BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24613_g1_i3 len=1002 path=[211:0-148 360:149-184 396:185-211
2872:212-216 425:217-227 170:228-285 493:286-336 544:337-416
624:417-436 644:437-457 2274:458-526 665:527-616 755:617-650
789:651-700 839:701-737 876:738-784 922:785-811 52:812-1001]

Length=1002
                                                                      Score     E

ref|XP_009591015.1|  PREDICTED: uncharacterized protein LOC104088099    145   1e-37   
ref|XP_010313849.1|  PREDICTED: uncharacterized protein LOC104644...    133   2e-33   
ref|XP_010313848.1|  PREDICTED: uncharacterized protein LOC104644...    132   5e-33   
ref|XP_004248173.1|  PREDICTED: uncharacterized protein LOC101265482    130   4e-32   
ref|XP_009801965.1|  PREDICTED: transcription factor bHLH120-like       130   7e-32   
emb|CDP14800.1|  unnamed protein product                                125   3e-30   
ref|XP_007043613.1|  Basic helix-loop-helix DNA-binding superfami...    123   6e-30   
ref|XP_007043611.1|  Basic helix-loop-helix DNA-binding superfami...    123   1e-29   
ref|XP_007043612.1|  Basic helix-loop-helix DNA-binding superfami...    123   2e-29   
ref|XP_011100438.1|  PREDICTED: uncharacterized protein LOC105178626    121   9e-29   
gb|KHG07347.1|  Transcription factor bHLH36 -like protein               120   2e-28   
ref|XP_006366312.1|  PREDICTED: uncharacterized protein LOC102597943    120   2e-28   
ref|XP_006366311.1|  PREDICTED: uncharacterized protein LOC102596975    120   3e-28   
ref|XP_004248474.1|  PREDICTED: uncharacterized protein LOC101259680    119   7e-28   
emb|CDP14799.1|  unnamed protein product                                117   2e-27   
gb|KDO53897.1|  hypothetical protein CISIN_1g027547mg                   115   1e-26   
ref|XP_011002885.1|  PREDICTED: transcription factor bHLH118-like...    115   2e-26   
gb|KDP24116.1|  hypothetical protein JCGZ_25773                         114   4e-26   
ref|XP_010327075.1|  PREDICTED: uncharacterized protein LOC104649466    114   5e-26   
gb|KCW47227.1|  hypothetical protein EUGRSUZ_K01037                     112   8e-26   
ref|XP_011037352.1|  PREDICTED: transcription factor bHLH118-like       112   1e-25   
ref|XP_011002883.1|  PREDICTED: transcription factor bHLH118-like...    112   1e-25   
ref|XP_011002882.1|  PREDICTED: transcription factor bHLH118-like...    112   2e-25   
ref|XP_010260225.1|  PREDICTED: transcription factor bHLH36-like        110   4e-25   
ref|XP_002274262.2|  PREDICTED: transcription factor bHLH36-like        110   4e-25   Vitis vinifera
ref|XP_003635365.2|  PREDICTED: transcription factor bHLH36             109   5e-25   
gb|KDO53898.1|  hypothetical protein CISIN_1g027547mg                   109   5e-25   
emb|CAN61967.1|  hypothetical protein VITISV_010916                     108   9e-25   Vitis vinifera
emb|CDP14797.1|  unnamed protein product                                108   1e-24   
emb|CBI33238.3|  unnamed protein product                                107   2e-24   
ref|XP_007198864.1|  hypothetical protein PRUPE_ppa018357mg             108   2e-24   
ref|XP_002509465.1|  DNA binding protein, putative                      108   3e-24   Ricinus communis
ref|XP_002305793.1|  basic helix-loop-helix family protein              105   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_003540366.1|  PREDICTED: transcription factor bHLH36-like        107   1e-23   
ref|XP_010091496.1|  hypothetical protein L484_010338                   106   1e-23   
ref|XP_011043394.1|  PREDICTED: uncharacterized protein LOC105138874    105   3e-23   
gb|EYU24919.1|  hypothetical protein MIMGU_mgv1a025903mg                105   6e-23   
ref|XP_010035765.1|  PREDICTED: transcription factor bHLH94-like        104   6e-23   
ref|XP_010038678.1|  PREDICTED: transcription factor bHLH99-like        104   7e-23   
ref|XP_008228998.1|  PREDICTED: transcription factor bHLH36-like        104   1e-22   
ref|XP_006469875.1|  PREDICTED: transcription factor bHLH36-like        103   1e-22   
ref|XP_007149840.1|  hypothetical protein PHAVU_005G102800g             103   1e-22   
ref|XP_006377370.1|  hypothetical protein POPTR_0011s05320g             104   1e-22   
ref|XP_006447292.1|  hypothetical protein CICLE_v10016466mg             103   2e-22   
ref|XP_009619775.1|  PREDICTED: transcription factor bHLH55-like        102   2e-22   
ref|XP_003540915.1|  PREDICTED: transcription factor bHLH36-like        103   2e-22   
ref|XP_007132724.1|  hypothetical protein PHAVU_011G119500g             102   3e-22   
ref|XP_011027821.1|  PREDICTED: transcription factor bHLH36-like ...    101   4e-22   
ref|XP_011016116.1|  PREDICTED: transcription factor bHLH36-like        101   4e-22   
ref|XP_004294013.1|  PREDICTED: transcription factor bHLH36-like        101   5e-22   
ref|XP_011016115.1|  PREDICTED: transcription factor bHLH36-like        101   6e-22   
ref|XP_011027820.1|  PREDICTED: transcription factor bHLH36-like ...    101   6e-22   
ref|XP_010272432.1|  PREDICTED: transcription factor bHLH36-like        100   2e-21   
ref|XP_007214498.1|  hypothetical protein PRUPE_ppa018726mg           99.8    2e-21   
ref|XP_004303146.1|  PREDICTED: transcription factor bHLH36-like        100   3e-21   
ref|XP_010327255.1|  PREDICTED: uncharacterized protein LOC104649501  99.4    5e-21   
ref|XP_008225174.1|  PREDICTED: transcription factor bHLH36           98.2    8e-21   
ref|XP_009340723.1|  PREDICTED: transcription factor bHLH55-like      97.8    1e-20   
ref|XP_006447291.1|  hypothetical protein CICLE_v10016466mg           98.2    1e-20   
ref|XP_008383729.1|  PREDICTED: transcription factor bHLH36-like ...  97.8    1e-20   
gb|KEH39148.1|  helix loop helix DNA-binding domain protein           98.6    1e-20   
ref|XP_008371377.1|  PREDICTED: transcription factor bHLH36-like      97.4    1e-20   
ref|XP_009352909.1|  PREDICTED: transcription factor bHLH55-like ...  97.1    2e-20   
emb|CDP14798.1|  unnamed protein product                              97.4    2e-20   
ref|XP_002517903.1|  DNA binding protein, putative                    97.8    3e-20   Ricinus communis
ref|XP_002511418.1|  DNA binding protein, putative                    96.3    3e-20   Ricinus communis
ref|XP_006371551.1|  hypothetical protein POPTR_0019s13090g           96.7    6e-20   
ref|XP_006371549.1|  hypothetical protein POPTR_0019s13070g           95.5    1e-19   
gb|KEH39144.1|  helix loop helix DNA-binding domain protein           95.5    1e-19   
ref|XP_010108177.1|  hypothetical protein L484_014502                 94.7    1e-19   
ref|XP_010439537.1|  PREDICTED: transcription factor bHLH36-like      94.4    2e-19   
ref|XP_009346720.1|  PREDICTED: uncharacterized protein LOC103938438  93.6    3e-19   
ref|XP_006376476.1|  hypothetical protein POPTR_0013s13340g           94.4    3e-19   
ref|XP_008383727.1|  PREDICTED: transcription factor bHLH36-like ...  93.2    5e-19   
ref|XP_009792759.1|  PREDICTED: uncharacterized protein LOC104239707  92.8    6e-19   
ref|XP_009352908.1|  PREDICTED: transcription factor bHLH55-like ...  92.4    9e-19   
ref|XP_009792659.1|  PREDICTED: transcription factor bHLH55-like      92.0    9e-19   
ref|XP_010925568.1|  PREDICTED: uncharacterized protein LOC105048079  91.7    1e-18   
ref|XP_010052302.1|  PREDICTED: uncharacterized protein LOC104441008  92.0    1e-18   
ref|XP_003526277.1|  PREDICTED: transcription factor bHLH36-like      92.4    2e-18   
ref|XP_003541734.1|  PREDICTED: uncharacterized protein LOC100784418  90.9    2e-18   
ref|XP_003607469.1|  Transcription factor bHLH36                      91.7    2e-18   
ref|XP_006449353.1|  hypothetical protein CICLE_v10016846mg           91.3    2e-18   
ref|XP_003593591.1|  Transcription factor bHLH36                      90.5    2e-18   
ref|XP_010057409.1|  PREDICTED: uncharacterized protein LOC104445270  90.9    4e-18   
ref|XP_006467789.1|  PREDICTED: transcription factor ABA-INDUCIBL...  90.1    5e-18   
ref|XP_006347029.1|  PREDICTED: uncharacterized protein LOC102588456  90.1    6e-18   
gb|KCW74558.1|  hypothetical protein EUGRSUZ_E03272                   89.7    7e-18   
ref|XP_010039147.1|  PREDICTED: transcription factor ORG2-like        89.7    8e-18   
ref|XP_009619774.1|  PREDICTED: uncharacterized protein LOC104111721  89.4    9e-18   
ref|XP_003547148.1|  PREDICTED: uncharacterized protein LOC100814407  89.0    1e-17   
ref|XP_006467787.1|  PREDICTED: transcription factor ABA-INDUCIBL...  89.0    1e-17   
gb|AFK47122.1|  unknown                                               89.0    1e-17   
ref|XP_010057407.1|  PREDICTED: uncharacterized protein LOC104445...  89.4    1e-17   
ref|XP_006284564.1|  hypothetical protein CARUB_v10005784mg           88.6    2e-17   
ref|XP_009134156.1|  PREDICTED: transcription factor bHLH36-like      88.6    2e-17   
gb|KEH39142.1|  helix loop helix DNA-binding domain protein           90.5    2e-17   
emb|CAB45892.1|  hypothetical protein                                 87.8    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193829.2|  basic helix-loop-helix domain-containing protein    87.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538664.1|  PREDICTED: uncharacterized protein LOC104812938  87.0    6e-17   
ref|XP_010434251.1|  PREDICTED: transcription factor bHLH36-like      86.7    1e-16   
ref|XP_010686666.1|  PREDICTED: uncharacterized protein LOC104900834  85.1    1e-16   
ref|XP_010057406.1|  PREDICTED: uncharacterized protein LOC104445267  85.5    2e-16   
gb|KCW74556.1|  hypothetical protein EUGRSUZ_E03270                   84.7    2e-16   
ref|XP_004505634.1|  PREDICTED: uncharacterized protein LOC101500132  85.5    3e-16   
ref|XP_006413836.1|  hypothetical protein EUTSA_v10026322mg           85.1    3e-16   
ref|XP_004486267.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  84.3    3e-16   
gb|EYU27979.1|  hypothetical protein MIMGU_mgv1a013945mg              85.1    4e-16   
ref|XP_011096311.1|  PREDICTED: transcription factor bHLH125          84.7    4e-16   
ref|XP_008455310.1|  PREDICTED: transcription factor bHLH101-like     84.7    5e-16   
ref|XP_008353778.1|  PREDICTED: transcription factor bHLH118-like...  84.3    5e-16   
ref|XP_008353776.1|  PREDICTED: transcription factor bHLH118-like...  85.1    6e-16   
ref|XP_004233835.1|  PREDICTED: uncharacterized protein LOC101247399  84.3    7e-16   
ref|XP_010039150.1|  PREDICTED: transcription factor ORG2-like        84.0    7e-16   
ref|XP_010667753.1|  PREDICTED: transcription factor bHLH36-like      83.6    8e-16   
ref|XP_003525498.1|  PREDICTED: uncharacterized protein LOC100811485  84.0    9e-16   
ref|XP_008794132.1|  PREDICTED: uncharacterized protein LOC103710251  84.0    9e-16   
ref|XP_007025601.1|  Basic helix-loop-helix DNA-binding superfami...  84.3    9e-16   
ref|XP_008353779.1|  PREDICTED: transcription factor bHLH118-like...  83.6    1e-15   
ref|XP_009137159.1|  PREDICTED: transcription factor bHLH36-like      83.2    1e-15   
ref|XP_002869917.1|  basic helix-loop-helix family protein            83.2    1e-15   
ref|XP_008342971.1|  PREDICTED: transcription factor bHLH36-like      84.3    1e-15   
ref|XP_004155520.1|  PREDICTED: uncharacterized protein LOC101232753  83.6    1e-15   
ref|XP_010057405.1|  PREDICTED: uncharacterized protein LOC104445266  82.8    1e-15   
gb|ABD32361.2|  Helix-loop-helix DNA-binding                          83.6    1e-15   Medicago truncatula
gb|KHG17385.1|  Transcription factor bHLH36 -like protein             82.4    2e-15   
emb|CDO99531.1|  unnamed protein product                              82.0    2e-15   
gb|KHN30895.1|  hypothetical protein glysoja_017432                   82.4    3e-15   
ref|XP_007138091.1|  hypothetical protein PHAVU_009G179600g           82.0    3e-15   
ref|XP_003523076.1|  PREDICTED: uncharacterized protein LOC100790403  82.0    4e-15   
gb|KHN09998.1|  Transcription factor bHLH36                           81.3    4e-15   
gb|KFK28692.1|  hypothetical protein AALP_AA7G034000                  81.6    5e-15   
ref|XP_010039149.1|  PREDICTED: uncharacterized protein LOC104427821  81.6    5e-15   
ref|XP_006371550.1|  hypothetical protein POPTR_0019s13080g           80.9    5e-15   
ref|XP_010915430.1|  PREDICTED: uncharacterized protein LOC105040557  80.5    9e-15   
ref|XP_004298935.1|  PREDICTED: uncharacterized protein LOC101299087  80.9    1e-14   
ref|XP_003541532.1|  PREDICTED: uncharacterized protein LOC100789728  80.5    1e-14   
gb|KHN19314.1|  hypothetical protein glysoja_012234                   80.1    2e-14   
ref|XP_003527022.1|  PREDICTED: uncharacterized protein LOC100809363  80.1    2e-14   
ref|XP_011021492.1|  PREDICTED: transcription factor bHLH118-like     80.5    2e-14   
ref|XP_009409379.1|  PREDICTED: uncharacterized protein LOC103991605  80.1    2e-14   
gb|KDP20980.1|  hypothetical protein JCGZ_21451                       79.3    2e-14   
emb|CBI29562.3|  unnamed protein product                              78.6    3e-14   
ref|XP_002325417.2|  hypothetical protein POPTR_0019s05030g           79.7    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007159331.1|  hypothetical protein PHAVU_002G229100g           78.6    4e-14   
ref|XP_006493102.1|  PREDICTED: uncharacterized protein LOC102607218  79.3    6e-14   
ref|XP_010647398.1|  PREDICTED: transcription factor bHLH36-like      77.4    7e-14   
ref|XP_009336214.1|  PREDICTED: transcription factor bHLH36-like      78.2    1e-13   
ref|XP_009400066.1|  PREDICTED: uncharacterized protein LOC103984307  77.0    1e-13   
ref|XP_008782439.1|  PREDICTED: uncharacterized protein LOC103701976  77.4    1e-13   
ref|XP_010936746.1|  PREDICTED: uncharacterized protein LOC105056299  77.4    1e-13   
ref|XP_002318646.1|  hypothetical protein POPTR_0012s08050g           77.0    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010940038.1|  PREDICTED: uncharacterized protein LOC105058719  77.0    2e-13   
gb|KCW74559.1|  hypothetical protein EUGRSUZ_E03273                   76.3    3e-13   
ref|XP_006447290.1|  hypothetical protein CICLE_v10016466mg           76.3    3e-13   
ref|XP_006476761.1|  PREDICTED: uncharacterized protein LOC102614927  76.3    3e-13   
ref|XP_011028585.1|  PREDICTED: uncharacterized protein LOC105128559  76.3    3e-13   
ref|XP_008369936.1|  PREDICTED: transcription factor bHLH36-like      77.0    4e-13   
ref|XP_011044317.1|  PREDICTED: uncharacterized protein LOC105139543  76.3    4e-13   
ref|XP_006442006.1|  hypothetical protein CICLE_v10024201mg           75.9    6e-13   
ref|XP_008787951.1|  PREDICTED: uncharacterized protein LOC103705848  75.5    7e-13   
ref|XP_007148151.1|  hypothetical protein PHAVU_006G184600g           75.1    8e-13   
ref|XP_006439795.1|  hypothetical protein CICLE_v10022480mg           75.1    8e-13   
ref|XP_002322161.1|  hypothetical protein POPTR_0015s08580g           74.7    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011087146.1|  PREDICTED: uncharacterized protein LOC105168709  74.3    2e-12   
emb|CDP12372.1|  unnamed protein product                              74.3    2e-12   
ref|XP_009393604.1|  PREDICTED: uncharacterized protein LOC103979252  73.9    2e-12   
ref|XP_010037569.1|  PREDICTED: transcription factor bHLH100-like     73.6    4e-12   
ref|XP_004248475.1|  PREDICTED: uncharacterized protein LOC101259985  73.2    4e-12   
ref|XP_003528456.2|  PREDICTED: transcription factor bHLH55-like      72.8    6e-12   
ref|XP_009388818.1|  PREDICTED: uncharacterized protein LOC103975545  72.4    7e-12   
ref|XP_010039148.1|  PREDICTED: transcription factor ORG2-like        72.4    7e-12   
ref|XP_010101195.1|  hypothetical protein L484_014999                 72.8    8e-12   
ref|XP_009388820.1|  PREDICTED: uncharacterized protein LOC103975547  72.4    8e-12   
ref|XP_008239751.1|  PREDICTED: uncharacterized protein LOC103338...  72.4    1e-11   
ref|XP_008239750.1|  PREDICTED: uncharacterized protein LOC103338...  72.0    1e-11   
gb|AHA11095.1|  bHLH transcription factor                             72.0    1e-11   
ref|XP_010925444.1|  PREDICTED: uncharacterized protein LOC105047972  71.6    2e-11   
gb|KHN18464.1|  Transcription factor bHLH36                           71.6    2e-11   
ref|XP_008239749.1|  PREDICTED: uncharacterized protein LOC103338...  71.6    2e-11   
ref|XP_010251286.1|  PREDICTED: uncharacterized protein LOC104593...  71.6    2e-11   
ref|XP_009413847.1|  PREDICTED: transcription factor bHLH36-like ...  70.9    3e-11   
ref|XP_009413848.1|  PREDICTED: transcription factor bHLH36-like ...  70.9    3e-11   
gb|KHN35247.1|  hypothetical protein glysoja_042317                   71.2    3e-11   
ref|XP_011087147.1|  PREDICTED: uncharacterized protein LOC105168711  70.9    3e-11   
ref|XP_004236112.1|  PREDICTED: uncharacterized protein LOC101248004  70.9    3e-11   
ref|XP_010686489.1|  PREDICTED: uncharacterized protein LOC104900...  71.2    3e-11   
ref|XP_009618665.1|  PREDICTED: transcription factor ORG3-like        70.9    3e-11   
ref|XP_010686490.1|  PREDICTED: uncharacterized protein LOC104900...  70.9    3e-11   
ref|XP_008393119.1|  PREDICTED: uncharacterized protein LOC103455312  70.5    5e-11   
ref|XP_007155415.1|  hypothetical protein PHAVU_003G199500g           70.5    5e-11   
ref|XP_002279841.1|  PREDICTED: uncharacterized protein LOC100253569  70.1    6e-11   Vitis vinifera
ref|XP_008442634.1|  PREDICTED: transcription factor ORG2-like        70.9    8e-11   
ref|XP_007044631.1|  Basic helix-loop-helix DNA-binding superfami...  69.3    1e-10   
ref|XP_010028270.1|  PREDICTED: transcription factor ORG2-like        69.7    1e-10   
ref|XP_010251287.1|  PREDICTED: uncharacterized protein LOC104593222  69.3    1e-10   
emb|CDP21802.1|  unnamed protein product                              69.3    1e-10   
gb|KDP31114.1|  hypothetical protein JCGZ_11490                       69.3    1e-10   
ref|XP_007211000.1|  hypothetical protein PRUPE_ppa020940mg           68.6    2e-10   
ref|XP_007208890.1|  hypothetical protein PRUPE_ppa026684mg           68.2    3e-10   
ref|XP_009108520.1|  PREDICTED: uncharacterized protein LOC103834211  67.8    3e-10   
ref|XP_010318915.1|  PREDICTED: transcription factor bHLH27-like      68.2    3e-10   
ref|NP_001239892.1|  uncharacterized protein LOC100787505             67.4    4e-10   
ref|XP_008353777.1|  PREDICTED: uncharacterized protein LOC103417...  68.2    5e-10   
gb|KEH39150.1|  hypothetical protein MTR_2g090500                     68.2    6e-10   
ref|XP_010537647.1|  PREDICTED: transcription factor bHLH36-like      66.6    7e-10   
ref|XP_007036186.1|  Basic helix-loop-helix DNA-binding superfami...  66.6    1e-09   
ref|XP_006449356.1|  hypothetical protein CICLE_v10016846mg           65.5    2e-09   
ref|XP_010251285.1|  PREDICTED: uncharacterized protein LOC104593...  66.6    2e-09   
ref|XP_008791819.1|  PREDICTED: uncharacterized protein LOC103708585  65.5    2e-09   
ref|XP_010057408.1|  PREDICTED: uncharacterized protein LOC104445...  65.1    2e-09   
gb|KHN07252.1|  Transcription factor bHLH125                          65.5    2e-09   
ref|XP_011072116.1|  PREDICTED: uncharacterized protein LOC105157401  63.5    1e-08   
ref|XP_009336213.1|  PREDICTED: transcription factor bHLH36-like      64.3    2e-08   
ref|XP_006345192.1|  PREDICTED: uncharacterized protein LOC102584256  62.0    4e-08   
ref|XP_007204917.1|  hypothetical protein PRUPE_ppa024966mg           62.4    6e-08   
emb|CDM80000.1|  unnamed protein product                              62.0    7e-08   
gb|EMS45882.1|  hypothetical protein TRIUR3_14872                     60.8    1e-07   
ref|XP_008364666.1|  PREDICTED: uncharacterized protein LOC103428336  60.5    1e-07   
gb|KHN40119.1|  hypothetical protein glysoja_044767                   60.5    1e-07   
ref|XP_007009593.1|  Basic helix-loop-helix DNA-binding superfami...  60.1    2e-07   
emb|CDP12371.1|  unnamed protein product                              60.5    2e-07   
ref|XP_010651083.1|  PREDICTED: uncharacterized protein LOC104879556  59.7    2e-07   
ref|XP_007009590.1|  Basic helix-loop-helix DNA-binding superfami...  58.5    6e-07   
gb|KHN34305.1|  hypothetical protein glysoja_016633                   58.2    7e-07   
ref|XP_010678925.1|  PREDICTED: uncharacterized protein LOC104894404  58.2    7e-07   
ref|XP_004967963.1|  PREDICTED: uncharacterized protein LOC101784195  58.2    1e-06   
ref|XP_003565225.1|  PREDICTED: uncharacterized protein LOC100830809  57.8    1e-06   
ref|XP_008243130.1|  PREDICTED: transcription factor ORG2-like        58.2    2e-06   
ref|XP_008439139.1|  PREDICTED: transcription factor bHLH36-like      57.4    2e-06   
ref|XP_008438283.1|  PREDICTED: uncharacterized protein LOC103483440  57.0    2e-06   
ref|XP_007149839.1|  hypothetical protein PHAVU_005G102700g           56.6    3e-06   
ref|XP_007149841.1|  hypothetical protein PHAVU_005G102900g           56.6    3e-06   
ref|XP_009404833.1|  PREDICTED: transcription factor bHLH120-like     56.2    3e-06   
ref|XP_010927034.1|  PREDICTED: transcription factor bHLH100-like     57.4    4e-06   
ref|XP_004148147.1|  PREDICTED: transcription factor bHLH36-like      56.6    4e-06   
ref|NP_001140429.1|  putative HLH DNA-binding domain superfamily ...  57.0    4e-06   Zea mays [maize]
ref|XP_007044624.1|  Basic helix-loop-helix DNA-binding superfami...  55.5    6e-06   
ref|XP_009409207.1|  PREDICTED: uncharacterized protein LOC103991458  55.5    6e-06   
ref|XP_002451822.1|  hypothetical protein SORBIDRAFT_04g008260        55.5    8e-06   Sorghum bicolor [broomcorn]
ref|XP_009398132.1|  PREDICTED: uncharacterized protein LOC103982820  55.1    9e-06   
ref|XP_002457514.1|  hypothetical protein SORBIDRAFT_03g008570        55.1    1e-05   Sorghum bicolor [broomcorn]
ref|XP_009339562.1|  PREDICTED: transcription factor ORG2-like        55.1    2e-05   
ref|XP_009625858.1|  PREDICTED: transcription factor ORG2-like is...  55.1    2e-05   
gb|EMS50762.1|  hypothetical protein TRIUR3_01157                     53.9    2e-05   
ref|XP_010678747.1|  PREDICTED: uncharacterized protein LOC104894259  53.9    2e-05   
ref|XP_009625857.1|  PREDICTED: transcription factor ORG2-like is...  55.1    2e-05   
ref|XP_009127274.1|  PREDICTED: transcription factor bHLH36-like      52.8    6e-05   
ref|XP_006345193.1|  PREDICTED: transcription factor ORG2-like        52.4    6e-05   
ref|XP_004290411.1|  PREDICTED: transcription factor ORG2-like        53.5    7e-05   
ref|XP_006859019.1|  hypothetical protein AMTR_s00068p00166340        52.4    8e-05   
ref|XP_008674508.1|  PREDICTED: transcription factor bHLH100-like...  52.4    1e-04   
ref|XP_003565088.1|  PREDICTED: transcription factor bHLH100-like     52.8    1e-04   
dbj|BAB78624.1|  unknown protein                                      52.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDY00498.1|  BnaA10g07750D                                        51.6    2e-04   
ref|XP_003565095.1|  PREDICTED: transcription factor bHLH100-like     52.0    2e-04   
ref|XP_010443714.1|  PREDICTED: transcription factor bHLH36-like      51.2    2e-04   
tpg|DAA55783.1|  TPA: putative HLH DNA-binding domain superfamily...  52.0    2e-04   
ref|XP_010667754.1|  PREDICTED: transcription factor bHLH36-like      50.1    2e-04   
gb|KHN36645.1|  hypothetical protein glysoja_001376                   50.1    3e-04   
gb|EAZ10240.1|  hypothetical protein OsJ_00072                        50.4    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMT05067.1|  hypothetical protein F775_22744                       50.8    4e-04   
ref|XP_006645381.1|  PREDICTED: transcription factor bHLH100-like     51.2    5e-04   
ref|XP_004967961.1|  PREDICTED: uncharacterized protein LOC101783...  50.4    5e-04   
emb|CDY46929.1|  BnaAnng08070D                                        50.1    6e-04   
ref|XP_004146605.1|  PREDICTED: transcription factor bHLH118-like     50.1    6e-04   
ref|XP_002531541.1|  DNA binding protein, putative                    49.7    6e-04   Ricinus communis
dbj|BAK02408.1|  predicted protein                                    50.4    6e-04   
gb|EMT05070.1|  hypothetical protein F775_43517                       50.4    6e-04   
ref|XP_004165574.1|  PREDICTED: transcription factor bHLH118-like     50.1    7e-04   
emb|CDY62057.1|  BnaC09g52800D                                        49.7    7e-04   
ref|XP_009387039.1|  PREDICTED: transcription factor ORG2-like        50.4    7e-04   
emb|CDX91606.1|  BnaC02g15540D                                        49.7    8e-04   
ref|XP_006440484.1|  hypothetical protein CICLE_v10024422mg           48.9    8e-04   
dbj|BAB64701.1|  bHLH transcription factor-like                       50.4    8e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674507.1|  PREDICTED: transcription factor bHLH100-like...  50.4    8e-04   
ref|XP_006446344.1|  hypothetical protein CICLE_v100181411mg          48.5    8e-04   
gb|EEC72172.1|  hypothetical protein OsI_05220                        49.3    0.001   Oryza sativa Indica Group [Indian rice]



