PLIDFIWRGSFNIWNKEYETFYG-QAHLSVKACQKVFEEAILLPASLQLEMLPKSDLWPK  348

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF  S PTD NI LYFF +  +    F  LVE M+   LA++A++ N+ELL+FTS ELPL
Sbjct  349  SFTISEPTDDNIALYFFPSDIRWEKVFDRLVEKMISNELALRAIVTNAELLVFTSTELPL  408

Query  362  IYWRFQGEFYLWGLFR  315
            +YWRFQG+ YLWG+FR
Sbjct  409  LYWRFQGKHYLWGVFR  424



>ref|XP_009615961.1| PREDICTED: uncharacterized protein LOC104108592 isoform X1 [Nicotiana 
tomentosiformis]
Length=496

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG F I  K+Y+   G  AHL V+A +KV++EA   P  LQLEMLP S +WP+
Sbjct  302  PLIDFIWRGSFNIWNKEYETFYG-QAHLSVKACQKVFEEAILLPASLQLEMLPKSDLWPK  360

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF  S PTD NI LYFF +  +    F  LVE M+   LA++A++ N+ELL+FTS ELPL
Sbjct  361  SFTISEPTDDNIALYFFPSDIRWEKVFDRLVEKMISNELALRAIVTNAELLVFTSTELPL  420

Query  362  IYWRFQGEFYLWGLFR  315
            +YWRFQG+ YLWG+FR
Sbjct  421  LYWRFQGKHYLWGVFR  436



>ref|XP_009776426.1| PREDICTED: uncharacterized protein LOC104226206 [Nicotiana sylvestris]
Length=485

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -1

Query  755  AQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQL  576
            A L   H+   PVIN  W G F I   D+  LDG+ A +  RA +KVY EA  FP  LQL
Sbjct  337  ALLPESHQCAEPVINPTWSGSFNILNGDHGTLDGIVARISSRACKKVYDEACFFPSTLQL  396

Query  575  EMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSE  396
            E++P S+VWP++F  S P+D  I LYFF    +  +KF  LV+ M+ +RLAM+ V++N+E
Sbjct  397  EIVPKSIVWPKNFLRSEPSDDIIALYFFPKDARDVAKFDDLVDEMIHQRLAMRTVVKNAE  456

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFRD  312
            LL+FTS++LP  +WRFQG+ YLWG+FR+
Sbjct  457  LLVFTSMDLPRRHWRFQGKHYLWGVFRE  484



>ref|XP_010664973.1| PREDICTED: uncharacterized protein LOC104882625 isoform X3 [Vitis 
vinifera]
 ref|XP_010664974.1| PREDICTED: uncharacterized protein LOC104882625 isoform X3 [Vitis 
vinifera]
 ref|XP_010664975.1| PREDICTED: uncharacterized protein LOC104882625 isoform X3 [Vitis 
vinifera]
Length=439

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 1/161 (1%)
 Frame = -1

Query  797  IGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEK  618
            IG  N P +  +   + + C     PV++ IWRG F IC +++D ++GLAAHL  +A  K
Sbjct  212  IGPSNTPELDPSNVPEFS-CFVHAQPVVDPIWRGSFSICNENFDSVNGLAAHLSSKACLK  270

Query  617  VYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMM  438
            V ++A   P +L   MLP   VWP+SF  S P+D NI LYFF   ++    F  LV  M+
Sbjct  271  VCQQASLLPALLCPTMLPKFDVWPKSFQISQPSDDNIALYFFPENERDEKVFDRLVLDMV  330

Query  437  QERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
               LAM+ V+EN+ELL+F S ELPL +WRF G+ YLWG+FR
Sbjct  331  SHELAMQTVVENAELLVFASTELPLRHWRFHGKLYLWGVFR  371



>ref|XP_010664972.1| PREDICTED: uncharacterized protein LOC104882625 isoform X2 [Vitis 
vinifera]
Length=482

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 1/161 (1%)
 Frame = -1

Query  797  IGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEK  618
            IG  N P +  +   + + C     PV++ IWRG F IC +++D ++GLAAHL  +A  K
Sbjct  259  IGPSNTPELDPSNVPEFS-CFVHAQPVVDPIWRGSFSICNENFDSVNGLAAHLSSKACLK  317

Query  617  VYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMM  438
            V ++A   P +L   MLP   VWP+SF  S P+D NI LYFF   ++    F  LV  M+
Sbjct  318  VCQQASLLPALLCPTMLPKFDVWPKSFQISQPSDDNIALYFFPENERDEKVFDRLVLDMV  377

Query  437  QERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
               LAM+ V+EN+ELL+F S ELPL +WRF G+ YLWG+FR
Sbjct  378  SHELAMQTVVENAELLVFASTELPLRHWRFHGKLYLWGVFR  418



>ref|XP_010664971.1| PREDICTED: uncharacterized protein LOC104882625 isoform X1 [Vitis 
vinifera]
Length=486

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 1/161 (1%)
 Frame = -1

Query  797  IGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEK  618
            IG  N P +  +   + + C     PV++ IWRG F IC +++D ++GLAAHL  +A  K
Sbjct  259  IGPSNTPELDPSNVPEFS-CFVHAQPVVDPIWRGSFSICNENFDSVNGLAAHLSSKACLK  317

Query  617  VYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMM  438
            V ++A   P +L   MLP   VWP+SF  S P+D NI LYFF   ++    F  LV  M+
Sbjct  318  VCQQASLLPALLCPTMLPKFDVWPKSFQISQPSDDNIALYFFPENERDEKVFDRLVLDMV  377

Query  437  QERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
               LAM+ V+EN+ELL+F S ELPL +WRF G+ YLWG+FR
Sbjct  378  SHELAMQTVVENAELLVFASTELPLRHWRFHGKLYLWGVFR  418



>gb|EYU17431.1| hypothetical protein MIMGU_mgv1a008715mg [Erythranthe guttata]
Length=364

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  707  IWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTS  528
            +WRG F I  +++DI+DG+ AH+  +A EKV +EA  F  +L LEMLP + VWP+SF+ S
Sbjct  3    VWRGSFSIWNENHDIIDGILAHMSNKACEKVNEEASQFQTVLYLEMLPKTDVWPKSFEES  62

Query  527  VPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRF  348
             PT  +I LYFF ++   R  F  LVE MM + LA+KA + N ELLIFTS ELP++YWR 
Sbjct  63   EPTGDSIALYFFPSEISERI-FDGLVEEMMHKELALKAPVHNGELLIFTSKELPIMYWRV  121

Query  347  QGEFYLWGLFRDS  309
            Q ++YLWG+FR +
Sbjct  122  QSKYYLWGVFRSN  134



>gb|EYU17430.1| hypothetical protein MIMGU_mgv1a026792mg [Erythranthe guttata]
Length=312

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+  IW+GCF I  + +DI DG+ AH  V+A EKV++EA  F   L  +MLP   +WP+
Sbjct  168  PVLRPIWKGCFSIWDEKHDI-DGITAHTSVKACEKVHEEATHFQESLHFKMLPKFDIWPK  226

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F  + P+D +I LYFF ++    +KF  LV  MM+E LA++A ++N+ELL+FTS ELP+
Sbjct  227  RFVDAEPSDDSIALYFFPSESG-DTKFDKLVAKMMREELALQAFVKNAELLVFTSTELPV  285

Query  362  IYWRFQGEFYLWGLFR  315
            ++ RFQG++YLWG+FR
Sbjct  286  LHQRFQGKYYLWGVFR  301



>gb|KDP43027.1| hypothetical protein JCGZ_25213 [Jatropha curcas]
Length=514

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 104/180 (58%), Gaps = 17/180 (9%)
 Frame = -1

Query  806  DNTIGSFNQPRVG-CNTQA-----QLAACHEPGL----------PVINIIWRGCFKICYK  675
            DN +G +N    G C  +A     QL  C    +          P+I+ IWRG   +  K
Sbjct  282  DNNLGRWNNLDEGSCCEEAEPENRQLVICDPSNILEQNFAVRAQPIIDQIWRGSLSVLGK  341

Query  674  DYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYF  495
             +  + GL AHL   A   VY+EAKSFP +L  E+ P S +WP+SF    P+D+NI L+F
Sbjct  342  HFGTV-GLVAHLSNLAGSSVYEEAKSFPTLLSPELRPRSAIWPKSFANKGPSDENIALFF  400

Query  494  FAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            F    +   K+ SLV  M+    AM+AVL+N+ELLIFTS  LP+ +WRF+ +F+LWG+F+
Sbjct  401  FPDNDRNEKKYDSLVNDMIHHDRAMRAVLQNAELLIFTSTTLPIDFWRFKAKFFLWGVFK  460



>ref|XP_006472951.1| PREDICTED: uncharacterized protein LOC102625994 [Citrus sinensis]
Length=549

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 89/142 (63%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+ P  P+I  IW+G  ++    Y  ++GL AHL   A  KV++EAK  P +L  E+LP 
Sbjct  349  CYVPAQPIIEPIWKGNLRLSSDKYGSIEGLVAHLSTSACSKVFQEAKLLPQLLCPELLPR  408

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            S  WP+SF    P+D NI LY F   ++    + SLV  M+   +A++AV++N+ELL+FT
Sbjct  409  SNSWPKSFHKWGPSDDNIALYLFPNNERSEKVYDSLVHDMISHDVALRAVVKNAELLLFT  468

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  LP  +WRFQ + YLWG+FR
Sbjct  469  SNLLPFQFWRFQSKVYLWGVFR  490



>ref|XP_006434426.1| hypothetical protein CICLE_v10000763mg [Citrus clementina]
 gb|ESR47666.1| hypothetical protein CICLE_v10000763mg [Citrus clementina]
Length=549

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 88/142 (62%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C  P  P+I  IW+G  ++    Y  ++GL AHL   A  KV++EAK  P +L  E+LP 
Sbjct  349  CFVPAQPIIEPIWKGNLRLSSDKYGSIEGLVAHLSTSACSKVFQEAKLLPQLLCPELLPR  408

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            S  WP+SF    P+D NI LY F   ++    + SLV  M+   +A++AV++N+ LL+FT
Sbjct  409  SNAWPKSFHKWGPSDDNIALYLFPNNERSEKVYDSLVHDMISHDVALRAVVKNAALLLFT  468

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  LP  +WRFQ +FYLWG+FR
Sbjct  469  SNLLPFQFWRFQSKFYLWGVFR  490



>gb|KDO83662.1| hypothetical protein CISIN_1g0089082mg [Citrus sinensis]
Length=546

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 88/142 (62%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C  P  P+I  IW+G  ++    Y  ++GL AHL   A  KV++EAK  P +L  E+LP 
Sbjct  346  CFVPAQPIIEPIWKGNLRLSSDKYGSIEGLVAHLSTSACSKVFQEAKLLPQLLCPELLPR  405

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            S  WP+SF    P+D NI LY F   ++    + SLV  M+   +A++AV++N+ LL+FT
Sbjct  406  SNSWPKSFHKWGPSDDNIALYLFPNNERSEKVYDSLVHDMISHDVALRAVVKNAALLLFT  465

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  LP  +WRFQ +FYLWG+FR
Sbjct  466  SNLLPFQFWRFQSKFYLWGVFR  487



>gb|KDO83661.1| hypothetical protein CISIN_1g0089082mg, partial [Citrus sinensis]
Length=548

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 88/142 (62%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C  P  P+I  IW+G  ++    Y  ++GL AHL   A  KV++EAK  P +L  E+LP 
Sbjct  348  CFVPAQPIIEPIWKGNLRLSSDKYGSIEGLVAHLSTSACSKVFQEAKLLPQLLCPELLPR  407

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            S  WP+SF    P+D NI LY F   ++    + SLV  M+   +A++AV++N+ LL+FT
Sbjct  408  SNSWPKSFHKWGPSDDNIALYLFPNNERSEKVYDSLVHDMISHDVALRAVVKNAALLLFT  467

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  LP  +WRFQ +FYLWG+FR
Sbjct  468  SNLLPFQFWRFQSKFYLWGVFR  489



>gb|KDO83660.1| hypothetical protein CISIN_1g0089082mg [Citrus sinensis]
Length=549

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 88/142 (62%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C  P  P+I  IW+G  ++    Y  ++GL AHL   A  KV++EAK  P +L  E+LP 
Sbjct  349  CFVPAQPIIEPIWKGNLRLSSDKYGSIEGLVAHLSTSACSKVFQEAKLLPQLLCPELLPR  408

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            S  WP+SF    P+D NI LY F   ++    + SLV  M+   +A++AV++N+ LL+FT
Sbjct  409  SNSWPKSFHKWGPSDDNIALYLFPNNERSEKVYDSLVHDMISHDVALRAVVKNAALLLFT  468

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  LP  +WRFQ +FYLWG+FR
Sbjct  469  SNLLPFQFWRFQSKFYLWGVFR  490



>ref|XP_002306612.2| PHD finger family protein [Populus trichocarpa]
 gb|EEE93608.2| PHD finger family protein [Populus trichocarpa]
Length=474

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  764  NTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPM  585
            NT AQ         P+++ IWRG F I   ++D++ GL A+   +AS KV + A   P  
Sbjct  318  NTNAQ---------PILDPIWRGNFTINDGNFDVMKGLVAYTSNQASPKVRETASLLPGS  368

Query  584  LQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLE  405
            + +EMLP   V+P+ F TS  T ++I LYFF  K++    F  LV+ ++++ LA+KAVLE
Sbjct  369  VSIEMLPRHEVFPKKFGTSDVTAEDIGLYFFPEKERDERAFDELVDNIIEQDLALKAVLE  428

Query  404  NSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            ++ELL+FTS++LPL  WR++G++YLWGLF
Sbjct  429  HAELLVFTSLQLPLQNWRYRGKYYLWGLF  457



>ref|XP_008237627.1| PREDICTED: uncharacterized protein LOC103336371 [Prunus mume]
Length=369

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG   I  KD++I+ GL AHL   A  KV +EA+  P ++  E++  + VWP+
Sbjct  180  PIIDPIWRGSLSIFNKDFNIVSGLVAHLSSLACPKVREEAELLPLLIFPELVRRTDVWPK  239

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            +F+   P+D++I LYFF   ++    F SLV  M+Q+ LAMKA+L+N+ELL+FTS  LP 
Sbjct  240  AFEKLGPSDRSIALYFFPDNERDEKDFDSLVASMIQDDLAMKAILDNAELLVFTSTILPE  299

Query  362  IYWRFQGEFYLWGLFR  315
             Y RFQ + YLWG+FR
Sbjct  300  QYQRFQTKIYLWGVFR  315



>ref|XP_007199125.1| hypothetical protein PRUPE_ppa021510mg, partial [Prunus persica]
 gb|EMJ00324.1| hypothetical protein PRUPE_ppa021510mg, partial [Prunus persica]
Length=350

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG   I  KD++I+ GL AHL   A  KV +EA+  P ++  E++  + VWP+
Sbjct  179  PIIDPIWRGSLSIFNKDFNIVSGLVAHLSSLACPKVREEAELLPLLIFPELVRRTDVWPK  238

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            +F+   P+D++I LYFF   ++    F SLV  M+Q+ LAMKA+L+N+ELL+FTS  LP 
Sbjct  239  AFEKLGPSDRSIALYFFPDNERDEKDFDSLVASMIQDDLAMKAILDNAELLVFTSTILPE  298

Query  362  IYWRFQGEFYLWGLFR  315
             Y RFQ + YLWG+FR
Sbjct  299  QYQRFQTKIYLWGVFR  314



>ref|XP_011001424.1| PREDICTED: uncharacterized protein LOC105108706 isoform X3 [Populus 
euphratica]
Length=476

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  764  NTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPM  585
            NT AQ         P+++ IWRG F I   ++D+++GL A+   +AS KV + A   P  
Sbjct  320  NTNAQ---------PILDPIWRGNFTIKDGNFDVMNGLVAYTSNQASPKVRETASLLPGC  370

Query  584  LQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLE  405
            + +EMLP   V+P+ F TS  T ++I LYFF  K++    F  LV+ ++++ LA+KAVLE
Sbjct  371  VSIEMLPRHEVFPKKFGTSDVTAEDIGLYFFPEKERDERAFDELVDNIIEQDLALKAVLE  430

Query  404  NSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            + ELL+FTS++LPL  WR++G++YLWGLF
Sbjct  431  HVELLVFTSLQLPLQNWRYRGKYYLWGLF  459



>ref|XP_011012507.1| PREDICTED: uncharacterized protein LOC105116745 isoform X3 [Populus 
euphratica]
Length=476

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  764  NTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPM  585
            NT AQ         P+++ IWRG F I   ++D+++GL A+   +AS KV + A   P  
Sbjct  320  NTNAQ---------PILDPIWRGNFTIKDGNFDVMNGLVAYTSNQASPKVRETASLLPGC  370

Query  584  LQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLE  405
            + +EMLP   V+P+ F TS  T ++I LYFF  K++    F  LV+ ++++ LA+KAVLE
Sbjct  371  VSIEMLPRHEVFPKKFGTSDVTAEDIGLYFFPEKERDERAFDELVDNIIEQDLALKAVLE  430

Query  404  NSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            + ELL+FTS++LPL  WR++G++YLWGLF
Sbjct  431  HVELLVFTSLQLPLQNWRYRGKYYLWGLF  459



>ref|XP_006606157.1| PREDICTED: uncharacterized protein LOC100796913 [Glycine max]
Length=343

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P IN IWRG    C +    ++GL AH+   A  KV +E   FP +L  E+LP   VWPE
Sbjct  193  PTINPIWRGSMYFCNETNGTVNGLLAHMSDLACSKVVEETGHFPEVLHAELLPRDKVWPE  252

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +  PTDQ+I L+ F   +     F  +VE +M    A+K V + +ELLIF S+ELP+
Sbjct  253  SFKSRRPTDQDIALFIFPDGEGSEKDFDKVVEDIMIHEHAIKIVAKKAELLIFHSIELPI  312

Query  362  IYWRFQGEFYLWGLFR  315
             YWRF+ ++YLWG+FR
Sbjct  313  KYWRFEAKYYLWGVFR  328



>ref|XP_011001422.1| PREDICTED: uncharacterized protein LOC105108706 isoform X1 [Populus 
euphratica]
 ref|XP_011012505.1| PREDICTED: uncharacterized protein LOC105116745 isoform X1 [Populus 
euphratica]
Length=440

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  764  NTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPM  585
            NT AQ         P+++ IWRG F I   ++D+++GL A+   +AS KV + A   P  
Sbjct  284  NTNAQ---------PILDPIWRGNFTIKDGNFDVMNGLVAYTSNQASPKVRETASLLPGC  334

Query  584  LQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLE  405
            + +EMLP   V+P+ F TS  T ++I LYFF  K++    F  LV+ ++++ LA+KAVLE
Sbjct  335  VSIEMLPRHEVFPKKFGTSDVTAEDIGLYFFPEKERDERAFDELVDNIIEQDLALKAVLE  394

Query  404  NSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            + ELL+FTS++LPL  WR++G++YLWGLF
Sbjct  395  HVELLVFTSLQLPLQNWRYRGKYYLWGLF  423



>ref|XP_011001423.1| PREDICTED: uncharacterized protein LOC105108706 isoform X2 [Populus 
euphratica]
 ref|XP_011012506.1| PREDICTED: uncharacterized protein LOC105116745 isoform X2 [Populus 
euphratica]
Length=432

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  764  NTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPM  585
            NT AQ         P+++ IWRG F I   ++D+++GL A+   +AS KV + A   P  
Sbjct  276  NTNAQ---------PILDPIWRGNFTIKDGNFDVMNGLVAYTSNQASPKVRETASLLPGC  326

Query  584  LQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLE  405
            + +EMLP   V+P+ F TS  T ++I LYFF  K++    F  LV+ ++++ LA+KAVLE
Sbjct  327  VSIEMLPRHEVFPKKFGTSDVTAEDIGLYFFPEKERDERAFDELVDNIIEQDLALKAVLE  386

Query  404  NSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            + ELL+FTS++LPL  WR++G++YLWGLF
Sbjct  387  HVELLVFTSLQLPLQNWRYRGKYYLWGLF  415



>gb|KHN46431.1| L-type lectin-domain containing receptor kinase S.6 [Glycine 
soja]
Length=433

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P IN IWRG    C +    ++GL AH+   A  KV +E   FP +L  E+LP   VWPE
Sbjct  283  PTINPIWRGSMYFCNETNGTVNGLLAHMSDLACSKVVEETGHFPEVLHAELLPRDKVWPE  342

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +  PTDQ+I L+ F   +     F  +VE +M    A+K V + +ELLIF S+ELP+
Sbjct  343  SFKSRRPTDQDIALFIFPDGEGSEKDFDKVVEDIMIHEHAIKIVAKKAELLIFHSIELPI  402

Query  362  IYWRFQGEFYLWGLFR  315
             YWRF+ ++YLWG+FR
Sbjct  403  KYWRFEAKYYLWGVFR  418



>ref|XP_007143517.1| hypothetical protein PHAVU_007G078100g [Phaseolus vulgaris]
 gb|ESW15511.1| hypothetical protein PHAVU_007G078100g [Phaseolus vulgaris]
Length=338

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG    C +    + GL AH+   A  KV +E   FP +L  E++P S+VWPE
Sbjct  188  PLIDPIWRGSIYFCNETIGTVSGLLAHVSDLACSKVAQETGRFPEVLHAELVPKSIVWPE  247

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTDQ+I L+FF   +     F +LV+ ++ +  A++ V +N+ELL+F S ELP+
Sbjct  248  SFKRKEPTDQDIALFFFPDSEGTEKVFDALVDDVICQEHAIRFVAKNTELLVFPSTELPI  307

Query  362  IYWRFQGEFYLWGLFR  315
             YWRF+ ++YLWG+F+
Sbjct  308  AYWRFEAKYYLWGVFK  323



>ref|XP_008461941.1| PREDICTED: uncharacterized protein LOC103500424 isoform X1 [Cucumis 
melo]
 ref|XP_008461942.1| PREDICTED: uncharacterized protein LOC103500424 isoform X1 [Cucumis 
melo]
Length=351

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ +WRG  KI  +    +  L AH+   A  KVY+EAK  P +L +E+L    VWP 
Sbjct  168  PIVDPLWRGTLKIWNRSLSRV-VLVAHMSSLACSKVYEEAKILPELLSVELLRRCDVWPR  226

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    PTDQ+I LYFF   +  +  F  LV  MM   LAMKAVL+N+ELL+FTS  LP+
Sbjct  227  GFQKLGPTDQSIALYFFPDGESSQKAFDLLVNAMMSHDLAMKAVLKNAELLVFTSAMLPM  286

Query  362  IYWRFQGEFYLWGLFR  315
             +WRFQ ++YLWG+FR
Sbjct  287  RFWRFQTKYYLWGVFR  302



>ref|XP_008461944.1| PREDICTED: uncharacterized protein LOC103500424 isoform X3 [Cucumis 
melo]
Length=326

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ +WRG  KI  +    +  L AH+   A  KVY+EAK  P +L +E+L    VWP 
Sbjct  143  PIVDPLWRGTLKIWNRSLSRV-VLVAHMSSLACSKVYEEAKILPELLSVELLRRCDVWPR  201

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    PTDQ+I LYFF   +  +  F  LV  MM   LAMKAVL+N+ELL+FTS  LP+
Sbjct  202  GFQKLGPTDQSIALYFFPDGESSQKAFDLLVNAMMSHDLAMKAVLKNAELLVFTSAMLPM  261

Query  362  IYWRFQGEFYLWGLFR  315
             +WRFQ ++YLWG+FR
Sbjct  262  RFWRFQTKYYLWGVFR  277



>ref|XP_006589501.1| PREDICTED: uncharacterized protein LOC102666082 [Glycine max]
Length=343