>ref|XP_009591015.1| PREDICTED: uncharacterized protein LOC104088099 [Nicotiana tomentosiformis]
Length=229

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 139/237 (59%), Gaps = 25/237 (11%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQLEK  813
            APKLERKY+EKNRRN++K+LY  L SLL  H   +E +ALPD++D    YIK LE +LEK
Sbjct  10   APKLERKYVEKNRRNNMKNLYNQLHSLLLNHASSKETLALPDRIDAATNYIKSLETKLEK  69

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
            ++   EEL    RK   S    N +P++  ++  P+I+  + SP M VVLI GL++++ F
Sbjct  70   NKMYLEELRISCRKRHRSVKATNELPSSSTKS-LPQIEFHEMSPTMFVVLITGLDNLAIF  128

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGK  453
            Y IIR+L+ ++G++V  ++F ++GNSTLQ++ E             K   +    F+   
Sbjct  129  YNIIRLLN-EEGVEVLYSSFSLNGNSTLQISLE------------TKMDRNSTMEFRAAT  175

Query  452  SEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQCQNP  282
                 + ++LK ++ G      +ES+ L+ WD  Y IE + LGF  LE   +  QNP
Sbjct  176  -----LFDKLKELLYGSSCSNNMESQ-LHLWD--YIIESELLGFDALELLPIASQNP  224



>ref|XP_010313849.1| PREDICTED: uncharacterized protein LOC104644845 isoform X2 [Solanum 
lycopersicum]
Length=215

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 125/230 (54%), Gaps = 43/230 (19%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            A +LE+KY+EK RR+++K+L+  L SLLP H  QE M LPDQ+D ++ YIK LE +LEKS
Sbjct  16   ASRLEKKYVEKKRRSNMKNLFNHLCSLLPPHPSQEAMGLPDQIDASITYIKNLEIKLEKS  75

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP-------PEIQVVDTSPGMSVVLINGL  651
            + + E+L  K R         N +  A   T P       P+I+V + SP M ++LI+GL
Sbjct  76   KMQLEKLRTKKRS--------NLLCMANHDTNPSISKLSSPQIEVQEMSPTMDLILISGL  127

Query  650  ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PG  471
            +++  FY IIR+ H ++  +V N+ F + GNS +Q+ HE             K I D   
Sbjct  128  DNLVMFYNIIRLFH-EENFEVINSNFSLDGNSMMQIFHES------------KVIGD---  171

Query  470  FFQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGF  321
                      M+  R+K ++ G    + I    L+SWDN  +I+ + LG 
Sbjct  172  --------STMVYRRVKELLNGSSSNDDIIETLLHSWDN--EIQSEMLGL  211



>ref|XP_010313848.1| PREDICTED: uncharacterized protein LOC104644845 isoform X1 [Solanum 
lycopersicum]
Length=217

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 125/232 (54%), Gaps = 45/232 (19%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALPDQLDETVKYIKCLENQLE  816
            A +LE+KY+EK RR+++K+L+  L SLLP H    QE M LPDQ+D ++ YIK LE +LE
Sbjct  16   ASRLEKKYVEKKRRSNMKNLFNHLCSLLPPHPSQLQEAMGLPDQIDASITYIKNLEIKLE  75

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP-------PEIQVVDTSPGMSVVLIN  657
            KS+ + E+L  K R         N +  A   T P       P+I+V + SP M ++LI+
Sbjct  76   KSKMQLEKLRTKKRS--------NLLCMANHDTNPSISKLSSPQIEVQEMSPTMDLILIS  127

Query  656  GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*  477
            GL+++  FY IIR+ H ++  +V N+ F + GNS +Q+ HE             K I D 
Sbjct  128  GLDNLVMFYNIIRLFH-EENFEVINSNFSLDGNSMMQIFHE------------SKVIGD-  173

Query  476  PGFFQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGF  321
                        M+  R+K ++ G    + I    L+SWDN  +I+ + LG 
Sbjct  174  ----------STMVYRRVKELLNGSSSNDDIIETLLHSWDN--EIQSEMLGL  213



>ref|XP_004248173.1| PREDICTED: uncharacterized protein LOC101265482 [Solanum lycopersicum]
Length=235

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 104/156 (67%), Gaps = 11/156 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQL  819
            APKLERKY+EKNRRNH+K+L   L S+LP H     +  M +PDQ+D  VK+I+ L+  L
Sbjct  10   APKLERKYVEKNRRNHMKNLCNQLHSMLPTHSSTSKETTMTVPDQIDAAVKHIETLKMNL  69

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTE-PPEIQVVDTSPGMSVVLINGLESI  642
            EK+++  EEL    +  PN +   N     G  T+ PP+I+  +  P M VVLIN L++I
Sbjct  70   EKNKKHLEEL----KMGPNKAQSLNQTNEPGPITKSPPQIEFHEMGPNMVVVLINSLDNI  125

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHE  534
            + F  IIR+ HK +G++V + +F+++GNSTLQ++HE
Sbjct  126  ATFNNIIRLCHK-EGVEVVSTSFKLNGNSTLQISHE  160



>ref|XP_009801965.1| PREDICTED: transcription factor bHLH120-like [Nicotiana sylvestris]
Length=237

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 138/246 (56%), Gaps = 24/246 (10%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            APKLERKY+EKNRRN++K+LY  L+SLLP H  +E + LPDQLD    YIK LE    K 
Sbjct  10   APKLERKYVEKNRRNNMKNLYNQLYSLLPNHASKETLTLPDQLDTATNYIKSLE-TKLKK  68

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++K  E L+ SRK P S +  N  P++  ++  P I+  + SP M VVLI GL++++ FY
Sbjct  69   KKKYMEELRISRKRPQSFNATNSEPSSSTKSLIPHIEFHEMSPTMFVVLITGLDNLATFY  128

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKS  450
             +I++LH ++G++V  + F ++GNS LQ++ E             K   +    F+    
Sbjct  129  NVIQLLH-EEGVEVVYSNFSLNGNSMLQISLET------------KMDKNSTMEFRATT-  174

Query  449  EMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQCQNPPPSF  270
                + ++LK ++ G      +ES  L+ W+  Y  E + LGF  LE   +  QNP   +
Sbjct  175  ----LFDKLKELLYGSSRKNYMESH-LHLWE--YIFESELLGFDALELLPIASQNPTLQY  227

Query  269  FWTAGN  252
             +   N
Sbjct  228  NYMQKN  233



>emb|CDP14800.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 132/236 (56%), Gaps = 41/236 (17%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            T  PK+ER+ +EKNRR+H+K LY  L+ L+P+   +E + +PDQ+DE + YIK +E +LE
Sbjct  8    TSNPKMERRIVEKNRRSHMKDLYARLYGLVPSDSSKENLTVPDQIDEAINYIKSMEKKLE  67

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            K ++KKE+LL   R  P S        A GE T+   ++V D  P + V+L+NGLE  + 
Sbjct  68   KCKEKKEKLLFGKR--PYSG-------ATGETTKITNVEVHDMGPNLDVILLNGLEEQAS  118

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVG  456
            FYGIIR+L K +G +V NA F  +GNS LQV H++                   G     
Sbjct  119  FYGIIRLLCK-EGFEVVNANFSSNGNSVLQVVHDK-------------------GGISTS  158

Query  455  KSEMGMIAERLKVVIKGCPGGEA-------IESEPLNSWDNNYDIERDNLGFPVLE  309
            ++E   +A+RLK +I G   GE        +ES  L  WD  ++IE D L   VLE
Sbjct  159  RTETTAVAKRLKELIYGYSRGEVESRLDSWVESR-LGPWD--FEIEPDILNSNVLE  211



>ref|XP_007043613.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOX99444.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=184

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 8/156 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            + K+ERK IEKNRRNH+K+LY+ L SLLP H  +E ++LPDQ+DE V YI+ L+ +L++S
Sbjct  20   SAKIERKIIEKNRRNHMKNLYSRLNSLLPRHTSKEPLSLPDQIDEAVNYIQSLQTRLKES  79

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQ-TEPPEIQVVDTSPGMSVVLINGLESISQF  633
            R+KKE L+ + R    S  C     A     ++ PEI + +T   M VVL+ G +    F
Sbjct  80   REKKESLMGRKR----SHRCTTATAAEAAAVSKSPEISINETDSAMEVVLMTGQDCQFMF  135

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            Y +IR+LH ++G QV NA F + GN+ + + H + R
Sbjct  136  YEMIRILH-EEGAQVLNANFSVLGNTIVHIVHAEQR  170



>ref|XP_007043611.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX99442.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=217

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 100/155 (65%), Gaps = 8/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            + K+ERK IEKNRRNH+K+LY+ L SLLP H  +E ++LPDQ+DE V YI+ L+ +L++S
Sbjct  20   SAKIERKIIEKNRRNHMKNLYSRLNSLLPRHTSKEPLSLPDQIDEAVNYIQSLQTRLKES  79

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQ-TEPPEIQVVDTSPGMSVVLINGLESISQF  633
            R+KKE L+ + R    S  C     A     ++ PEI + +T   M VVL+ G +    F
Sbjct  80   REKKESLMGRKR----SHRCTTATAAEAAAVSKSPEISINETDSAMEVVLMTGQDCQFMF  135

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            Y +IR+LH ++G QV NA F + GN+ + + H ++
Sbjct  136  YEMIRILH-EEGAQVLNANFSVLGNTIVHIVHAEI  169



>ref|XP_007043612.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOX99443.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=221

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 100/159 (63%), Gaps = 12/159 (8%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH------QERMALPDQLDETVKYIKCLENQ  822
            + K+ERK IEKNRRNH+K+LY+ L SLLP H      QE ++LPDQ+DE V YI+ L+ +
Sbjct  20   SAKIERKIIEKNRRNHMKNLYSRLNSLLPRHTSKWILQEPLSLPDQIDEAVNYIQSLQTR  79

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ-TEPPEIQVVDTSPGMSVVLINGLES  645
            L++SR+KKE L+ + R    S  C     A     ++ PEI + +T   M VVL+ G + 
Sbjct  80   LKESREKKESLMGRKR----SHRCTTATAAEAAAVSKSPEISINETDSAMEVVLMTGQDC  135

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               FY +IR+LH ++G QV NA F + GN+ + + H ++
Sbjct  136  QFMFYEMIRILH-EEGAQVLNANFSVLGNTIVHIVHAEI  173



>ref|XP_011100438.1| PREDICTED: uncharacterized protein LOC105178626 [Sesamum indicum]
Length=222

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 128/235 (54%), Gaps = 45/235 (19%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER----MALPDQLDETVKYIKCLEN  825
            K  AP++ERK IEKNRRN +K L ++L SLLP H  +    + LP Q+DE V+YI+ ++ 
Sbjct  18   KLTAPRIERKVIEKNRRNRMKGLCSNLISLLPNHTSKQLKGLPLPYQIDEAVEYIQSMKM  77

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++E+ RQKKE L  ++R      +C+N   +      P  ++V D  P + V++ NGL  
Sbjct  78   RVEEMRQKKESLFARNR----CDACKNQTTS----KSPTLVEVHDMGPNLDVIIANGLND  129

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFF  465
             S F  IIR +H Q G++V +A+F   GNS +Q+  +                       
Sbjct  130  -STFRDIIRFVH-QHGVEVASASFSRDGNSAVQILQD-----------------------  164

Query  464  QVGKSEMGM----IAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNL-GFPV  315
            +VGKS++      I+ +LK ++ G    E + S+ LN WD  Y+IE D++ GF +
Sbjct  165  KVGKSKLSFGGQTISRKLKELVCGASTSEVMVSQ-LNLWD--YEIESDDIWGFEI  216



>gb|KHG07347.1| Transcription factor bHLH36 -like protein [Gossypium arboreum]
Length=212

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 13/159 (8%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLEN  825
            ++  + K+ERK IEKNRRNH+K+LY+ L SLLP HQ   E ++LPDQ+DE VKYIK L+ 
Sbjct  17   SRCSSAKVERKIIEKNRRNHMKNLYSMLNSLLP-HQNSKEPLSLPDQVDEAVKYIKRLQT  75

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            +L++SR++KE L+ ++R    S  C      + + T+P EI++ +    M V L+ G  S
Sbjct  76   KLKESRERKESLMGRTR----SYKC----TQSNDSTKPAEIRINEKGSAMEVALMTGPGS  127

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               FY +IR+ H + G  V NA F + GN+   + H ++
Sbjct  128  QYMFYEMIRIFH-EDGAHVLNANFWVVGNTIFHIVHAEI  165



>ref|XP_006366312.1| PREDICTED: uncharacterized protein LOC102597943 [Solanum tuberosum]
Length=227

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 127/235 (54%), Gaps = 29/235 (12%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-MALPDQLDETVKYIKCLENQLEKSR  807
             PK+ERKY+EKNRRN++K+LY  L SL+P  +E  MA+PDQ+D  V YI+ L+  LE + 
Sbjct  13   GPKMERKYVEKNRRNYMKNLYNQLHSLIPTSKETIMAVPDQIDAAVNYIENLKMNLEMNN  72

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            +  EEL    ++    +   N          PP+I+  +  P + VVLI GL++I+ F  
Sbjct  73   KHLEELKMGLKR----AQSENQTDPGSTTKSPPQIEFHEMGPKIVVVLIIGLDNIATFNN  128

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSE  447
            IIR+ +  +G++V +  F+++GNSTLQ+ H+      I  S   +FI             
Sbjct  129  IIRLCY-VEGVEVVSTRFELNGNSTLQICHQTK----INRSSTMEFIGT-----------  172

Query  446  MGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQCQNP  282
               + +++K +I G   G  +ES+ L+ WD  Y IE D L +  L       QNP
Sbjct  173  --NLCDKVKELIYGPSHGNDVESQ-LHLWD--YKIEFDTLEYYFLPTI---SQNP  219



>ref|XP_006366311.1| PREDICTED: uncharacterized protein LOC102596975 [Solanum tuberosum]
Length=238

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 133/244 (55%), Gaps = 28/244 (11%)
 Frame = -2

Query  998  TTKTPA-PKLERKYIEKNRRNHLKSLYTDLFSLLPA---HQERMALPDQLDETVKYIKCL  831
            ++  PA  KLERK +EK RRN++K++   L+SL+P+    QE M L D++D  +KYIK  
Sbjct  7    SSSGPARAKLERKDVEKTRRNYMKNICNQLYSLIPSTHLSQETMGLQDKIDAAIKYIKSS  66

Query  830  ENQLEKSRQKKEELLQ-KSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            E +LEKS+   EEL +  SRK P SS+  +    + + T  P+IQ  +  P M VVLI G
Sbjct  67   EMKLEKSKMYLEELSRMSSRKRPKSSNSTDGPSPSIKST--PQIQFHEMGPNMVVVLICG  124

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*P  474
            L++I+ F  IIR L  ++G++V    F ++GNS LQ++HE    +   + C    + D  
Sbjct  125  LDNIATFNNIIR-LCNEEGVEVVYTNFTLNGNSMLQISHETKINMSSTMECRAANLCD--  181

Query  473  GFFQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQ  294
                           +LK ++ G      +ES+ L+ WD  Y +E + LGF  +E     
Sbjct  182  ---------------KLKELLYGKSNDNEMESQ-LHLWD--YIVESELLGFNDVEFLPST  223

Query  293  CQNP  282
             QNP
Sbjct  224  SQNP  227



>ref|XP_004248474.1| PREDICTED: uncharacterized protein LOC101259680 [Solanum lycopersicum]
Length=233

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 131/243 (54%), Gaps = 26/243 (11%)
 Frame = -2

Query  998  TTKTPAP-KLERKYIEKNRRNHLKSLYTDLFSLLPA-HQER--MALPDQLDETVKYIKCL  831
            ++  PA  KLERK +EKNRRN++K+L   L+SL+P+ H  R  M L D++D  +KYIK  
Sbjct  7    SSSAPAGVKLERKDVEKNRRNYMKNLCNQLYSLIPSTHHSRETMGLQDKIDAAIKYIKSS  66

Query  830  ENQLEKSRQKKEELLQKS-RKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            E +LEK +   E+L + S RK P SS+  N    +   +  P+IQ  +  P M VVLI+G
Sbjct  67   EMKLEKKKIHLEKLSRLSGRKRPKSSNSTNGPSPSTGLSSSPQIQFHEMGPNMVVVLISG  126

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*P  474
            L++I+ F  IIR+ H  +G++V  A F ++GNS LQ++HE    +   + C    + D  
Sbjct  127  LDNIATFNNIIRLCH-DEGVEVVYANFTLNGNSMLQISHETKINMSSTMECRAANLCD--  183

Query  473  GFFQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQ  294
                           +LK ++ G      +ES+ L  WD  Y +E + L F  +E     
Sbjct  184  ---------------KLKELLHGKSYDNELESQ-LYLWD--YIVESELLKFYDVEFLPST  225

Query  293  CQN  285
             QN
Sbjct  226  SQN  228



>emb|CDP14799.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 126/227 (56%), Gaps = 37/227 (16%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            T   K E++  EKNRRNH K+LY+ L+SLLP+   +E + +PD++ E + YIK +E +LE
Sbjct  8    TSNSKPEKRIKEKNRRNHFKNLYSQLYSLLPSDISKEVLPVPDKIGEVINYIKSMERKLE  67

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
              +Q KE+LL   R+  ++ S           +E   ++V D  P   ++LI+GL+  + 
Sbjct  68   NYKQMKEKLLGSKRRYSSTKS-----------SELTNVKVHDMGPDTDMILISGLKEPAS  116

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVG  456
            FYGII +L +++G +V NA F   GNS LQV HE+     I  S          G  ++ 
Sbjct  117  FYGIIHLL-QEEGFEVVNANFSNDGNSMLQVVHEKGG---ISTSS--------TGTIEIA  164

Query  455  KSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNL--GF  321
            K       ERLK +I G   GE +ES  ++SWD  +++E D L  GF
Sbjct  165  K------RERLKELIYGYSHGE-VES-TVDSWD--FEVEPDLLASGF  201



>gb|KDO53897.1| hypothetical protein CISIN_1g027547mg [Citrus sinensis]
Length=222

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 105/194 (54%), Gaps = 22/194 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK IEKNRR+ +K+LY+ L SLLP    +E ++LPDQ+DE + YIK LE +L++ ++
Sbjct  26   KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK  85

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            +KE L  + R     S             + PEI++ +    + V+L +G++    FY +
Sbjct  86   RKESLQGRERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQFIFYEV  145

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEM  444
            IR+LH Q G ++ NA F + GN+   V H ++R                   F  G ++ 
Sbjct  146  IRILH-QDGAEILNAKFSVVGNTIFHVIHAEIR----------------DSMFGFGAAK-  187

Query  443  GMIAERLKVVIKGC  402
              I+ERLK  + GC
Sbjct  188  --ISERLKGFVSGC  199



>ref|XP_011002885.1| PREDICTED: transcription factor bHLH118-like isoform X4 [Populus 
euphratica]
Length=214

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 99/153 (65%), Gaps = 8/153 (5%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +E+NRRN +KSLY++L SLLP    +E   LPDQ+D  + YIK LE +LEK+R+
Sbjct  23   KTERKIVERNRRNQMKSLYSNLNSLLPNRNFKEAQPLPDQIDRAINYIKSLEEKLEKARE  82

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L  +SRK   S +C    P +   ++ P++++ +    + +VL +GL++   FY I
Sbjct  83   KKESL--RSRK--RSYTC-TFDPISSAASKSPQLKIHEIGSALEIVLTSGLDNQFLFYEI  137

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V +A FQ  G+S   + H Q++
Sbjct  138  ISILH-EEGVEVVSANFQALGDSLFHIVHAQMK  169



>gb|KDP24116.1| hypothetical protein JCGZ_25773 [Jatropha curcas]
Length=228

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            + K ERK IEKNRRN +K+L+++L SLLP    +E + LPDQ+DE + YIK LE +L+KS
Sbjct  34   STKTERKVIEKNRRNQMKTLFSNLNSLLPKENAKEALPLPDQIDEAINYIKSLEARLKKS  93

Query  809  RQKKEELLQKSRKTPN-SSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
            ++KKE L  K R   + S+SC +         + P++Q+ +    + + LI+GL++   F
Sbjct  94   QEKKERLSSKKRSFSDYSNSCEST-----STLKAPQLQIREVGSALQITLISGLDNQFLF  148

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGK  453
              +IR+L  ++ +++ NA+F +  +S   V H Q+R             SD    F  G 
Sbjct  149  CEMIRILQ-EENVEIVNASFSVAASSIFHVVHAQMRE------------SD----FMFGG  191

Query  452  SEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGF  321
            ++   ++ERL  +I G      IE EP   WD N D+  +  GF
Sbjct  192  AK---VSERLNRLINGSTS--EIELEP-ELWDFN-DLNPETWGF  228



>ref|XP_010327075.1| PREDICTED: uncharacterized protein LOC104649466 [Solanum lycopersicum]
Length=226

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 121/240 (50%), Gaps = 32/240 (13%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-MALPDQLDETVKYIKCLENQLEKSR  807
             PK+ERKY+EKNRRN++K LY  L SL+P  +E  M +PDQ+D  V YI+ L+  LE + 
Sbjct  13   GPKIERKYVEKNRRNYMKKLYNQLHSLIPTSKETIMTVPDQIDAAVNYIENLKMNLEMNN  72

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            +  EEL    +K  + +      P    Q   P+I+  +  P M VVLI  L +I+ F  
Sbjct  73   KYLEELKMGLKKAQSFNPTNEPGPITKSQ---PQIEFHEMGPNMVVVLITSLNNIATFNN  129

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSE  447
            IIR+ +  +G++V +  F+++GNSTLQ++HE  +                        S 
Sbjct  130  IIRLCY-VEGVEVVSTRFELNGNSTLQISHETTKI--------------------NRSSA  168

Query  446  MGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGFPVLEQFLVQCQNPPPSFF  267
            M +I   L   +K    G +     L+ WD  Y IE     F  LE +L+  ++  P+ +
Sbjct  169  MELIGTNLCDKMKELIYGPSYMESQLHLWD--YKIE-----FDTLEYYLLPTRSKNPNMY  221



>gb|KCW47227.1| hypothetical protein EUGRSUZ_K01037 [Eucalyptus grandis]
Length=215

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 115/212 (54%), Gaps = 35/212 (17%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQLEKSR  807
            + ERK IEKNRRN +K LY+ L SLLP+    QE  +LPDQ+DE ++YIK LE  +++++
Sbjct  24   RTERKIIEKNRRNRMKHLYSVLNSLLPSQPSAQEAKSLPDQIDEAIRYIKGLETAVKEAK  83

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
             KKE L+ K R +P++SS  N + A    +   EI+V D+S  + V L +GL     F  
Sbjct  84   DKKENLMGKKRPSPSTSS--NTLAAI--TSAKIEIRVRDSS--LEVTLTSGLHDKFIFSE  137

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSE  447
            I+R+LH+++ ++V N  F + GNS   + H                        ++G+S 
Sbjct  138  ILRILHEEK-VEVLNVNFSVVGNSVYHLVHA-----------------------KIGESA  173

Query  446  MG--MIAERLKVVIKGCPGGEAIESEPLNSWD  357
            +G  MI++RLK  + G       E    N WD
Sbjct  174  LGAAMISQRLKTFVYGAATDGGHEEFHPNLWD  205



>ref|XP_011037352.1| PREDICTED: transcription factor bHLH118-like [Populus euphratica]
Length=224

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 102/154 (66%), Gaps = 9/154 (6%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK IEKNRRN +K+LY+ L SLLP    +E   LPDQ+DE + +IK LE +L+K+R+
Sbjct  24   KTERKVIEKNRRNQMKTLYSKLNSLLPNQNFKEPQPLPDQIDEAISHIKSLEEKLKKARE  83

Query  803  KKEELLQKSRKTPNSSSCR-NCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            KKE  L  SRK   S +C  +  P A  ++  P++++ +    + +VL +G+++   FY 
Sbjct  84   KKEG-LTSSRK--RSYTCTYDPTPIAAPKS--PQLKIQELGSALEIVLTSGIDNQFLFYE  138

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            IIR+LH ++G++V +A FQ+ G+S  QV H Q++
Sbjct  139  IIRILH-EEGVEVVSANFQVLGDSIFQVLHAQMK  171



>ref|XP_011002883.1| PREDICTED: transcription factor bHLH118-like isoform X2 [Populus 
euphratica]
 ref|XP_011002884.1| PREDICTED: transcription factor bHLH118-like isoform X3 [Populus 
euphratica]
Length=216

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +E+NRRN +KSLY++L SLLP    +E   LPDQ+D  + YI  LE +LEK+R+
Sbjct  23   KTERKIVERNRRNQMKSLYSNLNSLLPNRNFKEAQPLPDQIDRAINYINSLEEKLEKARE  82

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE  L +SRK   S +C    P +   ++ P++++ +    + +VL +G+++   FY I
Sbjct  83   KKES-LARSRK--GSYTC-TFDPISSAASKSPQLKIHEIGSALEIVLTSGIDNQFLFYEI  138

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V +A FQ  G+S   + H Q++
Sbjct  139  ISILH-EEGVEVVSANFQALGDSFFHIVHAQMK  170



>ref|XP_011002882.1| PREDICTED: transcription factor bHLH118-like isoform X1 [Populus 
euphratica]
Length=239

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +E+NRRN +KSLY++L SLLP    +E   LPDQ+D  + YI  LE +LEK+R+
Sbjct  46   KTERKIVERNRRNQMKSLYSNLNSLLPNRNFKEAQPLPDQIDRAINYINSLEEKLEKARE  105

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE  L +SRK   S +C    P +   ++ P++++ +    + +VL +G+++   FY I
Sbjct  106  KKES-LARSRK--GSYTC-TFDPISSAASKSPQLKIHEIGSALEIVLTSGIDNQFLFYEI  161

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V +A FQ  G+S   + H Q++
Sbjct  162  ISILH-EEGVEVVSANFQALGDSFFHIVHAQMK  193



>ref|XP_010260225.1| PREDICTED: transcription factor bHLH36-like [Nelumbo nucifera]
Length=181

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 94/156 (60%), Gaps = 9/156 (6%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
              + K +RK +E+NRRNH+K+LY++L SL+P H  +E M+LPDQL+E   YIK L+ +LE
Sbjct  6    NASSKTDRKTVERNRRNHMKNLYSELNSLIPNHSSKETMSLPDQLNEAANYIKKLQRKLE  65

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            + ++KKE L+  ++ + + SS            + P I++ D    + VVL +GL+    
Sbjct  66   RMKEKKENLMGINKLSRSISSGMMV------GVKSPHIEIHDMGSALHVVLTSGLDQQFM  119

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            FY ++R+LH ++G Q+ NA F I  +      H ++
Sbjct  120  FYEVVRLLH-EEGAQIVNANFSIIDDMIFHTVHSEI  154



>ref|XP_002274262.2| PREDICTED: transcription factor bHLH36-like [Vitis vinifera]
 emb|CBI21863.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +EKNRRN +K+LY+ L SLLP  + +E  ++PDQ+DE V YIK L+  LEK ++
Sbjct  21   KAERKIVEKNRRNLMKNLYSKLNSLLPDQSSKEAQSIPDQVDEAVSYIKSLQGNLEKLKE  80

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEP----PEIQVVDTSPGMSVVLINGLESISQ  636
            KKE L+  SRK P++ S      + GE + P    P +++ +    + V L+ GLE  S 
Sbjct  81   KKESLMS-SRKRPHTCST----TSVGETSTPSLRSPVMEIREMGSNLQVTLVTGLEDQSI  135

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            FY II +LH++   +V +A+F + GNS   V   QV
Sbjct  136  FYDIIGILHEESA-EVLSASFSVVGNSAFHVLIAQV  170



>ref|XP_003635365.2| PREDICTED: transcription factor bHLH36 [Vitis vinifera]
Length=154

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRNH+KSLY+ L SL+P HQ   E + LPDQLDE   YIK L+ +LEK
Sbjct  7    SSRTDRKTIERNRRNHMKSLYSKLNSLVP-HQTSREAITLPDQLDEAANYIKRLQEKLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQT--EPPEIQVVDTSPGMSVVLINGLESIS  639
             +++K+ L+   R  PN+S      P +G     +PP+I + +    + VVLI GL+   
Sbjct  66   MKERKDNLMGFER--PNTS------PNSGAMVGLKPPQIDIHEKGSALEVVLITGLDFQF  117

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   IRVLH ++G ++ NA+F +  ++     H QV
Sbjct  118  MFNETIRVLH-EEGAEIVNASFSVVDDTVFHTIHAQV  153



>gb|KDO53898.1| hypothetical protein CISIN_1g027547mg [Citrus sinensis]
Length=179

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK IEKNRR+ +K+LY+ L SLLP    +E ++LPDQ+DE + YIK LE +L++ ++
Sbjct  26   KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK  85

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            +KE L  + R     S             + PEI++ +    + V+L +G++    FY +
Sbjct  86   RKESLQGRERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQFIFYEV  145

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
            IR+LH Q G ++ NA F + GN+   V H +V +
Sbjct  146  IRILH-QDGAEILNAKFSVVGNTIFHVIHAEVCY  178



>emb|CAN61967.1| hypothetical protein VITISV_010916 [Vitis vinifera]
Length=174

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRNH+KSLY+ L SL+P HQ   E + LPDQLDE   YIK L+ +LEK
Sbjct  7    SSRTDRKTIERNRRNHMKSLYSKLNSLVP-HQTSREAITLPDQLDEAANYIKRLQEKLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQT--EPPEIQVVDTSPGMSVVLINGLESIS  639
             +++K+ L+   R  PN+S      P +G     +PP+I + +    + VVLI GL+   
Sbjct  66   MKERKDNLMGFER--PNTS------PNSGAMVGLKPPQIDIHEKGSALEVVLITGLDFQF  117

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   IRVLH ++G ++ NA+F +  ++     H QV
Sbjct  118  MFNETIRVLH-EEGAEIVNASFSVVDDTVFHTIHAQV  153



>emb|CDP14797.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 95/156 (61%), Gaps = 14/156 (9%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            T   K E++  EK+RR+  K+LY+ L+SLLP+   +E + +PD++ E + YIK +E +LE
Sbjct  8    TSNSKPEKRIKEKDRRHRFKNLYSQLYSLLPSDSSKEVLPVPDKIGEAINYIKSMERKLE  67

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
              +Q KE+LL   R+  +  S           +E   ++V D  P   ++LI+GL+  + 
Sbjct  68   NYKQMKEKLLCGRRRYSSIKS-----------SELMNVEVHDMGPDTDMILISGLKEPAS  116

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            FYG IR+LH ++G +V NA F  +GNS LQV HE+V
Sbjct  117  FYGKIRLLH-EEGFEVVNANFSNNGNSMLQVVHEKV  151



>emb|CBI33238.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 94/156 (60%), Gaps = 15/156 (10%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRNH+KSLY+ L SL+P HQ   E + LPDQLDE   YIK L+ +LEK
Sbjct  7    SSRTDRKTIERNRRNHMKSLYSKLNSLVP-HQTSREAITLPDQLDEAANYIKRLQEKLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQT--EPPEIQVVDTSPGMSVVLINGLESIS  639
             +++K+ L+   R  PN+S      P +G     +PP+I + +    + VVLI GL+   
Sbjct  66   MKERKDNLMGFER--PNTS------PNSGAMVGLKPPQIDIHEKGSALEVVLITGLDFQF  117

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             F   IRVLH ++G ++ NA+F +  ++     H Q
Sbjct  118  MFNETIRVLH-EEGAEIVNASFSVVDDTVFHTIHAQ  152



>ref|XP_007198864.1| hypothetical protein PRUPE_ppa018357mg [Prunus persica]
 gb|EMJ00063.1| hypothetical protein PRUPE_ppa018357mg [Prunus persica]
Length=208

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 118/216 (55%), Gaps = 29/216 (13%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQ  822
            +++ + K+ER+ IEKNRRN +K LY+ L SLLP    QE ++LPDQ+DE + YIK LE +
Sbjct  7    SQSSSTKVERRVIEKNRRNQMKVLYSKLNSLLPRQNSQEPLSLPDQIDEAINYIKSLETK  66

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            L+KS++K++ L  K +K  + ++C N    +   ++PP+I++ +    + VVLI+GL++ 
Sbjct  67   LQKSKEKRDSL--KGKKKRSHTACTNF--DSMRCSKPPQIEIHEMGSTLEVVLISGLDNH  122

Query  641  S-QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFF  465
               F  IIR++H++Q   V +A+    G+S   V   +V   +I                
Sbjct  123  QFMFTEIIRIVHEEQA-DVVHASLSTLGDSIFHVIRAEVGKSMIDFGA------------  169

Query  464  QVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
                     I E+L+  + G    E ++ E L  WD
Sbjct  170  -------AKITEKLRRFVNGSTSDEELQREYL--WD  196



>ref|XP_002509465.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF50852.1| DNA binding protein, putative [Ricinus communis]
Length=210

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 93/150 (62%), Gaps = 7/150 (5%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQKK  798
            +RK IE+NRRN +K+LY+ L SL+P H  R  ++LPDQLDE   YIK L+ +LEK +++K
Sbjct  39   DRKTIERNRRNQMKALYSQLNSLVPHHSSRESVSLPDQLDEAANYIKKLQIKLEKMKERK  98

Query  797  EELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIR  618
            + L+   R  PN+S+   C   AG +   P+I+V      + VVL+ GL+    F   IR
Sbjct  99   DSLMGIER--PNASA--GCSTRAGMRLRSPQIEVNGIGSALEVVLVTGLDCQFLFNETIR  154

Query  617  VLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            +L +++G ++ NATF +  ++   + H +V
Sbjct  155  IL-QEEGAEIVNATFSVLDDTVFHIIHSKV  183



>ref|XP_002305793.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE86304.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=162

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 90/158 (57%), Gaps = 7/158 (4%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K LY+ L SL+P    R   +++PDQLDE   YIK L+  LEK
Sbjct  7    SSRTDRKLIERNRRNQMKELYSQLNSLVPHQSSREPVLSVPDQLDEAASYIKRLQTNLEK  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK+ L+   R      +C+N           P+I+V +    + VVL+NGL+S   F
Sbjct  67   MKEKKDSLMGMERA---DYTCKNSSGGKTAGLRSPQIEVSEMGSTLEVVLMNGLDSRFMF  123

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWL  519
              IIRVLH ++G ++ NA+  +  ++     H +V  L
Sbjct  124  IEIIRVLH-EEGAEIINASLSVVQDTVFHTIHSKVYQL  160



>ref|XP_003540366.1| PREDICTED: transcription factor bHLH36-like [Glycine max]
 gb|KHN27898.1| Transcription factor bHLH36 [Glycine soja]
Length=222

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 115/213 (54%), Gaps = 28/213 (13%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK +EKNRR+ +K+LY++L SLLP    +E M+LPDQ+DE + YIK LE +++  ++
Sbjct  14   KVERKIVEKNRRSQMKNLYSELNSLLPTRNPKEAMSLPDQIDEAINYIKSLETKVKLEQE  73

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L ++ R       C +   A G   + P IQ+ +T   + V+L  G++S   F  I
Sbjct  74   KKERLKERKR---TRGGCSSSSEAQG-SLKSPNIQIHETGNLLEVILTCGVDSQFMFCEI  129

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEM  444
            IR+LH ++ ++V NA   + G+  + V H +V                 P  +Q G ++ 
Sbjct  130  IRILH-EENVEVINANSSMVGDLVIHVVHGEVE----------------PSIYQFGATK-  171

Query  443  GMIAERLKVVIKGCPGGEAIESEPLNSWDNNYD  345
              ++E+LK  + G      +E EP   W+   D
Sbjct  172  --VSEKLKWFMNGSFSD--VEMEPELMWNFKID  200



>ref|XP_010091496.1| hypothetical protein L484_010338 [Morus notabilis]
 gb|EXB44647.1| hypothetical protein L484_010338 [Morus notabilis]
Length=218

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 122/227 (54%), Gaps = 32/227 (14%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQ  822
            +++ A K+ER+ IEKNRRN +K LY+ L SLLP    +E   LPDQ+DE + +IK LE +
Sbjct  22   SQSSATKIERRIIEKNRRNQMKVLYSKLNSLLPPQNSKEVQTLPDQVDEAINHIKSLEAR  81

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            L+K ++KK+ LL + R    S +C N + + G Q   P+I++ +    + VVLI GL++ 
Sbjct  82   LKKYKEKKKSLLGRKR----SYTCANSLESVGSQ-RSPQIEIHEIGSVIEVVLITGLDNQ  136

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQ  462
              FY +IR+LH+++   V +A + +  +S   V H ++                    F 
Sbjct  137  FIFYELIRILHEERA-DVVDAKYSVSRDSIFHVVHAEIA----------------DSIFG  179

Query  461  VGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGF  321
              K     I+ERLK  + G      IE +P   WD +++I  + L F
Sbjct  180  ATK-----ISERLKRFVSGSSSD--IELQPDQWWD-DFEIHPELLKF  218



>ref|XP_011043394.1| PREDICTED: uncharacterized protein LOC105138874 [Populus euphratica]
Length=182