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P I+ IWRG    C +    ++G+ AH+   A  KV +E   FP +L  E+LP   VWPE
Sbjct  193  PTIDPIWRGSMYFCNETNGTVNGVLAHMSNLACSKVAEETGHFPEVLHAELLPRDKVWPE  252

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +  PTDQ+I L+ F   +     F  LVE +M     ++ V + +ELLIF S+ELP+
Sbjct  253  SFKSRRPTDQDIALFIFPDTEGSEKDFDKLVEDIMINEHVIRIVAKKAELLIFHSIELPI  312

Query  362  IYWRFQGEFYLWGLFR  315
             YWRF+ ++YLWG+FR
Sbjct  313  QYWRFEAKYYLWGVFR  328



>gb|KHN16995.1| hypothetical protein glysoja_011469 [Glycine soja]
Length=325

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P I+ IWRG    C +    ++G+ AH+   A  KV +E   FP +L  E+LP   VWPE
Sbjct  175  PTIDPIWRGSMYFCNETNGTVNGVLAHMSNLACSKVAEETGHFPEVLHAELLPRDKVWPE  234

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +  PTDQ+I L+ F   +     F  LVE +M     ++ V + +ELLIF S+ELP+
Sbjct  235  SFKSRRPTDQDIALFIFPDTEGSEKDFDKLVEDIMINEHVIRIVAKKAELLIFHSIELPI  294

Query  362  IYWRFQGEFYLWGLFR  315
             YWRF+ ++YLWG+FR
Sbjct  295  QYWRFEAKYYLWGVFR  310



>ref|XP_008373265.1| PREDICTED: uncharacterized protein LOC103436597 [Malus domestica]
Length=281

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+    P+I+ IWRG   I  KD++I+ GL AHL   A  KV +EA+  P +L  E++  
Sbjct  85   CYVAAQPIIDPIWRGSLSIFNKDFNIVSGLVAHLSSXACPKVREEAELLPLLLFPELVNR  144

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            + VWP++F+   P DQ+I LYFF   ++    F +LV  M+Q+ L M+AVLE++ELL+FT
Sbjct  145  TDVWPKAFEKCGPNDQSIALYFFPDNERDEKDFDTLVVSMIQDDLTMRAVLEDAELLVFT  204

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            SV LP  Y RFQ +FYLWG+FR
Sbjct  205  SVILPEQYRRFQTKFYLWGVFR  226



>ref|XP_008461943.1| PREDICTED: uncharacterized protein LOC103500424 isoform X2 [Cucumis 
melo]
Length=350

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ +WRG  KI  +    +  L AH+   A  KVY+EAK  P +L +E+L    VWP 
Sbjct  168  PIVDPLWRGTLKIWNRSLSRV-VLVAHMSSLACSKVYEEAKILPELLSVELLRRCDVWPR  226

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    PTDQ+I LYFF   +  +  F  LV  MM   LAMKAVL+N+ELL+FTS  LP+
Sbjct  227  GFQKLGPTDQSIALYFFPDGES-QKAFDLLVNAMMSHDLAMKAVLKNAELLVFTSAMLPM  285

Query  362  IYWRFQGEFYLWGLFR  315
             +WRFQ ++YLWG+FR
Sbjct  286  RFWRFQTKYYLWGVFR  301



>gb|EYU17432.1| hypothetical protein MIMGU_mgv1a010590mg [Erythranthe guttata]
Length=307

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  632  RASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSL  453
            +A   VY EA  F  +L LEMLPVS VWP+SF+ S P+  +I LYFF ++   R  F  L
Sbjct  4    KARGNVYDEASQFQVVLDLEMLPVSDVWPKSFEKSEPSCVDIALYFFPSEISERI-FDGL  62

Query  452  VEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFRDS  309
            VE MM + LA+KA L+N ELLIFTS ELP++YWRFQG++YLWG+FR S
Sbjct  63   VEEMMHKELALKAFLQNGELLIFTSKELPILYWRFQGKYYLWGVFRGS  110



>ref|XP_010999804.1| PREDICTED: uncharacterized protein LOC105107543 isoform X1 [Populus 
euphratica]
Length=458

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 2/153 (1%)
 Frame = -1

Query  767  CNTQAQLA--ACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSF  594
            C+  A  A  +C    LP+ + IWRG   I   +Y    G+ AHL   A  +  +EAK+ 
Sbjct  256  CHFDAHFAEQSCSIHVLPIRDPIWRGSMSIFQNNYGAPGGIVAHLSSIACSRASEEAKAL  315

Query  593  PPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKA  414
              +L  E+LP S VWP+SF    P   +I LYFF   ++    F SLV  M+ + LAM+ 
Sbjct  316  SGLLSPELLPRSGVWPKSFRKLGPAADHIGLYFFPDNERNEIVFDSLVNDMISQDLAMRV  375

Query  413  VLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            V+EN+ELLI+TS  LP+  WRFQ +FYLWG+FR
Sbjct  376  VIENAELLIYTSRILPMDCWRFQSKFYLWGVFR  408



>ref|XP_010999805.1| PREDICTED: uncharacterized protein LOC105107543 isoform X2 [Populus 
euphratica]
Length=453

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 2/153 (1%)
 Frame = -1

Query  767  CNTQAQLA--ACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSF  594
            C+  A  A  +C    LP+ + IWRG   I   +Y    G+ AHL   A  +  +EAK+ 
Sbjct  251  CHFDAHFAEQSCSIHVLPIRDPIWRGSMSIFQNNYGAPGGIVAHLSSIACSRASEEAKAL  310

Query  593  PPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKA  414
              +L  E+LP S VWP+SF    P   +I LYFF   ++    F SLV  M+ + LAM+ 
Sbjct  311  SGLLSPELLPRSGVWPKSFRKLGPAADHIGLYFFPDNERNEIVFDSLVNDMISQDLAMRV  370

Query  413  VLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            V+EN+ELLI+TS  LP+  WRFQ +FYLWG+FR
Sbjct  371  VIENAELLIYTSRILPMDCWRFQSKFYLWGVFR  403



>ref|XP_002307485.1| PHD finger family protein [Populus trichocarpa]
 gb|EEE94481.1| PHD finger family protein [Populus trichocarpa]
Length=456

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            LP+ + IWRG   I   +Y    G+ AHL   A  +  +EAK    +L  E+LP S VWP
Sbjct  272  LPIRDPIWRGSMSIFQNNYGAPGGIVAHLSSIACSRASEEAKGLSGLLSPELLPRSGVWP  331

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            +SF    P   +I LYFF   ++    F SLV  M+ + LAM+ V+EN+ELLI+TS  LP
Sbjct  332  KSFRKLGPAADHIGLYFFPDNERNEIVFDSLVNDMISQDLAMRVVIENAELLIYTSRILP  391

Query  365  LIYWRFQGEFYLWGLFR  315
            +  WRFQ +FYLWG+FR
Sbjct  392  MDCWRFQSKFYLWGVFR  408



>ref|XP_010245258.1| PREDICTED: uncharacterized protein LOC104588837 isoform X7 [Nelumbo 
nucifera]
Length=309

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  115  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  174

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  175  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  234

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  235  LPQTCRRFLGKYFLWGVF  252



>ref|XP_010062138.1| PREDICTED: uncharacterized protein LOC104449615 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69204.1| hypothetical protein EUGRSUZ_F02722 [Eucalyptus grandis]
Length=445

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG  K   +  +    + AH+   A  KV KEAK FP +L  E+ P   VWP+
Sbjct  264  PIIDPIWRGSLKFNKQGINYFGKVVAHVSDLACSKVNKEAKLFPSILCTELHPTPKVWPK  323

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    P+D +I +Y F   K  +  F SLV  M++  LAM+ V+ N+E L+FTS +LPL
Sbjct  324  GFKDRGPSDDSIAIYIFPDNKSEQEFFDSLVIEMIRNDLAMRVVVTNAEFLVFTSTKLPL  383

Query  362  IYWRFQGEFYLWGLFRD  312
              WRFQ +FYLWG+FR+
Sbjct  384  HLWRFQSKFYLWGVFRE  400



>ref|XP_009360762.1| PREDICTED: uncharacterized protein LOC103951174 [Pyrus x bretschneideri]
 ref|XP_009360763.1| PREDICTED: uncharacterized protein LOC103951174 [Pyrus x bretschneideri]
 ref|XP_009360764.1| PREDICTED: uncharacterized protein LOC103951174 [Pyrus x bretschneideri]
 ref|XP_009360765.1| PREDICTED: uncharacterized protein LOC103951174 [Pyrus x bretschneideri]
Length=225

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 92/139 (66%), Gaps = 0/139 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+    P+I+ IWRG   I  +D++I+ GL AHL   A  KV +EA+  P +L  E++  
Sbjct  85   CYVAAQPIIDPIWRGSLSIFNEDFNIVSGLVAHLSSLACPKVREEAELLPLLLFPELVNK  144

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            + VWP++F+   P DQ+I LYFF   ++    F +LV  M+Q+ LAM+AVLE++ELL+FT
Sbjct  145  TDVWPKAFEKCGPNDQSIALYFFPDNERNEKDFDTLVVSMIQDDLAMRAVLEDAELLVFT  204

Query  380  SVELPLIYWRFQGEFYLWG  324
            SV LP  Y RFQ +FYLWG
Sbjct  205  SVILPEQYRRFQTKFYLWG  223



>gb|KCW69205.1| hypothetical protein EUGRSUZ_F02722 [Eucalyptus grandis]
Length=414

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG  K   +  +    + AH+   A  KV KEAK FP +L  E+ P   VWP+
Sbjct  237  PIIDPIWRGSLKFNKQGINYFGKVVAHVSDLACSKVNKEAKLFPSILCTELHPTPKVWPK  296

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    P+D +I +Y F   K  +  F SLV  M++  LAM+ V+ N+E L+FTS +LPL
Sbjct  297  GFKDRGPSDDSIAIYIFPDNKSEQEFFDSLVIEMIRNDLAMRVVVTNAEFLVFTSTKLPL  356

Query  362  IYWRFQGEFYLWGLFRD  312
              WRFQ +FYLWG+FR+
Sbjct  357  HLWRFQSKFYLWGVFRE  373



>ref|XP_010245256.1| PREDICTED: uncharacterized protein LOC104588837 isoform X5 [Nelumbo 
nucifera]
Length=360

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  166  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  225

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  226  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  285

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  286  LPQTCRRFLGKYFLWGVF  303



>ref|XP_010245254.1| PREDICTED: uncharacterized protein LOC104588837 isoform X3 [Nelumbo 
nucifera]
Length=362

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  168  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  227

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  228  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  287

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  288  LPQTCRRFLGKYFLWGVF  305



>ref|XP_010062139.1| PREDICTED: uncharacterized protein LOC104449615 isoform X2 [Eucalyptus 
grandis]
 gb|KCW69206.1| hypothetical protein EUGRSUZ_F02722 [Eucalyptus grandis]
Length=418

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IWRG  K   +  +    + AH+   A  KV KEAK FP +L  E+ P   VWP+
Sbjct  237  PIIDPIWRGSLKFNKQGINYFGKVVAHVSDLACSKVNKEAKLFPSILCTELHPTPKVWPK  296

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F    P+D +I +Y F   K  +  F SLV  M++  LAM+ V+ N+E L+FTS +LPL
Sbjct  297  GFKDRGPSDDSIAIYIFPDNKSEQEFFDSLVIEMIRNDLAMRVVVTNAEFLVFTSTKLPL  356

Query  362  IYWRFQGEFYLWGLFRD  312
              WRFQ +FYLWG+FR+
Sbjct  357  HLWRFQSKFYLWGVFRE  373



>ref|XP_010245255.1| PREDICTED: uncharacterized protein LOC104588837 isoform X4 [Nelumbo 
nucifera]
Length=362

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  168  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  227

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  228  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  287

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  288  LPQTCRRFLGKYFLWGVF  305



>ref|XP_010245257.1| PREDICTED: uncharacterized protein LOC104588837 isoform X6 [Nelumbo 
nucifera]
Length=347

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  153  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  212

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  213  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  272

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  273  LPQTCRRFLGKYFLWGVF  290



>ref|XP_010245253.1| PREDICTED: uncharacterized protein LOC104588837 isoform X2 [Nelumbo 
nucifera]
Length=384

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  190  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  249

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  250  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  309

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  310  LPQTCRRFLGKYFLWGVF  327



>ref|XP_010245252.1| PREDICTED: uncharacterized protein LOC104588837 isoform X1 [Nelumbo 
nucifera]
Length=384

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+I+ +WRG F I  K YD +  L  H+  +A  KV  +  +  P+L LEMLP   V
Sbjct  190  PAQPIISPVWRGSFHISNKKYDGIPCLVGHVSSKACSKVSDKVNALQPLLGLEMLPKLDV  249

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S PTD NI LYFF  K++ + +F  L+  +++   A+KA+L   ELLIF S+E
Sbjct  250  WPPRFCKSPPTDDNIALYFFPEKERDKPQFEDLLFHLIEHDFALKAMLGAVELLIFPSLE  309

Query  371  LPLIYWRFQGEFYLWGLF  318
            LP    RF G+++LWG+F
Sbjct  310  LPQTCRRFLGKYFLWGVF  327



>gb|KGN44494.1| hypothetical protein Csa_7G318450 [Cucumis sativus]
Length=175

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -1

Query  701  RGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVP  522
            RG  K   +    +  L AH+   A  KVY+EAK  P +L  E+     VWP  F    P
Sbjct  11   RGTLKFWNRSSGKVCVLVAHMSSLACSKVYEEAKMLPVLLSAELFRRCDVWPRGFQKLGP  70

Query  521  TDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQG  342
            TDQNI LYFF   +  ++ F  LV  MM + LAMKAVL+N+ELL+FTS  LP+ YWRFQ 
Sbjct  71   TDQNIALYFFPDGESQKA-FDLLVNAMMSQDLAMKAVLKNAELLVFTSSMLPMRYWRFQT  129

Query  341  EFYLWGLFR  315
            ++YLWG+FR
Sbjct  130  KYYLWGVFR  138



>ref|XP_009338913.1| PREDICTED: uncharacterized protein LOC103931215, partial [Pyrus 
x bretschneideri]
Length=343

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 92/139 (66%), Gaps = 0/139 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+    P+I+ IWRG   I  +D++I+ GL AHL   A  KV +EA+  P +L  E++  
Sbjct  203  CYVAAQPIIDPIWRGSLSIFNEDFNIVSGLVAHLSSLACPKVREEAELLPLLLFPELVNK  262

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
            + VWP++F+   P DQ+I LYFF   ++    F +LV  M+Q+ LAM+AVLE++ELL+FT
Sbjct  263  TDVWPKAFEKCGPNDQSIALYFFPDNERNEKDFDTLVVSMIQDDLAMRAVLEDAELLVFT  322

Query  380  SVELPLIYWRFQGEFYLWG  324
            SV LP  Y RFQ +FYLWG
Sbjct  323  SVILPEQYRRFQTKFYLWG  341



>ref|XP_004295161.1| PREDICTED: uncharacterized protein LOC101308361 [Fragaria vesca 
subsp. vesca]
Length=333

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+    P+I++ WRG   I  KD+ I+ GL AHL   A  KV++EAK  P ML  +++  
Sbjct  144  CYIAAQPIIDLTWRGSLSIMNKDFSIISGLVAHLSSLACAKVFEEAKLLPMMLFPDLVCR  203

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
              VWP++F +S P+D +I LYFF A +     F +LV  M+QE LAM+AVL+N+ELL+FT
Sbjct  204  VDVWPKAFQSSGPSDHSIALYFFPASESNEMDFDNLVVSMIQEDLAMRAVLDNTELLVFT  263

Query  380  SVELPLIYWRFQ  345
            S+ LP    + Q
Sbjct  264  SIVLPEHIQKLQ  275



>ref|XP_003536437.1| PREDICTED: uncharacterized protein LOC100817132 isoform X1 [Glycine 
max]
Length=338

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P I+ IWRG    C      + GL AH+   A  +V +E   FP +L  E LP   VW E
Sbjct  194  PTIDPIWRGSMYFCNGTIRTVSGLLAHISNLACSQVAEETGHFPEVLHAEFLPRDKVWAE  253

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTDQ+I L+FF   +     F  LVE +M  +  ++ V +N+ELLIF S ELP+
Sbjct  254  SFKRGDPTDQDIALFFFPDSEGSEKDFDVLVEDIMICKHVIRFVGKNAELLIFPSTELPV  313

Query  362  IYWRFQGEFYLWGLFR  315
              WR++ ++YLWG+FR
Sbjct  314  QNWRYEAKYYLWGVFR  329



>gb|KHN16994.1| hypothetical protein glysoja_011468 [Glycine soja]
Length=343

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P I+ IWRG    C      + GL AH+   A  +V +E   FP +L  E LP   VW E
Sbjct  199  PTIDPIWRGSMYFCNGTIRTVSGLLAHISNLACSQVAEETGHFPEVLHAEFLPRDKVWAE  258

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTDQ+I L+FF   +     F  LVE +M  +  ++ V +N+ELLIF S ELP+
Sbjct  259  SFKRGDPTDQDIALFFFPDSEGSEKDFDVLVEDIMICKHVIRFVGKNAELLIFPSTELPV  318

Query  362  IYWRFQGEFYLWGLFR  315
              WR++ ++YLWG+FR
Sbjct  319  QNWRYEAKYYLWGVFR  334



>ref|XP_004496495.1| PREDICTED: uncharacterized protein LOC101501681 isoform X2 [Cicer 
arietinum]
Length=307

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG    C +    ++GL AHL   AS KV  EA+ FP +L  ++LP SVVWP 
Sbjct  170  PIAEPIWRGNLFFCNEAIVTVNGLQAHLSSLASLKVLTEARLFPEVLCADLLPRSVVWPN  229

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PT+QNI LYFF ++K     F  LV+ ++++ +A++   +N+ LLIF S  LP+
Sbjct  230  SFKNEGPTNQNIALYFFGSEK----IFDKLVDDIIRKEVAIRVGTKNAVLLIFPSTLLPI  285

Query  362  IYWRFQGEFYLWGLFR  315
             + +FQ ++YLWG+FR
Sbjct  286  QHQKFQTKYYLWGVFR  301



>ref|XP_010247257.1| PREDICTED: uncharacterized protein LOC104590334 isoform X2 [Nelumbo 
nucifera]
Length=539

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 93/161 (58%), Gaps = 10/161 (6%)
 Frame = -1

Query  770  GCNTQAQLAACHE---------PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEK  618
            G  + A L ACH+            P+I+ IW G F IC +++  +    AH+   A  K
Sbjct  197  GRTSPASLDACHQSFRECPSSGAAQPIIDPIWTGSFNICNENHGAVP-CVAHVSSLACSK  255

Query  617  VYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMM  438
            V  EAK+ PP+L +++LP   VWP +F  S PTD  I LYFF   ++ ++KF  L+  ++
Sbjct  256  VTSEAKALPPLLDVKILPKLDVWPPTFCRSPPTDNKIGLYFFPITERDKTKFDRLLYDLI  315

Query  437  QERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
               LA++AV+   ELLIF S+ELP    +F G ++LWG+FR
Sbjct  316  DRELALRAVIGVVELLIFPSLELPPSCRKFLGNYFLWGVFR  356



>ref|XP_010247256.1| PREDICTED: uncharacterized protein LOC104590334 isoform X1 [Nelumbo 
nucifera]
Length=573

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 93/161 (58%), Gaps = 10/161 (6%)
 Frame = -1

Query  770  GCNTQAQLAACHE---------PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEK  618
            G  + A L ACH+            P+I+ IW G F IC +++  +    AH+   A  K
Sbjct  231  GRTSPASLDACHQSFRECPSSGAAQPIIDPIWTGSFNICNENHGAVP-CVAHVSSLACSK  289

Query  617  VYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMM  438
            V  EAK+ PP+L +++LP   VWP +F  S PTD  I LYFF   ++ ++KF  L+  ++
Sbjct  290  VTSEAKALPPLLDVKILPKLDVWPPTFCRSPPTDNKIGLYFFPITERDKTKFDRLLYDLI  349

Query  437  QERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
               LA++AV+   ELLIF S+ELP    +F G ++LWG+FR
Sbjct  350  DRELALRAVIGVVELLIFPSLELPPSCRKFLGNYFLWGVFR  390



>ref|XP_004496494.1| PREDICTED: uncharacterized protein LOC101501681 isoform X1 [Cicer 
arietinum]
Length=310

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG    C +    ++GL AHL   AS KV  EA+ FP +L  ++LP SVVWP 
Sbjct  170  PIAEPIWRGNLFFCNEAIVTVNGLQAHLSSLASLKVLTEARLFPEVLCADLLPRSVVWPN  229

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PT+QNI LYFF  ++     F  LV+ ++++ +A++   +N+ LLIF S  LP+
Sbjct  230  SFKNEGPTNQNIALYFFGYERS-EKIFDKLVDDIIRKEVAIRVGTKNAVLLIFPSTLLPI  288

Query  362  IYWRFQGEFYLWGLFR  315
             + +FQ ++YLWG+FR
Sbjct  289  QHQKFQTKYYLWGVFR  304



>ref|XP_010931048.1| PREDICTED: uncharacterized protein LOC105052052 [Elaeis guineensis]
Length=463

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 77/136 (57%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I  +W G F IC   Y  +    AHL  +A EKV   A+  PP+LQ+  L     WP 
Sbjct  29   PIIFCVWSGSFGICDDTYGPI---KAHLSNKACEKVCVAAEKLPPVLQMAKLAKLEAWPR  85

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF+ S PT  NI LYFF    + +S    L+  ++ + L +K V   +ELLIF S+ LP 
Sbjct  86   SFENSPPTGDNIALYFFPDSTRAKSMLGDLLRDVISKHLVLKVVFNEAELLIFPSIILPK  145

Query  362  IYWRFQGEFYLWGLFR  315
            +Y RFQG +YLWG F+
Sbjct  146  VYHRFQGNYYLWGAFK  161



>ref|XP_007019436.1| Uncharacterized protein TCM_035488 [Theobroma cacao]
 gb|EOY16661.1| Uncharacterized protein TCM_035488 [Theobroma cacao]
Length=417

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 86/139 (62%), Gaps = 2/139 (1%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+   IWRG F++   D ++  G+ AHL   A  KV + AK  P  L LE+LP   V
Sbjct  239  PARPIFEPIWRGSFRL--YDENLAVGIVAHLSSLACLKVCEMAKCLPESLFLELLPRCDV  296

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP+ F    P++++I LYFF   ++    F +LV+ ++   L M+AV+++ ELL+FTS  
Sbjct  297  WPKGFKKWGPSEESIALYFFPNDERDVKIFYNLVDKVIVRDLGMRAVVQDVELLVFTSNI  356

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LPL  WRFQ +FYLWG+FR
Sbjct  357  LPLHLWRFQEKFYLWGVFR  375



>ref|XP_004139676.1| PREDICTED: uncharacterized protein LOC101213907 [Cucumis sativus]
 ref|XP_004173810.1| PREDICTED: uncharacterized LOC101213907 [Cucumis sativus]
Length=145

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = -1

Query  629  ASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLV  450
            A  KVY+EAK  P +L  E+     VWP  F    PTDQNI LYFF    + +  F  LV
Sbjct  5    ACSKVYEEAKMLPVLLSAELFRRCDVWPRGFQKLGPTDQNIALYFFP-DGESQKAFDLLV  63

Query  449  EMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              MM + LAMKAVL+N+ELL+FTS  LP+ YWRFQ ++YLWG+FR
Sbjct  64   NAMMSQDLAMKAVLKNAELLVFTSSMLPMRYWRFQTKYYLWGVFR  108



>ref|XP_011023004.1| PREDICTED: uncharacterized protein LOC105124611 [Populus euphratica]
Length=337

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IW+G F I   +      L AHL   A  KV+  A + P  L +E+L  S  WP 
Sbjct  160  PIIDPIWKGSFNIQNLENHTSVLLLAHLSTNACSKVWDAASTLPAQLNIEILSRSDAWPH  219

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F T+ PT ++I LYFF  +++    F SL++ M+ +  A+KAV+ + ELL+F+S ELP 
Sbjct  220  KFQTTPPTVESIGLYFFPQRERDEKVFESLLDGMIIQDRALKAVINDLELLVFSSCELPQ  279

Query  362  IYWRFQGEFYLWGLFR  315
             +WRF   +YLWG+F+
Sbjct  280  EHWRFCQNYYLWGVFK  295



>ref|XP_008373583.1| PREDICTED: uncharacterized protein LOC103436904 [Malus domestica]
Length=185

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = -1

Query  698  GCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPT  519
            G   I  KD++I+ GL AHL   A  KV +EA+  P +L  E++  + VWP++F+   P 
Sbjct  3    GSLSIFNKDFNIVSGLVAHLSSXACPKVREEAELLPLLLFPELVNRTDVWPKAFEKCGPN  62

Query  518  DQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGE  339
            DQ+I LYFF   ++    F +LV  M+Q+ L M+AVLE++ELL+FTSV LP  Y RFQ +
Sbjct  63   DQSIALYFFPDNERDEKDFDTLVVSMIQDDLTMRAVLEDAELLVFTSVILPEQYRRFQTK  122

Query  338  FYLWGLFR  315
            FYLWG+FR
Sbjct  123  FYLWGVFR  130



>emb|CDP04750.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -1

Query  719  VINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
            ++N IWRG F I  +      G+ AHL  +A  KV   A   PP L  E+L    VWP+S
Sbjct  274  LMNPIWRGSFSITREKNQTNLGILAHLSRKACSKVSDIAIMLPPELVAEVLAKRRVWPKS  333

Query  539  FDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLI  360
            F    PTD +IDL+FF   ++    +  L++ M++   A+K ++++ ELLIF+S ELPL 
Sbjct  334  FQNVPPTDGSIDLFFFPEYERDEKVYDGLLDDMIEGDNALKVMMKDLELLIFSSRELPLE  393

Query  359  YWRFQGEFYLWGLFR  315
            +WRFQ ++YLWG+F+
Sbjct  394  HWRFQQKYYLWGVFQ  408



>ref|XP_003592150.1| hypothetical protein MTR_1g099270 [Medicago truncatula]
 gb|AES62401.1| hypothetical protein MTR_1g099270 [Medicago truncatula]
Length=369

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = -1

Query  737  HEPGLPVINIIWRGCFKICYKDYDI--LDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLP  564
            H    P+ + IWRG    C K   I  ++GL AHL   AS KV  E K FP +L  ++LP
Sbjct  213  HVDAKPIADPIWRGNLIFCDKSKTIGRVNGLLAHLSNIASPKVLDEMKFFPHVLSADLLP  272

Query  563  VSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLI  387
             S VWP SF    PTD++I LYFF   ++   K F  LV+ ++    A++ V EN+ LLI
Sbjct  273  RSEVWPNSFKEEGPTDESIALYFFPGNRRLSIKAFDKLVDDIICTEAAVRVVTENAVLLI  332

Query  386  FTSVELPLIYWRFQGEFYLWGLFR  315
            F S  LP+ + +FQ ++YLWG+F+
Sbjct  333  FPSDLLPIRHQKFQTKYYLWGVFK  356



>ref|XP_006854608.1| hypothetical protein AMTR_s00030p00140460 [Amborella trichopoda]
 gb|ERN16075.1| hypothetical protein AMTR_s00030p00140460 [Amborella trichopoda]
Length=341

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 93/164 (57%), Gaps = 16/164 (10%)
 Frame = -1

Query  803  NTIGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRAS  624
            ++ GSF+Q            A + P  P+I+ IWRG F+   K Y +     AH   +A 
Sbjct  97   HSHGSFHQ------------ATYVPAQPIIDSIWRGEFETGNKIYGMF---VAHPSNKAI  141

Query  623  EKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAA-KKKCRSKFVSLVE  447
             +V++ A+  P  L ++ LP   VWP+ F T  P D++I LYFF    ++    F  L+E
Sbjct  142  SRVHEGARKLPATLHMQKLPRCEVWPQRFQTLPPNDEDIGLYFFPEMDERSLVLFHELLE  201

Query  446  MMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
             +MQ  +A+K V+++ ELLIF+S++LP    RF G +Y+WG+FR
Sbjct  202  DLMQHDIALKFVVDSIELLIFSSIQLPKETQRFSGRYYIWGIFR  245



>ref|XP_008799746.1| PREDICTED: uncharacterized protein LOC103714318 [Phoenix dactylifera]
Length=582

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I  +W GCF+IC + Y     + AHL  +A EKV   A   PP+LQ+  L     WP 
Sbjct  438  PMIVCVWSGCFEICNEAYG---PIKAHLSNKACEKVCITAAKLPPVLQMAKLSKLEAWPR  494

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF  S P   NI LYFF    + +     L+  ++ + L +K VL  +ELLIF S+ LP 
Sbjct  495  SFKNSPPMGGNIALYFFPHNTRAKLMLDRLLCDVISKDLVLKVVLNEAELLIFPSIILPE  554

Query  362  IYWRFQGEFYLWGLFR  315
            +Y RFQG FYLWG+F+
Sbjct  555  VYHRFQGSFYLWGVFK  570



>ref|XP_007152080.1| hypothetical protein PHAVU_004G100400g, partial [Phaseolus vulgaris]
 gb|ESW24074.1| hypothetical protein PHAVU_004G100400g, partial [Phaseolus vulgaris]
Length=865

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 0/137 (0%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            LP+ + +WRG   +       + GL AH+   A  KV +E K FP +L  ++L  + VWP
Sbjct  720  LPIADPVWRGSMCLFNPSIRTVVGLMAHMSTLACSKVLEETKFFPDVLCPDLLSRTAVWP  779

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
             SF    P + +I LYFF   +   S F  LV+ MM   LA++AV+EN++LLIF S+ LP
Sbjct  780  MSFMNCGPNEDSIALYFFPDSESVESSFDKLVDHMMSRDLAIRAVVENADLLIFPSLLLP  839

Query  365  LIYWRFQGEFYLWGLFR  315
            +   RFQ ++YLWG+FR
Sbjct  840  IQSRRFQEKYYLWGVFR  856



>ref|XP_009769945.1| PREDICTED: uncharacterized protein LOC104220727 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769946.1| PREDICTED: uncharacterized protein LOC104220727 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769948.1| PREDICTED: uncharacterized protein LOC104220727 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769949.1| PREDICTED: uncharacterized protein LOC104220727 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769950.1| PREDICTED: uncharacterized protein LOC104220727 isoform X1 [Nicotiana 
sylvestris]
Length=464

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIVDTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_009597717.1| PREDICTED: uncharacterized protein LOC104093645 isoform X2 [Nicotiana 
tomentosiformis]
Length=515

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 94/160 (59%), Gaps = 8/160 (5%)
 Frame = -1

Query  794  GSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKV  615
             S+N P++        +A + P  PVI  +WRGCF +  ++ +    + AH+  +A E  
Sbjct  249  NSYNGPQLE-------SANYLPAQPVIEPLWRGCF-LFNRERETSINILAHISDKACENA  300

Query  614  YKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQ  435
             K AK  P  L +++L  S VWP+SF  S PTD +I LY F   ++  + + +L+E  ++
Sbjct  301  AKAAKGLPMNLDVKILAKSDVWPKSFLRSPPTDNSIALYLFPELERDENCYDALLEEAIE  360

Query  434  ERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              LAM A +++ E+LIF+S ELP   WR + ++YLWG+FR
Sbjct  361  NDLAMSATIDDLEMLIFSSRELPQKDWRIRRKYYLWGVFR  400



>ref|XP_009597716.1| PREDICTED: uncharacterized protein LOC104093645 isoform X1 [Nicotiana 
tomentosiformis]
Length=528

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 94/160 (59%), Gaps = 8/160 (5%)
 Frame = -1

Query  794  GSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKV  615
             S+N P++        +A + P  PVI  +WRGCF +  ++ +    + AH+  +A E  
Sbjct  262  NSYNGPQLE-------SANYLPAQPVIEPLWRGCF-LFNRERETSINILAHISDKACENA  313

Query  614  YKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQ  435
             K AK  P  L +++L  S VWP+SF  S PTD +I LY F   ++  + + +L+E  ++
Sbjct  314  AKAAKGLPMNLDVKILAKSDVWPKSFLRSPPTDNSIALYLFPELERDENCYDALLEEAIE  373

Query  434  ERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              LAM A +++ E+LIF+S ELP   WR + ++YLWG+FR
Sbjct  374  NDLAMSATIDDLEMLIFSSRELPQKDWRIRRKYYLWGVFR  413



>gb|KHN47277.1| hypothetical protein glysoja_043087 [Glycine soja]
Length=568

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + +WRG  +I    +  + GL AH+   AS KV +E + FP +L  ++ P + VWP+
Sbjct  427  PIADPVWRGSLRISDPSFGTVIGLLAHVSTLASPKVLEETRFFPDVLCPDLRPRTAVWPK  486

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    P   +I LYFF   ++    F  LVE MM   L+++  +EN+ELLIF S+ LP+
Sbjct  487  SFMKCGPNMDSIALYFFPDSERVERAFHKLVEDMMYFDLSLRTEVENAELLIFPSILLPI  546

Query  362  IYWRFQGEFYLWGLFR  315
               RFQ ++YLWG+FR
Sbjct  547  QCRRFQEKYYLWGVFR  562



>ref|XP_009769953.1| PREDICTED: uncharacterized protein LOC104220727 isoform X4 [Nicotiana 
sylvestris]
Length=462

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIVDTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_009769952.1| PREDICTED: uncharacterized protein LOC104220727 isoform X3 [Nicotiana 
sylvestris]
Length=463

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIVDTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_009769951.1| PREDICTED: uncharacterized protein LOC104220727 isoform X2 [Nicotiana 
sylvestris]
Length=463

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++ IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIVDTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_006393770.1| hypothetical protein EUTSA_v10011612mg [Eutrema salsugineum]
 gb|ESQ31056.1| hypothetical protein EUTSA_v10011612mg [Eutrema salsugineum]
Length=354

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG   +   +   +DGL AHL   A  KV+++A S   +L  EM P   +WP+
Sbjct  210  PICKPIWRGSMFLKNGNSCSIDGLVAHLSTLACGKVHEKASSLHALLSAEMFPRLEIWPD  269

Query  542  SF-DTSVPTDQNIDLYFF-AAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            SF     PTD++I LYFF +++ K    + SLV  M +  LAM+ VL+N +LL+FTS +L
Sbjct  270  SFLKDGPPTDESIALYFFPSSESKDEKVYYSLVGEMKKNDLAMRCVLDNVDLLLFTSYQL  329

Query  368  PLIYWRFQGEFYLWGLFR  315
            P+  W F  + YLWG+FR
Sbjct  330  PMHCWTFYSKEYLWGIFR  347



>gb|KHN19657.1| hypothetical protein glysoja_047067 [Glycine soja]
Length=623

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 2/155 (1%)
 Frame = -1

Query  779  PRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAK  600
            P+   NT   L A      P+ + +WRG  +I    +  + GL AH+   AS KV +E +
Sbjct  465  PKDEANTSESLNAT--VPYPIADPVWRGSLRISDPSFGTVIGLLAHVSTLASPKVLEETR  522

Query  599  SFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAM  420
             FP +L  ++ P + VWP+SF    P   +I LYFF   ++    F  LVE MM   L++
Sbjct  523  FFPDVLCPDLRPRTAVWPKSFMKCGPNMDSIALYFFPDSERVERAFHKLVEDMMYFDLSL  582

Query  419  KAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +  +EN+ELLIF S+ LP+   RFQ ++YLWG+FR
Sbjct  583  RTEVENAELLIFPSILLPIQCRRFQEKYYLWGVFR  617



>ref|XP_006587258.1| PREDICTED: uncharacterized protein LOC102669160 [Glycine max]
Length=668

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 2/155 (1%)
 Frame = -1

Query  779  PRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAK  600
            P+   NT   L A      P+ + +WRG  +I    +  + GL AH+   AS KV +E +
Sbjct  510  PKDEANTSESLNAT--VPYPIADPVWRGSLRISDPSFGTVIGLLAHVSTLASPKVLEETR  567

Query  599  SFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAM  420
             FP +L  ++ P + VWP+SF    P   +I LYFF   ++    F  LVE MM   L++
Sbjct  568  FFPDVLCPDLRPRTAVWPKSFMKCGPNMDSIALYFFPDSERVERAFHKLVEDMMYFDLSL  627

Query  419  KAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +  +EN+ELLIF S+ LP+   RFQ ++YLWG+FR
Sbjct  628  RTEVENAELLIFPSILLPIQCRRFQEKYYLWGVFR  662



>emb|CDY59127.1| BnaCnng34380D, partial [Brassica napus]
Length=600

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   +WRG   +   +   + GL AHL   A  +VY++A S    L  EMLP   +WP 
Sbjct  456  PICAPVWRGSVTVKQGNNCSIHGLVAHLSTLACPRVYEKASSLHTRLSAEMLPRLEIWPP  515

Query  542  SF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            SF     PTD +I LYFF +      S + SLV+ M ++ L M+ +L+++ELL+FTS +L
Sbjct  516  SFLKNGPPTDDSIALYFFPSHDSNGESVYYSLVDEMKKKDLGMRCLLDDAELLLFTSYQL  575

Query  368  PLIYWRFQGEFYLWGLFR  315
            PL  W+F  + YLWG+FR
Sbjct  576  PLPCWKFHSKEYLWGVFR  593



>ref|XP_010680252.1| PREDICTED: uncharacterized protein LOC104895438 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYD-ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            P+ N IW G F++ Y +Y+  + G+ AH+   AS++  + A S P  L +EM+P   +WP
Sbjct  155  PLPNPIWMGNFQL-YGEYNYTVHGMVAHIANVASKEASEVASSLPMPLCVEMIPKISIWP  213

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
              F    PT  NI +YFF    +    +  LVE +++ + AM +   N ELLIF+S ELP
Sbjct  214  IKFKEMEPTADNIAVYFFPEDYRAERVYDCLVEDIIEHKFAMISKFNNVELLIFSSCELP  273

Query  365  LIYWRFQGEFYLWGLFR  315
            L  WR Q ++YLWGLFR
Sbjct  274  LDNWRLQRKYYLWGLFR  290



>ref|XP_010530238.1| PREDICTED: uncharacterized protein LOC104806851 [Tarenaya hassleriana]
Length=397

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I  +WRG        +  +  L AHL   A  KV+  AKS P  L  E+ P   +WP+
Sbjct  247  PIIEPVWRGSLSANLGTFGSVI-LVAHLSSIACLKVHDAAKSLPRCLCAEIFPRLDIWPQ  305

Query  542  SF-DTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            SF  +  PTD++I L+FF +       F +LV+ ++++ LAM+ VL+N+EL++F+S  LP
Sbjct  306  SFLRSGGPTDESIGLFFFPSGPSDEKVFYALVDEIIEKDLAMRIVLDNAELILFSSYMLP  365

Query  365  LIYWRFQGEFYLWGLFR  315
            +  WRFQ +F+LWG FR
Sbjct  366  MQSWRFQSKFFLWGAFR  382



>ref|XP_011100150.1| PREDICTED: uncharacterized protein LOC105178383 [Sesamum indicum]
Length=506

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV++ IWRG F I  +    ++ LA HL  +A  K  + A + PPML++ +L   V WP+
Sbjct  265  PVMDPIWRGWFNIKEESETCVEILA-HLSNKACFKASEAASALPPMLEIHLLDKCVAWPK  323

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F  S PT  +I LYFF A ++    F  L++ +++  LA+K +++N ELLIF S+ELPL
Sbjct  324  CFRVSPPTAASIALYFFPACERDERLFDILLDEVIERDLALKTLIDNLELLIFPSLELPL  383

Query  362  IYWRFQGEFYLWGLF  318
              WR++ +++LWG+F
Sbjct  384  QNWRYKSKYFLWGVF  398



>ref|XP_009620783.1| PREDICTED: uncharacterized protein LOC104112537 isoform X4 [Nicotiana 
tomentosiformis]
Length=462

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIADTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   IFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_006582126.1| PREDICTED: uncharacterized protein LOC102667689 [Glycine max]
Length=686

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 87/155 (56%), Gaps = 2/155 (1%)
 Frame = -1

Query  779  PRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAK  600
            P+   NT   L A      P+ + +WRG  +I    +  + GL AH+   AS KV +E +
Sbjct  528  PKDEANTSESLNAT--VPYPIADPVWRGSLRISDPSFGTVIGLLAHVSTLASPKVLEETR  585

Query  599  SFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAM  420
             FP +L  ++ P + VWP+SF    P   +I LYFF   ++    F  LVE MM   L++
Sbjct  586  FFPDVLCPDLRPRTAVWPKSFMKCGPNMDSIALYFFPDSERVERAFHKLVEDMMYFDLSL  645

Query  419  KAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +  +EN+ELLIF S+ LP+   RF  ++YLWG+FR
Sbjct  646  RTEVENAELLIFPSILLPIQCRRFLEKYYLWGVFR  680



>ref|XP_009620782.1| PREDICTED: uncharacterized protein LOC104112537 isoform X3 [Nicotiana 
tomentosiformis]
Length=463

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIADTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   IFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_009620781.1| PREDICTED: uncharacterized protein LOC104112537 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIADTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   IFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>ref|XP_003619204.1| PHD-finger family protein expressed [Medicago truncatula]
Length=984

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 92/166 (55%), Gaps = 6/166 (4%)
 Frame = -1

Query  809  VDNTIGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYD-ILDGLAAHLPV  633
            +D+  G  +  + GC T   +A   +P  P+ + IWRG   +  K +D I+ GL  HL  
Sbjct  807  IDSEKGEVDSSK-GCATAVTIA---DP-QPISDPIWRGSLLVLNKSFDKIITGLLCHLST  861

Query  632  RASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSL  453
             A  KV +E K  P +L  +M+    VWP+SF      + +I LYFF   ++    F  L
Sbjct  862  LACPKVLEETKHLPNVLDADMIQREAVWPKSFWKFGTNNLSIGLYFFPQNERDERYFDQL  921

Query  452  VEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            V+ M+   LAM+A +E +ELLIF S  LP  Y RFQ ++YLWG++R
Sbjct  922  VDEMISNDLAMRARVEKAELLIFPSTMLPSKYKRFQSKYYLWGVYR  967



>ref|XP_009620780.1| PREDICTED: uncharacterized protein LOC104112537 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I +    +   L AHL  +A  KV+  AK    +L  E+LP   VWP+
Sbjct  5    PIADTIWRGSFMISHPKVSL--NLTAHLSSKACAKVWLAAKEMAEVLCFELLPRLDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F +S   D NI +YFF+ K +    F +L+  +     A+KA++ +SELLIFTS +LP 
Sbjct  63   IFKSSKLIDDNIAIYFFSVKGRDDQVFDNLLYNLRHYDFALKALVGDSELLIFTSAQLPE  122

Query  362  IYWRFQGEFYLWGLF  318
             + RF+G+ YLWG+F
Sbjct  123  KHQRFEGQLYLWGVF  137



>gb|AES75422.2| hypothetical protein MTR_6g044600 [Medicago truncatula]
Length=927

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 92/166 (55%), Gaps = 6/166 (4%)
 Frame = -1

Query  809  VDNTIGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYD-ILDGLAAHLPV  633
            +D+  G  +  + GC T   +A   +P  P+ + IWRG   +  K +D I+ GL  HL  
Sbjct  750  IDSEKGEVDSSK-GCATAVTIA---DP-QPISDPIWRGSLLVLNKSFDKIITGLLCHLST  804

Query  632  RASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSL  453
             A  KV +E K  P +L  +M+    VWP+SF      + +I LYFF   ++    F  L
Sbjct  805  LACPKVLEETKHLPNVLDADMIQREAVWPKSFWKFGTNNLSIGLYFFPQNERDERYFDQL  864

Query  452  VEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            V+ M+   LAM+A +E +ELLIF S  LP  Y RFQ ++YLWG++R
Sbjct  865  VDEMISNDLAMRARVEKAELLIFPSTMLPSKYKRFQSKYYLWGVYR  910



>ref|XP_009406063.1| PREDICTED: uncharacterized protein LOC103989049 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+ N IWRG F +C K+   L    AH+  +A EKV+  AK  P +LQ+  L     
Sbjct  60   PAQPIRNHIWRGHFHVCNKE---LGPFTAHISSKACEKVWNIAKKLPAVLQMTKLSRLDS  116

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP+SF TS P D++I LYFFA   +  +    L+  + ++   +K   + +ELL F+S+ 
Sbjct  117  WPKSFKTSPPNDESIALYFFAQDARVGAMLDELLCEITKKDFVLKVKHDEAELLAFSSIV  176

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LP  Y +FQ +++LW +FR
Sbjct  177  LPESYCKFQEKYFLWAVFR  195



>ref|XP_009147898.1| PREDICTED: uncharacterized protein LOC103871409 isoform X2 [Brassica 
rapa]
Length=611

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   +WRG   +   +   + GL AH+   A  KVY++A S    L  EMLP   +WP 
Sbjct  469  PICTPVWRGSVTVKQGNNCSIHGLVAHVSNLACPKVYEKASSLRTRLSAEMLPRLEIWPP  528

Query  542  SF-DTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            SF     PTD +I LYFF +     + + SLV+ M ++ L M+ +L+++ELL+FTS +LP
Sbjct  529  SFLKNGPPTDDSIALYFFPSHDS-ENLYYSLVDEMKKKDLGMRCLLDDAELLLFTSYQLP  587

Query  365  LIYWRFQGEFYLWGLFR  315
            L  W+F  + YLWG+FR
Sbjct  588  LPCWKFHSKEYLWGVFR  604



>gb|EMT00025.1| hypothetical protein F775_04899 [Aegilops tauschii]
Length=965

 Score =   107 bits (267),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = -1

Query  737  HEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
            H   LP+   IW G  K C KDY  LD   AHL  +  E V K ++S  P++++  L   
Sbjct  664  HYSSLPIDEPIWSGLIKTCSKDYVSLD---AHLSTKYCEIVCKLSRSLQPVVEVTKLSRM  720

Query  557  VVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
              WP SF+ S PTD +I LYFF  K + R+    LV+ +++  + + AV+  +E+LIF S
Sbjct  721  EAWPRSFEVSRPTDSDIALYFFPHKMRQRTDLDQLVKEVVENDMVLLAVVGEAEMLIFPS  780

Query  377  VELPLIYWRFQGEFYLWGLFR  315
            + LP  +  FQG  YLW  FR
Sbjct  781  ILLPEQHQTFQGRPYLWAAFR  801



>emb|CDY48869.1| BnaA06g03130D [Brassica napus]
Length=487

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 81/138 (59%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   +WRG   +   +   + GL AH+   A  KVY++A S    L  EMLP   +WP 
Sbjct  343  PICTPVWRGSVTVKQGNNCSIHGLVAHVSNLACPKVYEKASSLRTRLSAEMLPRLEIWPP  402

Query  542  SF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            SF     PTD +I LYFF +      + + SLV+ M ++ L M+ +L+++ELL+FTS +L
Sbjct  403  SFLKNGPPTDDSIALYFFPSHDSNSENLYYSLVDEMKKKDLGMRCLLDDAELLLFTSYQL  462

Query  368  PLIYWRFQGEFYLWGLFR  315
            PL  W+F  + YLWG+FR
Sbjct  463  PLPCWKFHLKEYLWGVFR  480



>ref|XP_006663987.1| PREDICTED: uncharacterized protein LOC102709889 isoform X2 [Oryza 
brachyantha]
Length=978