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 92/155 (59%), Gaps = 8/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERM---ALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K+LY+ L SL+P    R    +LPDQLD+   YIK L+  LE+
Sbjct  7    SSRTDRKTIERNRRNQMKALYSQLNSLVPHQSSREPVPSLPDQLDDAASYIKRLQTNLER  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KKE L+   R   N +S  +C    G ++  P+I+V +T   + VVLI GL+S   F
Sbjct  67   MKEKKENLMGTERT--NYASMSSCNGTTGLRS--PQIEVRETGSTLEVVLITGLDSQFMF  122

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               IRVLH ++G ++ NA F +  ++     H +V
Sbjct  123  NETIRVLH-EEGAEIINANFSVVEDTVFHTIHSKV  156



>gb|EYU24919.1| hypothetical protein MIMGU_mgv1a025903mg [Erythranthe guttata]
Length=216

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 97/155 (63%), Gaps = 13/155 (8%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLEN  825
            + + AP++ERK  EKNRRN +K L+++L SLLP H    E + +PDQ+DE V+YIK ++ 
Sbjct  12   SSSSAPRIERKITEKNRRNQMKLLFSNLTSLLPHHTSKVEGLPVPDQIDEAVEYIKSMKT  71

Query  824  QLEKSRQKKEELLQKSRKTPNSSSC-RNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
            +LE+  +K       S K P    C ++    + E+T  P ++V +  P + VVL  GL+
Sbjct  72   KLEEMSRK------DSLKLPRKEYCDQDQTTTSIEKT--PLVEVHNMGPNIDVVLAKGLK  123

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQV  543
              S F+ IIR+LH+ + ++V +ATF   GNST+Q+
Sbjct  124  DFSTFHDIIRMLHRHE-VEVASATFARCGNSTIQI  157



>ref|XP_010035765.1| PREDICTED: transcription factor bHLH94-like [Eucalyptus grandis]
 gb|KCW47228.1| hypothetical protein EUGRSUZ_K01038 [Eucalyptus grandis]
Length=217

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 111/212 (52%), Gaps = 33/212 (16%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQLEKSR  807
            + ERK IEKNRRN +K LY+ L SLLP+    QE  +LPDQ+DE + YIK LE  +++++
Sbjct  24   RTERKIIEKNRRNRMKHLYSVLNSLLPSQPSSQEAKSLPDQIDEAILYIKGLEKAVKEAK  83

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
             KKE L+ K R +P+ S   N +    E  + P+I++      + V+L +GL     F  
Sbjct  84   DKKENLMGKKRPSPSPSPSSNTL----EAIKSPQIEIGVRDSSLEVILTSGLHDQFIFLE  139

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSE  447
            I+R+LH+++ ++V NA F +  NS   + H                        ++G+S 
Sbjct  140  ILRMLHEEK-VEVLNANFSVVENSVYHLVHA-----------------------KIGESG  175

Query  446  MG--MIAERLKVVIKGCPGGEAIESEPLNSWD  357
            +G  MIAERLK ++ G       E      WD
Sbjct  176  LGAVMIAERLKTLVNGSATDGGPEEFYPKLWD  207



>ref|XP_010038678.1| PREDICTED: transcription factor bHLH99-like [Eucalyptus grandis]
 gb|KCW47229.1| hypothetical protein EUGRSUZ_K01039 [Eucalyptus grandis]
Length=215

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 114/216 (53%), Gaps = 35/216 (16%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQL  819
            + + + ERK IEKNRRN +K LY+ L SLLP+    QE  +LPDQ+DE +KYIK LE  +
Sbjct  20   STSRRTERKIIEKNRRNRMKHLYSVLNSLLPSQPSDQEARSLPDQIDEAIKYIKGLETAV  79

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            ++++ KKE  + K R +P++SS      +  E  + P+I++      + V+L +GL    
Sbjct  80   KEAKDKKENRMGKKRPSPSTSS------STLEAVKSPQIEIRVRDSSLEVILTSGLHDQF  133

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  I+R+LH+++ ++V NA F + GNS   + H                        ++
Sbjct  134  IFSEILRMLHEEE-VEVMNANFSVVGNSVYHLVHA-----------------------KI  169

Query  458  GKSEMG--MIAERLKVVIKGCPGGEAIESEPLNSWD  357
            G+S +G  MI+ERLK  + G       E      WD
Sbjct  170  GESSLGAAMISERLKTFVNGSAADGGHEEFHPKLWD  205



>ref|XP_008228998.1| PREDICTED: transcription factor bHLH36-like [Prunus mume]
Length=224

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 120/221 (54%), Gaps = 39/221 (18%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQ  822
            +++ + K+ER+ IEKNRRN +K LY+ L SLLP    QE  +LPDQ+DE + YIK LE++
Sbjct  23   SQSSSTKVERRVIEKNRRNQMKVLYSKLNSLLPRQNSQEPPSLPDQIDEAINYIKSLESK  82

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            L+KS++K++ L  K  +  + ++C N    +   ++PP+I++ +    + VVLI+GL++ 
Sbjct  83   LQKSKEKRDSL--KGNRKRSHTACTNF--DSMRSSKPPQIEIHEIGSTLEVVLISGLDN-  137

Query  641  SQFY--GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGF  468
             QF    IIR+LH++Q   V +A+    G+S   V                         
Sbjct  138  HQFMLTEIIRILHEEQA-DVVHASLSTLGDSIFHVIRA----------------------  174

Query  467  FQVGKSEMGM----IAERLKVVIKGCPGGEAIESEPLNSWD  357
             ++GKS +      I E+L+  + G    E ++ E L  WD
Sbjct  175  -EMGKSMLDFGAAKITEKLRRFVDGSTSDEELQREYL--WD  212



>ref|XP_006469875.1| PREDICTED: transcription factor bHLH36-like [Citrus sinensis]
Length=222

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 105/194 (54%), Gaps = 22/194 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK IEKNRR+ +K+LY+ L SLLP    +E ++LPDQ+DE + YIK LE +L++ ++
Sbjct  26   KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK  85

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L  + R     S             + PEI++ +    + V+L +G++    FY +
Sbjct  86   KKESLQGRERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQFIFYDV  145

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEM  444
            IR+LH Q G ++ NA F + GN+   V H ++R                   F  G ++ 
Sbjct  146  IRILH-QDGAEILNANFSVVGNTIFHVIHAEIR----------------DSMFGFGAAK-  187

Query  443  GMIAERLKVVIKGC  402
              I+ERLK  + GC
Sbjct  188  --ISERLKGFVSGC  199



>ref|XP_007149840.1| hypothetical protein PHAVU_005G102800g [Phaseolus vulgaris]
 gb|ESW21834.1| hypothetical protein PHAVU_005G102800g [Phaseolus vulgaris]
Length=196

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 101/154 (66%), Gaps = 6/154 (4%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            + +++RK +EKNRRNH+K+LY++L SLLP++  ++ +ALPDQ+DE  +YIK LE ++  +
Sbjct  11   STRVDRKIVEKNRRNHMKNLYSELNSLLPSYNPKQVVALPDQIDEATEYIKSLEAKVRMA  70

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++KKE L+ + ++T +  S      A G   +PP++++ +T   + V+L  G++    F 
Sbjct  71   KEKKERLIMERKRTRSGFSSD--FEARG-NLKPPKMEIHETGSVLRVILTCGIDDHFVFC  127

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IIR+LH ++ + V N ++ + G+S + V   +V
Sbjct  128  EIIRILH-EENVDVINTSYSVVGDSVIHVVLGEV  160



>ref|XP_006377370.1| hypothetical protein POPTR_0011s05320g [Populus trichocarpa]
 gb|ERP55167.1| hypothetical protein POPTR_0011s05320g [Populus trichocarpa]
Length=235

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 90/156 (58%), Gaps = 9/156 (6%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K+LY+ L SL+P    R   ++LPDQLDE   YIK L+  LE+
Sbjct  59   SSRTDRKTIERNRRNQMKALYSQLNSLVPHQSSREPVLSLPDQLDEAASYIKRLQTNLER  118

Query  812  SRQKKEELLQKSRKTPNS-SSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
             ++KK+ L+   RK   S SSC             P+I++ +T   + VVLI GL+    
Sbjct  119  MKEKKDNLMGTERKNYASMSSCNGTTTG----LRSPQIEIRETGSTLEVVLITGLDGQFM  174

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            F   IRVLH ++G ++ NA+F +  ++     H +V
Sbjct  175  FNETIRVLH-EEGAEIINASFSVVEDTVFHTIHSKV  209



>ref|XP_006447292.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
 gb|ESR60532.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
Length=241

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 105/194 (54%), Gaps = 22/194 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK IEKNRR+ +K+LY+ L SLLP    +E ++LPDQ+DE + YIK LE +L++ ++
Sbjct  45   KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK  104

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L  + R     S             + PEI++ +    + V+L +G++    FY +
Sbjct  105  KKESLQGRERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQFIFYDV  164

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEM  444
            IR+LH Q G ++ NA F + GN+   V H ++R                   F  G ++ 
Sbjct  165  IRILH-QDGAEILNANFSVVGNTIFHVIHAEIR----------------DSMFGFGAAK-  206

Query  443  GMIAERLKVVIKGC  402
              I+ERLK  + GC
Sbjct  207  --ISERLKGFVSGC  218



>ref|XP_009619775.1| PREDICTED: transcription factor bHLH55-like [Nicotiana tomentosiformis]
Length=183

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 108/199 (54%), Gaps = 28/199 (14%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQL  819
            + + K +RK IEKNRRN +K+LY  L SL+P  Q   E ++LPDQL+E + YIK L+  L
Sbjct  10   SSSSKADRKTIEKNRRNQMKALYLKLHSLVPNQQHSREVLSLPDQLEEAINYIKRLQIDL  69

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            E+  QKK+ L    ++  NSSS  +C    G      EI  VD++  + VVL  GL+   
Sbjct  70   ERMTQKKDSL----KRGENSSSNSSCGRKTGLSLPHIEIHSVDSA--LQVVLTTGLDYQF  123

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  +IR+LH ++G+QV NA++ +  ++ +   H +      M  C P          Q 
Sbjct  124  IFTDVIRLLH-EEGVQVINASYTLICDTIVHSIHSK------MGECAPD---------QY  167

Query  458  GKSEMGMIAERLKVVIKGC  402
            G +    I+ERLK  + GC
Sbjct  168  GAAR---ISERLKKFVGGC  183



>ref|XP_003540915.1| PREDICTED: transcription factor bHLH36-like [Glycine max]
 gb|KHN35225.1| Transcription factor bHLH36 [Glycine soja]
Length=211

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 124/228 (54%), Gaps = 31/228 (14%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            + + K+ER+ +EKNRRN +K+LY  L SLLP++  +E + LPDQ+DE + YIK LE +++
Sbjct  10   SSSTKVERRLVEKNRRNQMKNLYNKLNSLLPSYNPKEALPLPDQVDEAINYIKSLEAKVK  69

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP--PEIQVVDTSPGMSVVLINGLESI  642
             +++KKE  LQ  RK        N    A     P  P++++ +    + VVL  GL+  
Sbjct  70   MAQEKKEN-LQGIRKRSRGCFSNNSANFAATSGFPKSPQLEIHEVGSSLQVVLTCGLDHQ  128

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQ  462
              FY II++LH ++ ++V +    + G+S L V H ++          P+       F Q
Sbjct  129  FIFYEIIQILH-EENIEVRSVNSSLAGDSVLHVVHAEI----------PQ------SFLQ  171

Query  461  VGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNL-GF  321
             G ++   ++ERLK  + G      +E++P   WD  ++I  D++ GF
Sbjct  172  FGATK---VSERLKRFVNGSCSD--VETQP-ELWD--FEIGTDDMWGF  211



>ref|XP_007132724.1| hypothetical protein PHAVU_011G119500g [Phaseolus vulgaris]
 gb|ESW04718.1| hypothetical protein PHAVU_011G119500g [Phaseolus vulgaris]
Length=208

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 119/223 (53%), Gaps = 26/223 (12%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKS  810
            + K+ER+ +EKNRRN +K L+  L SLLP++  +E + LPDQ+DE + YIK LE +++ +
Sbjct  10   STKVERRLVEKNRRNQMKILFNKLNSLLPSYNPKEVLPLPDQVDEAINYIKSLEAKVKMA  69

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++KKE L    +++    S      AA    + P++++ +    + VVLI G++    F 
Sbjct  70   QEKKESLQGIKKRSHGCFSSSRATFAATRLPKSPQLEIQEVGSSLQVVLITGIDHQFIFC  129

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKS  450
             IIR+LH ++ ++V +A   + G+S L V H ++          P+       F Q+G +
Sbjct  130  EIIRMLH-EENIEVRSANSSLTGDSVLHVVHAEI----------PQ------SFLQLGAA  172

Query  449  EMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNLGF  321
            +   ++ERLK  + G       + E  + W +  +   D  GF
Sbjct  173  K---VSERLKRFVNGSNS----DVETQDEWWDFDNCSDDMWGF  208



>ref|XP_011027821.1| PREDICTED: transcription factor bHLH36-like isoform X2 [Populus 
euphratica]
Length=157

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K LY+ L SL+P    R   +++PDQLDE   YIK L+  LEK
Sbjct  7    SSRTDRKLIERNRRNQMKELYSQLNSLVPHQSSREPVLSVPDQLDEAASYIKRLQTNLEK  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK+ L+   +    S +  +   A       P+I+V++    + VVL+NGL+S   F
Sbjct  67   LKEKKDSLMGMEKADYTSKNSGSGTTAC---LRSPQIKVIEMGSTLEVVLMNGLDSRFMF  123

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IIRVLH ++G ++ NA+  +  ++     H +V
Sbjct  124  NEIIRVLH-EEGAEIINASLSVVEDTVFHTIHSKV  157



>ref|XP_011016116.1| PREDICTED: transcription factor bHLH36-like [Populus euphratica]
Length=171

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K LY+ L SL+P    R   +++PDQLDE   YIK L+  LEK
Sbjct  7    SSRTDRKLIERNRRNQMKELYSQLNSLVPHQSSREPVLSVPDQLDEAASYIKRLQTNLEK  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK+ L+   +    S +  +   A       P+I+V++    + VVL+NGL+S   F
Sbjct  67   LKEKKDSLMGMEKADYTSKNSGSGTTAC---LRSPQIKVIEMGSTLEVVLMNGLDSRFMF  123

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IIRVLH ++G ++ NA+  +  ++     H +V
Sbjct  124  NEIIRVLH-EEGAEIINASLSVVEDTVFHTIHSKV  157



>ref|XP_004294013.1| PREDICTED: transcription factor bHLH36-like [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 86/153 (56%), Gaps = 9/153 (6%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSR  807
            + +RK IEKNRRN +K+LY++L SLLP HQ   E  +LPDQ+D  V YIK L+  LEK R
Sbjct  13   RADRKTIEKNRRNQMKALYSELNSLLPHHQHSREVTSLPDQIDAAVNYIKKLQTNLEKLR  72

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
             KK+  +   R T N +      P        P+I++ +    + VVLI GL+    F G
Sbjct  73   AKKDRHMGVERITNNRNGAYGSGPNG-----SPQIEIREIGSALDVVLITGLDFQFMFEG  127

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IR+L  ++G  + NA+F +  ++     H ++
Sbjct  128  AIRLL-LEEGADIVNASFSVVEDTIFHTIHSKI  159



>ref|XP_011016115.1| PREDICTED: transcription factor bHLH36-like [Populus euphratica]
Length=184

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K LY+ L SL+P    R   +++PDQLDE   YIK L+  LEK
Sbjct  7    SSRTDRKLIERNRRNQMKELYSQLNSLVPHQSSREPVLSVPDQLDEAASYIKRLQTNLEK  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK+ L+   +    S +  +   A       P+I+V++    + VVL+NGL+S   F
Sbjct  67   LKEKKDSLMGMEKADYTSKNSGSGTTAC---LRSPQIKVIEMGSTLEVVLMNGLDSRFMF  123

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IIRVLH ++G ++ NA+  +  ++     H +V
Sbjct  124  NEIIRVLH-EEGAEIINASLSVVEDTVFHTIHSKV  157



>ref|XP_011027820.1| PREDICTED: transcription factor bHLH36-like isoform X1 [Populus 
euphratica]
Length=184

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K LY+ L SL+P    R   +++PDQLDE   YIK L+  LEK
Sbjct  7    SSRTDRKLIERNRRNQMKELYSQLNSLVPHQSSREPVLSVPDQLDEAASYIKRLQTNLEK  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK+ L+   +    S +  +   A       P+I+V++    + VVL+NGL+S   F
Sbjct  67   LKEKKDSLMGMEKADYTSKNSGSGTTAC---LRSPQIKVIEMGSTLEVVLMNGLDSRFMF  123

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IIRVLH ++G ++ NA+  +  ++     H +V
Sbjct  124  NEIIRVLH-EEGAEIINASLSVVEDTVFHTIHSKV  157



>ref|XP_010272432.1| PREDICTED: transcription factor bHLH36-like [Nelumbo nucifera]
Length=178

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 89/156 (57%), Gaps = 14/156 (9%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEK  813
             + K++R+ +EK RRNH+K+LY +L SL+P+H  +E MALPDQ++E   YIK L+ +LE+
Sbjct  7    SSSKVDRRTVEKIRRNHMKNLYAELNSLIPSHGTKETMALPDQIEEATNYIKMLQQKLER  66

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS-Q  636
             ++KK  ++                     + + P I++ D    +  VL++GL+     
Sbjct  67   MKEKKASIM----------GLEGITSGMMVRAKSPHIEIHDMGSALQAVLVSGLDHHQLL  116

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            FY IIR+LH  +G ++ +A+F +  NS     H +V
Sbjct  117  FYEIIRLLH-DEGAEIVSASFSVVDNSVFHTIHAEV  151



>ref|XP_007214498.1| hypothetical protein PRUPE_ppa018726mg [Prunus persica]
 gb|EMJ15697.1| hypothetical protein PRUPE_ppa018726mg [Prunus persica]
Length=184

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKS  810
            + + +RK IEKNRRN +K+LY+ L SL+P  + R   +LPDQLD+ V YIK  +  LEK 
Sbjct  7    SSRADRKTIEKNRRNQMKALYSKLNSLVPHQRSREVTSLPDQLDDAVNYIKKQQTNLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            R+KKE L+   +   N++         G ++   EI++ +    + VVLI GL+    F 
Sbjct  67   REKKEYLMGTEKSGNNNAGFVGGEVIGGLKSPQIEIEIQEMGSALQVVLITGLDYQFMFN  126

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IRVLH ++G  + NA+F I  ++     H ++
Sbjct  127  ESIRVLH-EEGADIVNASFSIVEDTIFHTIHSKI  159



>ref|XP_004303146.1| PREDICTED: transcription factor bHLH36-like [Fragaria vesca subsp. 
vesca]
Length=228

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 111/228 (49%), Gaps = 38/228 (17%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLE  828
             T   T   K+ER+ IEKNRRNH+K LY+ L SLLP    +E ++LP+Q+DE + YIK LE
Sbjct  16    TQLTTSGSKIERRVIEKNRRNHMKILYSQLNSLLPNQHSKEPVSLPEQIDEAINYIKTLE  75

Query  827   NQLEKSRQKKEELLQKSRKTPNSSSCRNC-------IPAAGEQTEPPEIQVVDTSPGMSV  669
             + ++K +QK++ L     K     S   C         AA    + P+IQ+ +    + V
Sbjct  76    SNMQKLKQKRDNL-----KIGRKRSYELCSSSSSTRSAAATSTAKSPQIQIHEIGSTLEV  130

Query  668   VLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKF  489
             VL  GL +   FY IIR+L ++Q   V +A+F   G+S L +   ++  L++        
Sbjct  131   VLSTGLHNQFIFYDIIRILDQEQA-DVVHASFSASGDSILHLVRAEMGNLILDFGA----  185

Query  488   ISD*PGFFQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNS----WD  357
                              I E+LK ++ G    E ++ +  N     WD
Sbjct  186   ---------------AKITEKLKRIVYGSASDEELQHDDHNQDYYLWD  218



>ref|XP_010327255.1| PREDICTED: uncharacterized protein LOC104649501 [Solanum lycopersicum]
Length=215

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 90/157 (57%), Gaps = 37/157 (24%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP-------AHQERMALPDQLDETVKYIKCLEN  825
             PKLERK +EKNRRN++K+L   L+SL+P       + +E MA+PDQ+D  + YI+ L+ 
Sbjct  10   GPKLERKDVEKNRRNYMKNLCNQLYSLIPFPNASTSSSKETMAVPDQIDAAINYIESLKM  69

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
             LEK+++                               P+I+  +  P + VVLI GL++
Sbjct  70   NLEKNKKST-----------------------------PQIEFHEMGPNIVVVLIIGLDN  100

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHE  534
            I+ F  IIR+ +  +G++V +  F+++GNST+Q++HE
Sbjct  101  IATFNNIIRLCY-MEGVEVVSTRFELNGNSTIQISHE  136



>ref|XP_008225174.1| PREDICTED: transcription factor bHLH36 [Prunus mume]
Length=186

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKS  810
            + + +RK IEKNRRN +K+LY+ L SL+P  + R   +LPDQLD+ V YIK L+  LEK 
Sbjct  7    SSRADRKTIEKNRRNQMKALYSKLNSLVPHQRSREVTSLPDQLDDAVNYIKKLQTNLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            R+KKE L+   +   N++           ++   EI++ +    + VVLI GL+    F 
Sbjct  67   REKKECLMGTEKSGNNNAGFVGGEVMESFKSPQIEIEIQEMGSALQVVLITGLDYQFMFN  126

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IRVLH ++G  + NA+F I  ++     H ++
Sbjct  127  ESIRVLH-EEGADIVNASFSIVEDTIFHTIHSKI  159



>ref|XP_009340723.1| PREDICTED: transcription factor bHLH55-like [Pyrus x bretschneideri]
Length=189

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRRN +K+L++ L SL+P HQ   E  +LPDQLD+ V YIK L+  LEK R+K
Sbjct  11   DRKTIEKNRRNQMKALFSKLNSLVP-HQRSGEAASLPDQLDDAVNYIKQLQTNLEKMREK  69