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYD--ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++  WRG F++        + +GL AHLP  AS KV + AK FP  +QLE LP   V
Sbjct  667  IPELDYSWRGDFELLRTGRSPVLFEGLQAHLPCSASPKVLEVAKKFPSNIQLEELPRQNV  726

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +C    +  LVE ++++ LA++  +E +ELLIF+S 
Sbjct  727  WPPQFHANGPTIDSIGLFFFARDTQCYEIHYSKLVESLLKDDLALRGNIETAELLIFSSN  786

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  787  TLPNNFQRWNMFHFLWGVFR  806



>ref|XP_009147897.1| PREDICTED: uncharacterized protein LOC103871409 isoform X1 [Brassica 
rapa]
Length=613

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 81/138 (59%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   +WRG   +   +   + GL AH+   A  KVY++A S    L  EMLP   +WP 
Sbjct  469  PICTPVWRGSVTVKQGNNCSIHGLVAHVSNLACPKVYEKASSLRTRLSAEMLPRLEIWPP  528

Query  542  SF-DTSVPTDQNIDLYFFAA-KKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            SF     PTD +I LYFF +      + + SLV+ M ++ L M+ +L+++ELL+FTS +L
Sbjct  529  SFLKNGPPTDDSIALYFFPSHDSNSENLYYSLVDEMKKKDLGMRCLLDDAELLLFTSYQL  588

Query  368  PLIYWRFQGEFYLWGLFR  315
            PL  W+F  + YLWG+FR
Sbjct  589  PLPCWKFHSKEYLWGVFR  606



>ref|XP_006663986.1| PREDICTED: uncharacterized protein LOC102709889 isoform X1 [Oryza 
brachyantha]
Length=981

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYD--ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++  WRG F++        + +GL AHLP  AS KV + AK FP  +QLE LP   V
Sbjct  670  IPELDYSWRGDFELLRTGRSPVLFEGLQAHLPCSASPKVLEVAKKFPSNIQLEELPRQNV  729

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +C    +  LVE ++++ LA++  +E +ELLIF+S 
Sbjct  730  WPPQFHANGPTIDSIGLFFFARDTQCYEIHYSKLVESLLKDDLALRGNIETAELLIFSSN  789

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  790  TLPNNFQRWNMFHFLWGVFR  809



>ref|XP_004515116.1| PREDICTED: uncharacterized protein LOC101510687 isoform X1 [Cicer 
arietinum]
Length=1042

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 1/137 (1%)
 Frame = -1

Query  722   PVINIIWRGCFKICYKDYD-ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
             PV + IWRG  K+     D  +  L  HL   A  KV ++A+  P +L  ++L  S VWP
Sbjct  888   PVADPIWRGSLKLYNPRLDDTVTRLMGHLSTLACPKVLEKARHLPNVLYPDLLQRSAVWP  947

Query  545   ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
             ESF    P +Q+I +YFF   ++    F  LV+ M+   LA++  +E +ELLIF S  LP
Sbjct  948   ESFKKYGPNNQSIAIYFFPQNERVERSFDQLVDEMITSDLAIRVGVEKAELLIFPSTVLP  1007

Query  365   LIYWRFQGEFYLWGLFR  315
               Y RFQ ++YLWG+F+
Sbjct  1008  TQYRRFQSKYYLWGIFK  1024



>gb|EEC68900.1| hypothetical protein OsI_37561 [Oryza sativa Indica Group]
Length=530

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IW G FKI   DY      +AHL  ++ +KV+  + S P ++Q+  L  SVVWP+
Sbjct  248  PIDEPIWSGIFKIGGNDYIPF---SAHLSTKSCKKVWDLSVSIPSIVQVTKLSRSVVWPK  304

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S + S PTD +I LYFF  K +       LV+ ++++ +A+ AV+  +++L+F S  LP 
Sbjct  305  SLEASSPTDDSIGLYFFPPKMRLDKGMDQLVKEIVEKDMALSAVIGEAQMLMFPSTLLPE  364

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQG+ YLWG+F+
Sbjct  365  KYQTFQGKHYLWGVFK  380



>ref|NP_001066219.1| Os12g0161500 [Oryza sativa Japonica Group]
 dbj|BAF29238.1| Os12g0161500 [Oryza sativa Japonica Group]
 gb|EEE52810.1| hypothetical protein OsJ_35308 [Oryza sativa Japonica Group]
Length=530

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IW G FKI   DY      +AHL  ++ +KV+  + S P ++Q+  L  SVVWP+
Sbjct  248  PIDEPIWSGIFKIGGNDYIPF---SAHLSTKSCKKVWDLSVSIPSIVQVTKLSRSVVWPK  304

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S + S PTD +I LYFF  K +       LV+ ++++ +A+ AV+  +++L+F S  LP 
Sbjct  305  SLEASSPTDDSIGLYFFPPKMRLDKGMDQLVKEIVEKDMALSAVIGEAQMLMFPSTLLPE  364

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQG+ YLWG+F+
Sbjct  365  KYRTFQGKHYLWGVFK  380



>gb|KEH25789.1| hypothetical protein MTR_6g034375 [Medicago truncatula]
Length=862

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG  K+ +K  D +  L  HL   A  KV +EA+  P +L  E+L  S VWPE
Sbjct  699  PIAAPIWRGSLKVYHKSVDKVTRLMGHLSTLACPKVLEEARHIPDVLYGELLQRSAVWPE  758

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF      + +I LYFF   ++    F  LV  M+   LA++  +  +ELLIF S  LP 
Sbjct  759  SFKKFGTNNMSIGLYFFPQNERVERYFDQLVHEMISNDLAIRTFIVKAELLIFPSTVLPS  818

Query  362  IYWRFQGEFYLWGLFR  315
             + RFQ ++YLWG+FR
Sbjct  819  EFKRFQSKYYLWGVFR  834



>gb|KEH25788.1| hypothetical protein MTR_6g034375 [Medicago truncatula]
Length=917

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 0/136 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG  K+ +K  D +  L  HL   A  KV +EA+  P +L  E+L  S VWPE
Sbjct  754  PIAAPIWRGSLKVYHKSVDKVTRLMGHLSTLACPKVLEEARHIPDVLYGELLQRSAVWPE  813

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF      + +I LYFF   ++    F  LV  M+   LA++  +  +ELLIF S  LP 
Sbjct  814  SFKKFGTNNMSIGLYFFPQNERVERYFDQLVHEMISNDLAIRTFIVKAELLIFPSTVLPS  873

Query  362  IYWRFQGEFYLWGLFR  315
             + RFQ ++YLWG+FR
Sbjct  874  EFKRFQSKYYLWGVFR  889



>gb|ABA96542.2| expressed protein [Oryza sativa Japonica Group]
Length=604

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IW G FKI   DY      +AHL  ++ +KV+  + S P ++Q+  L  SVVWP+
Sbjct  322  PIDEPIWSGIFKIGGNDYIPF---SAHLSTKSCKKVWDLSVSIPSIVQVTKLSRSVVWPK  378

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S + S PTD +I LYFF  K +       LV+ ++++ +A+ AV+  +++L+F S  LP 
Sbjct  379  SLEASSPTDDSIGLYFFPPKMRLDKGMDQLVKEIVEKDMALSAVIGEAQMLMFPSTLLPE  438

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQG+ YLWG+F+
Sbjct  439  KYRTFQGKHYLWGVFK  454



>ref|XP_006362810.1| PREDICTED: uncharacterized protein LOC102603012 isoform X1 [Solanum 
tuberosum]
Length=460

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 79/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I   +  +   L AHL  +A  KV+  AK    ++  E LP   VWP+
Sbjct  5    PIADTIWRGSFMISRPEMRL--NLIAHLSSKACAKVWLAAKEMAEVIYPEFLPKRDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +    +A+KA++ +SELLIFTS  LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFENLLYNLRHYDIALKALVGDSELLIFTSAHLPE  122

Query  362  IYWRFQGEFYLWGLF  318
               RF+G+ YLWG+F
Sbjct  123  KNHRFEGKLYLWGVF  137



>ref|XP_006362811.1| PREDICTED: uncharacterized protein LOC102603012 isoform X2 [Solanum 
tuberosum]
Length=459

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 79/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I   +  +   L AHL  +A  KV+  AK    ++  E LP   VWP+
Sbjct  5    PIADTIWRGSFMISRPEMRL--NLIAHLSSKACAKVWLAAKEMAEVIYPEFLPKRDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S   D NI +YFF+ K +    F +L+  +    +A+KA++ +SELLIFTS  LP 
Sbjct  63   SFKSSKLIDDNIAIYFFSVKGRDDQVFENLLYNLRHYDIALKALVGDSELLIFTSAHLPE  122

Query  362  IYWRFQGEFYLWGLF  318
               RF+G+ YLWG+F
Sbjct  123  KNHRFEGKLYLWGVF  137



>ref|XP_006464615.1| PREDICTED: uncharacterized protein LOC102607669 isoform X5 [Citrus 
sinensis]
Length=365

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -1

Query  719  VINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
             ++ IWRGCFK+         GL A L VRA  K+   A   P  + +E+L  S VWP+ 
Sbjct  155  TVDPIWRGCFKVNGGKVQTSVGLVARLTVRACPKLVYAASVLPLWVPVEILSKSDVWPQR  214

Query  539  FDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLI  360
            F  S PT     LYFF   +     F S+++ M+   LA+KAV+++ +LL+F+S ELP  
Sbjct  215  FQISPPTVDGAALYFFPEYESDERAFDSILDDMIDHNLALKAVIKDQQLLVFSSRELPPD  274

Query  359  YWRFQGEFYLWGLF  318
            +WR   ++Y WG+F
Sbjct  275  HWRICRKYYWWGVF  288



>ref|XP_006427808.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 gb|ESR41048.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
Length=349

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -1

Query  719  VINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
             ++ IWRGCFK+         GL A L VRA  K+   A   P  + +E+L  S VWP+ 
Sbjct  155  TVDPIWRGCFKVNGGKVQTSVGLVARLTVRACPKLVYAASVLPLWVPVEILSKSDVWPQR  214

Query  539  FDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLI  360
            F  S PT     LYFF   +     F S+++ M+   LA+KAV+++ +LL+F+S ELP  
Sbjct  215  FQISPPTVDGAALYFFPEYESDERAFDSILDDMIDHNLALKAVIKDQQLLVFSSRELPPD  274

Query  359  YWRFQGEFYLWGLF  318
            +WR   ++Y WG+F
Sbjct  275  HWRICRKYYWWGVF  288



>gb|KDO58369.1| hypothetical protein CISIN_1g0167792mg [Citrus sinensis]
Length=383

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 76/135 (56%), Gaps = 0/135 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P ++ IWRGCFK+         GL A L  RA  K+   A   P  + +E+L  S VWP+
Sbjct  188  PAVDPIWRGCFKVNGGKVQTSVGLVARLTGRACPKLVYAASVLPLWVPVEILSKSDVWPQ  247

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F  S PT     LYFF   +     F S+++ M+   LA+KAV+++ +LL+F+S ELP 
Sbjct  248  RFQISPPTVDGAALYFFPEYESDERAFDSILDDMIDHNLALKAVIKDQQLLVFSSRELPP  307

Query  362  IYWRFQGEFYLWGLF  318
             +WR   ++Y WG+F
Sbjct  308  DHWRICRKYYWWGVF  322



>ref|XP_006464611.1| PREDICTED: uncharacterized protein LOC102607669 isoform X1 [Citrus 
sinensis]
 ref|XP_006464612.1| PREDICTED: uncharacterized protein LOC102607669 isoform X2 [Citrus 
sinensis]
 ref|XP_006464613.1| PREDICTED: uncharacterized protein LOC102607669 isoform X3 [Citrus 
sinensis]
 ref|XP_006464614.1| PREDICTED: uncharacterized protein LOC102607669 isoform X4 [Citrus 
sinensis]
Length=399

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -1

Query  719  VINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
             ++ IWRGCFK+         GL A L VRA  K+   A   P  + +E+L  S VWP+ 
Sbjct  189  TVDPIWRGCFKVNGGKVQTSVGLVARLTVRACPKLVYAASVLPLWVPVEILSKSDVWPQR  248

Query  539  FDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLI  360
            F  S PT     LYFF   +     F S+++ M+   LA+KAV+++ +LL+F+S ELP  
Sbjct  249  FQISPPTVDGAALYFFPEYESDERAFDSILDDMIDHNLALKAVIKDQQLLVFSSRELPPD  308

Query  359  YWRFQGEFYLWGLF  318
            +WR   ++Y WG+F
Sbjct  309  HWRICRKYYWWGVF  322



>ref|XP_006427809.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 ref|XP_006427810.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 ref|XP_006427811.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 gb|ESR41049.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 gb|ESR41050.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
 gb|ESR41051.1| hypothetical protein CICLE_v10025832mg [Citrus clementina]
Length=383

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -1

Query  719  VINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
             ++ IWRGCFK+         GL A L VRA  K+   A   P  + +E+L  S VWP+ 
Sbjct  189  TVDPIWRGCFKVNGGKVQTSVGLVARLTVRACPKLVYAASVLPLWVPVEILSKSDVWPQR  248

Query  539  FDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLI  360
            F  S PT     LYFF   +     F S+++ M+   LA+KAV+++ +LL+F+S ELP  
Sbjct  249  FQISPPTVDGAALYFFPEYESDERAFDSILDDMIDHNLALKAVIKDQQLLVFSSRELPPD  308

Query  359  YWRFQGEFYLWGLF  318
            +WR   ++Y WG+F
Sbjct  309  HWRICRKYYWWGVF  322



>emb|CBI35492.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSEL  393
            MLP   VWP+SF  S P+D NI LYFF   ++    F  LV  M+   LAM+ V+EN+EL
Sbjct  1    MLPKFDVWPKSFQISQPSDDNIALYFFPENERYEKVFDRLVLDMVSHELAMQTVVENAEL  60

Query  392  LIFTSVELPLIYWRFQGEFYLWGLFR  315
            L+F S ELPL +WRF G+ YLWG+FR
Sbjct  61   LVFASTELPLRHWRFHGKLYLWGVFR  86



>ref|XP_009785077.1| PREDICTED: uncharacterized protein LOC104233387 [Nicotiana sylvestris]
Length=565

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 96/159 (60%), Gaps = 8/159 (5%)
 Frame = -1

Query  791  SFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVY  612
            S+N+P        + +A + P LPVI  IWRGCF I  ++ +    + AH+  +A EK  
Sbjct  263  SYNEPE-------RESANYLPALPVIEPIWRGCF-IFDRESETSINIIAHISDKACEKAA  314

Query  611  KEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQE  432
            K AK  P  L +++L  S VWP+SF  S PTD +I LY F   +   + + +L+E  +++
Sbjct  315  KAAKGLPMNLDVKVLAKSDVWPKSFLRSPPTDNSIALYLFPELESDENAYDALLEEAIED  374

Query  431  RLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
             LAM A +++ E+L+F+S ELP   WR + ++YLWG+FR
Sbjct  375  DLAMNATIDDLEILMFSSRELPQKDWRIRRKYYLWGVFR  413



>ref|XP_003619407.1| hypothetical protein MTR_6g052260 [Medicago truncatula]
 gb|AES75625.1| hypothetical protein MTR_6g052260 [Medicago truncatula]
Length=329

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 81/154 (53%), Gaps = 3/154 (2%)
 Frame = -1

Query  773  VGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSF  594
               +   + AA      P+ + IWRGC K+   +   +  L  HL   A  KV++EA+  
Sbjct  4    TSADENGECAAASVHPQPIADPIWRGCLKVS--NIGKVIELMGHLSTLACPKVHEEARYL  61

Query  593  PPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKK-KCRSKFVSLVEMMMQERLAMK  417
            P M+    L  S VWPESF  S   + +I +YF +         F  LVE M+ ++LA+K
Sbjct  62   PNMISANFLQKSTVWPESFKNSGTNNFSIGIYFLSPHNPSVDGSFDELVEEMISDKLAIK  121

Query  416  AVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              + N++LLIF S +LP  Y  FQ  +YLWG+FR
Sbjct  122  VGVVNADLLIFPSTDLPSEYRTFQSRYYLWGVFR  155



>ref|XP_010237283.1| PREDICTED: uncharacterized protein LOC100845718 isoform X1 [Brachypodium 
distachyon]
Length=977

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
            P  P +  IW+GCF++    K  ++ +GL  HL   AS KV + AK FP  +QLE LP  
Sbjct  671  PTFPELACIWQGCFELWRTGKSPELCEGLQVHLSSSASPKVLEIAKKFPSKIQLEELPRQ  730

Query  557  VVWPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
             +WP  F  +VP   +I L+FFA   +   + +  LVE M+++ LA++  +E +ELLIF 
Sbjct  731  NLWPLQFHENVPIYDSIGLFFFARDIQSYENHYNKLVENMLKDDLALRGNIETAELLIFP  790

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  L   + R+   +YLWG+FR
Sbjct  791  SNILSKNFQRWNMLYYLWGVFR  812



>ref|XP_010237285.1| PREDICTED: uncharacterized protein LOC100845718 isoform X2 [Brachypodium 
distachyon]
Length=975

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
            P  P +  IW+GCF++    K  ++ +GL  HL   AS KV + AK FP  +QLE LP  
Sbjct  671  PTFPELACIWQGCFELWRTGKSPELCEGLQVHLSSSASPKVLEIAKKFPSKIQLEELPRQ  730

Query  557  VVWPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
             +WP  F  +VP   +I L+FFA   +   + +  LVE M+++ LA++  +E +ELLIF 
Sbjct  731  NLWPLQFHENVPIYDSIGLFFFARDIQSYENHYNKLVENMLKDDLALRGNIETAELLIFP  790

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            S  L   + R+   +YLWG+FR
Sbjct  791  SNILSKNFQRWNMLYYLWGVFR  812



>ref|XP_010649403.1| PREDICTED: uncharacterized protein LOC104879183 [Vitis vinifera]
Length=149

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 80/138 (58%), Gaps = 11/138 (8%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            +Q Q++A H          W GCF I  + ++I+  L AHL  +A   V+  A +  P +
Sbjct  20   SQCQVSANH----------W-GCFSIKNEKHEIIIRLVAHLSSKACPNVFYVASTLQPTI  68

Query  581  QLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLEN  402
             +++LP    WP SF  S PTD +I LYFF   ++    F  L++ ++  +LA+KA++ N
Sbjct  69   NVQILPKFDTWPSSFQMSPPTDGDIGLYFFPQHERDEKVFDMLLDEIINLKLALKAMISN  128

Query  401  SELLIFTSVELPLIYWRF  348
            +ELL+F+S ELP  +WRF
Sbjct  129  TELLVFSSQELPQQHWRF  146



>ref|XP_006351039.1| PREDICTED: uncharacterized protein LOC102604199 [Solanum tuberosum]
Length=496

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI+ IWRGCF I   + +    + AHL  +A EK    A   P  L ++++  + VWP 
Sbjct  275  PVIDPIWRGCF-IFNTESESSINILAHLSNKACEKASMAANRLPVKLDVKLVSKNDVWPR  333

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTD +I LY F   ++  + + +L+E ++   LAM A +++ ELLIF+S  LP 
Sbjct  334  SFLRLQPTDCSIALYLFPELEEDENSYDALLEDVIDNDLAMSATIDDLELLIFSSRVLPQ  393

Query  362  IYWRFQGEFYLWGLFR  315
             +WR + ++YLWG+F+
Sbjct  394  KHWRLRRKYYLWGVFK  409



>ref|XP_004978327.1| PREDICTED: uncharacterized protein LOC101754677 [Setaria italica]
Length=552

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+    W+G FKI  K+Y     LA HL  ++ EKV++ +KS PP++++E +   V WP 
Sbjct  391  PICEPSWKGIFKIDGKEYI---SLAGHLSTKSCEKVWELSKSLPPVVEVERVSRLVAWPS  447

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             +  S P+  NI LYF     +   +   LV+ +++  L ++AV+  +E+LIF SV LP 
Sbjct  448  VWKASKPSSDNIGLYFLHENMRNVEELDQLVKEVVENDLLLRAVVNEAEMLIFPSVLLPK  507

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQ ++YLW +F+
Sbjct  508  RYQTFQAKYYLWAVFK  523



>ref|XP_010461428.1| PREDICTED: uncharacterized protein LOC104742151 [Camelina sativa]
Length=566

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 83/151 (55%), Gaps = 2/151 (1%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            T  +L + H    P+   IWRG   +        DG++AHL   A   V+++A S    L
Sbjct  409  TSERLTSMHCRAQPIKKPIWRGLMSVKGGTSYSFDGISAHLSSLACPIVHEKASSLRGCL  468

Query  581  QLEMLPVSVVWPESF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVL  408
              EM P   +WP++F     P D ++ L+FF + +    K F SLV  M +  LAM+ +L
Sbjct  469  SAEMFPRMEIWPKTFLKNGGPKDDSVALFFFPSSQSNDEKTFYSLVGEMEKNDLAMRCLL  528

Query  407  ENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +++ELL+FTS  LP+ +W F  + YLWG+F+
Sbjct  529  DDAELLLFTSFMLPVDFWSFNSKDYLWGVFK  559



>ref|NP_001117432.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 dbj|BAH30335.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31995.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=431

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 79/138 (57%), Gaps = 2/138 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IWRG   +   +   +DG+ AH+   A  KV++ A S    L  E+LP   VWP+
Sbjct  287  PIKIPIWRGLMSVKGGNSCTMDGIVAHVSSLACPKVHETASSLKGRLSAEILPRLEVWPK  346

Query  542  SF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            +F     P D+++ L+FF + +    K F SLV+ M +   AM+ VL ++ELL+FTS  L
Sbjct  347  TFLKNGGPKDESVALFFFPSSESNDEKVFDSLVDKMKKNDSAMRCVLNDAELLLFTSYML  406

Query  368  PLIYWRFQGEFYLWGLFR  315
            P   W F  ++YLWG+F+
Sbjct  407  PKDSWTFNSKYYLWGVFK  424



>gb|KEH43663.1| hypothetical protein MTR_1g099270 [Medicago truncatula]
Length=353

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 80/143 (56%), Gaps = 6/143 (4%)
 Frame = -1

Query  737  HEPGLPVINIIWRGCFKICYKDYDI--LDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLP  564
            H    P+ + IWRG    C K   I  ++GL AHL   AS KV  E K FP +L  ++LP
Sbjct  213  HVDAKPIADPIWRGNLIFCDKSKTIGRVNGLLAHLSNIASPKVLDEMKFFPHVLSADLLP  272

Query  563  VSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLI  387
             S VWP SF    PTD++I LYFF   ++   K F  LV+ ++    A++ V EN+ LLI
Sbjct  273  RSEVWPNSFKEEGPTDESIALYFFPGNRRLSIKAFDKLVDDIICTEAAVRVVTENAVLLI  332

Query  386  FTSVELPLIYWRFQGEFYLWGLF  318
            F S  LP+   R Q E +L+ LF
Sbjct  333  FPSDLLPI---RHQSELHLFQLF  352



>ref|XP_010270011.1| PREDICTED: uncharacterized protein LOC104606480 isoform X5 [Nelumbo 
nucifera]
Length=1667

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P  + +W+GCF++       D+ DG+ AHL   AS KV +  K FP  + LE +P    
Sbjct  1036  IPEHDFLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLST  1095

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  FD +  T+ N+ LYFFA   +   ++   LV+ M++  LA+K   + +ELLIF S 
Sbjct  1096  WPRQFDDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSN  1155

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1156  KLPDKSQRWNMLFFLWGVFR  1175



>ref|XP_010270004.1| PREDICTED: uncharacterized protein LOC104606480 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270006.1| PREDICTED: uncharacterized protein LOC104606480 isoform X1 [Nelumbo 
nucifera]
Length=1792