Query  800  KEELLQKSRKTP--NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            K+ L+    K+   N+   R   P  G     P +++ +T   + V +I GLE    F  
Sbjct  70   KDRLMGGIEKSTHCNAGFGRCAGPITGGS---PLVEIRETGSALEVQMITGLEYQFMFNE  126

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWL  519
             IRVLH ++G  V NA F +  ++     H ++  L
Sbjct  127  SIRVLH-EEGADVVNAGFSVVEDTVFHTIHSKIEEL  161



>ref|XP_006447291.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
 gb|ESR60531.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
Length=198

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K+ERK IEKNRR+ +K+LY+ L SLLP    +E ++LPDQ+DE + YIK LE +L++ ++
Sbjct  45   KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK  104

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L  + R     S             + PEI++ +    + V+L +G++    FY +
Sbjct  105  KKESLQGRERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQFIFYDV  164

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
            IR+LH Q G ++ NA F + GN+   V H +V +
Sbjct  165  IRILH-QDGAEILNANFSVVGNTIFHVIHAEVCY  197



>ref|XP_008383729.1| PREDICTED: transcription factor bHLH36-like isoform X2 [Malus 
domestica]
Length=187

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 99/187 (53%), Gaps = 18/187 (10%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMA-LPDQLDETVKYIKCLENQLEKS  810
             + + +RK IEKNRRN +K+L++ L SL+P  + R A LPDQLD+ V YIK L+  LEK 
Sbjct  6    SSSRTDRKTIEKNRRNQMKALFSKLNSLVPHQRSREASLPDQLDDAVNYIKKLQTNLEKL  65

Query  809  RQKKEELLQKSRKTPNSSSCRNCIP-AAGEQTE----PPEIQVVDTSPGMSVVLINGLES  645
            R+KK+ L+        SS C      + G  TE     P +++ +    + V++I GL+ 
Sbjct  66   REKKDRLM----GIEKSSHCNAGFGRSGGAITEGLNSSPLVEIHEMGSALGVLMITGLDH  121

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSC-------LPKFI  486
               F   IRV+ +++G  + NA+F +  ++     H +VR      S        L KF+
Sbjct  122  QFMFNESIRVI-QEEGADIVNASFSVVKDTIFHTIHSKVRESAAAGSVAARISERLKKFV  180

Query  485  SD*PGFF  465
            +D  G F
Sbjct  181  NDQDGAF  187



>gb|KEH39148.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=219

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 117/214 (55%), Gaps = 30/214 (14%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQL  819
            + + K+ERK +EKNRRN +K L+++L SLLP++  +   + LPDQ+DE + YIK LE  +
Sbjct  11   SSSTKVERKIVEKNRRNQMKILFSNLNSLLPSYNPKELALPLPDQVDEAINYIKRLETNI  70

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            + +++KKE L+   R   + SS       A    + P+I++ +  P + +++  G++   
Sbjct  71   KLAKEKKESLMGNKRSRGDCSSSS----GAKGIIKLPKIEIHEMGPTLQIIVTCGVDEHF  126

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  I+R+LH ++ ++V ++   + G+S L   H Q+          P+         Q 
Sbjct  127  IFCEIMRILH-EENVEVISSNTSLTGHSLLHTVHAQI----------PQ------SLLQF  169

Query  458  GKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
            G+++   I+ERLK  + G      +E+EPL  WD
Sbjct  170  GETK---ISERLKAFVNGSVSD--VETEPL-LWD  197



>ref|XP_008371377.1| PREDICTED: transcription factor bHLH36-like [Malus domestica]
Length=189

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRRN +K+L++ L SL+P HQ   E  +LPDQLD+ V YIK L+  LEK R+K
Sbjct  11   DRKTIEKNRRNQMKALFSKLNSLVP-HQRSGEAASLPDQLDDAVNYIKQLQTNLEKMREK  69

Query  800  KEELLQKSRKTP--NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            K+ L+    K+   N+   R   P  G     P +++ +T   + V +I GLE    F  
Sbjct  70   KDRLMGGIEKSTHCNAGFGRCAGPITGGS---PLVEIHETGSALEVQMITGLEYQFMFNE  126

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWL  519
             IRVLH ++G  V NA F +  ++     H ++  L
Sbjct  127  SIRVLH-EEGADVVNAGFSVVEDTVFHTIHSKIEEL  161



>ref|XP_009352909.1| PREDICTED: transcription factor bHLH55-like isoform X2 [Pyrus 
x bretschneideri]
Length=187

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 98/182 (54%), Gaps = 10/182 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMA-LPDQLDETVKYIKCLENQLEKSR  807
            + + +RK IEKNRRN +K+L++ L SL+P  + R A LPDQLD+ V YIK L   LEK R
Sbjct  7    SSRTDRKTIEKNRRNQMKALFSKLNSLVPHRRSREASLPDQLDDAVNYIKKLRTNLEKLR  66

Query  806  QKKEELLQKSRKTP-NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            +KK+ L+   + +  N+   R+  P        P +++ +    + V++I GL+    F 
Sbjct  67   EKKDRLMGIEKSSHCNAGFGRSGGPITEGLNSSPLVEIHEMGSALEVLMITGLDYQFMFN  126

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSC-------LPKFISD*PG  471
              IRVL +++G  + NA+F +  ++     H +VR      S        L KF++D  G
Sbjct  127  ESIRVL-QEEGADIVNASFSVVEDTIFHTIHSKVRESAAPGSVAARISKRLKKFVNDQDG  185

Query  470  FF  465
             F
Sbjct  186  AF  187



>emb|CDP14798.1| unnamed protein product [Coffea canephora]
Length=219

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 32/219 (15%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQ  804
            K  +K  EKNRR+ +KSL  +L+ LLP    +    LPD+L E + +IK +E +LE  ++
Sbjct  12   KTGKKISEKNRRDQMKSLCAELYRLLPNDISKGFCPLPDKLGEAINHIKSMEKKLENYKE  71

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
             KE+LL   R   ++SS       +   ++   ++V D  P  +V+LI+GLE  + FYGI
Sbjct  72   WKEKLLFGKRSCSSTSS------ESNNSSKLTNVEVQDIGPDANVILISGLEEQASFYGI  125

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEM  444
            I  LH ++G +V NA F  +G S LQV H++V                  G    G SE 
Sbjct  126  IPRLH-EEGFEVVNANFSNNGTSMLQVVHQKV------------------GASTSG-SET  165

Query  443  GMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNL  327
              +++RLK +I G   GE +ES  L+ WD  + IE D L
Sbjct  166  TAVSKRLKELIYGYSQGE-VESN-LDLWD--FRIEPDLL  200



>ref|XP_002517903.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF44421.1| DNA binding protein, putative [Ricinus communis]
Length=246

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 101/160 (63%), Gaps = 7/160 (4%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMA--LPDQLDETVKYIKCLEN  825
            +  T + K ERK IEKNRRN +K+L+++L SL P    + A  LPDQ+DE + +IK LE 
Sbjct  47   SGSTSSTKTERKVIEKNRRNQMKTLFSNLNSLFPRRNAKEAPPLPDQIDEAINHIKSLEE  106

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            +L+K + KKE     +RK P  S C +   +A   +  P++Q+ +    + +VLI+GL++
Sbjct  107  KLKKLKVKKES--LSARKRP-FSECSDSYESAS-ASRAPQLQIKEMGSALEIVLISGLDN  162

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               FY IIR+LH Q+G+ + +A++ + GNS + + H ++R
Sbjct  163  QFMFYEIIRILH-QEGVDIASASYSVAGNSIVYIVHAEIR  201



>ref|XP_002511418.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52020.1| DNA binding protein, putative [Ricinus communis]
Length=173

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 92/163 (56%), Gaps = 9/163 (6%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            T  T +PKL+RK +E+NRR H+K L   L SL+P+H     ++ ++  DQLD    YIK 
Sbjct  4    TNSTGSPKLDRKTVERNRRIHMKGLCFKLASLIPSHHLKHSKDTLSQQDQLDHAAAYIKH  63

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L+ ++EK ++ KE   Q  R    +S+  N + A    +  P I++ D    + V+LI+G
Sbjct  64   LKERIEKLKKMKE---QAMRSLATNSTNNNALDATTMGSRLPMIELRDLGSSIEVILISG  120

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            L+     Y +I ++ +++G +V +A+F   G+    + H QV+
Sbjct  121  LKKNFMLYEVITIV-EEEGAEVVSASFSTVGDKVFHIIHAQVK  162



>ref|XP_006371551.1| hypothetical protein POPTR_0019s13090g [Populus trichocarpa]
 gb|ERP49348.1| hypothetical protein POPTR_0019s13090g [Populus trichocarpa]
Length=232

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +E+NRRN +KSLY+ L SLLP    +E   LPDQ+D  + YIK LE +LEK+R+
Sbjct  39   KTERKVVERNRRNQMKSLYSSLNSLLPNQNFKEAQPLPDQIDRAINYIKSLEEKLEKARE  98

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE  L +SRK   S +C    P +   ++ P++++ +    + +VL +GL++   FY I
Sbjct  99   KKES-LARSRK--RSYTC-TFDPISSAASKSPQLKIHEIGSALEIVLTSGLDNQFLFYEI  154

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V ++ FQ  G+S   + H Q++
Sbjct  155  ISILH-EEGVEVVSSNFQALGDSFFHIVHAQMK  186



>ref|XP_006371549.1| hypothetical protein POPTR_0019s13070g [Populus trichocarpa]
 gb|ERP49346.1| hypothetical protein POPTR_0019s13070g [Populus trichocarpa]
Length=216

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 97/153 (63%), Gaps = 7/153 (5%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK +E+NRRN +KSLY+ L SLLP    +E   LPDQ+D  + YIK LE +LE++R+
Sbjct  23   KTERKVVERNRRNQMKSLYSSLNSLLPNQNFKEAQPLPDQIDRAINYIKSLEEKLERARE  82

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE  L +SRK   S +C    P +   ++ P++++ +    + +VL +GL +   FY I
Sbjct  83   KKES-LARSRK--RSYTC-TFDPISSAASKSPQLKIHEIGSALEIVLTSGLGNQFLFYEI  138

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V +A FQ  G+S   + H Q++
Sbjct  139  ISILH-EEGVEVVSANFQALGDSFFHIVHAQMK  170



>gb|KEH39144.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=217

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 112/214 (52%), Gaps = 32/214 (15%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQL  819
            + + K+ERK +EKNRRN +K L+++L S+LP++  +   + LPDQ+DE + YIK LE  L
Sbjct  11   SSSTKVERKIVEKNRRNQMKILFSNLNSILPSYNPKELALPLPDQVDEAINYIKSLETNL  70

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            + +++KKE L+   +++      R    A G   + P+I++ +    + V++  G++   
Sbjct  71   KGAKEKKESLMGNKKRS------RGGYGAKGSIIKLPKIEIHEMGSTLQVIVTCGVDEHF  124

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  I+R+LH ++ ++V ++   + G+S L   H Q+   L+    +             
Sbjct  125  IFCEIMRILH-EENVEVISSNSSLTGDSLLHTVHAQIPQTLLQFGAMK------------  171

Query  458  GKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
                   I++RLK  + G      +E+ PL  WD
Sbjct  172  -------ISQRLKAFVNGSMSD--VETGPL-LWD  195



>ref|XP_010108177.1| hypothetical protein L484_014502 [Morus notabilis]
 gb|EXC18102.1| hypothetical protein L484_014502 [Morus notabilis]
Length=187

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 8/150 (5%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLP---AHQERMALPDQLDETVKYIKCLENQL  819
            + + + +RK IE+NRRN +K LY+ L SL+P   + +E ++LPDQLDE   YIK L+  L
Sbjct  9    SSSSRTDRKTIERNRRNQMKVLYSKLNSLVPHQTSSKEVISLPDQLDEAATYIKKLQVSL  68

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            EK ++KK  L    + T N     N     G Q + P+I+V +  P + VVLI GL+   
Sbjct  69   EKMKEKKNSLKGIEKSTGN---YFNNDVGMGSQ-KWPQIEVHEKGPALEVVLITGLDCQF  124

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTL  549
             F   IRVLH ++G  + NA+F +    T+
Sbjct  125  MFNETIRVLH-EEGADIVNASFSVVNEDTV  153



>ref|XP_010439537.1| PREDICTED: transcription factor bHLH36-like [Camelina sativa]
Length=188

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 88/152 (58%), Gaps = 5/152 (3%)
 Frame = -2

Query  968  RKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQKKE  795
            RK +EKNRR  +KSLY++L SLLP H  R  + LPDQLDE   YIK L+  +EK R++K 
Sbjct  14   RKTVEKNRRMQMKSLYSELTSLLPHHSSREPLTLPDQLDEAANYIKKLQVNVEKKRERKS  73

Query  794  ELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFYGI  624
            +L+  +     +S+  + + ++ + + P   P I++ +T     + L+  LE    F  I
Sbjct  74   KLVATATSEKLNSAGSSLVASSVDVSVPRRLPRIEIQETGSIFHIFLVTSLEHKFMFCEI  133

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            +RVL ++ G ++T+A + I  ++     H +V
Sbjct  134  VRVLTEELGAEITHAGYSIVDDAVFHTLHCKV  165



>ref|XP_009346720.1| PREDICTED: uncharacterized protein LOC103938438 [Pyrus x bretschneideri]
Length=189

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 10/156 (6%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRRN +K+L++ L SL+P HQ   E  +LPDQLD+ V YIK L+  LEK R+K
Sbjct  11   DRKTIEKNRRNQMKALFSKLNSLVP-HQRSGEAASLPDQLDDAVNYIKQLQTNLEKMREK  69

Query  800  KEELLQKSRKTP--NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            K+ L+    K+   N+   R   P  G     P +++ +T   + + +I GLE    F  
Sbjct  70   KDRLMGGIEKSTHCNAGFGRCAGPITGGS---PLVEIRETGSALEIQMITGLEYQFMFNE  126

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWL  519
             I VLH ++G  V NA F +  ++     H ++  L
Sbjct  127  SICVLH-EEGADVVNAGFSVVEDTVFHTIHSKIEEL  161



>ref|XP_006376476.1| hypothetical protein POPTR_0013s13340g [Populus trichocarpa]
 gb|ERP54273.1| hypothetical protein POPTR_0013s13340g [Populus trichocarpa]
Length=218

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLE  828
             +++   + K ERK IEKNRRN +K+LY+ L SLLP    +E   LPDQ+DE + +IK LE
Sbjct  13    SSSNISSTKTERKIIEKNRRNQMKTLYSKLNSLLPNQNFKEPQPLPDQIDEAISHIKSLE  72

Query  827   NQLEKSRQKKEELLQKSRKTPNSSSC-RNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL  651
              +L+K+++KKE  L  SRK   S +C  + +P A  +  PP++++ +    + +VL +G 
Sbjct  73    EKLKKAKEKKEG-LTSSRK--RSYTCTYDPMPIASPK--PPQLKIQELGSALEIVLTSGP  127

Query  650   ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             ++   FY IIR+LH ++G++V +A FQ+ G+S  QV H Q++
Sbjct  128   DNQFLFYEIIRILH-EEGVEVVSANFQVLGDSIFQVLHAQMK  168



>ref|XP_008383727.1| PREDICTED: transcription factor bHLH36-like isoform X1 [Malus 
domestica]
Length=198

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 100/198 (51%), Gaps = 29/198 (15%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERM------------ALPDQLDETVKY  843
             + + +RK IEKNRRN +K+L++ L SL+P  + R+            +LPDQLD+ V Y
Sbjct  6    SSSRTDRKTIEKNRRNQMKALFSKLNSLVPHQRSRVSLSLSESSLWEASLPDQLDDAVNY  65

Query  842  IKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIP-AAGEQTE----PPEIQVVDTSPG  678
            IK L+  LEK R+KK+ L+        SS C      + G  TE     P +++ +    
Sbjct  66   IKKLQTNLEKLREKKDRLM----GIEKSSHCNAGFGRSGGAITEGLNSSPLVEIHEMGSA  121

Query  677  MSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSC-  501
            + V++I GL+    F   IRV+ +++G  + NA+F +  ++     H +VR      S  
Sbjct  122  LGVLMITGLDHQFMFNESIRVI-QEEGADIVNASFSVVKDTIFHTIHSKVRESAAAGSVA  180

Query  500  ------LPKFISD*PGFF  465
                  L KF++D  G F
Sbjct  181  ARISERLKKFVNDQDGAF  198



>ref|XP_009792759.1| PREDICTED: uncharacterized protein LOC104239707 [Nicotiana sylvestris]
Length=187

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 92/159 (58%), Gaps = 12/159 (8%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQL  819
            +   K +RK IEKNRRN LK+LY++L SL+P  Q   E ++LPDQL+E   YIK L+  L
Sbjct  8    SSVSKADRKTIEKNRRNQLKALYSELNSLVPHQQHSREVLSLPDQLEEAANYIKKLQINL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP--PEIQVVDTSPGMSVVLINGLES  645
            E+ RQ+KE L      T + +S      +  ++T P  P +++      + VVLI  ++ 
Sbjct  68   ERMRQRKESL------TVDGNSSSIRSSSVRKETLPLLPHLEIHHVDSSLDVVLITRIDD  121

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               F  IIR+LH ++ L+V NA++ + G++     H +V
Sbjct  122  QFIFNDIIRMLH-EESLEVINASYTLIGDTIFHSIHSKV  159



>ref|XP_009352908.1| PREDICTED: transcription factor bHLH55-like isoform X1 [Pyrus 
x bretschneideri]
Length=198

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 99/193 (51%), Gaps = 21/193 (11%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERM------------ALPDQLDETVKYI  840
            + + +RK IEKNRRN +K+L++ L SL+P  + R+            +LPDQLD+ V YI
Sbjct  7    SSRTDRKTIEKNRRNQMKALFSKLNSLVPHRRSRVSLSLSESSLWEASLPDQLDDAVNYI  66

Query  839  KCLENQLEKSRQKKEELLQKSRKTP-NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVL  663
            K L   LEK R+KK+ L+   + +  N+   R+  P        P +++ +    + V++
Sbjct  67   KKLRTNLEKLREKKDRLMGIEKSSHCNAGFGRSGGPITEGLNSSPLVEIHEMGSALEVLM  126

Query  662  INGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSC------  501
            I GL+    F   IRVL +++G  + NA+F +  ++     H +VR      S       
Sbjct  127  ITGLDYQFMFNESIRVL-QEEGADIVNASFSVVEDTIFHTIHSKVRESAAPGSVAARISK  185

Query  500  -LPKFISD*PGFF  465
             L KF++D  G F
Sbjct  186  RLKKFVNDQDGAF  198



>ref|XP_009792659.1| PREDICTED: transcription factor bHLH55-like [Nicotiana sylvestris]
Length=179

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 101/199 (51%), Gaps = 32/199 (16%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQL  819
            + + K +RK IEKNRRN +K+LY  L SL+P  Q   E ++LPDQL+E + YIK L+  L
Sbjct  10   SSSSKADRKTIEKNRRNQMKALYLKLHSLVPHQQHSREVLSLPDQLEEAINYIKRLQIDL  69

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
             +  QKK+ L     K+  +SSC   I         P +++      + VV+   L+   
Sbjct  70   GRMTQKKDSL-----KSGENSSCGRKIGLP-----LPHLEINSVDSALQVVITTSLDYQF  119

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  +IR+LH ++ +QV NA + + G++ +   H Q      M  C P          Q 
Sbjct  120  IFTDVIRLLH-EESVQVINANYTLIGDTIVHSIHSQ------MGECAPD---------QY  163

Query  458  GKSEMGMIAERLKVVIKGC  402
            G +    I+ERLK  + GC
Sbjct  164  GAAR---ISERLKKFVGGC  179



>ref|XP_010925568.1| PREDICTED: uncharacterized protein LOC105048079 [Elaeis guineensis]
Length=178

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 83/153 (54%), Gaps = 12/153 (8%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQER-----MALPDQLDETVKYIKCLENQLEKSR  807
            +RK +EKNRR  +K+L + L SLLP+         + LPD+LDE V YIK L+ +LE+ +
Sbjct  11   DRKTVEKNRRIQMKALCSKLESLLPSSPNSREGVTLPLPDRLDEAVNYIKGLQGRLERMK  70

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            ++K +L+   R++      R      G     P+I+V D  P + VVLI+       FY 
Sbjct  71   ERKRQLMGSERRS------RGMGSEVGGGMRVPQIEVQDLGPALRVVLISSPVDRLLFYE  124

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IRVL ++ G  V NA F + G++   + H  V
Sbjct  125  AIRVLEEEGG-AVLNANFSVVGDNAFHIIHSMV  156



>ref|XP_010052302.1| PREDICTED: uncharacterized protein LOC104441008 [Eucalyptus grandis]
 gb|KCW76236.1| hypothetical protein EUGRSUZ_D00616 [Eucalyptus grandis]
Length=187

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 90/154 (58%), Gaps = 9/154 (6%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLEKS  810
            + K +RK IE+NRR+H+K+LY+ L SL+  H   E  +LPDQL E   YIK L+  LEK 
Sbjct  7    SSKSDRKLIERNRRHHMKALYSQLNSLVHHHSPTEVTSLPDQLHEATNYIKKLQINLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++KKE LL  ++    ++S  N +  A   +  PEI++  +   + V+LI GL+    F 
Sbjct  67   KEKKESLLGIAKM---NTSMNNGMDVA---SNSPEIEIHQSGSSLQVILITGLDHQFMFN  120

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             +I +LH + G+++ NA+F +  +      H +V
Sbjct  121  HVISLLH-EDGVKILNASFSVLEDKAFHSIHCEV  153



>ref|XP_003526277.1| PREDICTED: transcription factor bHLH36-like [Glycine max]
Length=224

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 126/232 (54%), Gaps = 30/232 (13%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            + + K+ER+ +EKNRRN +K L   L SLLP++  +E + LPDQ+DE + YIK LE +++
Sbjct  10   SSSTKVERRLVEKNRRNQMKILCNKLNSLLPSYNPKEALPLPDQVDEAINYIKSLEAKVK  69

Query  815  KSRQKKEEL--LQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
             +++KKE L  ++K  +   S++  N    +    + P++++ +    + VVL  GL+  
Sbjct  70   MAQEKKECLQGIRKRSRDCFSNNSTNFAATSAGFPKSPQLEIHEVGSSLQVVLTCGLDHQ  129

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQ  462
              F  IIR+LH ++ + V +A   + G+S L V H ++          P+         Q
Sbjct  130  FIFSEIIRMLH-EENIDVRSANSSLAGDSMLHVVHAEI----------PQ------SLLQ  172

Query  461  VGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWDNNYDIERDNL-GFPVLE  309
             G ++   +++RLK  + G      +E++P   WD  ++I  D++ G  +L+
Sbjct  173  FGATK---VSQRLKRFVNG--SCSDVETQP-ELWD--FEIGTDDMWGLYILQ  216



>ref|XP_003541734.1| PREDICTED: uncharacterized protein LOC100784418 [Glycine max]
 gb|KHN08515.1| Transcription factor bHLH36 [Glycine soja]
Length=181

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 88/152 (58%), Gaps = 10/152 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + +++RK+IE+NRRN +K+L+  L SL+P HQ   E + LPDQL+E   YIK L+  LEK
Sbjct  7    SSRVDRKFIERNRRNQMKALFRKLNSLVP-HQRSKEAIPLPDQLEEATNYIKKLQINLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             + KK  LL   R  PN     N     G ++  P I++      + VVLI GL+S   F
Sbjct  66   MKDKKNMLLGNER--PN-ERMNNDGRRVGLKS--PRIEIQQMGSALEVVLITGLDSQFMF  120

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
               IRVLH ++G+ V NA++++  ++     H
Sbjct  121  GETIRVLH-EEGVDVVNASYKVIEDAVFHSIH  151



>ref|XP_003607469.1| Transcription factor bHLH36 [Medicago truncatula]
 gb|AES89666.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=208

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 108/211 (51%), Gaps = 35/211 (17%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQLEKSR  807
            K+ER+ +EKNRRN +K LY+ L SLLP +  +   +ALPDQ+DE + YIK LE  ++ + 
Sbjct  16   KVERRLVEKNRRNQMKILYSKLNSLLPNYNPKELPLALPDQVDEAINYIKSLEANVQMAM  75

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            +KKE LL       N  S   C+    +  + P  ++ +    + ++L  GL++   FY 
Sbjct  76   EKKERLLAGK----NKRSREYCL----DLPKSPCFEIHEIGSSLQIILTCGLDNQFIFYE  127

Query  626  IIRVLHKQQ-GLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKS  450
            IIRVLH++   ++  N++ ++  NS L V H ++                 P   Q G +
Sbjct  128  IIRVLHEENVDIRSVNSS-KVGDNSLLHVVHAEIP----------------PSCVQFGAT  170

Query  449  EMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
            +   ++ERLK  + G      I+ E    WD
Sbjct  171  K---VSERLKSFVYGSSSDVEIQPE---LWD  195



>ref|XP_006449353.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 ref|XP_006449354.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 ref|XP_006449355.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 gb|ESR62593.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 gb|ESR62594.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 gb|ESR62595.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
Length=188

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 91/157 (58%), Gaps = 7/157 (4%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K+LY+ L SL+P HQ   E  +LPDQLDE  KYIK L+  LE+
Sbjct  7    SSRTDRKTIERNRRNQMKALYSTLNSLVP-HQRPMEATSLPDQLDEATKYIKRLQTNLER  65

Query  812  SRQKKEELL--QKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
             +++KE L+  +K      +SS  N           P+I++ +    + VVL  GL+   
Sbjct  66   MKERKERLMGIEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTTGLDFQF  125

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   IR+LH ++G+++ NA+F +  ++     H ++
Sbjct  126  MFIETIRLLH-EEGVEIVNASFNVVEDTIFHTIHSKI  161



>ref|XP_003593591.1| Transcription factor bHLH36 [Medicago truncatula]
 gb|AES63842.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=174

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 11/155 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + +++RK++E+NRRN +K+L   L SLLP HQ   E +++PDQL E   YIK L+  LEK
Sbjct  7    SSRVDRKFVERNRRNQMKALCQKLNSLLP-HQTSKEAISVPDQLKEATNYIKKLQINLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK  LL   R  PN +  RN     G   + P+I++      + VVLI GLES   F
Sbjct  66   MKEKKNFLLGIQR--PNVNLNRN--QKMG--LKSPKIKIQQIGLVLEVVLITGLESQFLF  119

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
                RVLH ++G+ + NA+++++ +S     H QV
Sbjct  120  SETFRVLH-EEGVDIVNASYKVNEDSVFHSIHCQV  153



>ref|XP_010057409.1| PREDICTED: uncharacterized protein LOC104445270 [Eucalyptus grandis]
 ref|XP_010057410.1| PREDICTED: uncharacterized protein LOC104445270 [Eucalyptus grandis]
Length=204

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 95/159 (60%), Gaps = 10/159 (6%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLEN  825
            +K  + + +RK  E+NRRN +K+L+++L SL+P     ++ ++LPDQL E   YI+ L+ 
Sbjct  26   SKPGSSRHDRKTRERNRRNQMKALFSELHSLVPPRSPTEKTLSLPDQLGEAANYIRSLQV  85

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++EK R++KE+LL+  +     ++  N  P  G ++  PEI++ +    + VVL+ GL+ 
Sbjct  86   KVEKMREQKEQLLELGK----INTTMNSGPMIGFKS--PEIRIWNNKSILEVVLVTGLDG  139

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               F   +RV+H ++G  + NA+    G++ L   H +V
Sbjct  140  QFMFNETVRVIH-EEGADIVNASSSYVGDAMLHTIHAKV  177



>ref|XP_006467789.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
isoform X3 [Citrus sinensis]
 ref|XP_006467790.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
isoform X4 [Citrus sinensis]
 ref|XP_006467791.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
isoform X5 [Citrus sinensis]
 gb|KDO75990.1| hypothetical protein CISIN_1g029713mg [Citrus sinensis]
 gb|KDO75991.1| hypothetical protein CISIN_1g029713mg [Citrus sinensis]
Length=188

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 91/157 (58%), Gaps = 7/157 (4%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K+LY+ L S++P HQ   E  +LPDQLDE  KYIK L+  LE+
Sbjct  7    SSRTDRKTIERNRRNQMKALYSTLNSIVP-HQRPMEATSLPDQLDEATKYIKRLQTNLER  65

Query  812  SRQKKEELL--QKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
             +++KE L+  +K      +SS  N           P+I++ +    + VVL  GL+   
Sbjct  66   MKERKERLMGIEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTTGLDFQF  125

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   IR+LH ++G+++ NA+F +  ++     H ++
Sbjct  126  MFIETIRLLH-EEGVEIVNASFNVVEDTIFHTIHSKI  161



>ref|XP_006347029.1| PREDICTED: uncharacterized protein LOC102588456 [Solanum tuberosum]
Length=199

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 88/152 (58%), Gaps = 6/152 (4%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRRN +K LY  L SL+   Q   E ++LPDQL+E   YIK L+  LEK R K
Sbjct  20   DRKTIEKNRRNQMKDLYMKLNSLVHHDQHSKEFLSLPDQLEEAANYIKKLQIDLEKMRLK  79

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP-PEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KE  L  +  T NS+S  N      E T P P I++   +  + V+LI GL+    F  I
Sbjct  80   KES-LTAAVGTLNSNSSSNTNGRTLENTLPLPHIEIHSVNAALEVLLITGLDYHFMFNHI  138

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            IR+LH + G+QV NA++ + G++     H +V
Sbjct  139  IRMLH-EDGVQVINASYTLVGDTIFHSIHSKV  169



>gb|KCW74558.1| hypothetical protein EUGRSUZ_E03272 [Eucalyptus grandis]
Length=182

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 95/159 (60%), Gaps = 10/159 (6%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLEN  825
            +K  + + +RK  E+NRRN +K+L+++L SL+P     ++ ++LPDQL E   YI+ L+ 
Sbjct  4    SKPGSSRPDRKRTERNRRNQMKALFSELHSLVPQQSPTEKTLSLPDQLGEAANYIRSLQV  63

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++EK R++KE+LL+  +     ++  N  P  G ++  PEI++ +    + VVL+ GL+ 
Sbjct  64   KVEKMREQKEQLLEVGK----INTTMNSGPMIGFKS--PEIRIWNNKSILEVVLVTGLDG  117

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               F   ++V+H ++G  + NA+    G++ L   H +V
Sbjct  118  QFMFNETVQVIH-EEGADIVNASSSYVGDAMLHTIHAKV  155



>ref|XP_010039147.1| PREDICTED: transcription factor ORG2-like [Eucalyptus grandis]
 gb|KCW49295.1| hypothetical protein EUGRSUZ_K02851 [Eucalyptus grandis]
Length=187

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 90/166 (54%), Gaps = 7/166 (4%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-----ERMALPDQLDETVKYIK  837
             +T+   +PK+ERK IEKNRR H+  L + L SL+P H      + ++  DQLD+   YIK
Sbjct  4     STSNNQSPKVERKTIEKNRRIHMNILCSKLASLIPQHHITTSLDSLSRQDQLDQATSYIK  63

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIP-AAGEQTEPPEIQVVDTSPGMSVVLI  660
              L+ +++  + +K++ + KS     SSS  + I   A      P  Q+ D   G+ V+LI
Sbjct  64    QLKERIDGLKLRKDQAVLKSEGIDTSSSLTSSIDQEANLGFMLPVFQLRDHGLGLEVILI  123

Query  659   NGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
             +G       Y +I +L +++G +V +A+F + G+      H QVR 
Sbjct  124   SGRRKNFMLYEVISIL-EEEGAEVVSASFSVVGDKIFHTLHAQVRL  168



>ref|XP_009619774.1| PREDICTED: uncharacterized protein LOC104111721 [Nicotiana tomentosiformis]
Length=184

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 89/155 (57%), Gaps = 12/155 (8%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSR  807
            K +RK IEKNRRN +K LY++L SL+P  Q   E ++LPDQL+E   YIK L+  LE+ R
Sbjct  12   KADRKTIEKNRRNQMKGLYSELNSLVPHQQHSREVLSLPDQLEEAANYIKKLQIDLERMR  71

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP--PEIQVVDTSPGMSVVLINGLESISQF  633
            Q+KE L      T   +S      +  ++T P  P +++      + VVLI  ++    F
Sbjct  72   QRKESL------TVGENSSSITSSSGRKETLPLLPHLEIHHVDSSLDVVLITRIDYQFIF  125

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IIR+LH ++ L+V NA++ + G++     H +V
Sbjct  126  NDIIRMLH-EENLEVINASYTLIGDTIFHSIHSKV  159



>ref|XP_003547148.1| PREDICTED: uncharacterized protein LOC100814407 [Glycine max]
Length=180

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 86/155 (55%), Gaps = 8/155 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQLEKS  810
            + ++ERK IE+NRRN +K+L+ +L SL+P  + +E ++LPDQL+E   YIK L+  LEK 
Sbjct  7    SSRVERKIIERNRRNQMKALFRELNSLVPHQSSKEAISLPDQLEEATNYIKKLQINLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            + KK  LL   R  PN    R        +   P I++      + VVLI G +    F 
Sbjct  67   KDKKNMLLGIER--PN---VRMNNGGRTVRLNSPRIEIQQMGSALEVVLITGFDCQFMFS  121

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              IRVLH ++G+ V NA++++   +     H Q R
Sbjct  122  ETIRVLH-EEGVDVVNASYKVIEGAVFHSIHCQDR  155



>ref|XP_006467787.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467788.1| PREDICTED: transcription factor ABA-INDUCIBLE bHLH-TYPE-like 
isoform X2 [Citrus sinensis]
 gb|KDO75989.1| hypothetical protein CISIN_1g029713mg [Citrus sinensis]
Length=189

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 89/154 (58%), Gaps = 7/154 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + + +RK IE+NRRN +K+LY+ L S++P HQ   E  +LPDQLDE  KYIK L+  LE+
Sbjct  7    SSRTDRKTIERNRRNQMKALYSTLNSIVP-HQRPMEATSLPDQLDEATKYIKRLQTNLER  65

Query  812  SRQKKEELL--QKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
             +++KE L+  +K      +SS  N           P+I++ +    + VVL  GL+   
Sbjct  66   MKERKERLMGIEKPDAAAATSSSGNSSGTITTGLRSPQIEIHEMGSALEVVLTTGLDFQF  125

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
             F   IR+LH ++G+++ NA+F +  ++     H
Sbjct  126  MFIETIRLLH-EEGVEIVNASFNVVEDTIFHTIH  158



>gb|AFK47122.1| unknown [Lotus japonicus]
Length=180

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 89/152 (59%), Gaps = 10/152 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEK  813
            + +++RK IE+NRRN +++LY  L SL+  HQ   E ++LPDQL+E   YIK L+  LEK
Sbjct  7    SSRVDRKVIERNRRNQMRTLYRKLDSLV-LHQTSKEAISLPDQLEEATNYIKRLQVNLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK  LL   R  PN  S +   P+ G ++  P+I++      + VVLI G +    F
Sbjct  66   MKEKKNTLLGIER--PNVMSLKEG-PSMGLKS--PKIEIQQMGSALDVVLITGSDCQFMF  120

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
               IRVLH ++G+ V NA++++   S     H
Sbjct  121  NETIRVLH-EEGVDVVNASYKVIEGSAFHSIH  151



>ref|XP_010057407.1| PREDICTED: uncharacterized protein LOC104445269 isoform X1 [Eucalyptus 
grandis]
Length=204

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 95/159 (60%), Gaps = 10/159 (6%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLEN  825
            +K  + + +RK  E+NRRN +K+L+++L SL+P     ++ ++LPDQL E   YI+ L+ 
Sbjct  26   SKPGSSRPDRKRTERNRRNQMKALFSELHSLVPQQSPTEKTLSLPDQLGEAANYIRSLQV  85

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++EK R++KE+LL+  +     ++  N  P  G ++  PEI++ +    + VVL+ GL+ 
Sbjct  86   KVEKMREQKEQLLEVGK----INTTMNSGPMIGFKS--PEIRIWNNKSILEVVLVTGLDG  139

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               F   ++V+H ++G  + NA+    G++ L   H +V
Sbjct  140  QFMFNETVQVIH-EEGADIVNASSSYVGDAMLHTIHAKV  177



>ref|XP_006284564.1| hypothetical protein CARUB_v10005784mg, partial [Capsella rubella]
 gb|EOA17462.1| hypothetical protein CARUB_v10005784mg, partial [Capsella rubella]
Length=196

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 90/154 (58%), Gaps = 5/154 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK IEKNRR  +KSLY++L SLLP H  R   ALPDQLDE   YIK L+  +EK R++
Sbjct  20   VDRKTIEKNRRMQMKSLYSELISLLPHHSSRETSALPDQLDEAANYIKKLQVNVEKKRER  79

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFY  630
            K +L+  +     +S+  +   ++ + + P   P+I++ +    + + L+  LE    F 
Sbjct  80   KRKLVATTTFEKLNSAGSSLASSSVDVSVPKRLPKIEIQEMGSILHIFLVTSLEHKFMFG  139

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IIRVL ++ G ++T+A + I  ++     H +V
Sbjct  140  EIIRVLTEELGAEITHAGYSIVDDAVFHTLHCKV  173



>ref|XP_009134156.1| PREDICTED: transcription factor bHLH36-like [Brassica rapa]
Length=189

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLP-AHQERMALPDQLDETVKYIKCLENQLEKSRQKK  798
            ++RK IEKNRR  +K LY++L SLLP   +E +ALPDQLDE   YIK L+  +EK R++K
Sbjct  14   VDRKTIEKNRRIQMKDLYSELNSLLPQTSRESLALPDQLDEAANYIKKLQVNVEKKRERK  73

Query  797  EELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFYG  627
             +LL  +     +S+  + + ++ + + P   P I++ +T P + + L+  +E    F+ 
Sbjct  74   RKLLATAAFEKLNSTGSSSMSSSVDVSMPRRLPRIEIQETGPVLHIFLVTSMEHKFIFHE  133

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            I R++ ++ G ++T+A + I  ++     H +V
Sbjct  134  ITRLITEEAGAEMTHAGYSIVDDAVFHTLHCKV  166



>gb|KEH39142.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=327

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 116/214 (54%), Gaps = 29/214 (14%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQL  819
            + + K+ERK +EKNRRN +K L++ L SLLP++ ++   + LPDQ+DE + YIK LE  +
Sbjct  11   SSSTKVERKIVEKNRRNQMKILFSKLNSLLPSYNQKELALPLPDQVDEAINYIKSLEINI  70

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            + +++KKE L+   +++    S       A    E P+I++ +  P + V++  G++   
Sbjct  71   KLAKEKKESLMGNKKRSRGGWSSSY---GAKGSIELPKIEIHEIGPTLQVIVTCGVDEHF  127

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQV  459
             F  I+R+LH ++ + V ++   + G+S L            +L+ +P+         Q 
Sbjct  128  IFCEIMRILH-EENVDVISSNSSLAGDSLLHT----------VLAQIPQ------SLLQF  170

Query  458  GKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
            G+++   I++RLK  + G      +E++P   WD
Sbjct  171  GETK---ISKRLKAFVDGSMSD--VETDP-QLWD  198



>emb|CAB45892.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79097.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH30524.1| hypothetical protein [Arabidopsis thaliana]
Length=167

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 89/154 (58%), Gaps = 5/154 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK +EKNRR  +KSLY++L SLLP H   E + LPDQLDE   YIK L+  +EK R++
Sbjct  14   VDRKTVEKNRRMQMKSLYSELISLLPHHSSTEPLTLPDQLDEAANYIKKLQVNVEKKRER  73

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFY  630
            K  L+  +     +S   + + ++ + + P   P+I++ +T     + L+  LE    F 
Sbjct  74   KRNLVATTTLEKLNSVGSSSVSSSVDVSVPRKLPKIEIQETGSIFHIFLVTSLEHKFMFC  133

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IIRVL ++ G ++T+A + I  ++     H +V
Sbjct  134  EIIRVLTEELGAEITHAGYSIVDDAVFHTLHCKV  167



>ref|NP_193829.2| basic helix-loop-helix domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE84380.1| basic helix-loop-helix domain-containing protein [Arabidopsis 
thaliana]
Length=190

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 89/154 (58%), Gaps = 5/154 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK +EKNRR  +KSLY++L SLLP H   E + LPDQLDE   YIK L+  +EK R++
Sbjct  14   VDRKTVEKNRRMQMKSLYSELISLLPHHSSTEPLTLPDQLDEAANYIKKLQVNVEKKRER  73

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFY  630
            K  L+  +     +S   + + ++ + + P   P+I++ +T     + L+  LE    F 
Sbjct  74   KRNLVATTTLEKLNSVGSSSVSSSVDVSVPRKLPKIEIQETGSIFHIFLVTSLEHKFMFC  133

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             IIRVL ++ G ++T+A + I  ++     H +V
Sbjct  134  EIIRVLTEELGAEITHAGYSIVDDAVFHTLHCKV  167



>ref|XP_010538664.1| PREDICTED: uncharacterized protein LOC104812938 [Tarenaya hassleriana]
Length=180

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 86/146 (59%), Gaps = 17/146 (12%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRR  +K+L +DL SLLP  Q   E +  PDQLDE  KYIK L+ ++E+ +++
Sbjct  13   DRKTIEKNRRIQMKTLQSDLNSLLPNSQNSREPLTQPDQLDEAAKYIKKLQVKVERMKER  72

Query  800  KEELL--QKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            K +L+  + S  +P+  + R            P I++ +  P M++VL+ GL+    FY 
Sbjct  73   KRKLVGSEGSSDSPSGFAFRR-----------PRIEIQEMGPIMNIVLVTGLDCKHMFYE  121

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTL  549
            IIRVL   +G  V++++F +  ++  
Sbjct  122  IIRVL-TDEGTDVSHSSFSVVDDAVF  146



>ref|XP_010434251.1| PREDICTED: transcription factor bHLH36-like [Camelina sativa]
Length=191

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 90/154 (58%), Gaps = 5/154 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK +EKNRR  +KSLY++L SLLP H  R  + LPDQLDE   YIK L+  +EK R++
Sbjct  15   VDRKTVEKNRRMQMKSLYSELTSLLPHHSSREPLTLPDQLDEAANYIKKLQVNVEKKRER  74

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFY  630
            K +L+  +     +S+  + + ++ + + P   P I++ ++     + L+  LE    F 
Sbjct  75   KSKLVATANSEKLNSAGSSLVSSSVDVSVPRKLPRIEIQESGSIFHIFLVTSLEHKFMFC  134

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             I+RVL ++ G ++T+A + I  ++     H +V
Sbjct  135  EIVRVLTEELGAEITHAGYSIVEDAVFHTLHCKV  168



>ref|XP_010686666.1| PREDICTED: uncharacterized protein LOC104900834, partial [Beta 
vulgaris subsp. vulgaris]
Length=154

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 82/159 (52%), Gaps = 13/159 (8%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSL----LPAHQERMALPDQLDETVKYIKC  834
             T +     K +RK IEKNRRNH+K LY+ L SL    + + ++ + LPDQ+DE  KYIK 
Sbjct  3     TNSSKSVSKTDRKTIEKNRRNHMKGLYSQLNSLVHHDVSSSRDSLPLPDQIDEATKYIKK  62

Query  833   LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
             LE  +   ++KK+ L+    K  N                P +I+V +    + V+L+ G
Sbjct  63    LEENVMNLKEKKDSLVGVDGKYSN--------IRGYSLNSPVQIEVHEKGSAVEVILVTG  114