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P  + +W+GCF++       D+ DG+ AHL   AS KV +  K FP  + LE +P    
Sbjct  1161  IPEHDFLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLST  1220

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  FD +  T+ N+ LYFFA   +   ++   LV+ M++  LA+K   + +ELLIF S 
Sbjct  1221  WPRQFDDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSN  1280

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1281  KLPDKSQRWNMLFFLWGVFR  1300



>ref|XP_010270010.1| PREDICTED: uncharacterized protein LOC104606480 isoform X4 [Nelumbo 
nucifera]
Length=1733

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P  + +W+GCF++       D+ DG+ AHL   AS KV +  K FP  + LE +P    
Sbjct  1102  IPEHDFLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLST  1161

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  FD +  T+ N+ LYFFA   +   ++   LV+ M++  LA+K   + +ELLIF S 
Sbjct  1162  WPRQFDDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSN  1221

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1222  KLPDKSQRWNMLFFLWGVFR  1241



>ref|XP_010270008.1| PREDICTED: uncharacterized protein LOC104606480 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010270009.1| PREDICTED: uncharacterized protein LOC104606480 isoform X3 [Nelumbo 
nucifera]
Length=1746

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P  + +W+GCF++       D+ DG+ AHL   AS KV +  K FP  + LE +P    
Sbjct  1115  IPEHDFLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLST  1174

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  FD +  T+ N+ LYFFA   +   ++   LV+ M++  LA+K   + +ELLIF S 
Sbjct  1175  WPRQFDDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSN  1234

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1235  KLPDKSQRWNMLFFLWGVFR  1254



>ref|XP_010270007.1| PREDICTED: uncharacterized protein LOC104606480 isoform X2 [Nelumbo 
nucifera]
Length=1790

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P  + +W+GCF++       D+ DG+ AHL   AS KV +  K FP  + LE +P    
Sbjct  1159  IPEHDFLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLST  1218

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  FD +  T+ N+ LYFFA   +   ++   LV+ M++  LA+K   + +ELLIF S 
Sbjct  1219  WPRQFDDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSN  1278

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1279  KLPDKSQRWNMLFFLWGVFR  1298



>ref|XP_006307521.1| hypothetical protein CARUB_v10009144mg [Capsella rubella]
 gb|EOA40419.1| hypothetical protein CARUB_v10009144mg [Capsella rubella]
Length=443

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 2/151 (1%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            T   L + H    P+   IWRG   +   +    DG+ AH+   A  KV+  A S    L
Sbjct  286  TSEMLTSGHYRAQPIKIPIWRGLMSVEGGNSCSFDGIVAHVSSLACPKVHDTASSLRGRL  345

Query  581  QLEMLPVSVVWPESF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVL  408
              ++LP   +WP++F  +  P D++I LYFF + +    K F S V  M +  LA++ VL
Sbjct  346  SAKILPRMEIWPKTFLKSGGPKDESIALYFFPSNESNDDKIFYSFVGEMRKNDLALRCVL  405

Query  407  ENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +++ELL+FTS  LP+  W F  + YLWG+F+
Sbjct  406  DDAELLLFTSYMLPVGSWSFNSKDYLWGVFK  436



>ref|XP_010500118.1| PREDICTED: uncharacterized protein LOC104777541 [Camelina sativa]
Length=690

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 83/151 (55%), Gaps = 2/151 (1%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            T  +L + H    P+   IWRG   +        DG++AHL   A   V+++A S    L
Sbjct  533  TSERLTSMHCRAQPIKKPIWRGLMSVKGGTSYSFDGISAHLSSLACPIVHEKASSLRGCL  592

Query  581  QLEMLPVSVVWPESF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVL  408
              EM P   +WP++F     P D ++ L+FF + +    K F SLV  M +  LAM+ +L
Sbjct  593  SAEMFPRMEIWPKTFLKNGGPKDDSVALFFFPSSQSNDEKTFYSLVGEMEKNDLAMRCLL  652

Query  407  ENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +++ELL+FTS  LP+ +W F  + YLWG+F+
Sbjct  653  DDAELLLFTSFMLPVDFWSFNSKDYLWGVFK  683



>ref|XP_010680257.1| PREDICTED: uncharacterized protein LOC104895445 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=871

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 79/141 (56%), Gaps = 0/141 (0%)
 Frame = -1

Query  737  HEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
            H P  P+I+ +WRG   I      +  GL AHL  +A  +V+  A + P +L  +++   
Sbjct  569  HVPAQPIISALWRGECSITDDALRMSFGLEAHLSNKAHARVHGAASALPHVLSFDIVQKH  628

Query  557  VVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
              WP+SF+ S PT   I LYFF   ++    +  L+E M++    M + + N ELL+F S
Sbjct  629  YAWPKSFEKSPPTSDTIGLYFFPVGERDEKWYDYLLEKMIEGDFMMISRINNLELLVFCS  688

Query  377  VELPLIYWRFQGEFYLWGLFR  315
            ++LP    R+Q ++YLWG+F+
Sbjct  689  LQLPREERRYQSKYYLWGVFK  709



>gb|EEE53135.1| hypothetical protein OsJ_35943 [Oryza sativa Japonica Group]
Length=1305

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  782  VPELDFIWQGGFELWRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRQNS  841

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + P+ +NI L+FFA        + S LVE M++  LA++  +E +ELLIF S 
Sbjct  842  WPTQFQENGPSYENIGLFFFARDTDSYENYYSKLVENMLKNDLALRGNIETAELLIFPSN  901

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWG+FR
Sbjct  902  ILSKNFQRWNMFYFLWGVFR  921



>ref|XP_008461945.1| PREDICTED: uncharacterized protein LOC103500424 isoform X4 [Cucumis 
melo]
Length=306

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -1

Query  554  VWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            VWP  F    PTDQ+I LYFF   +  +  F  LV  MM   LAMKAVL+N+ELL+FTS 
Sbjct  178  VWPRGFQKLGPTDQSIALYFFPDGESSQKAFDLLVNAMMSHDLAMKAVLKNAELLVFTSA  237

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP+ +WRFQ ++YLWG+FR
Sbjct  238  MLPMRFWRFQTKYYLWGVFR  257



>gb|KCW90978.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1112

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
            A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  828  AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  887

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
             +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  888  EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  947

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFR  315
            LLIF S +LP    R+   FYLWG+FR
Sbjct  948  LLIFPSNQLPEKSQRWNTLFYLWGVFR  974



>ref|NP_001067711.2| Os11g0292000 [Oryza sativa Japonica Group]
 dbj|BAF28074.2| Os11g0292000 [Oryza sativa Japonica Group]
Length=928

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IWRG F++    +   + +GL AHL   AS KV + AK FP  +QLE LP   +
Sbjct  507  IPELDYIWRGGFELSRTVRSPVLCEGLQAHLSCFASPKVLEVAKKFPSNVQLEELPRQNL  566

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +     +  LVE M+++ LA++  +E +ELLIF S 
Sbjct  567  WPPQFHDNGPTIDSIALFFFARDTESYEIHYRKLVENMLKDDLALRGNIETAELLIFASN  626

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  627  TLPNNFQRWNMFHFLWGVFR  646



>ref|XP_006663990.1| PREDICTED: uncharacterized protein LOC102710931 isoform X1 [Oryza 
brachyantha]
Length=1347

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  810  VPELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRLNS  869

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKC-RSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + P+ +NI L+FFA       + +  LVE M++  LA++  +E +ELLIF S 
Sbjct  870  WPRQFQENGPSYENIGLFFFARDTDSYENHYSKLVENMLKNDLALRGTIETAELLIFPSN  929

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWG+FR
Sbjct  930  ILSKNFQRWNMFYFLWGVFR  949



>ref|XP_006663991.1| PREDICTED: uncharacterized protein LOC102710931 isoform X2 [Oryza 
brachyantha]
Length=1326

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  789  VPELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRLNS  848

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKC-RSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + P+ +NI L+FFA       + +  LVE M++  LA++  +E +ELLIF S 
Sbjct  849  WPRQFQENGPSYENIGLFFFARDTDSYENHYSKLVENMLKNDLALRGTIETAELLIFPSN  908

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWG+FR
Sbjct  909  ILSKNFQRWNMFYFLWGVFR  928



>gb|ABA97690.2| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
Length=1267

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  745  VPELDFIWQGGFELWRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRQNS  804

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + P+ +NI L+FFA        + S LVE M++  LA++  +E +ELLIF S 
Sbjct  805  WPTQFQENGPSYENIGLFFFARDTDSYENYYSKLVENMLKNDLALRGNIETAELLIFPSN  864

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWG+FR
Sbjct  865  ILSKNFQRWNMFYFLWGVFR  884



>ref|XP_010063523.1| PREDICTED: uncharacterized protein LOC104450589 isoform X3 [Eucalyptus 
grandis]
Length=1543

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
            A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  795  AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  854

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
             +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  855  EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  914

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFR  315
            LLIF S +LP    R+   FYLWG+FR
Sbjct  915  LLIFPSNQLPEKSQRWNTLFYLWGVFR  941



>ref|XP_010312473.1| PREDICTED: uncharacterized protein LOC101263371 isoform X3 [Solanum 
lycopersicum]
Length=534

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI+ IWRGC     +    ++ LA HL  +A EK    A   P  L ++++  + VWP 
Sbjct  275  PVIDPIWRGCLIFNTESQSSINILA-HLSNKACEKACIAATRLPVNLDVKLVSKNDVWPR  333

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTD +I +Y F   ++  + + +L+E +++  LAM A +++ ELLIF+S  LP 
Sbjct  334  SFQRLQPTDCSIAVYLFPELEEDENSYDALLEDVIENDLAMSATIDDVELLIFSSCVLPQ  393

Query  362  IYWRFQGEFYLWGLFR  315
             +WR + ++YLWG+F+
Sbjct  394  KHWRLRRKYYLWGVFK  409



>gb|KCW90977.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1433

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
            A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  795  AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  854

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
             +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  855  EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  914

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFR  315
            LLIF S +LP    R+   FYLWG+FR
Sbjct  915  LLIFPSNQLPEKSQRWNTLFYLWGVFR  941



>gb|EEC69185.1| hypothetical protein OsI_38169 [Oryza sativa Indica Group]
Length=1305

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  782  VPELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRQNS  841

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + P+ +NI L+FFA        + S LVE M++  LA++  +E +ELLIF S 
Sbjct  842  WPTQFQENGPSYENIGLFFFARDTDSYENYYSKLVENMLKNDLALRGNIETAELLIFPSN  901

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWG+FR
Sbjct  902  ILSKNFQRWNMFYFLWGVFR  921



>gb|EEC74340.1| hypothetical protein OsI_09634 [Oryza sativa Indica Group]
Length=934

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IWRG F++    +   + +GL AHL   AS KV + AK FP  +QLE LP   +
Sbjct  628  IPELDYIWRGGFELSRTVRSPVLCEGLQAHLSCFASPKVLEVAKKFPSNVQLEELPRQNL  687

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +     +  LVE M+++ LA++  +E +ELLIF S 
Sbjct  688  WPPQFHDNGPTIDSIALFFFARDTESYEIHYRKLVENMLKDDLALRGNIETAELLIFASN  747

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  748  TLPNNFQRWNMFHFLWGVFR  767



>gb|AAX96031.1| PHD-finger, putative [Oryza sativa Japonica Group]
 gb|ABA92921.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
Length=1056

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IWRG F++    +   + +GL AHL   AS KV + AK FP  +QLE LP   +
Sbjct  721  IPELDYIWRGGFELSRTVRSPVLCEGLQAHLSCFASPKVLEVAKKFPSNVQLEELPRQNL  780

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +     +  LVE M+++ LA++  +E +ELLIF S 
Sbjct  781  WPPQFHDNGPTIDSIALFFFARDTESYEIHYRKLVENMLKDDLALRGNIETAELLIFASN  840

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  841  TLPNNFQRWNMFHFLWGVFR  860



>gb|KCW90976.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1576

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
            A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  828  AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  887

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
             +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  888  EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  947

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFR  315
            LLIF S +LP    R+   FYLWG+FR
Sbjct  948  LLIFPSNQLPEKSQRWNTLFYLWGVFR  974



>ref|XP_010063504.1| PREDICTED: uncharacterized protein LOC104450589 isoform X1 [Eucalyptus 
grandis]
Length=1609

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746   AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
             A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  861   AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  920

Query  572   MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
              +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  921   EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  980

Query  395   LLIFTSVELPLIYWRFQGEFYLWGLFR  315
             LLIF S +LP    R+   FYLWG+FR
Sbjct  981   LLIFPSNQLPEKSQRWNTLFYLWGVFR  1007



>ref|XP_010312474.1| PREDICTED: uncharacterized protein LOC101263371 isoform X4 [Solanum 
lycopersicum]
Length=528

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI+ IWRGC     +    ++ LA HL  +A EK    A   P  L ++++  + VWP 
Sbjct  269  PVIDPIWRGCLIFNTESQSSINILA-HLSNKACEKACIAATRLPVNLDVKLVSKNDVWPR  327

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTD +I +Y F   ++  + + +L+E +++  LAM A +++ ELLIF+S  LP 
Sbjct  328  SFQRLQPTDCSIAVYLFPELEEDENSYDALLEDVIENDLAMSATIDDVELLIFSSCVLPQ  387

Query  362  IYWRFQGEFYLWGLFR  315
             +WR + ++YLWG+F+
Sbjct  388  KHWRLRRKYYLWGVFK  403



>ref|XP_010063514.1| PREDICTED: uncharacterized protein LOC104450589 isoform X2 [Eucalyptus 
grandis]
Length=1583

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  AACHEPGLPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLE  573
            A C    +P    IWRG  ++C   +  D   GL AHL   AS +V    K F   L L 
Sbjct  835  AICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLS  894

Query  572  MLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSE  396
             +P S  WP  F  S   D NI LYFFA   +   + +  L+E M++  LA+K   +  E
Sbjct  895  EVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVE  954

Query  395  LLIFTSVELPLIYWRFQGEFYLWGLFR  315
            LLIF S +LP    R+   FYLWG+FR
Sbjct  955  LLIFPSNQLPEKSQRWNTLFYLWGVFR  981



>gb|EEE51986.1| hypothetical protein OsJ_33669 [Oryza sativa Japonica Group]
Length=1013

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICY--KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IWRG F++    +   + +GL AHL   AS KV + AK FP  +QLE LP   +
Sbjct  661  IPELDYIWRGGFELSRTVRSPVLCEGLQAHLSCFASPKVLEVAKKFPSNVQLEELPRQNL  720

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  +I L+FFA   +     +  LVE M+++ LA++  +E +ELLIF S 
Sbjct  721  WPPQFHDNGPTIDSIALFFFARDTESYEIHYRKLVENMLKDDLALRGNIETAELLIFASN  780

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             LP  + R+    +LWG+FR
Sbjct  781  TLPNNFQRWNMFHFLWGVFR  800



>ref|XP_010312472.1| PREDICTED: uncharacterized protein LOC101263371 isoform X2 [Solanum 
lycopersicum]
Length=534

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI+ IWRGC     +    ++ LA HL  +A EK    A   P  L ++++  + VWP 
Sbjct  275  PVIDPIWRGCLIFNTESQSSINILA-HLSNKACEKACIAATRLPVNLDVKLVSKNDVWPR  333

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTD +I +Y F   ++  + + +L+E +++  LAM A +++ ELLIF+S  LP 
Sbjct  334  SFQRLQPTDCSIAVYLFPELEEDENSYDALLEDVIENDLAMSATIDDVELLIFSSCVLPQ  393

Query  362  IYWRFQGEFYLWGLFR  315
             +WR + ++YLWG+F+
Sbjct  394  KHWRLRRKYYLWGVFK  409



>ref|XP_010322713.1| PREDICTED: uncharacterized protein LOC104648063 [Solanum lycopersicum]
Length=352

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 72/139 (52%), Gaps = 0/139 (0%)
 Frame = -1

Query  734  EPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
             P  P +   W+G F I            AH P R S KVY  +K  P  L+LE+LP   
Sbjct  196  HPCDPALAPSWKGSFDILGAPELAPGIFQAHPPCRVSRKVYDFSKLLPHTLKLELLPRGD  255

Query  554  VWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            +WP  FD   P+ ++I LYFF ++KK    ++ LVE M  + L M+ ++ + EL++  S 
Sbjct  256  IWPSLFDNHCPSKEDIGLYFFESEKKRFEGYIDLVEFMSNKDLMMRTLINDVELIVTAST  315

Query  374  ELPLIYWRFQGEFYLWGLF  318
             L     R+  E +LWGLF
Sbjct  316  TLCNDSQRWNNEHFLWGLF  334



>ref|XP_010312471.1| PREDICTED: uncharacterized protein LOC101263371 isoform X1 [Solanum 
lycopersicum]
Length=542

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PVI+ IWRGC     +    ++ + AHL  +A EK    A   P  L ++++  + VWP 
Sbjct  283  PVIDPIWRGCLIFNTESQSSIN-ILAHLSNKACEKACIAATRLPVNLDVKLVSKNDVWPR  341

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF    PTD +I +Y F   ++  + + +L+E +++  LAM A +++ ELLIF+S  LP 
Sbjct  342  SFQRLQPTDCSIAVYLFPELEEDENSYDALLEDVIENDLAMSATIDDVELLIFSSCVLPQ  401

Query  362  IYWRFQGEFYLWGLFR  315
             +WR + ++YLWG+F+
Sbjct  402  KHWRLRRKYYLWGVFK  417



>gb|KDP26133.1| hypothetical protein JCGZ_22234 [Jatropha curcas]
Length=349

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            P  P+ + IWRG F+I +       GL AHL  +A  KV   AK+ P  L L   P   V
Sbjct  187  PSQPINDPIWRGSFRIKHNKNPTFIGLTAHLSSKACTKVEDAAKALPMQLNLATFPRLEV  246

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP  F  S P+D +I LY F   ++    F  L++ ++    A+KAVL N ELL+F+S E
Sbjct  247  WPLRFQISPPSDCDIALYLFPEHERDEKFFDDLLDDIIMHDQALKAVLNNVELLVFSSRE  306

Query  371  LPLIYWR  351
            LP  +WR
Sbjct  307  LPPEHWR  313



>ref|XP_010479666.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
[Camelina sativa]
Length=644

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 2/151 (1%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            T  +L + H    P+   IWRG   +   +    DG+ AH+   A  KV++ A S    L
Sbjct  487  TSERLPSMHCRAQPIKIPIWRGLMSVKGGNSYSFDGITAHVSSLACPKVHEVASSLRGCL  546

Query  581  QLEMLPVSVVWPESF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVL  408
              EM P   +WP++F     P D ++ L+FF + +    K F SLV  M +  LAM+ +L
Sbjct  547  SAEMFPRMEIWPQTFVKNGGPKDDSVALFFFPSSESNDEKTFYSLVGEMEKNDLAMRCLL  606

Query  407  ENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            +++ELL+FTS  LP+  W F  + YLWG+F+
Sbjct  607  DDAELLLFTSFLLPVYSWSFYSKDYLWGVFK  637



>ref|XP_011101614.1| PREDICTED: uncharacterized protein LOC105179636 isoform X5 [Sesamum 
indicum]
Length=630

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+   WRG FKI    +++   +AAH+  +A  KV + A + P  L LEM P   VWP 
Sbjct  18   PVVVAAWRGRFKI--PSHNLYINVAAHVSNKACMKVLEVASTMPESLCLEMFPRLDVWPA  75

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S PT+Q+I L+FF  + +       L+   +    A+K ++  +ELLIF+S++LP 
Sbjct  76   SFKSSPPTEQSIALFFF-PEGRGEEILDCLLNDAICTDFALKGMIGKAELLIFSSLQLPE  134

Query  362  IYWRFQGEFYLWGLFR  315
               RFQG+ Y WG+FR
Sbjct  135  KLHRFQGKLYFWGVFR  150



>ref|XP_011101579.1| PREDICTED: uncharacterized protein LOC105179636 isoform X1 [Sesamum 
indicum]
 ref|XP_011101584.1| PREDICTED: uncharacterized protein LOC105179636 isoform X1 [Sesamum 
indicum]
Length=650

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+   WRG FKI    +++   +AAH+  +A  KV + A + P  L LEM P   VWP 
Sbjct  18   PVVVAAWRGRFKI--PSHNLYINVAAHVSNKACMKVLEVASTMPESLCLEMFPRLDVWPA  75

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S PT+Q+I L+FF  + +       L+   +    A+K ++  +ELLIF+S++LP 
Sbjct  76   SFKSSPPTEQSIALFFF-PEGRGEEILDCLLNDAICTDFALKGMIGKAELLIFSSLQLPE  134

Query  362  IYWRFQGEFYLWGLFR  315
               RFQG+ Y WG+FR
Sbjct  135  KLHRFQGKLYFWGVFR  150



>ref|XP_011101606.1| PREDICTED: uncharacterized protein LOC105179636 isoform X4 [Sesamum 
indicum]
Length=649

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+   WRG FKI    +++   +AAH+  +A  KV + A + P  L LEM P   VWP 
Sbjct  18   PVVVAAWRGRFKI--PSHNLYINVAAHVSNKACMKVLEVASTMPESLCLEMFPRLDVWPA  75

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S PT+Q+I L+FF  + +       L+   +    A+K ++  +ELLIF+S++LP 
Sbjct  76   SFKSSPPTEQSIALFFF-PEGRGEEILDCLLNDAICTDFALKGMIGKAELLIFSSLQLPE  134

Query  362  IYWRFQGEFYLWGLFR  315
               RFQG+ Y WG+FR
Sbjct  135  KLHRFQGKLYFWGVFR  150



>ref|XP_011101598.1| PREDICTED: uncharacterized protein LOC105179636 isoform X3 [Sesamum 
indicum]
Length=649

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+   WRG FKI    +++   +AAH+  +A  KV + A + P  L LEM P   VWP 
Sbjct  18   PVVVAAWRGRFKI--PSHNLYINVAAHVSNKACMKVLEVASTMPESLCLEMFPRLDVWPA  75

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S PT+Q+I L+FF  + +       L+   +    A+K ++  +ELLIF+S++LP 
Sbjct  76   SFKSSPPTEQSIALFFF-PEGRGEEILDCLLNDAICTDFALKGMIGKAELLIFSSLQLPE  134

Query  362  IYWRFQGEFYLWGLFR  315
               RFQG+ Y WG+FR
Sbjct  135  KLHRFQGKLYFWGVFR  150



>ref|XP_011101590.1| PREDICTED: uncharacterized protein LOC105179636 isoform X2 [Sesamum 
indicum]
Length=649

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV+   WRG FKI    +++   +AAH+  +A  KV + A + P  L LEM P   VWP 
Sbjct  18   PVVVAAWRGRFKI--PSHNLYINVAAHVSNKACMKVLEVASTMPESLCLEMFPRLDVWPA  75

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF +S PT+Q+I L+FF  + +       L+   +    A+K ++  +ELLIF+S++LP 
Sbjct  76   SFKSSPPTEQSIALFFF-PEGRGEEILDCLLNDAICTDFALKGMIGKAELLIFSSLQLPE  134

Query  362  IYWRFQGEFYLWGLFR  315
               RFQG+ Y WG+FR
Sbjct  135  KLHRFQGKLYFWGVFR  150



>ref|XP_010237286.1| PREDICTED: uncharacterized protein LOC100846635 [Brachypodium 
distachyon]
Length=1042

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 81/140 (58%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS KV + AK FP  +QLE LP    
Sbjct  544  VPELDYIWQGDFELWRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRQCS  603

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKC-RSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  NI ++FFA   +  ++ +  LV+ M+ + LA++  +E +ELLIF S 
Sbjct  604  WPTQFQENGPTYDNIGVFFFARDTQSYQNHYSKLVQNMLDKDLALRGNIETAELLIFPSN  663

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L     R+   ++LWG+FR
Sbjct  664  ILTKNSQRWNMLYFLWGVFR  683



>ref|NP_001233912.1| E4/E8 binding protein-1 [Solanum lycopersicum]
 gb|AAB67671.1| E4/E8 binding protein-1 [Solanum lycopersicum]
Length=460

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+ + IWRG F I   +  +   L AHL  +A  KV+  AK    ++  E LP   VWP+
Sbjct  5    PIDDTIWRGSFMISRPEMRL--NLTAHLSSKACAKVWLAAKEMAEVIYPEFLPKRDVWPK  62

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            SF ++   D NI +YFF+ K +    F +L+  +    +A++A++ +SELLIFTS  LP 
Sbjct  63   SFKSAKLIDDNIAIYFFSVKGRDDQVFENLLYNLRHYDIALRALVGDSELLIFTSAHLPE  122

Query  362  IYW--RFQGEFYLWGLF  318
             +    F+G+ YLWG+F
Sbjct  123  KHHIAGFEGKVYLWGVF  139



>ref|XP_003618041.1| hypothetical protein MTR_5g098320 [Medicago truncatula]
 gb|AET01000.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=227

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+++  W G  +  + D + ++GL AHL      KV+KE +  P +L  ++LP S VWP+
Sbjct  79   PILDANWSGNLR--FGD-NTINGLMAHLSDLVCPKVWKETELLPDVLSADLLPRSEVWPD  135

Query  542  SFDTSVPTDQNIDLYFFAA-KKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            SF    PT++NI LY F   +        +L+  ++    A++ V EN++LLIF S  LP
Sbjct  136  SFKKDGPTNKNIALYLFPEYEGPSMDALDNLIVEVIHAEAALRVVTENAQLLIFPSTLLP  195

Query  365  LIYWRFQGEFYLWGLFR  315
            + + +F  + YLWG+FR
Sbjct  196  IQHQKFDSKNYLWGVFR  212



>ref|XP_008788672.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103706375 
[Phoenix dactylifera]
Length=1571

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 3/141 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYK--DYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P + +IW+G FK+       +I DGL AH     S K  + A  FP ++ LE +P    
Sbjct  979   IPKLELIWQGGFKVLRTGGHSEICDGLQAHPSTCVSPKALEAAFKFPCIIHLEEVPRHGS  1038

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P + NI L FFA   +  ++ +  L+E M++  LAMK  ++ +ELLIF S 
Sbjct  1039  WPSQFQKNSPKEDNIALXFFAKDIESYKNNYSKLLETMLKNDLAMKGNVDGAELLIFPSN  1098

Query  374   ELPLIYWRFQGEFYLWGLFRD  312
              LP    R+   F+LWG+FR+
Sbjct  1099  LLPENSQRWNNLFFLWGVFRE  1119



>gb|ABA96546.1| expressed protein [Oryza sativa Japonica Group]
Length=826

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 79/136 (58%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+    W G F     D ++   LAAHL  +A ++V + A+S  P++++  LP    WPE
Sbjct  440  PMGEPAWSGIF---MTDSNVPIMLAAHLSTKACQRVSEFARSLQPVVEVIKLPRLKAWPE  496

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             +D S PTD +I L+FF    +   +   LV+ +++  + +KAVL   ELLIF S+ LP 
Sbjct  497  RWDKSGPTDDSIGLFFFPHSMRPNEELDKLVKEVIESDVVLKAVLGTVELLIFPSILLPE  556

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQG++YLWG+ +
Sbjct  557  QYHEFQGKYYLWGVCK  572



>ref|XP_002309893.2| hypothetical protein POPTR_0007s03750g, partial [Populus trichocarpa]
 gb|EEE90343.2| hypothetical protein POPTR_0007s03750g, partial [Populus trichocarpa]
Length=311

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 0/124 (0%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+I+ IW+G F I   +      L AHL   A  KV+  A + P  L +E+L  S  WP 
Sbjct  179  PIIDPIWKGSFNIQNLENHTSVLLLAHLSTNACSKVWDAASTLPAQLNIEILSRSDAWPH  238

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             F  + PT ++I LYFF  +++    F SL++ M+    A+KAV+ + ELL+F+S ELP 
Sbjct  239  KFQITPPTVESIGLYFFPQRERDEKVFESLLDEMIIHDRALKAVINDLELLVFSSCELPQ  298

Query  362  IYWR  351
             +WR
Sbjct  299  EHWR  302



>gb|EEE52811.1| hypothetical protein OsJ_35311 [Oryza sativa Japonica Group]
Length=791

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 78/134 (58%), Gaps = 3/134 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+    W G F     D ++   LAAHL  +A ++V + A+S  P++++  LP    WPE
Sbjct  405  PMGEPAWSGIF---MTDSNVPIMLAAHLSTKACQRVSEFARSLQPVVEVIKLPRLKAWPE  461

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             +D S PTD +I L+FF    +   +   LV+ +++  + +KAVL   ELLIF S+ LP 
Sbjct  462  RWDKSGPTDDSIGLFFFPHSMRPNEELDKLVKEVIESDVVLKAVLGTVELLIFPSILLPE  521

Query  362  IYWRFQGEFYLWGL  321
             Y  FQG++YLWG+
Sbjct  522  QYHEFQGKYYLWGV  535



>ref|XP_010259783.1| PREDICTED: uncharacterized protein LOC104599106 isoform X1 [Nelumbo 
nucifera]
Length=590

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 3/139 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P +   W+G F+IC +    +  DG  AH P + S K Y+ +K  P +LQ ++ P   VW
Sbjct  149  PALYSTWKGSFEICDRSLPGEFYDGFQAHPPEKVSRKAYEASKKMPGILQFKLQPRQNVW  208

Query  548  PESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             E F    P   ++ LYFF     + +  + SL +++ ++ L M +     ELLIFTS E
Sbjct  209  SEIFHKCPPAGNDVALYFFPGDFYRSKEMYNSLYDLIERDDLMMLSSFNGLELLIFTSRE  268

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LP+   R    F+LWG+FR
Sbjct  269  LPVDLQRINMPFFLWGIFR  287



>ref|XP_010259806.1| PREDICTED: uncharacterized protein LOC104599106 isoform X4 [Nelumbo 
nucifera]
Length=514

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 3/139 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P +   W+G F+IC +    +  DG  AH P + S K Y+ +K  P +LQ ++ P   VW
Sbjct  73   PALYSTWKGSFEICDRSLPGEFYDGFQAHPPEKVSRKAYEASKKMPGILQFKLQPRQNVW  132

Query  548  PESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             E F    P   ++ LYFF     + +  + SL +++ ++ L M +     ELLIFTS E
Sbjct  133  SEIFHKCPPAGNDVALYFFPGDFYRSKEMYNSLYDLIERDDLMMLSSFNGLELLIFTSRE  192

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LP+   R    F+LWG+FR
Sbjct  193  LPVDLQRINMPFFLWGIFR  211



>ref|XP_010259799.1| PREDICTED: uncharacterized protein LOC104599106 isoform X3 [Nelumbo 
nucifera]
Length=566

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 3/139 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P +   W+G F+IC +    +  DG  AH P + S K Y+ +K  P +LQ ++ P   VW
Sbjct  125  PALYSTWKGSFEICDRSLPGEFYDGFQAHPPEKVSRKAYEASKKMPGILQFKLQPRQNVW  184

Query  548  PESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             E F    P   ++ LYFF     + +  + SL +++ ++ L M +     ELLIFTS E
Sbjct  185  SEIFHKCPPAGNDVALYFFPGDFYRSKEMYNSLYDLIERDDLMMLSSFNGLELLIFTSRE  244

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LP+   R    F+LWG+FR
Sbjct  245  LPVDLQRINMPFFLWGIFR  263



>ref|XP_010259791.1| PREDICTED: uncharacterized protein LOC104599106 isoform X2 [Nelumbo 
nucifera]
Length=588

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 3/139 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P +   W+G F+IC +    +  DG  AH P + S K Y+ +K  P +LQ ++ P   VW
Sbjct  147  PALYSTWKGSFEICDRSLPGEFYDGFQAHPPEKVSRKAYEASKKMPGILQFKLQPRQNVW  206

Query  548  PESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             E F    P   ++ LYFF     + +  + SL +++ ++ L M +     ELLIFTS E
Sbjct  207  SEIFHKCPPAGNDVALYFFPGDFYRSKEMYNSLYDLIERDDLMMLSSFNGLELLIFTSRE  266

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LP+   R    F+LWG+FR
Sbjct  267  LPVDLQRINMPFFLWGIFR  285



>ref|XP_010680259.1| PREDICTED: uncharacterized protein LOC104895446 [Beta vulgaris 
subsp. vulgaris]
Length=658

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 79/136 (58%), Gaps = 2/136 (1%)
 Frame = -1

Query  722  PVINIIWRGCFK-ICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            P+I+ IWRG F  IC   Y   + L  HL  +AS KV+    + P  + L+++P    WP
Sbjct  517  PIIDPIWRGRFSLICDVQYLSFE-LFGHLSNKASLKVHGVVSALPEFINLKIVPKYKAWP  575

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            + F+ S PT ++IDLYF    ++    +  ++  ++ ++L + + + N +LL+F+S ELP
Sbjct  576  KVFNISPPTSKDIDLYFLPVNERDEEMYNVVLGDLIADKLVLTSKINNLDLLLFSSRELP  635

Query  365  LIYWRFQGEFYLWGLF  318
               WR Q  +Y+WG+F
Sbjct  636  HEQWRIQRNYYIWGVF  651



>ref|XP_003567412.2| PREDICTED: uncharacterized protein LOC100822533 [Brachypodium 
distachyon]
Length=725

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            LP+   IW G FKI  K       LAAHL V+  +KV+K ++S  P +++  L     WP
Sbjct  441  LPIDEPIWSGVFKIGNKYVP----LAAHLSVKHCDKVWKISRSLQPRVEVTKLSRLEAWP  496

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            +SF+   PTD +I LYF   + +  +   +LV  +M   + ++AV+  +E+LIF S+ LP
Sbjct  497  KSFEALGPTDDSIALYFLPHEMRQDADLDNLVREVMDNDMVLRAVVGEAEMLIFPSILLP  556

Query  365  LIYWRFQGEFYLWGLFR  315
              +  F+G+ YLW +F+
Sbjct  557  KRHQTFKGKPYLWAVFK  573



>ref|XP_008662494.1| PREDICTED: uncharacterized protein LOC103640797 [Zea mays]
Length=669

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 4/130 (3%)
 Frame = -1

Query  704  WRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSV  525
            W G FKI  K++     LA HL  ++ EKV+K   S P ++Q+  +P   VWP+ F  S 
Sbjct  448  WSGTFKIDGKEHI---SLAGHLSSKSCEKVWK-LSSLPKVVQVTKVPRMAVWPKIFKASE  503

Query  524  PTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQ  345
            P+  NI LYFF  + +   +   LV  +M + L ++A++  +E+LIF SV LP  Y  FQ
Sbjct  504  PSGDNIGLYFFPPEMRHDEELDQLVNEVMDKDLILRAIIGEAEMLIFPSVLLPERYQTFQ  563

Query  344  GEFYLWGLFR  315
             + YLW  F+
Sbjct  564  TKHYLWAAFK  573



>ref|XP_008661744.1| PREDICTED: uncharacterized protein LOC100276865 isoform X1 [Zea 
mays]
 ref|XP_008661745.1| PREDICTED: uncharacterized protein LOC100276865 isoform X1 [Zea 
mays]
 ref|XP_008661746.1| PREDICTED: uncharacterized protein LOC100276865 isoform X1 [Zea 
mays]
 gb|ACR35079.1| unknown [Zea mays]
 gb|AFW56127.1| hypothetical protein ZEAMMB73_505831 [Zea mays]
Length=669

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 4/130 (3%)
 Frame = -1

Query  704  WRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSV  525
            W G FKI  K++     LA HL  ++ EKV+K   S P ++Q+  +P   VWP+ F  S 
Sbjct  448  WSGTFKIDGKEHI---SLAGHLSSKSCEKVWK-LSSLPKVVQVTKVPRMAVWPKIFKASE  503

Query  524  PTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQ  345
            P+  NI LYFF  + +   +   LV  +M + L ++A++  +E+LIF SV LP  Y  FQ
Sbjct  504  PSGDNIGLYFFPPEMRHDEELDQLVNEVMDKDLILRAIIGEAEMLIFPSVLLPERYQTFQ  563

Query  344  GEFYLWGLFR  315
             + YLW  F+
Sbjct  564  TKHYLWAAFK  573



>gb|EMT09239.1| hypothetical protein F775_08146 [Aegilops tauschii]
Length=709

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 79/137 (58%), Gaps = 3/137 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            LP+   IW G  +I    +     LAAHL  +  EKV+K ++S  P++++  L     WP
Sbjct  413  LPIDEPIWSGIIRIGSGKFV---SLAAHLSTKYCEKVWKLSRSLEPVVEVTKLSRLEGWP  469

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            +SF+ S PTD NI LY    + +  +    LV+ +++  + ++A++  +E+LIF S+ LP
Sbjct  470  KSFEASRPTDDNIALYLLPTEMRQDADLDQLVKEVVENDMVLRAIVGEAEMLIFPSILLP  529

Query  365  LIYWRFQGEFYLWGLFR  315
              +  FQG+ YLW +F+
Sbjct  530  EQHQTFQGKPYLWAVFK  546



>gb|EMT25501.1| hypothetical protein F775_04308 [Aegilops tauschii]
Length=608

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 78/137 (57%), Gaps = 3/137 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
            LP+   IW G  K+    +     LAAHL  +  EKV+K ++S   ++++  L     WP
Sbjct  328  LPIDEPIWSGIIKLGSGKFV---SLAAHLSTKYCEKVWKLSRSLEAVVEVTKLSRLEAWP  384

Query  545  ESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            +SF+ S PTD NI LY    + +  +    LV+ +M+  + ++A++  +E+LIF S+ LP
Sbjct  385  KSFEASRPTDDNIALYLLPTEMRQDADLEQLVKEVMENDMVLRAIVGEAEMLIFPSILLP  444

Query  365  LIYWRFQGEFYLWGLFR  315
              +  FQG+ YLW +F+
Sbjct  445  EQHQTFQGKPYLWAVFK  461



>ref|XP_006664360.1| PREDICTED: uncharacterized protein LOC102708487 [Oryza brachyantha]
Length=826

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 79/136 (58%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            PV   +W G F     D ++   LAAHL  +A  +V++ A+S   ++++  LP    WP+
Sbjct  436  PVGEPVWSGIF---MTDSNVSVMLAAHLSTKACPRVFEFARSLQQVIEVIKLPRLKAWPK  492

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S+ TS PTD +I L+FF    +   +   L++ +++  L +KAVL   ELL+F S+ LP 
Sbjct  493  SWGTSGPTDDSIGLFFFPRSMRPNEELDRLLKEVIESDLVLKAVLGTVELLVFPSILLPE  552

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQ ++YLWG+ R
Sbjct  553  QYHEFQRKYYLWGVCR  568



>ref|XP_006837134.1| hypothetical protein AMTR_s00110p00135600 [Amborella trichopoda]
 gb|ERM99987.1| hypothetical protein AMTR_s00110p00135600 [Amborella trichopoda]
Length=925

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  728  GLPVINIIWRGCFKI-CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
              PV N +W+G F I C     I  G+ AH     + K Y+ +K+ P  +  +++    V
Sbjct  411  NFPVRNALWKGSFNISCASFLHICKGIQAHPSKEVASKAYEFSKTLPYHVPFKLVSRDNV  470

Query  551  WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
            WP+SF  + PTD++I LYFF  +   R+++V L+E ++ + LAM      +ELL+F+S +
Sbjct  471  WPKSFIETPPTDRDIALYFFPGEFD-RTEYVYLLEYIVGQDLAMSYCTNGAELLVFSSKQ  529

Query  371  LPLIYWRFQGEFYLWGLFR  315
            LPL         YLWGL+R
Sbjct  530  LPLDCQNLSMHMYLWGLYR  548



>gb|EMS56098.1| Tyrosine-protein kinase BAZ1B [Triticum urartu]
Length=731

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 77/137 (56%), Gaps = 3/137 (2%)
 Frame = -1

Query  716  INIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            +   +RGCF+I    +      GL  HL   AS+KV + AK FP  ++LE LP   +WP 
Sbjct  524  VETPFRGCFEIWRTGRSSKFCKGLQGHLSCSASQKVLEIAKKFPSKIRLEQLPRRNIWPP  583

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSVELP  366
             F  +  +  +I L+FFA   +   +  S LVE M++  LA++  +E +ELLIF S  LP
Sbjct  584  QFHGNGLSYDSIGLFFFAQDIQSYERHYSKLVEWMLKGDLALRGNIETAELLIFPSNILP  643

Query  365  LIYWRFQGEFYLWGLFR  315
              + R+   +YLWG+FR
Sbjct  644  KSFQRWNMSYYLWGVFR  660



>emb|CAN63105.1| hypothetical protein VITISV_029609 [Vitis vinifera]
Length=1761

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  731   PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
             P +P    IW+G F++    K  D+  G+ AHL   AS KV + A  FP  + L  +P S
Sbjct  1160  PVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASPKVLEVANKFPHKVLLNEVPRS  1219

Query  557   VVWPESF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
              +WP  F D SV  D NI LYFFA   +     + SL+E MM+  LA+K  ++  ELLIF
Sbjct  1220  SMWPAQFQDCSVKED-NIGLYFFAKDLESYERNYRSLLESMMKNDLALKGNIDGVELLIF  1278

Query  383   TSVELPLIYWRFQGEFYLWGLFR  315
              S +LP    R+   F+LWG+F+
Sbjct  1279  PSNQLPEKSQRWNMMFFLWGVFK  1301



>emb|CBI26469.3| unnamed protein product [Vitis vinifera]
Length=1382

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  731  PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
            P +P    IW+G F++    K  D+  G+ AHL   AS KV + A  FP  + L  +P S
Sbjct  781  PVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASPKVLEVANKFPHKVLLNEVPRS  840

Query  557  VVWPESF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
             +WP  F D SV  D NI LYFFA   +     + SL+E MM+  LA+K  ++  ELLIF
Sbjct  841  SMWPAQFQDCSVKED-NIGLYFFAKDLESYERNYRSLLESMMKNDLALKGNIDGVELLIF  899

Query  383  TSVELPLIYWRFQGEFYLWGLFR  315
             S +LP    R+   F+LWG+F+
Sbjct  900  PSNQLPEKSQRWNMMFFLWGVFK  922



>ref|XP_010662093.1| PREDICTED: uncharacterized protein LOC100261463 isoform X2 [Vitis 
vinifera]
Length=1626

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  731   PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
             P +P    IW+G F++    K  D+  G+ AHL   AS KV + A  FP  + L  +P S
Sbjct  1025  PVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASPKVLEVANKFPHKVLLNEVPRS  1084

Query  557   VVWPESF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
              +WP  F D SV  D NI LYFFA   +     + SL+E MM+  LA+K  ++  ELLIF
Sbjct  1085  SMWPAQFQDCSVKED-NIGLYFFAKDLESYERNYRSLLESMMKNDLALKGNIDGVELLIF  1143

Query  383   TSVELPLIYWRFQGEFYLWGLFR  315
              S +LP    R+   F+LWG+F+
Sbjct  1144  PSNQLPEKSQRWNMMFFLWGVFK  1166



>ref|XP_002270307.3| PREDICTED: uncharacterized protein LOC100261463 isoform X3 [Vitis 
vinifera]
Length=1581

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  731   PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
             P +P    IW+G F++    K  D+  G+ AHL   AS KV + A  FP  + L  +P S
Sbjct  980   PVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASPKVLEVANKFPHKVLLNEVPRS  1039

Query  557   VVWPESF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
              +WP  F D SV  D NI LYFFA   +     + SL+E MM+  LA+K  ++  ELLIF
Sbjct  1040  SMWPAQFQDCSVKED-NIGLYFFAKDLESYERNYRSLLESMMKNDLALKGNIDGVELLIF  1098

Query  383   TSVELPLIYWRFQGEFYLWGLFR  315
              S +LP    R+   F+LWG+F+
Sbjct  1099  PSNQLPEKSQRWNMMFFLWGVFK  1121



>ref|XP_010662091.1| PREDICTED: uncharacterized protein LOC100261463 isoform X1 [Vitis 
vinifera]
 ref|XP_010662092.1| PREDICTED: uncharacterized protein LOC100261463 isoform X1 [Vitis 
vinifera]
Length=1659

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = -1

Query  731   PGLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
             P +P    IW+G F++    K  D+  G+ AHL   AS KV + A  FP  + L  +P S
Sbjct  1058  PVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASPKVLEVANKFPHKVLLNEVPRS  1117

Query  557   VVWPESF-DTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIF  384
              +WP  F D SV  D NI LYFFA   +     + SL+E MM+  LA+K  ++  ELLIF
Sbjct  1118  SMWPAQFQDCSVKED-NIGLYFFAKDLESYERNYRSLLESMMKNDLALKGNIDGVELLIF  1176

Query  383   TSVELPLIYWRFQGEFYLWGLFR  315
              S +LP    R+   F+LWG+F+
Sbjct  1177  PSNQLPEKSQRWNMMFFLWGVFK  1199



>ref|XP_002891271.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67530.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = -1

Query  761  TQAQLAACHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPML  582
            T  +L++ H    P+   IWRG   +   +  I+DG+ AH+   A  KV++ A S    L
Sbjct  305  TTERLSSRHYRAQPIKIPIWRGLMSVKGGNNCIMDGIVAHVSSLACPKVHETASSLKGSL  364

Query  581  QLEMLPVSVVWPESF-DTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVL  408
              E+LP   VWP++F     P D++I L+FF + +    K F SLV+ M     AM+ VL
Sbjct  365  SAEVLPRLEVWPKTFLKNGGPKDESIALFFFPSSESNDEKVFNSLVDKMKTNDSAMRFVL  424

Query  407  ENSELLIFTSVELPLIYWRFQGEFYLWGLFRDS*LGFKDFP  285
             ++ELL+FTS  LP   W  +G++ L  L R    G    P
Sbjct  425  NDAELLLFTSYMLPKDSWTKKGDYRLQLLTRSITCGASSSP  465



>ref|XP_004956435.1| PREDICTED: uncharacterized protein LOC101759939 isoform X2 [Setaria 
italica]
Length=1268

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 96/178 (54%), Gaps = 8/178 (4%)
 Frame = -1

Query  830  SGTTSKCVDNTIGSFNQPRVGCNTQAQLAACHEP---GLPVINIIWRGCFKI--CYKDYD  666
            S TT   VDN+  +    R   + QA  +A  EP    +P ++ IW+G F++    +  +
Sbjct  737  SATTGIPVDNSC-TMPSDRRDESAQA-FSAGDEPMASTVPELDWIWQGGFELRRTGRSPE  794

Query  665  ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAA  486
            + DG  AHL   AS+ V + AK FP  +QLE +P    WP  F  + PT +N+ L+FFA 
Sbjct  795  LCDGFQAHLSCSASQLVLEVAKKFPSKVQLEEVPRQNSWPTQFQENGPTYENVGLFFFAR  854

Query  485  K-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              +   + +  LVE M++  L ++  ++  ELLIF S  L   + R+   ++LWG+FR
Sbjct  855  DIQSYENHYSKLVENMLKNDLVLRGSVDAVELLIFPSNTLSKNFQRWNMFYFLWGVFR  912



>ref|XP_004956434.1| PREDICTED: uncharacterized protein LOC101759939 isoform X1 [Setaria 
italica]
Length=1269

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 96/178 (54%), Gaps = 8/178 (4%)
 Frame = -1