Query  653   LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
             LE    F   +R++H++   +V NA++ + G +     H
Sbjct  115   LECQFVFTEAMRIVHEEHA-EVVNASYSVVGTTVFHSIH  152



>ref|XP_010057406.1| PREDICTED: uncharacterized protein LOC104445267 [Eucalyptus grandis]
 gb|KCW74557.1| hypothetical protein EUGRSUZ_E03271 [Eucalyptus grandis]
Length=180

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQ  822
            K  + + +RK  E+NRRN +K+L++ L SL+P    R   ++ PDQL +   YIK L+ +
Sbjct  4    KPGSSRADRKTTERNRRNQMKALFSKLHSLVPPQSPRESTLSQPDQLSQAANYIKNLQVK  63

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQT--EPPEIQVVDTSPGMSVVLINGLE  648
            +EK R++KE LL+  +    S+S +N     GE    + PEI++      + VVL++GL+
Sbjct  64   VEKMREQKERLLEIEKI---STSMKN-----GEMIGFKSPEIRIQKMGSILEVVLVSGLD  115

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
                F   +RV++ ++G  + NA+F   G++ L   H +V
Sbjct  116  GQFMFNETVRVIY-EEGADIVNASFSNVGDAMLHTIHAKV  154



>gb|KCW74556.1| hypothetical protein EUGRSUZ_E03270 [Eucalyptus grandis]
Length=158

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 89/159 (56%), Gaps = 10/159 (6%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQ  822
            K  + + +RK  E+NRRN +K+L + L SL+P    R   +++PDQL +   YIK L+ +
Sbjct  4    KPGSSRADRKTTERNRRNRMKALLSKLHSLVPPQCPRESTLSMPDQLGKAANYIKNLQVK  63

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            ++K R++KE LL+  +    +++  N +       + PEI +  +   + VVL+ GL+  
Sbjct  64   VQKMREQKERLLEIEKI---NTTMNNGLTIG---FKSPEIGIRKSGSILEVVLVTGLDGQ  117

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              F   +RV+H ++G  V NA F   G++ L   H +VR
Sbjct  118  FMFNETVRVIH-EEGADVMNANFSYVGDAMLHTVHAKVR  155



>ref|XP_004505634.1| PREDICTED: uncharacterized protein LOC101500132, partial [Cicer 
arietinum]
Length=206

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 89/157 (57%), Gaps = 17/157 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-------ERMALPDQLDETVKYIKCLENQL  819
            K+ER+ +E++RRN +K LY+ L SLLP +        E ++LP+Q+DE + YIK LE ++
Sbjct  14   KVERRIVERDRRNKMKILYSKLNSLLPNYNPKFSLSLEVLSLPEQVDEAINYIKNLEAKV  73

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +  ++KKE LL+K +++      R+C   A    + P  ++ +    +  V   GL++  
Sbjct  74   KMDKEKKEMLLRKKKRS------RDCFIGA---PKLPRFEIHEIGSSLQFVFTCGLDNRF  124

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              Y IIRVLH ++ ++V +      G+  + V H +V
Sbjct  125  ILYEIIRVLH-EENVEVKSVNSSTFGDLLVHVVHAKV  160



>ref|XP_006413836.1| hypothetical protein EUTSA_v10026322mg [Eutrema salsugineum]
 gb|ESQ55289.1| hypothetical protein EUTSA_v10026322mg [Eutrema salsugineum]
Length=190

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 92/153 (60%), Gaps = 5/153 (3%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLP-AHQERMALPDQLDETVKYIKCLENQLEKSRQKKE  795
            +RK IEKNRR  +K+LY++L SLLP   +E + LPDQLDE   YIK L+  +EK R++K 
Sbjct  15   DRKTIEKNRRIQMKALYSELNSLLPQTSREPLTLPDQLDEAASYIKKLQVNVEKKRERKR  74

Query  794  ELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFYG-  627
            +LL  +     +SS  + + ++ + + P   P+I++ +T   + + L+  LE    FY  
Sbjct  75   KLLATAAFDKLNSSGSSSMSSSVDISVPRRLPKIEIQETGSILHIFLVTSLEHKFMFYHE  134

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            IIRVL ++ G ++++A + I  ++     H +V
Sbjct  135  IIRVLTEELGTEISHAGYSIVDDAVFHTIHSKV  167



>ref|XP_004486267.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH36-like, 
partial [Cicer arietinum]
Length=170

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 9/154 (6%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQLEKS  810
            + K++RK+IE++RRN +K LY  L SLLP    ++ ++LP+QL+E   YIK L+ +LEK 
Sbjct  2    SSKIDRKFIERDRRNQMKPLYHKLNSLLPHQTFKDAISLPNQLEEATSYIKRLQIKLEKI  61

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            R KK  LL+  R   N +   N         +  +I++      + VV+I GL+S   F 
Sbjct  62   RDKKNTLLEIQRTNMNMNKKMNL------WLKSTKIEIQPIGLALEVVIIIGLDSQLLFN  115

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              IRVL +++G+ + N +++++ +      H QV
Sbjct  116  ETIRVL-REEGVDIVNTSYKVNEDVIFHSIHCQV  148



>gb|EYU27979.1| hypothetical protein MIMGU_mgv1a013945mg [Erythranthe guttata]
Length=205

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 89/172 (52%), Gaps = 18/172 (10%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQ  804
            K +RK IEKNRRN +K LY  L SL+P    R  ++LPDQL+    YI+ L++ LEK +Q
Sbjct  12   KADRKTIEKNRRNQMKDLYNKLTSLVPRPNPRELVSLPDQLEGAANYIQKLQHDLEKMKQ  71

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEP---------------PEIQVVDTSPGMSV  669
            KK  LL  +  + NS++          ++                 P+I V  T   + V
Sbjct  72   KKNCLLMGT-VSANSTTTTATTTTTTNKSSISNTDNNNNNNGGINLPDIDVRVTGSALEV  130

Query  668  VLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLI  513
            V+I G  S   F  IIR+LH+++G +V NA+F +  +S     H ++   L+
Sbjct  131  VVITGQNSHFMFSEIIRMLHEEEGAEVVNASFSMLQDSVFHTLHCKIGECLV  182



>ref|XP_011096311.1| PREDICTED: transcription factor bHLH125 [Sesamum indicum]
Length=181

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = -2

Query  986  PAP-KLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQL  819
            P P K +RK IEKNRRN +K+L + L SL+P HQ   E  +LPDQL+    YIK L+  +
Sbjct  5    PNPSKADRKTIEKNRRNQMKTLCSRLSSLVP-HQTPREVASLPDQLEGATNYIKKLQTNI  63

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            EK +QKK  L+  S  T NSS+  +C  + G      +++VV ++  + V L+ GL S  
Sbjct  64   EKMKQKKNCLVGLSSATANSSARSSCSNSGGLVLPNVDVRVVGSA--LEVALVTGLNSQF  121

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   +R+LH ++G +V NA+F +  NS     H Q+
Sbjct  122  MFTQTLRLLH-EEGAEVLNASFSVLENSIFHTIHCQI  157



>ref|XP_008455310.1| PREDICTED: transcription factor bHLH101-like [Cucumis melo]
Length=205

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 89/161 (55%), Gaps = 13/161 (8%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCL  831
             + + + A K+ER+ IEKNRRN +K+L   L SL+P    +   +ALPDQ+D  +KYIK L
Sbjct  9     SASSSTAAKIERRIIEKNRRNQMKNLCDQLKSLVPQQYSKEVSLALPDQIDVAIKYIKDL  68

Query  830   ENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL  651
             E ++  +++KK  L  K++   N  S           +  P++++      + +VL +G+
Sbjct  69    EKKVNSAKEKKNRLQGKNKSAINMDS---------SSSSSPQLKINQMGKSLEIVLSSGI  119

Query  650   ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             ++       +R+L  ++G++V NA+F + G S     H ++
Sbjct  120   DNQYLLCETLRILQ-EEGIEVVNASFSVSGKSVFHTIHAEL  159



>ref|XP_008353778.1| PREDICTED: transcription factor bHLH118-like isoform X3 [Malus 
domestica]
Length=194

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 98/158 (62%), Gaps = 7/158 (4%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQL  819
            ++ + K+ER+ +EKNRRN +K LY++L+SLLP    +E ++  DQ+DE + YIK  E+ L
Sbjct  8    ESSSTKVERRVVEKNRRNRMKLLYSNLYSLLPKQTFKEPLSQTDQIDEAINYIKSQESNL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +K ++KKE L+ ++RK   +++C N    +    + P I++ +    + VVLI+GLE+  
Sbjct  68   QKLKEKKESLM-RTRKRSYATACVNV--ESTRSAKAPHIKIHEIDSTLEVVLISGLENHQ  124

Query  638  -QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              FY IIR+L ++    V +A F   G+ST  +   ++
Sbjct  125  FMFYDIIRLLDEEHA-NVVHANFSTLGDSTFHIVRAEI  161



>ref|XP_008353776.1| PREDICTED: transcription factor bHLH118-like isoform X1 [Malus 
domestica]
Length=228

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 101/162 (62%), Gaps = 8/162 (5%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQL  819
            ++ + K+ER+ +EKNRRN +K LY++L+SLLP    +E ++  DQ+DE + YIK  E+ L
Sbjct  8    ESSSTKVERRVVEKNRRNRMKLLYSNLYSLLPKQTFKEPLSQTDQIDEAINYIKSQESNL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +K ++KKE L+ ++RK   +++C N    +    + P I++ +    + VVLI+GLE+  
Sbjct  68   QKLKEKKESLM-RTRKRSYATACVNV--ESTRSAKAPHIKIHEIDSTLEVVLISGLENHQ  124

Query  638  -QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV-RWL  519
              FY IIR+L ++    V +A F   G+ST  +   ++ +W+
Sbjct  125  FMFYDIIRLLDEEHA-NVVHANFSTLGDSTFHIVRAEICQWI  165



>ref|XP_004233835.1| PREDICTED: uncharacterized protein LOC101247399 [Solanum lycopersicum]
Length=196

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 86/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQK  801
            +RK IEKNRRN +K LY  L SL+   Q   E ++LPDQL+E   YIK L+  LEK R K
Sbjct  20   DRKTIEKNRRNQMKDLYMKLNSLVHHDQHTKEFLSLPDQLEEAANYIKKLQIDLEKMRLK  79

Query  800  KEEL------LQKSRKTPNSSSCRNCIPAAGEQTEP-PEIQVVDTSPGMSVVLINGLESI  642
            KE L      L  +  + +++  R       E T P P I + + +  + V+LI G +  
Sbjct  80   KEALTATAGTLNSNSNSSSNTDGRTL-----ENTLPLPHIDIHNVNSALEVLLITGYDYH  134

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              F  IIR+LH + G+Q+ +A + + G++     H +V
Sbjct  135  FMFNHIIRMLH-EDGVQIISANYTLVGHTIFHSIHSKV  171



>ref|XP_010039150.1| PREDICTED: transcription factor ORG2-like [Eucalyptus grandis]
 gb|KCW49297.1| hypothetical protein EUGRSUZ_K02855 [Eucalyptus grandis]
Length=187

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 7/166 (4%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIK  837
             +T+   + K+ERK +EKNRR  +  L + L SL+P H     +  ++  DQLD+   YI 
Sbjct  4     STSNNQSLKVERKTVEKNRRIRMNILCSKLASLIPQHHITTSKGSLSRQDQLDQATSYIT  63

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIP-AAGEQTEPPEIQVVDTSPGMSVVLI  660
              L+ +++  + +KE+ + +S     SSS  + I   A     PP  Q+ D   G+ V+LI
Sbjct  64    QLKERIDGLKLRKEQAVLQSEGIDTSSSLTSSIDQKAKLGFVPPVFQLRDHGLGLDVILI  123

Query  659   NGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
             +G       Y +IR+L +++G +V +A+F + G+      H QVR 
Sbjct  124   SGRRKNFMLYEVIRIL-EEEGAEVVSASFSVVGDKIFHTLHAQVRL  168



>ref|XP_010667753.1| PREDICTED: transcription factor bHLH36-like [Beta vulgaris subsp. 
vulgaris]
Length=171

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 78/157 (50%), Gaps = 18/157 (11%)
 Frame = -2

Query  980  PKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQK  801
            PK  RK +EK RRN++K+LY+ L SL+P       LPDQLDE   YIK L+  +E  RQ 
Sbjct  6    PKRSRKTMEKERRNNMKNLYSQLNSLIPNQDPSRPLPDQLDEATNYIKQLQGNVENLRQT  65

Query  800  KEELLQKSRKT------PNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            ++ ++            P  SS  +            +I+V +    + V L+ GLE   
Sbjct  66   RDGMMGVGGSQGSSSTRPGYSSNSSV-----------QIEVNENGSALEVTLVTGLECQF  114

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   +R+LH++   +V NA++ +  N+     H Q+
Sbjct  115  VFTEAVRILHEENA-EVVNASYSVAENTVFHTIHAQI  150



>ref|XP_003525498.1| PREDICTED: uncharacterized protein LOC100811485 [Glycine max]
Length=191

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 90/163 (55%), Gaps = 11/163 (7%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            T+ + +PKL+RK IE+NRR H+KSL   L S +P++     ++ ++  DQLD    YIK 
Sbjct  6    TSTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNDLKPTKDMLSQQDQLDLATTYIKR  65

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L+ ++EK + +KE+++       +S+   N I   G Q   P +++ D   G+ V+LI+G
Sbjct  66   LKERIEKLKGEKEKIMNMMM---SSNQNNNSIFNIGSQL--PLLEIKDLGSGIEVMLISG  120

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            L      Y +I VL +++G +V  A F    +      H QV+
Sbjct  121  LNKNFMLYEVISVL-EEEGAEVVTANFSTVADKIFYTVHAQVK  162



>ref|XP_008794132.1| PREDICTED: uncharacterized protein LOC103710251 [Phoenix dactylifera]
Length=203

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (51%), Gaps = 22/168 (13%)
 Frame = -2

Query  986  PAPKLE---------RKYIEKNRRNHLKSLYTDLFSLLP------AHQERMALPDQLDET  852
            P+P++E         RK +EKNRR  +K+L + L SLLP           + LPD+LDE 
Sbjct  16   PSPQMESSHGSTRPDRKTVEKNRRIQMKALCSKLESLLPNSPTSREGASTLPLPDRLDEA  75

Query  851  VKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMS  672
            V YIK L+ +LE+ +++K++L+     +    S        G+      I+V D  PG+ 
Sbjct  76   VNYIKGLQGRLERMKERKKQLMGSEGTSGGMGS------EMGKGMRSSHIEVQDLGPGLR  129

Query  671  VVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            VV I+       FY  IRVL +++G  V NA F + G+    + H  V
Sbjct  130  VVQISSPVDRLLFYEAIRVL-EEEGGAVLNANFSVVGDKAFHIIHSMV  176



>ref|XP_007025601.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY28223.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=226

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 84/156 (54%), Gaps = 16/156 (10%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKS  810
            + + +RK IE+NRRN +K+LY+ L SL+P H  R   +LPDQL E   YIK L+  LE+ 
Sbjct  55   SSRTDRKLIERNRRNQMKALYSKLNSLIPHHNSRESTSLPDQLGEAANYIKRLQTNLERM  114

Query  809  RQKKEELL--QKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            +++K+ LL  ++S  T  SS  R+           P+I + +    + + L     S   
Sbjct  115  KERKDSLLGVERSMNTSRSSGPRS-----------PQIMIQEMGSSLVIGLTTCSSSQFI  163

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            F   IR+LH ++G ++ NA+F +  ++     H  V
Sbjct  164  FNETIRILH-EEGAEIVNASFSVVDDTVFHTIHLTV  198



>ref|XP_008353779.1| PREDICTED: transcription factor bHLH118-like isoform X4 [Malus 
domestica]
Length=190

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 96/153 (63%), Gaps = 7/153 (5%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQL  819
            ++ + K+ER+ +EKNRRN +K LY++L+SLLP    +E ++  DQ+DE + YIK  E+ L
Sbjct  8    ESSSTKVERRVVEKNRRNRMKLLYSNLYSLLPKQTFKEPLSQTDQIDEAINYIKSQESNL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +K ++KKE L+ ++RK   +++C N    +    + P I++ +    + VVLI+GLE+  
Sbjct  68   QKLKEKKESLM-RTRKRSYATACVNV--ESTRSAKAPHIKIHEIDSTLEVVLISGLENHQ  124

Query  638  -QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQV  543
              FY IIR+L ++    V +A F   G+ST  +
Sbjct  125  FMFYDIIRLLDEEHA-NVVHANFSTLGDSTFHI  156



>ref|XP_009137159.1| PREDICTED: transcription factor bHLH36-like [Brassica rapa]
Length=180

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 86/153 (56%), Gaps = 7/153 (5%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP-AHQERMALPDQLDETVKYIKCLENQLEKSR  807
            A  ++RK IEKNRR  +K+LY++L SLLP   +  + LPDQLDE   YIK L+  +EK  
Sbjct  11   ARSVDRKTIEKNRRIQMKALYSELNSLLPQTSRAPLTLPDQLDEAANYIKKLQVNVEKMT  70

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            ++K + L  +  +P SSS    +P        P+I++ +T P + + L+  +E    F+ 
Sbjct  71   ERKGK-LAATGSSPMSSSVDVSVPR-----RLPKIEIQETGPILHIFLVTSVEHKFIFHE  124

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            II VL ++ G ++T+A      ++     H +V
Sbjct  125  IISVLTEESGAEITHAGSSTVDDTVFHTLHCKV  157



>ref|XP_002869917.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46176.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 89/154 (58%), Gaps = 5/154 (3%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK IEKNRR  +KSLY++L SLLP    R  + LPD+LDE   YIK L+  +EK R++
Sbjct  14   VDRKTIEKNRRMQMKSLYSELISLLPHQSSREPLTLPDELDEAANYIKKLQVNVEKKRER  73

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFY  630
            K +L+  +     +S   + + ++ + + P   P+I++ +T     + L+  LE    F 
Sbjct  74   KRKLVATTTFEKLNSVGSSSVSSSVDVSVPRRLPKIEIQETGSIFHIFLVTSLEHKFMFC  133

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             I+R+L ++ G ++T+A + I  ++     H +V
Sbjct  134  EIVRLLTEELGAEITHAGYSIVNDAVFHTLHCKV  167



>ref|XP_008342971.1| PREDICTED: transcription factor bHLH36-like [Malus domestica]
Length=247

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 98/158 (62%), Gaps = 7/158 (4%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQL  819
            ++ + K+ER+ +EKNRRN +K LY++L+SLLP    +E ++  DQ+DE + YIK  E+ L
Sbjct  8    ESSSTKVERRVVEKNRRNRMKLLYSNLYSLLPKQTFKEPLSQTDQIDEAINYIKSQESXL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +K ++KKE L+ ++RK   +++C N    +    + P I++ +    + VVLI+GLE+  
Sbjct  68   QKLKEKKESLM-RTRKRSYATACVNV--ESTRSAKAPHIKIHEXDSTLEVVLISGLENHQ  124

Query  638  -QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              FY IIR+L ++    V +A F   G+ST  +   ++
Sbjct  125  FMFYDIIRLLDEEHA-NVVHANFSTLGDSTFHIVRAEI  161



>ref|XP_004155520.1| PREDICTED: uncharacterized protein LOC101232753 [Cucumis sativus]
 gb|KGN43623.1| hypothetical protein Csa_7G048070 [Cucumis sativus]
Length=210

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 90/161 (56%), Gaps = 8/161 (5%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCL  831
             + + + A K+ER+ IEKNRRN +K+L   L SL+P    +   +ALPDQ+D  +KYIK L
Sbjct  8     SASSSTAAKIERRIIEKNRRNQMKNLCDQLKSLVPQQDSKEVSLALPDQIDVAIKYIKDL  67

Query  830   ENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL  651
             E ++  +++KK  L  K++   N     +   ++   +  P++++      + ++L +G 
Sbjct  68    EKRVNSAKEKKNRLQGKNKSAIN----MDSSSSSSSSSSSPQLKINQMGKSLEIILSSGN  123

Query  650   ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             ++       +R+L  ++G +V +A+F + GNS     H Q+
Sbjct  124   DNQYLLCETLRILE-EEGTEVVSASFSVSGNSVFHTIHAQL  163



>ref|XP_010057405.1| PREDICTED: uncharacterized protein LOC104445266 [Eucalyptus grandis]
 gb|KCW74555.1| hypothetical protein EUGRSUZ_E03270 [Eucalyptus grandis]
Length=181

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER---MALPDQLDETVKYIKCLENQ  822
            K  + + +RK  E+NRRN +K+L + L SL+P    R   +++PDQL +   YIK L+ +
Sbjct  4    KPGSSRADRKTTERNRRNRMKALLSKLHSLVPPQCPRESTLSMPDQLGKAANYIKNLQVK  63

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            ++K R++KE LL+  +    +++  N +       + PEI +  +   + VVL+ GL+  
Sbjct  64   VQKMREQKERLLEIEKI---NTTMNNGLTIG---FKSPEIGIRKSGSILEVVLVTGLDGQ  117

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
              F   +RV+H ++G  V NA F   G++ L   H +V
Sbjct  118  FMFNETVRVIH-EEGADVMNANFSYVGDAMLHTVHAKV  154



>gb|ABD32361.2| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=221

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 93/173 (54%), Gaps = 29/173 (17%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---------------------ERMALPD  867
            + +++RK++E+NRRN +K+L   L SLLP HQ                     E +++PD
Sbjct  36   SSRVDRKFVERNRRNQMKALCQKLNSLLP-HQTSKASLLSLIFFLLLYSLRCLEAISVPD  94

Query  866  QLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDT  687
            QL E   YIK L+  LEK ++KK  LL   R  PN +  RN     G ++  P+I++   
Sbjct  95   QLKEATNYIKKLQINLEKMKEKKNFLLGIQR--PNVNLNRN--QKMGLKS--PKIKIQQI  148

Query  686  SPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               + VVLI GLES   F    RVLH ++G+ + NA+++++ +S     H QV
Sbjct  149  GLVLEVVLITGLESQFLFSETFRVLH-EEGVDIVNASYKVNEDSVFHSIHCQV  200