Query  830  SGTTSKCVDNTIGSFNQPRVGCNTQAQLAACHEP---GLPVINIIWRGCFKI--CYKDYD  666
            S TT   VDN+  +    R   + QA  +A  EP    +P ++ IW+G F++    +  +
Sbjct  738  SATTGIPVDNSC-TMPSDRRDESAQA-FSAGDEPMASTVPELDWIWQGGFELRRTGRSPE  795

Query  665  ILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAA  486
            + DG  AHL   AS+ V + AK FP  +QLE +P    WP  F  + PT +N+ L+FFA 
Sbjct  796  LCDGFQAHLSCSASQLVLEVAKKFPSKVQLEEVPRQNSWPTQFQENGPTYENVGLFFFAR  855

Query  485  K-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
              +   + +  LVE M++  L ++  ++  ELLIF S  L   + R+   ++LWG+FR
Sbjct  856  DIQSYENHYSKLVENMLKNDLVLRGSVDAVELLIFPSNTLSKNFQRWNMFYFLWGVFR  913



>ref|XP_011087298.1| PREDICTED: uncharacterized protein LOC105168837 isoform X2 [Sesamum 
indicum]
Length=437

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKIC--YKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P ++  W+G F I    K  ++   +  H P +   KVY+ +K  P +L  E++   + W
Sbjct  199  PALSTSWKGSFCIHDDLKHAELNLQIEGHSPSQVRRKVYRFSKQMPEVLHFELVSCKIFW  258

Query  548  PESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
               F   +P  ++I LYFF++ ++    ++SL+E +  E LA++   ++ ELL+FTS  L
Sbjct  259  KIFFQEYLPDGRDIGLYFFSSDRERSDDYISLLETISVENLALRKQFDDVELLVFTSKLL  318

Query  368  PLIYWRFQGEFYLWGLF  318
            P+   R++G+++LWG+F
Sbjct  319  PVDCQRWEGKYFLWGVF  335



>ref|XP_011087297.1| PREDICTED: uncharacterized protein LOC105168837 isoform X1 [Sesamum 
indicum]
Length=464

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKIC--YKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P ++  W+G F I    K  ++   +  H P +   KVY+ +K  P +L  E++   + W
Sbjct  226  PALSTSWKGSFCIHDDLKHAELNLQIEGHSPSQVRRKVYRFSKQMPEVLHFELVSCKIFW  285

Query  548  PESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
               F   +P  ++I LYFF++ ++    ++SL+E +  E LA++   ++ ELL+FTS  L
Sbjct  286  KIFFQEYLPDGRDIGLYFFSSDRERSDDYISLLETISVENLALRKQFDDVELLVFTSKLL  345

Query  368  PLIYWRFQGEFYLWGLF  318
            P+   R++G+++LWG+F
Sbjct  346  PVDCQRWEGKYFLWGVF  362



>ref|XP_002442849.1| hypothetical protein SORBIDRAFT_08g003820 [Sorghum bicolor]
 gb|EES16687.1| hypothetical protein SORBIDRAFT_08g003820 [Sorghum bicolor]
Length=654

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 80/142 (56%), Gaps = 3/142 (2%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            C+    P+    W G FK   K+Y  LDG   HL  ++ EK +  +K    +++++ L  
Sbjct  373  CYSCSKPIEKPTWSGIFKTDNKEYVSLDG---HLSTKSCEKAWSLSKQLLKVVEVKRLSR  429

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFT  381
              V P++++ S PT  +I +YFF  + +       LV  +MQ  LA++AV+  +E+LI  
Sbjct  430  LEVQPKAWELSKPTADDIGIYFFPHEMRQDEVLDQLVREVMQNDLALRAVVGEAEMLILP  489

Query  380  SVELPLIYWRFQGEFYLWGLFR  315
            SV LP  +  FQG++YLWG+F+
Sbjct  490  SVLLPNHHQTFQGKYYLWGVFK  511



>ref|XP_010322710.1| PREDICTED: uncharacterized protein LOC104648062 [Solanum lycopersicum]
Length=373

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 78/140 (56%), Gaps = 2/140 (1%)
 Frame = -1

Query  734  EPGLPVINIIWRGCFKICYKDYDILDG-LAAHLPVRASEKVYKEAKSFPPMLQLEMLPVS  558
             P  P +   W+G F I   + ++  G + AH P R   KVY+ +   P  L+LE++P  
Sbjct  193  HPYDPALVPSWKGNFDI-LGELELAPGYIQAHSPCRVRRKVYEFSGRLPDTLKLELVPRG  251

Query  557  VVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
             +W   F+  +P  ++I LYFFA++++   ++++LVE M  + L ++ ++ + EL+I TS
Sbjct  252  DIWASLFNGYIPDKEDIGLYFFASERERSDRYIALVEFMHSKDLVLRTLINDVELIILTS  311

Query  377  VELPLIYWRFQGEFYLWGLF  318
              L      +  E +LWGLF
Sbjct  312  TALCSDSQSWNSEHFLWGLF  331



>ref|XP_004977330.1| PREDICTED: uncharacterized protein LOC101784120 [Setaria italica]
Length=1133

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 77/136 (57%), Gaps = 4/136 (3%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   +W G FKI   D ++L  L AHL  +A E+V + + S   +++++ LP S  WP+
Sbjct  703  PLDEPVWSGVFKI---DTEVL-MLDAHLSSKACERVRELSASLQSVVEVKKLPRSQAWPK  758

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S+ +  PTD NI L+FF    +       LV  +++   A+K  +  +ELLIF S  LP 
Sbjct  759  SWKSFGPTDDNIGLFFFPNSSRQNEVSNRLVNGIIKSDGALKVAVGMAELLIFPSSLLPE  818

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQG  YLWG+FR
Sbjct  819  QYHFFQGNHYLWGVFR  834



>ref|XP_002442853.1| hypothetical protein SORBIDRAFT_08g003860 [Sorghum bicolor]
 gb|EES16691.1| hypothetical protein SORBIDRAFT_08g003860 [Sorghum bicolor]
Length=777

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 4/130 (3%)
 Frame = -1

Query  704  WRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSV  525
            W G FKI  K+Y     LA HL  ++ EKV+K + S P ++Q+  +P    WP+ F  S 
Sbjct  463  WSGLFKIDGKEYI---SLAGHLSSKSCEKVWKLS-SLPKVVQVTKVPRMAAWPKIFKASK  518

Query  524  PTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQ  345
            PT  NI LYFF  + +   +   L+  +M + L ++AV+  +E+LIF SV LP  Y  F+
Sbjct  519  PTGDNIGLYFFPPEMRLDEELDQLINEVMDKDLILQAVIGEAEMLIFPSVLLPERYQTFR  578

Query  344  GEFYLWGLFR  315
             + YLW  F+
Sbjct  579  RKNYLWAAFK  588



>ref|XP_004962559.1| PREDICTED: uncharacterized protein LOC101777003 isoform X3 [Setaria 
italica]
Length=676

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 11/182 (6%)
 Frame = -1

Query  827  GTTSKCVDNTIGSFNQPRVGCNTQAQLAACH-EPG-------LPVINIIWRGCFKI--CY  678
            G +SK +  ++ S   P    N     ++ H  PG        P +N IW+G F++    
Sbjct  384  GQSSKTLGRSVDSPTMPSDLANKALTFSSQHFPPGYEQLALTAPELNYIWQGGFELWRTG  443

Query  677  KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLY  498
               ++ DG  AHL   AS K+ + AK FP  +QLE LP   VWP  F  + PT  +I L+
Sbjct  444  GSPELCDGFQAHLSCSASPKLLELAKKFPSKIQLEELPRDNVWPLQFQENCPTFDSIGLF  503

Query  497  FFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGL  321
            FFA   +   + +  LVE +++  LA++  ++ +ELLIF S  L     R+    +LWG+
Sbjct  504  FFARDIQSYENHYSKLVENIIKCDLALRGNIDTAELLIFASSTLSKNCQRWNMLIFLWGV  563

Query  320  FR  315
             R
Sbjct  564  LR  565



>ref|XP_009595024.1| PREDICTED: uncharacterized protein LOC104091403 isoform X1 [Nicotiana 
tomentosiformis]
Length=554

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 88/181 (49%), Gaps = 5/181 (3%)
 Frame = -1

Query  845  KLSSNSGTTSK-CVDNTIGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDY  669
            +++   G +SK C  +TI  F  P     +   +     P  P     W+G F I + D 
Sbjct  216  EMTKKPGQSSKGCDGSTILEFRSPDAVNASPMMIPPKTHPCDPAGVPSWKGSFVI-FGDL  274

Query  668  DI---LDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLY  498
                  D + A+ P R   KVY+ ++  P  LQ E++P   +W   F    P  ++I LY
Sbjct  275  KPEMPKDPIQAYPPSRVRRKVYEFSRLLPDTLQFELVPRGHIWSSLFHNRYPGKEDIGLY  334

Query  497  FFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLF  318
            FFA++++   K+++LVE M  + L M+A   + ELL+  S  L     RF  E +LWGLF
Sbjct  335  FFASERERSEKYIALVEFMHVKDLVMRAFGHDVELLVLASTTLCNDSRRFNSEHFLWGLF  394

Query  317  R  315
             
Sbjct  395  H  395



>ref|XP_010091858.1| hypothetical protein L484_000507 [Morus notabilis]
 gb|EXC37117.1| hypothetical protein L484_000507 [Morus notabilis]
Length=768

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILD--GLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P+I+ IW G  +I  +D +  +   +AAHL   A  KV++ AK  P  + LE+   S  W
Sbjct  617  PMIDPIWNGTLRISNRDLNTPEILSVAAHLSNLACHKVFEVAKLLPEEVSLELSKRSHFW  676

Query  548  PESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            P+SF    P+  +I LYFF    +  + F SLV+ M++E LAM+AVL+ +ELL+FTS +L
Sbjct  677  PKSFRMFGPSCHHIALYFFPDNGRDDNVFNSLVDGMIKEDLAMRAVLKEAELLVFTSYDL  736

Query  368  PL  363
            P+
Sbjct  737  PM  738



>ref|XP_010238691.1| PREDICTED: uncharacterized protein LOC104584781 [Brachypodium 
distachyon]
Length=909

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 77/136 (57%), Gaps = 3/136 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P+   IW G  +I  +++  LD   AHL  +A E V++ ++S   ++++  LP    WP+
Sbjct  521  PIDEPIWSGILQINAEEFVWLD---AHLSTKACELVWQLSRSLQTVVEVIKLPQFEAWPK  577

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
            S++ S PTD NI LYFF      + +   LVE +++    +K  L  +ELLIF S  LP 
Sbjct  578  SWEASGPTDDNIALYFFPPSMSSKEESDGLVEELIESSSVLKVALGIAELLIFPSTILPD  637

Query  362  IYWRFQGEFYLWGLFR  315
             Y   QG+ YLWGLF+
Sbjct  638  QYKVCQGKHYLWGLFK  653



>ref|XP_004962558.1| PREDICTED: uncharacterized protein LOC101777003 isoform X2 [Setaria 
italica]
Length=726

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 11/182 (6%)
 Frame = -1

Query  827  GTTSKCVDNTIGSFNQPRVGCNTQAQLAACH-EPG-------LPVINIIWRGCFKI--CY  678
            G +SK +  ++ S   P    N     ++ H  PG        P +N IW+G F++    
Sbjct  434  GQSSKTLGRSVDSPTMPSDLANKALTFSSQHFPPGYEQLALTAPELNYIWQGGFELWRTG  493

Query  677  KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLY  498
               ++ DG  AHL   AS K+ + AK FP  +QLE LP   VWP  F  + PT  +I L+
Sbjct  494  GSPELCDGFQAHLSCSASPKLLELAKKFPSKIQLEELPRDNVWPLQFQENCPTFDSIGLF  553

Query  497  FFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGL  321
            FFA   +   + +  LVE +++  LA++  ++ +ELLIF S  L     R+    +LWG+
Sbjct  554  FFARDIQSYENHYSKLVENIIKCDLALRGNIDTAELLIFASSTLSKNCQRWNMLIFLWGV  613

Query  320  FR  315
             R
Sbjct  614  LR  615



>ref|XP_009407037.1| PREDICTED: uncharacterized protein LOC103989817 [Musa acuminata 
subsp. malaccensis]
Length=711

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 1/137 (1%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P     W+G F++      I   + AH P + S K Y  +K  P  L+L+MLP    WP+
Sbjct  363  PAPGTCWKGTFEVFDMGIHIYGEIQAHFPSQVSPKAYDISKKLPMKLKLDMLPRRDAWPK  422

Query  542  SFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
             F +  PT  +I LYFF ++ ++ + K+  L+E +     AM+  +E+ ELLI+ S +L 
Sbjct  423  IFQSDPPTYDDIGLYFFPSQLERPKEKYFRLLERIDSCDFAMQTWIEDVELLIYPSQQLT  482

Query  365  LIYWRFQGEFYLWGLFR  315
            +   R   + YLWG+FR
Sbjct  483  VDSHRINEQIYLWGVFR  499



>ref|XP_004956348.1| PREDICTED: uncharacterized protein LOC101756415 [Setaria italica]
Length=586

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 79/136 (58%), Gaps = 4/136 (3%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPE  543
            P    IWRG      K+Y  L G   HL  ++ EKV+  +KS   ++++  LP   VWP+
Sbjct  349  PSDEPIWRGLLNTG-KEYIPLFG---HLSTKSCEKVHNLSKSLSRVVEVTKLPRLKVWPK  404

Query  542  SFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPL  363
             +D S P + +I LYFF  K +    +  L++ +M+  LA++A++ ++E+L+F S  LP 
Sbjct  405  RWDESRPLNGSIGLYFFPPKMRPDKSYDQLLKEVMENDLALRAIIGDTEMLMFPSTLLPQ  464

Query  362  IYWRFQGEFYLWGLFR  315
             Y  FQ + YLWG+F+
Sbjct  465  RYKTFQMKHYLWGVFK  480



>ref|XP_009418602.1| PREDICTED: uncharacterized protein LOC103998755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1701

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (54%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P ++ IW+G F++    +   + DG  AHL    S K  + A  FP  +QLE +P    
Sbjct  1082  IPELDYIWQGAFEVLRTAEAPTLFDGFQAHLSTYVSPKALEVASQFPCKIQLEEIPRLRS  1141

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFV-SLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P D NI L+FFA   +   K+   L+E M++  LA+   ++  ELLIF S 
Sbjct  1142  WPLQFHINSPKDDNIALFFFAKDIESYGKYYWKLLENMLKNDLALIGNIDTVELLIFPSN  1201

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   FYLWG+FR
Sbjct  1202  MLPENSQRWNKLFYLWGVFR  1221



>ref|XP_009418603.1| PREDICTED: uncharacterized protein LOC103998755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1698

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (54%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P ++ IW+G F++    +   + DG  AHL    S K  + A  FP  +QLE +P    
Sbjct  1079  IPELDYIWQGAFEVLRTAEAPTLFDGFQAHLSTYVSPKALEVASQFPCKIQLEEIPRLRS  1138

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFV-SLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P D NI L+FFA   +   K+   L+E M++  LA+   ++  ELLIF S 
Sbjct  1139  WPLQFHINSPKDDNIALFFFAKDIESYGKYYWKLLENMLKNDLALIGNIDTVELLIFPSN  1198

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   FYLWG+FR
Sbjct  1199  MLPENSQRWNKLFYLWGVFR  1218



>ref|XP_010102093.1| hypothetical protein L484_001826 [Morus notabilis]
 gb|EXB91952.1| hypothetical protein L484_001826 [Morus notabilis]
Length=783

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -1

Query  722  PVINIIWRGCFKICYKDYDILD--GLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVW  549
            P+I+ IW G  +I  +D +  +   +AAHL   A  KV++ AK  P  + LE+   S  W
Sbjct  632  PMIDPIWNGTLRISNRDLNTPEILSVAAHLSNLACHKVFEVAKLLPEEVSLELSKRSHFW  691

Query  548  PESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            P+SF    P+  +I LYFF    +  + F SLV+ M++E LAM+AVL+ +ELL+FTS +L
Sbjct  692  PKSFRMFGPSCHHIALYFFPDNGRDDNVFNSLVDGMIKEDLAMRAVLKEAELLVFTSYDL  751

Query  368  PL  363
            P+
Sbjct  752  PM  753



>ref|XP_009392778.1| PREDICTED: uncharacterized protein LOC103978646 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1677

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P +  IW+G F++    K   + DG+ AHL    S K  + A  FP  +QLE +P  + 
Sbjct  1044  IPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAYVSPKALEVATHFPCKVQLEEVPRLIS  1103

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFV-SLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P ++NI L+FFA   +   K+   L+E M++  LA+   ++  ELLIF S 
Sbjct  1104  WPLQFYENSPKEENIALFFFAKDTESYDKYYWKLLENMLKNDLALIGNIDAVELLIFPSN  1163

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   FYLWG+FR
Sbjct  1164  VLPENSQRWNKLFYLWGVFR  1183



>ref|XP_008459205.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Cucumis melo]
Length=1291

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++  C K  D  DG+ AHL   AS KV + A   P  + L+ +P    
Sbjct  1026  IPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCASPKVIEVASKLPHNISLKEVPRLST  1085

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F      + NI LYFFA         +  LV+ M +  LA+K  L+  ELLIF+S 
Sbjct  1086  WPSQFHDCGVKEDNIALYFFARDISSYERNYRGLVDHMTKNDLALKGNLDGVELLIFSSN  1145

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1146  QLPENSQRWNMLFFLWGVFR  1165



>ref|XP_009392773.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392774.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392775.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392776.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392777.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1683

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P +  IW+G F++    K   + DG+ AHL    S K  + A  FP  +QLE +P  + 
Sbjct  1050  IPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAYVSPKALEVATHFPCKVQLEEVPRLIS  1109

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFV-SLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P ++NI L+FFA   +   K+   L+E M++  LA+   ++  ELLIF S 
Sbjct  1110  WPLQFYENSPKEENIALFFFAKDTESYDKYYWKLLENMLKNDLALIGNIDAVELLIFPSN  1169

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   FYLWG+FR
Sbjct  1170  VLPENSQRWNKLFYLWGVFR  1189



>ref|XP_004962557.1| PREDICTED: uncharacterized protein LOC101777003 isoform X1 [Setaria 
italica]
Length=840

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 11/182 (6%)
 Frame = -1

Query  827  GTTSKCVDNTIGSFNQPRVGCNTQAQLAACH-EPG-------LPVINIIWRGCFKI--CY  678
            G +SK +  ++ S   P    N     ++ H  PG        P +N IW+G F++    
Sbjct  548  GQSSKTLGRSVDSPTMPSDLANKALTFSSQHFPPGYEQLALTAPELNYIWQGGFELWRTG  607

Query  677  KDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLY  498
               ++ DG  AHL   AS K+ + AK FP  +QLE LP   VWP  F  + PT  +I L+
Sbjct  608  GSPELCDGFQAHLSCSASPKLLELAKKFPSKIQLEELPRDNVWPLQFQENCPTFDSIGLF  667

Query  497  FFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGL  321
            FFA   +   + +  LVE +++  LA++  ++ +ELLIF S  L     R+    +LWG+
Sbjct  668  FFARDIQSYENHYSKLVENIIKCDLALRGNIDTAELLIFASSTLSKNCQRWNMLIFLWGV  727

Query  320  FR  315
             R
Sbjct  728  LR  729



>ref|XP_002325874.2| PHD finger family protein [Populus trichocarpa]
 gb|EEF00256.2| PHD finger family protein [Populus trichocarpa]
Length=1539

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  979   IPEHEYIWQGVFEVHRAEKVVDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPRIST  1038

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1039  WPRQFLVTGAKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1098

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1099  LPENSQRWNMLYFLWGVFR  1117



>ref|XP_008459204.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=1553

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++  C K  D  DG+ AHL   AS KV + A   P  + L+ +P    
Sbjct  976   IPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCASPKVIEVASKLPHNISLKEVPRLST  1035

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F      + NI LYFFA         +  LV+ M +  LA+K  L+  ELLIF+S 
Sbjct  1036  WPSQFHDCGVKEDNIALYFFARDISSYERNYRGLVDHMTKNDLALKGNLDGVELLIFSSN  1095

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1096  QLPENSQRWNMLFFLWGVFR  1115



>ref|XP_009392779.1| PREDICTED: uncharacterized protein LOC103978646 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1583

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P +  IW+G F++    K   + DG+ AHL    S K  + A  FP  +QLE +P  + 
Sbjct  950   IPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAYVSPKALEVATHFPCKVQLEEVPRLIS  1009

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFV-SLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F  + P ++NI L+FFA   +   K+   L+E M++  LA+   ++  ELLIF S 
Sbjct  1010  WPLQFYENSPKEENIALFFFAKDTESYDKYYWKLLENMLKNDLALIGNIDAVELLIFPSN  1069

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   FYLWG+FR
Sbjct  1070  VLPENSQRWNKLFYLWGVFR  1089



>ref|XP_008459203.1| PREDICTED: uncharacterized protein LOC103498397 isoform X1 [Cucumis 
melo]
Length=1603

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++  C K  D  DG+ AHL   AS KV + A   P  + L+ +P    
Sbjct  1026  IPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCASPKVIEVASKLPHNISLKEVPRLST  1085

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F      + NI LYFFA         +  LV+ M +  LA+K  L+  ELLIF+S 
Sbjct  1086  WPSQFHDCGVKEDNIALYFFARDISSYERNYRGLVDHMTKNDLALKGNLDGVELLIFSSN  1145

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1146  QLPENSQRWNMLFFLWGVFR  1165



>ref|XP_002437705.1| hypothetical protein SORBIDRAFT_10g001106 [Sorghum bicolor]
 gb|EER89072.1| hypothetical protein SORBIDRAFT_10g001106 [Sorghum bicolor]
Length=518

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 3/140 (2%)
 Frame = -1

Query  725  LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
            +P ++ IW+G F++    +  ++ DG  AHL   AS+ V    K FP  +QLE +P    
Sbjct  62   VPELDWIWQGGFELQRTGRSPELCDGFQAHLSCSASQLVLDVVKKFPSKVQLEEVPRQNS  121

Query  551  WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
            WP  F  + PT  NI L+FFA   +   + +  LVE M++  L ++  +   ELLIF S 
Sbjct  122  WPTQFQENGPTYDNIGLFFFARDVQSYENHYSKLVENMLKNDLVLRGSVGTVELLIFPSN  181

Query  374  ELPLIYWRFQGEFYLWGLFR  315
             L   + R+   ++LWGLFR
Sbjct  182  ILSKNFQRWNMFYFLWGLFR  201



>ref|XP_010322702.1| PREDICTED: uncharacterized protein LOC104648061 [Solanum lycopersicum]
Length=309

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = -1

Query  704  WRGCFKICYKDYDILDG-----LAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPES  540
            W+G F I +  ++ + G     + AH P +   KVY  + +FP  L+ E++    +    
Sbjct  113  WKGSFDI-FNHFEFIHGVFDNCIEAHPPSKVKRKVYDISTAFPDTLKFELIAYEDIQQSL  171

Query  539  FDTSVPTDQNIDLYFFAA-KKKCRS-KFVSLVEMMMQERLAMKAVLENSELLIFTSVELP  366
            F+  +P  ++I LYFFA+ K++CRS ++ +LV+ + +  L M+  ++N++LL+F S  L 
Sbjct  172  FNNHIPVREDIGLYFFASEKERCRSTRYNALVQFLYRNDLVMRTFIDNTQLLVFPSTALC  231

Query  365  LIYWRFQGEFYLWGLF  318
            +   R+  E +LWGLF
Sbjct  232  IDSQRWNEEGFLWGLF  247



>ref|XP_011012545.1| PREDICTED: uncharacterized protein LOC105116774 isoform X5 [Populus 
euphratica]
Length=1625

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  1033  IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1092

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1093  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1152

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1153  LPENSQRWNMLYFLWGVFR  1171



>ref|XP_011012543.1| PREDICTED: uncharacterized protein LOC105116774 isoform X4 [Populus 
euphratica]
Length=1678

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  1086  IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1145

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1146  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1205

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1206  LPENSQRWNMLYFLWGVFR  1224



>ref|XP_011012540.1| PREDICTED: uncharacterized protein LOC105116774 isoform X1 [Populus 
euphratica]
Length=1694

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  1102  IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1161

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1162  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1221

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1222  LPENSQRWNMLYFLWGVFR  1240



>ref|XP_011012542.1| PREDICTED: uncharacterized protein LOC105116774 isoform X3 [Populus 
euphratica]
Length=1682

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  1090  IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1149

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1150  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1209

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1210  LPENSQRWNMLYFLWGVFR  1228



>ref|XP_011012546.1| PREDICTED: uncharacterized protein LOC105116774 isoform X6 [Populus 
euphratica]
Length=1555

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  963   IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1022

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1023  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1082

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1083  LPENSQRWNMLYFLWGVFR  1101



>gb|EMS52711.1| hypothetical protein TRIUR3_32732 [Triticum urartu]
Length=624

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 3/129 (2%)
 Frame = -1

Query  701  RGCFKICYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVP  522
            RG  KI    +     LAAHL  +  EKV+K ++S  P++++  L     WP+SF+ S P
Sbjct  362  RGIIKIGSGKFV---SLAAHLSTKYCEKVWKLSRSLEPVVEVTKLSRLEAWPKSFEASRP  418

Query  521  TDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQG  342
            TD NI LY    + +  +    LV+ +M+  + ++A++  +E+LIF S+ LP  +  FQG
Sbjct  419  TDDNIALYLLPMEMRQDADMDQLVKEVMENDMVLRAIVAEAEMLIFPSILLPEQHQTFQG  478

Query  341  EFYLWGLFR  315
            + YLW +F+
Sbjct  479  KPYLWAVFK  487



>ref|XP_011012541.1| PREDICTED: uncharacterized protein LOC105116774 isoform X2 [Populus 
euphratica]
Length=1690

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++    K  D+ DG+ AHL   AS KV      FP  ++L+ +P    
Sbjct  1098  IPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSKFPQKIKLDEVPCIST  1157

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVE  372
             WP  F  +   ++NI LYFFA   +    +  L++ M+++ LA+K   E  E  IF S +
Sbjct  1158  WPRQFLVTGVKEENIALYFFAKNFESYENYKRLLDNMIKKDLALKGSFEGVEFFIFPSTQ  1217

Query  371   LPLIYWRFQGEFYLWGLFR  315
             LP    R+   ++LWG+FR
Sbjct  1218  LPENSQRWNMLYFLWGVFR  1236



>ref|XP_011084637.1| PREDICTED: uncharacterized protein LOC105166844 [Sesamum indicum]
Length=1453

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = -1

Query  728   GLPVINIIWRGCFKICYKD--YDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
              +P    IW+G F+IC  D  +D  DG+ AHL   AS KV K    F   + L  +P   
Sbjct  901   AIPEHEHIWQGSFEICRSDETFDSWDGIQAHLSTSASPKVIKAVNKFKSRIVLYEVPRKS  960

Query  554   VWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTS  378
              WP  F      + NI L+FFA   +   K +  L++ MM++ LA++  +   ELLIF S
Sbjct  961   TWPIQFQECGVREDNIALFFFAKDLESYEKIYKVLLDNMMKKDLALRGNVNGVELLIFAS  1020

Query  377   VELPLIYWRFQGEFYLWGLFR  315
              +LP    R+   F+LWG+FR
Sbjct  1021  NQLPDKSQRWNMLFFLWGVFR  1041



>ref|XP_010663251.1| PREDICTED: uncharacterized protein LOC100854642 isoform X3 [Vitis 
vinifera]
Length=639

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 3/138 (2%)
 Frame = -1

Query  719  VINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
             I+ +W+G FK        +   G  AH P     K Y+ +K  P +LQ E L    +W 
Sbjct  279  AIDAVWKGSFKFVDTVTPNESYVGFQAHPPYIVHRKAYEFSKQMPTVLQFERLHRCSLWA  338

Query  545  ESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            E F    P   +I LYFF  +  + R  +V L+E++  + LAM++ ++  ELL+FTS ++
Sbjct  339  ELFQDDSPDGDDIALYFFPGRFGRSRRDYVHLLELLETQDLAMRSHIDGVELLLFTSKQM  398

Query  368  PLIYWRFQGEFYLWGLFR  315
               + R   ++YLWG+FR
Sbjct  399  HRDFQRIDTQYYLWGVFR  416



>ref|XP_010663250.1| PREDICTED: uncharacterized protein LOC100854642 isoform X2 [Vitis 
vinifera]
Length=652

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 3/138 (2%)
 Frame = -1

Query  719  VINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
             I+ +W+G FK        +   G  AH P     K Y+ +K  P +LQ E L    +W 
Sbjct  292  AIDAVWKGSFKFVDTVTPNESYVGFQAHPPYIVHRKAYEFSKQMPTVLQFERLHRCSLWA  351

Query  545  ESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            E F    P   +I LYFF  +  + R  +V L+E++  + LAM++ ++  ELL+FTS ++
Sbjct  352  ELFQDDSPDGDDIALYFFPGRFGRSRRDYVHLLELLETQDLAMRSHIDGVELLLFTSKQM  411

Query  368  PLIYWRFQGEFYLWGLFR  315
               + R   ++YLWG+FR
Sbjct  412  HRDFQRIDTQYYLWGVFR  429



>ref|XP_003634298.2| PREDICTED: uncharacterized protein LOC100854642 isoform X1 [Vitis 
vinifera]
 ref|XP_010663247.1| PREDICTED: uncharacterized protein LOC100854642 isoform X1 [Vitis 
vinifera]
 ref|XP_010663248.1| PREDICTED: uncharacterized protein LOC100854642 isoform X1 [Vitis 
vinifera]
 ref|XP_010663249.1| PREDICTED: uncharacterized protein LOC100854642 isoform X1 [Vitis 
vinifera]
Length=666

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 3/138 (2%)
 Frame = -1

Query  719  VINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWP  546
             I+ +W+G FK        +   G  AH P     K Y+ +K  P +LQ E L    +W 
Sbjct  306  AIDAVWKGSFKFVDTVTPNESYVGFQAHPPYIVHRKAYEFSKQMPTVLQFERLHRCSLWA  365

Query  545  ESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSVEL  369
            E F    P   +I LYFF  +  + R  +V L+E++  + LAM++ ++  ELL+FTS ++
Sbjct  366  ELFQDDSPDGDDIALYFFPGRFGRSRRDYVHLLELLETQDLAMRSHIDGVELLLFTSKQM  425

Query  368  PLIYWRFQGEFYLWGLFR  315
               + R   ++YLWG+FR
Sbjct  426  HRDFQRIDTQYYLWGVFR  443



>ref|XP_010933485.1| PREDICTED: uncharacterized protein LOC105053867 [Elaeis guineensis]
Length=1636

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 76/140 (54%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P I  IW+G F++    K  +  DG+ AHL   AS KV +    FP  LQL+ +P   +
Sbjct  1038  IPEIEYIWQGGFEVLRTGKLPEFFDGIQAHLSTCASPKVLEVVSHFPGKLQLDEVPCLRL  1097

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F    P + NI L FFA   +   S +  L+E M++  LA++  +   ELLIF S 
Sbjct  1098  WPVQFQGMSPKEDNIALLFFAKDIESYESAYGKLLENMLKNDLALRGNINELELLIFPSN  1157

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1158  KLPENCQRWNMLFFLWGVFR  1177



>ref|XP_009595025.1| PREDICTED: uncharacterized protein LOC104091403 isoform X2 [Nicotiana 
tomentosiformis]
Length=549

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 81/169 (48%), Gaps = 4/169 (2%)
 Frame = -1

Query  812  CVDNTIGSFNQPRVGCNTQAQLAACHEPGLPVINIIWRGCFKICYKDYDI---LDGLAAH  642
            C  +TI  F  P     +   +     P  P     W+G F I + D       D + A+
Sbjct  223  CDGSTILEFRSPDAVNASPMMIPPKTHPCDPAGVPSWKGSFVI-FGDLKPEMPKDPIQAY  281

Query  641  LPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKF  462
             P R   KVY+ ++  P  LQ E++P   +W   F    P  ++I LYFFA++++   K+
Sbjct  282  PPSRVRRKVYEFSRLLPDTLQFELVPRGHIWSSLFHNRYPGKEDIGLYFFASERERSEKY  341

Query  461  VSLVEMMMQERLAMKAVLENSELLIFTSVELPLIYWRFQGEFYLWGLFR  315
            ++LVE M  + L M+A   + ELL+  S  L     RF  E +LWGLF 
Sbjct  342  IALVEFMHVKDLVMRAFGHDVELLVLASTTLCNDSRRFNSEHFLWGLFH  390



>ref|XP_008786315.1| PREDICTED: uncharacterized protein LOC103704691 isoform X3 [Phoenix 
dactylifera]
 ref|XP_008786316.1| PREDICTED: uncharacterized protein LOC103704691 isoform X3 [Phoenix 
dactylifera]
Length=1645

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query  728   GLPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
              +P    IW+G F++       +  DG+ AHL   AS KV +    FP  LQL+ +P   
Sbjct  1034  AIPEHKYIWQGGFEVLRTGRLPEFFDGIQAHLSTCASSKVLEVVSQFPGKLQLDEVPCLR  1093

Query  554   VWPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
             +WP  F    P + NI L+FFA   +   S +  L+E M++  LA++  +   ELLIF S
Sbjct  1094  LWPVQFQGMSPKEDNIALFFFAKDIESYESTYGKLLENMLKRDLALRGNISEVELLIFPS  1153

Query  377   VELPLIYWRFQGEFYLWGLFR  315
              +LP    R+   F+LWG+FR
Sbjct  1154  NKLPENCQRWNMLFFLWGVFR  1174



>ref|XP_008786313.1| PREDICTED: uncharacterized protein LOC103704691 isoform X1 [Phoenix 
dactylifera]
Length=1686

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query  728   GLPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
              +P    IW+G F++       +  DG+ AHL   AS KV +    FP  LQL+ +P   
Sbjct  1075  AIPEHKYIWQGGFEVLRTGRLPEFFDGIQAHLSTCASSKVLEVVSQFPGKLQLDEVPCLR  1134

Query  554   VWPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
             +WP  F    P + NI L+FFA   +   S +  L+E M++  LA++  +   ELLIF S
Sbjct  1135  LWPVQFQGMSPKEDNIALFFFAKDIESYESTYGKLLENMLKRDLALRGNISEVELLIFPS  1194

Query  377   VELPLIYWRFQGEFYLWGLFR  315
              +LP    R+   F+LWG+FR
Sbjct  1195  NKLPENCQRWNMLFFLWGVFR  1215



>ref|XP_008786314.1| PREDICTED: uncharacterized protein LOC103704691 isoform X2 [Phoenix 
dactylifera]
Length=1655

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 3/141 (2%)
 Frame = -1

Query  728   GLPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
              +P    IW+G F++       +  DG+ AHL   AS KV +    FP  LQL+ +P   
Sbjct  1044  AIPEHKYIWQGGFEVLRTGRLPEFFDGIQAHLSTCASSKVLEVVSQFPGKLQLDEVPCLR  1103

Query  554   VWPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTS  378
             +WP  F    P + NI L+FFA   +   S +  L+E M++  LA++  +   ELLIF S
Sbjct  1104  LWPVQFQGMSPKEDNIALFFFAKDIESYESTYGKLLENMLKRDLALRGNISEVELLIFPS  1163

Query  377   VELPLIYWRFQGEFYLWGLFR  315
              +LP    R+   F+LWG+FR
Sbjct  1164  NKLPENCQRWNMLFFLWGVFR  1184



>ref|XP_009794402.1| PREDICTED: uncharacterized protein LOC104241184 isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDI---LDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            C   G+P     W+G F I + D       D + A+ P R   KVY+ ++  P  LQ E+
Sbjct  250  CDPAGVPS----WKGSFVI-FGDLKPEMPKDLIQAYPPSRVRRKVYEFSRLLPDTLQFEL  304

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            +P   +W   F    P  ++I LYFFA++++   K+++LVE M  + L M+A   + ELL
Sbjct  305  VPRGHIWSSLFHNRYPGKEDIGLYFFASERERSEKYIALVEFMHVKDLVMRAFRNDVELL  364

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +  S  L     RF  E +LWGLF 
Sbjct  365  VLASTTLCSDSRRFNSEHFLWGLFH  389



>ref|XP_009794401.1| PREDICTED: uncharacterized protein LOC104241184 isoform X2 [Nicotiana 
sylvestris]
Length=558

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDI---LDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            C   G+P     W+G F I + D       D + A+ P R   KVY+ ++  P  LQ E+
Sbjct  260  CDPAGVPS----WKGSFVI-FGDLKPEMPKDLIQAYPPSRVRRKVYEFSRLLPDTLQFEL  314

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            +P   +W   F    P  ++I LYFFA++++   K+++LVE M  + L M+A   + ELL
Sbjct  315  VPRGHIWSSLFHNRYPGKEDIGLYFFASERERSEKYIALVEFMHVKDLVMRAFRNDVELL  374

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +  S  L     RF  E +LWGLF 
Sbjct  375  VLASTTLCSDSRRFNSEHFLWGLFH  399



>ref|XP_009794403.1| PREDICTED: uncharacterized protein LOC104241184 isoform X4 [Nicotiana 
sylvestris]
Length=530

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDI---LDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            C   G+P     W+G F I + D       D + A+ P R   KVY+ ++  P  LQ E+
Sbjct  232  CDPAGVPS----WKGSFVI-FGDLKPEMPKDLIQAYPPSRVRRKVYEFSRLLPDTLQFEL  286

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            +P   +W   F    P  ++I LYFFA++++   K+++LVE M  + L M+A   + ELL
Sbjct  287  VPRGHIWSSLFHNRYPGKEDIGLYFFASERERSEKYIALVEFMHVKDLVMRAFRNDVELL  346

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +  S  L     RF  E +LWGLF 
Sbjct  347  VLASTTLCSDSRRFNSEHFLWGLFH  371



>ref|XP_011042293.1| PREDICTED: uncharacterized protein LOC105138011 [Populus euphratica]
Length=479

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 7/148 (5%)
 Frame = -1

Query  737  HEPGLPVINIIWRGCFKICYKDYDIL-DGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPV  561
            + P  P +++ W+G FK       +   G  A LP R   K Y+ ++  P +LQ+++LP 
Sbjct  226  YHPHFPALHVTWKGGFKFDVATQQMFYGGFQAQLPCRIHRKAYESSRKIPLILQVKLLPQ  285

Query  560  SVVWPESFDTSVPTDQNIDLYFFAAKKKCRSK--FVSLVEMMMQERLAMKAVLENSELLI  387
              +W + F  S P   +I LYFF +    RSK    SL  +M  E  AM++ ++  ELLI
Sbjct  286  CDIWEDLFQDSCPDFCDIALYFFPSANIERSKENHASLFRLMETENAAMRSYIDGVELLI  345

Query  386  FTSVELPL----IYWRFQGEFYLWGLFR  315
            FTS +L +    I  R     +LWG+FR
Sbjct  346  FTSKQLHVESQDIIARSGMGNFLWGVFR  373



>ref|XP_009794400.1| PREDICTED: uncharacterized protein LOC104241184 isoform X1 [Nicotiana 
sylvestris]
Length=563

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  740  CHEPGLPVINIIWRGCFKICYKDYDI---LDGLAAHLPVRASEKVYKEAKSFPPMLQLEM  570
            C   G+P     W+G F I + D       D + A+ P R   KVY+ ++  P  LQ E+
Sbjct  265  CDPAGVPS----WKGSFVI-FGDLKPEMPKDLIQAYPPSRVRRKVYEFSRLLPDTLQFEL  319

Query  569  LPVSVVWPESFDTSVPTDQNIDLYFFAAKKKCRSKFVSLVEMMMQERLAMKAVLENSELL  390
            +P   +W   F    P  ++I LYFFA++++   K+++LVE M  + L M+A   + ELL
Sbjct  320  VPRGHIWSSLFHNRYPGKEDIGLYFFASERERSEKYIALVEFMHVKDLVMRAFRNDVELL  379

Query  389  IFTSVELPLIYWRFQGEFYLWGLFR  315
            +  S  L     RF  E +LWGLF 
Sbjct  380  VLASTTLCSDSRRFNSEHFLWGLFH  404



>ref|XP_009389328.1| PREDICTED: uncharacterized protein LOC103975917 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1577

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F+I       +I+DG+ AHL + AS KV++    FP  +QLE +P   +
Sbjct  1024  IPEQECIWQGAFEILKIGTITEIVDGIQAHLSMFASPKVHEVVCQFPCKIQLEEVPRVSL  1083

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F    P + NI LYFFA   +   + +  ++E  ++  LA+K  +   ELLIF S 
Sbjct  1084  WPLQFQEINPKEFNIALYFFAKDSESYERSYRKVLEAAIENDLALKGNISEVELLIFPSS  1143

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+FR
Sbjct  1144  MLPESSQRWNMLFFLWGIFR  1163



>ref|XP_004145410.1| PREDICTED: uncharacterized protein LOC101208726 [Cucumis sativus]
 ref|XP_004164797.1| PREDICTED: uncharacterized LOC101211560 [Cucumis sativus]
Length=1567

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++  C K  D  DG+ AHL   AS +V + A   P  + L+ +P    
Sbjct  990   IPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCASPRVIEVASKLPQNISLKEVPRLST  1049

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F      + NI LYFFA         +  L++ M +  LA+K  L+  ELLIF+S 
Sbjct  1050  WPSQFHDCGVKEDNIALYFFARDIHSYERNYRGLLDHMTKNDLALKGNLDGVELLIFSSN  1109

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1110  QLPEKSQRWNMLFFLWGVFR  1129



>ref|XP_009389331.1| PREDICTED: uncharacterized protein LOC103975917 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=1331

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F+I       +I+DG+ AHL + AS KV++    FP  +QLE +P   +
Sbjct  1024  IPEQECIWQGAFEILKIGTITEIVDGIQAHLSMFASPKVHEVVCQFPCKIQLEEVPRVSL  1083

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F    P + NI LYFFA   +   + +  ++E  ++  LA+K  +   ELLIF S 
Sbjct  1084  WPLQFQEINPKEFNIALYFFAKDSESYERSYRKVLEAAIENDLALKGNISEVELLIFPSS  1143

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+FR
Sbjct  1144  MLPESSQRWNMLFFLWGIFR  1163



>ref|XP_009389330.1| PREDICTED: uncharacterized protein LOC103975917 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1543

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F+I       +I+DG+ AHL + AS KV++    FP  +QLE +P   +
Sbjct  990   IPEQECIWQGAFEILKIGTITEIVDGIQAHLSMFASPKVHEVVCQFPCKIQLEEVPRVSL  1049

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F    P + NI LYFFA   +   + +  ++E  ++  LA+K  +   ELLIF S 
Sbjct  1050  WPLQFQEINPKEFNIALYFFAKDSESYERSYRKVLEAAIENDLALKGNISEVELLIFPSS  1109

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+FR
Sbjct  1110  MLPESSQRWNMLFFLWGIFR  1129



>ref|XP_009389329.1| PREDICTED: uncharacterized protein LOC103975917 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1560

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKICYKDY--DILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F+I       +I+DG+ AHL + AS KV++    FP  +QLE +P   +
Sbjct  1007  IPEQECIWQGAFEILKIGTITEIVDGIQAHLSMFASPKVHEVVCQFPCKIQLEEVPRVSL  1066

Query  551   WPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F    P + NI LYFFA   +   + +  ++E  ++  LA+K  +   ELLIF S 
Sbjct  1067  WPLQFQEINPKEFNIALYFFAKDSESYERSYRKVLEAAIENDLALKGNISEVELLIFPSS  1126

Query  374   ELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+FR
Sbjct  1127  MLPESSQRWNMLFFLWGIFR  1146



>gb|KGN61722.1| hypothetical protein Csa_2G233010 [Cucumis sativus]
Length=1546

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 3/140 (2%)
 Frame = -1

Query  725   LPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVV  552
             +P    IW+G F++  C K  D  DG+ AHL   AS +V + A   P  + L+ +P    
Sbjct  969   IPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCASPRVIEVASKLPQNISLKEVPRLST  1028

Query  551   WPESFDTSVPTDQNIDLYFFAAK-KKCRSKFVSLVEMMMQERLAMKAVLENSELLIFTSV  375
             WP  F      + NI LYFFA         +  L++ M +  LA+K  L+  ELLIF+S 
Sbjct  1029  WPSQFHDCGVKEDNIALYFFARDIHSYERNYRGLLDHMTKNDLALKGNLDGVELLIFSSN  1088

Query  374   ELPLIYWRFQGEFYLWGLFR  315
             +LP    R+   F+LWG+FR
Sbjct  1089  QLPEKSQRWNMLFFLWGVFR  1108



>ref|XP_007029696.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
8 [Theobroma cacao]
 gb|EOY10198.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
8 [Theobroma cacao]
Length=1209

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 73/141 (52%), Gaps = 3/141 (2%)
 Frame = -1

Query  728  GLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
             +P    IW+G F++    K  D   G+ AHL   AS KV +   +FP  + L  +P   
Sbjct  625  AIPEHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLS  684

Query  554  VWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTS  378
             WP  F  S P + NI LYFFA   +   K +  L+E M++  LA+K   E  ELLIF S
Sbjct  685  TWPAQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPS  744

Query  377  VELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+F+
Sbjct  745  NLLPENCQRWNTLFFLWGVFK  765



>ref|XP_007029695.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
7 [Theobroma cacao]
 gb|EOY10197.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
7 [Theobroma cacao]
Length=1404

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 73/141 (52%), Gaps = 3/141 (2%)
 Frame = -1

Query  728  GLPVINIIWRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSV  555
             +P    IW+G F++    K  D   G+ AHL   AS KV +   +FP  + L  +P   
Sbjct  820  AIPEHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLS  879

Query  554  VWPESFDTSVPTDQNIDLYFFAAKKKCRSK-FVSLVEMMMQERLAMKAVLENSELLIFTS  378
             WP  F  S P + NI LYFFA   +   K +  L+E M++  LA+K   E  ELLIF S
Sbjct  880  TWPAQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPS  939

Query  377  VELPLIYWRFQGEFYLWGLFR  315
              LP    R+   F+LWG+F+
Sbjct  940  NLLPENCQRWNTLFFLWGVFK  960



>gb|EMT02054.1| Tyrosine-protein kinase BAZ1B [Aegilops tauschii]
Length=795

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -1

Query  704  WRGCFKI--CYKDYDILDGLAAHLPVRASEKVYKEAKSFPPMLQLEMLPVSVVWPESFDT  531
            +RGCF+I    +      GL  HL   AS+KV + AK FP  ++LE LP   ++P  F  
Sbjct  566  FRGCFEIWRTGRPSKFCKGLQGHLSCSASQKVLEIAKKFPSKIRLEQLPRRNIFPPQFHG  625

Query  530  SVPTDQNIDLYFFAAKKKCRSKFVS-LVEMMMQERLAMKAVLENSELLIFTSVELPLIYW  354
            +  +  +I L+FFA   +   +  S LVE M++  LA++  +E +ELLIF S  LP  + 
Sbjct  626  NGLSYDSIGLFFFAQDIQSYERHYSKLVEWMLKGDLALRGNIETAELLIFPSNILPKSFQ  685

Query  353  RFQGEFYLWGLFR  315
            R+   +YLWG+FR
Sbjct  686  RWNMSYYLWGVFR  698



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956