>gb|KHG17385.1| Transcription factor bHLH36 -like protein [Gossypium arboreum]
Length=168

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 12/144 (8%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQK  801
            ++RK+IE+NRR  +K+LY+ L SL+P H  R  ++LPDQLDE   YIK L+  LE+ ++ 
Sbjct  1    MDRKFIERNRRIQMKALYSKLNSLVPHHSSREAISLPDQLDEATNYIKRLKANLERMKEM  60

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGII  621
            K+ L     +   S S           ++ P+IQ+ +    +++ L  G  S   F   I
Sbjct  61   KDGLRGLEERGNTSRSY---------GSKSPQIQIQEIGSSLAIALNTGFNSQFIFNETI  111

Query  620  RVLHKQQGLQVTNATFQIHGNSTL  549
            R++H+++  +V NA F +  + T+
Sbjct  112  RIVHEERA-EVVNANFSVVDDDTV  134



>emb|CDO99531.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH-QERMALPDQLDETVKYIKCLENQLEKSR  807
            + K +RK IE++RRN +K+LY+ L SL+P   +E  +LPDQL+E   YIK ++ +LEK  
Sbjct  7    SSKADRKTIERDRRNRMKTLYSKLTSLIPPQSREASSLPDQLEEATNYIKKMQIKLEK--  64

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
                  L++ R   N +   +    A      P I + +    + VVLI   +    F  
Sbjct  65   ------LKERRDFTNGTRLSSDTDTASAGLRLPHIDIQERGSALEVVLITKSDCQFMFTE  118

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
             IR+LH ++G +V NA+F + G +     H
Sbjct  119  TIRLLH-EEGAEVVNASFSVLGETIFHTVH  147



>gb|KHN30895.1| hypothetical protein glysoja_017432 [Glycine soja]
Length=190

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 94/167 (56%), Gaps = 19/167 (11%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALP--DQLDETVKYI  840
              +T T + KL+RK IEKNRR H+KSL   L SL+P +    + ++ L   DQLD   +YI
Sbjct  6     ASTSTESSKLDRKTIEKNRRIHMKSLCDQLSSLIPPNLKPAKSKLMLGQRDQLDLAARYI  65

Query  839   KCLENQLEKSRQKKEELLQKS--RKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVV  666
             K +  ++EK +++KE+++  +  RK  N++           +++ P +++ D    + V+
Sbjct  66    KHMNERIEKLKRQKEQVMSNNDDRKMFNNNV----------ESKLPIVELRDLGSSIEVM  115

Query  665   LINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             L++GL      Y +I VL +++G +V  A+F   G+    V H QV+
Sbjct  116   LVSGLNKTFMLYEVISVL-EEEGAEVVTASFSTVGDKIFYVVHAQVK  161



>ref|XP_007138091.1| hypothetical protein PHAVU_009G179600g [Phaseolus vulgaris]
 gb|ESW10085.1| hypothetical protein PHAVU_009G179600g [Phaseolus vulgaris]
Length=191

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 89/157 (57%), Gaps = 14/157 (9%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALP--DQLDETVKYIKCLENQLE  816
            KL+RK IE+NRR H+KSL   L SL+P +    + ++ L   DQLD   +YIK +  ++E
Sbjct  14   KLDRKTIERNRRIHMKSLCHQLGSLIPPNLKPPKSKLMLGQQDQLDLAARYIKHMRERIE  73

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            K +++KE+ +       N SS R  +    + T+ P +++ D   G+ V+L++GL     
Sbjct  74   KLKRQKEKAMS------NQSSDRKMLDKNVD-TKLPVLELRDLGSGIEVMLVSGLNKTFM  126

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             Y +I VL +++G +V  A+F   G+    V H QV+
Sbjct  127  LYEVINVL-EEEGAEVVTASFSTVGDKIFYVVHAQVK  162



>ref|XP_003523076.1| PREDICTED: uncharacterized protein LOC100790403 [Glycine max]
Length=190

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 94/167 (56%), Gaps = 19/167 (11%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALP--DQLDETVKYI  840
              +T T + KL+RK IEKNRR H+KSL   L SL+P +    + ++ L   DQLD   +YI
Sbjct  6     ASTSTESSKLDRKTIEKNRRIHMKSLCHQLSSLIPPNLKPAKSKLMLGQRDQLDLAARYI  65

Query  839   KCLENQLEKSRQKKEELLQKS--RKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVV  666
             K +  ++EK +++KE+++  +  RK  N++           +++ P +++ D    + V+
Sbjct  66    KHMNERIEKLKRQKEQVMSNNDDRKMFNNNV----------ESKLPIVELRDLGSSIEVM  115

Query  665   LINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             L++GL      Y +I VL +++G +V  A+F   G+    V H QV+
Sbjct  116   LVSGLNKAFMLYEVISVL-EEEGAEVVTASFSTVGDKIFYVVHAQVK  161



>gb|KHN09998.1| Transcription factor bHLH36 [Glycine soja]
Length=172

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 83/156 (53%), Gaps = 11/156 (7%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMAL--PDQLDETVKYIKCLENQLE  816
            + + + +RK+IE+NRRNH+K L+  L S++P    R A+  PDQ+ E   YIK L+ +LE
Sbjct  6    SSSSRTDRKFIEQNRRNHMKDLFFKLNSVVPHQSSREAISRPDQIGEATNYIKNLQIKLE  65

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            K ++KK  L+   R + N S     + +       P+ ++      + V LI GL+    
Sbjct  66   KMKEKKNNLIDIKR-SKNVSMNMGLLKS-------PQFKIQQMGSTLEVFLITGLDCQFM  117

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            F   +RVL +++G  V NA++ +  N      H QV
Sbjct  118  FNETVRVL-QEEGSDVVNASYTVVENEVFHTIHCQV  152



>gb|KFK28692.1| hypothetical protein AALP_AA7G034000 [Arabis alpina]
Length=185

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 8/152 (5%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPA-HQERMALPDQLDETVKYIKCLENQLEKSRQKKE  795
            +RK +EKNRR  +KSLY++L SLLP   +E + LPDQLDE   YIK L+  +EK R++K 
Sbjct  15   DRKTVEKNRRIQMKSLYSELNSLLPQPSRELLTLPDQLDEAANYIKRLQVNVEKKRERKR  74

Query  794  ELLQKS---RKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            +L+  +   +     SS  N I         P+I++ +T   + + L+  LE    F  I
Sbjct  75   KLIATTCFEKSNSAGSSSVNVIAPK----RVPKIEIQETGSILHIFLVTSLEHKFMFSEI  130

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            IR+L ++   ++T+A +    ++     H +V
Sbjct  131  IRLLTEELEAEITHAGYSTVDDAVFHTLHCKV  162



>ref|XP_010039149.1| PREDICTED: uncharacterized protein LOC104427821 [Eucalyptus grandis]
 gb|KCW49296.1| hypothetical protein EUGRSUZ_K02854 [Eucalyptus grandis]
Length=187

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 90/166 (54%), Gaps = 7/166 (4%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ---ERMALP--DQLDETVKYIK  837
             +T+   + K+ERK +EKNRR  +  L + L SL+P H     + +LP  DQLD+   YI 
Sbjct  4     STSNNQSLKVERKTLEKNRRIRMNILCSKLASLIPQHHITTSKESLPRQDQLDQAASYIT  63

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIP-AAGEQTEPPEIQVVDTSPGMSVVLI  660
              L+ +++  + +KE+ + +S     SSS  + I   A     PP  Q+ D   G+ V+LI
Sbjct  64    QLKERIDGLKLRKEQAVLQSEGIDTSSSLTSSIDQKAKLGFVPPVFQLRDHGLGLEVILI  123

Query  659   NGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
             +G       Y +IR+L +++G +V +A+F + G+      + QVR 
Sbjct  124   SGRRKNFMLYEVIRIL-EEEGAEVVSASFSVVGDKIFHTLNAQVRL  168



>ref|XP_006371550.1| hypothetical protein POPTR_0019s13080g [Populus trichocarpa]
 gb|ERP49347.1| hypothetical protein POPTR_0019s13080g [Populus trichocarpa]
Length=163

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 74/122 (61%), Gaps = 5/122 (4%)
 Frame = -2

Query  890  QERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP  711
            QE   LPDQ+D  + YIK LE +LEK+R+KKE  L +SRK   S +C    P +   ++ 
Sbjct  2    QEAQPLPDQIDRAINYIKSLEEKLEKAREKKES-LTRSRK--GSYTC-TFDPLSSAASKS  57

Query  710  PEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            P++++ +      +VL +GL +   FY II +LH ++G++V +A FQ  G+S   + H Q
Sbjct  58   PQLKIHEIGSVREIVLTSGLGNQFLFYEIISILH-EEGVEVVSANFQALGDSFFHIVHAQ  116

Query  530  VR  525
            ++
Sbjct  117  MK  118



>ref|XP_010915430.1| PREDICTED: uncharacterized protein LOC105040557 [Elaeis guineensis]
Length=180

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 12/153 (8%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIKCLENQLEKSR  807
            +RK IEK+RR  +K+L + L SLLP          + LPD+LDE V YIK L+ +LE+ +
Sbjct  11   DRKTIEKHRRIQMKALCSKLDSLLPNPPTSREGAALPLPDRLDEAVNYIKSLQGRLERMK  70

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            ++K +LL+     P  SS R            P+I+V D   G  VV+I+       FY 
Sbjct  71   ERKRQLLE-----PEGSS-RGMGSEERGGMGLPQIEVQDLGSGFRVVIISSPGDRLMFYE  124

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             +RVL ++ G ++ NA F + G+  +   H  V
Sbjct  125  AVRVLEEEGG-EILNANFLVVGDKAVHSIHSMV  156



>ref|XP_004298935.1| PREDICTED: uncharacterized protein LOC101299087 [Fragaria vesca 
subsp. vesca]
Length=191

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 85/168 (51%), Gaps = 12/168 (7%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP-------AHQERMALPDQLDETVKYIK  837
            T   + KL+RK +E+NRR  +K L   L S++P         +E M    QLD    YIK
Sbjct  5    TSETSSKLDRKTVERNRRIQMKGLCFKLASMVPPQYFKSSKSKEMMTQQSQLDLAASYIK  64

Query  836  CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ----TEPPEIQVVDTSPGMSV  669
             L  ++E  +++KE+ L+    T N SS  N   A  +     +  P I++ ++ P + V
Sbjct  65   QLTERIENLKERKEKELKSQSGTSNKSSITNVDRANNKAVVVGSRLPIIKMSESGPSIEV  124

Query  668  VLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            +LI+GL     FY +I VL  ++G +V +A F   G+      H QV+
Sbjct  125  MLISGLNKNFMFYEVISVLQ-EEGAEVVSANFSTVGDKIFHTLHAQVK  171



>ref|XP_003541532.1| PREDICTED: uncharacterized protein LOC100789728 [Glycine max]
Length=173

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 81/153 (53%), Gaps = 11/153 (7%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMAL--PDQLDETVKYIKCLENQLE  816
            + + + +RK+IE+NRRNHLK L+  L S++P    R A+  PDQ+ E   YIK L+ +LE
Sbjct  6    SSSSRTDRKFIEQNRRNHLKDLFFKLNSVVPHQSSREAISRPDQIGEATNYIKNLQIKLE  65

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            K ++KK  L+   R + N S     + +       P+ ++      + V LI GL+    
Sbjct  66   KMKEKKNNLIDIKR-SKNVSMNMGLLKS-------PQFKIQQMGSTLEVFLITGLDCQFM  117

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
            F   +RVL +++G  V NA++ +  N      H
Sbjct  118  FNETVRVL-QEEGSDVVNASYTVVENEVFHTIH  149



>gb|KHN19314.1| hypothetical protein glysoja_012234 [Glycine soja]
Length=193

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 88/165 (53%), Gaps = 13/165 (8%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQE------RMALPDQLDETVKYI  840
              +T   + KL+RK IE+NRR H+KSL   L SL+P + +       + L DQLD   +YI
Sbjct  7     ASTSNESSKLDRKTIERNRRTHMKSLCHQLSSLIPPNLKPAKPKLMLGLQDQLDLAARYI  66

Query  839   KCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLI  660
             + +  ++EK +++KE+ +       N S+    +     +++ P +++ D   G+ V+L+
Sbjct  67    RQMTERVEKLKRQKEQAMS------NQSNDGRKMFNNNVESKLPILELRDLGSGIEVILV  120

Query  659   NGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              GL      Y +I VL +++G +V  A+F   G+    V H Q +
Sbjct  121   TGLNKTFMLYEVISVL-EEEGAEVVTASFSTVGDKIFYVVHAQAK  164



>ref|XP_003527022.1| PREDICTED: uncharacterized protein LOC100809363 [Glycine max]
Length=193

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 88/165 (53%), Gaps = 13/165 (8%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQE------RMALPDQLDETVKYI  840
              +T   + KL+RK IE+NRR H+KSL   L SL+P + +       + L DQLD   +YI
Sbjct  7     ASTSNESSKLDRKTIERNRRTHMKSLCHQLSSLIPPNLKPVKPKLMLGLQDQLDLAARYI  66

Query  839   KCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLI  660
             + +  ++EK +++KE+ +       N S+    +     +++ P +++ D   G+ V+L+
Sbjct  67    RQMTERVEKLKRQKEQAMS------NQSNDGRKMFNNNVESKLPILELRDLGSGIEVILV  120

Query  659   NGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              GL      Y +I VL +++G +V  A+F   G+    V H Q +
Sbjct  121   TGLNKTFMLYEVISVL-EEEGAEVVTASFSTVGDKIFYVVHAQAK  164



>ref|XP_011021492.1| PREDICTED: transcription factor bHLH118-like [Populus euphratica]
Length=205

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 90/155 (58%), Gaps = 22/155 (14%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLEKS  810
            + K ERK  EKNRR  +K+LY+ L SLLP  +  E+  LPDQ+DE + YIK LE +LE++
Sbjct  37   STKTERKVNEKNRRYQMKTLYSKLNSLLPDKKSTEKQPLPDQIDEAISYIKSLEIKLEET  96

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++KKE L   +  TP S                P++++ +T   + +V   GL++   FY
Sbjct  97   KEKKESL---TFATPKS----------------PKLKIQETGSALEIVFTCGLDNQFLFY  137

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             II +LH ++G++V +A  Q  G+S   V H Q++
Sbjct  138  EIISILH-EEGVEVVSANSQALGDSFFHVVHAQMK  171



>ref|XP_009409379.1| PREDICTED: uncharacterized protein LOC103991605 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 87/151 (58%), Gaps = 14/151 (9%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMA--LPDQLDETVKYIKCLENQLE  816
            + +L+RK +EKNRR H+K+LY  L SLLP  A QE +A  LP+QLDE + YIK ++  LE
Sbjct  7    SARLDRKIVEKNRRIHMKALYAKLVSLLPASASQESVAATLPNQLDEAINYIKAMQETLE  66

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING-LESIS  639
            + +++K+ L+  +    +  +   C+         P+++V D + G+ V+ I+   +   
Sbjct  67   RMKKRKKLLMWCAGIGKDEEN--TCL-------RVPKMEVQDLNSGLRVIAISSTCDHRL  117

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQ  546
            +F   +R++   +G ++  A++ + G++   
Sbjct  118  KFSEAVRIVEAAEGNEIITASYAVVGDAAFH  148



>gb|KDP20980.1| hypothetical protein JCGZ_21451 [Jatropha curcas]
Length=162

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 75/138 (54%), Gaps = 5/138 (4%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAHQER--MALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPN  762
            +K+LY+ L SL+P    R  M+LPDQL+E  +YIK L+  LEK +++K  L     +  N
Sbjct  1    MKALYSKLNSLVPHQTSREPMSLPDQLEEAARYIKKLQTNLEKMKERKNNL--TGNEMEN  58

Query  761  SSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTN  582
             +S  +      +    P+I++ +    + +VLI GL+S   F   IRVLH ++G ++ N
Sbjct  59   KASLMSSSRTTMQYLRSPQIEIHEMGSALEIVLITGLDSQFMFNETIRVLH-EEGAEIVN  117

Query  581  ATFQIHGNSTLQVAHEQV  528
            A F    ++     H ++
Sbjct  118  ANFSAINDTVFHTIHSKI  135



>emb|CBI29562.3| unnamed protein product [Vitis vinifera]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 15/132 (11%)
 Frame = -2

Query  908  SLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCI  738
            SL+P HQ   E + LPDQLDE   YIK L+ +LEK +++K+ L+   R  PN+S      
Sbjct  2    SLVP-HQTSREAITLPDQLDEAANYIKRLQEKLEKMKERKDNLMGFER--PNTS------  52

Query  737  PAAGEQT--EPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIH  564
            P +G     +PP+I + +    + VVLI GL+    F   IRVLH ++G ++ NA+F + 
Sbjct  53   PNSGAMVGLKPPQIDIHEKGSALEVVLITGLDFQFMFNETIRVLH-EEGAEIVNASFSVV  111

Query  563  GNSTLQVAHEQV  528
             ++     H QV
Sbjct  112  DDTVFHTIHAQV  123



>ref|XP_002325417.2| hypothetical protein POPTR_0019s05030g [Populus trichocarpa]
 gb|EEE99798.2| hypothetical protein POPTR_0019s05030g [Populus trichocarpa]
Length=200

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 90/153 (59%), Gaps = 22/153 (14%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLEKSRQ  804
            K ERK  EKNRRN +K+LY+ L SLLP  +  E+  LPDQ+DE + YIK LE +LEK+++
Sbjct  23   KTERKVSEKNRRNQMKTLYSKLNSLLPDKESTEKQPLPDQIDEAISYIKTLEEKLEKTKE  82

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGI  624
            KKE L   + K+                   P++++ +T   + +V  +GL++   FY I
Sbjct  83   KKESLTFATSKS-------------------PKLKIQETGSALEIVFTSGLDNQFLFYEI  123

Query  623  IRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            I +LH ++G++V +A  Q  G+S   V H Q++
Sbjct  124  ISILH-EEGVEVVSANSQALGDSFFHVVHAQMK  155



>ref|XP_007159331.1| hypothetical protein PHAVU_002G229100g [Phaseolus vulgaris]
 gb|ESW31325.1| hypothetical protein PHAVU_002G229100g [Phaseolus vulgaris]
Length=171

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 88/155 (57%), Gaps = 12/155 (8%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQLEK  813
             + K +RK++E++RR+ +K L++ L S+LP  + +ER++ PDQ+ E   YIK L+ +LEK
Sbjct  6    SSSKSDRKFVERDRRSQMKDLFSKLNSVLPHQSSRERISRPDQIGEATDYIKNLQIKLEK  65

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             ++KK  L    R        RN     G ++   +IQ + ++  + VVL+ GL+    F
Sbjct  66   MKEKKSNLTDIER-------SRNDSMNMGVKSSEFKIQQMGST--LEVVLVTGLDCQFIF  116

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
               IR+L +++G  + NA++ +  N+     H QV
Sbjct  117  NETIRIL-QEEGSDIVNASYTVVENAVFHTIHCQV  150



>ref|XP_006493102.1| PREDICTED: uncharacterized protein LOC102607218 [Citrus sinensis]
Length=220

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 88/159 (55%), Gaps = 11/159 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-----MALPDQLDETVKYIKCLENQL  819
            + KL+RK IEKNRR+H+KSL   LFSL+P+H  +     ++  DQLD    YIK L  ++
Sbjct  47   SSKLDRKNIEKNRRDHMKSLCFKLFSLVPSHHFKASKSMLSQEDQLDLACCYIKQLRERI  106

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGE-QTEPPEIQVVDTSPGMSVVLINGLESI  642
            +K  + K + ++  +  PNSS+  N +       +  P +++ D    + VVLI+G++  
Sbjct  107  DKLNRMKGQAMKSIK--PNSSN--NILDETNNICSNLPVVELRDLGSSIEVVLISGVQRN  162

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               Y +I +L +++G QV +A+F   G+        Q +
Sbjct  163  FMLYEVISIL-EEEGAQVVSASFSTIGDKIFHTVRAQAK  200



>ref|XP_010647398.1| PREDICTED: transcription factor bHLH36-like, partial [Vitis vinifera]
Length=134

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 11/122 (9%)
 Frame = -2

Query  887  ERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQT--E  714
            E + LPDQLDE   YIK L+ +LEK +++K+ L+   R  PN+S      P +G     +
Sbjct  1    EAITLPDQLDEAANYIKRLQEKLEKMKERKDNLMGFER--PNTS------PNSGAMVGLK  52

Query  713  PPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHE  534
            PP+I + +    + VVLI GL+    F   IRVLH ++G ++ NA+F +  ++     H 
Sbjct  53   PPQIDIHEKGSALEVVLITGLDFQFMFNETIRVLH-EEGAEIVNASFSVVDDTVFHTIHA  111

Query  533  QV  528
            QV
Sbjct  112  QV  113



>ref|XP_009336214.1| PREDICTED: transcription factor bHLH36-like [Pyrus x bretschneideri]
Length=220

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 102/167 (61%), Gaps = 13/167 (8%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQ  822
            +K+ + K+ER+ +EKNRRNHLK LY+ L+SLLP    +E +++ +Q+DE + YIK  E++
Sbjct  7    SKSSSTKVERRVVEKNRRNHLKLLYSKLYSLLPNQNPKEPLSVNEQIDEAINYIKSKESK  66

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPA--------AGEQTEPPEIQVVDTSPGMSVV  666
            L+K+++KKE L   +RK  N+++  N            +   T+ P+IQ+ +T   + VV
Sbjct  67   LQKAKEKKESLT-GTRKRSNATAFVNVESMEPKTLNIESVRSTKAPQIQIHETGSTVEVV  125

Query  665  LINGLESISQ-FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            L +GL++    FY IIR+L ++Q   V  A+F   G++   V   ++
Sbjct  126  LTSGLDNHQFIFYEIIRILDEEQA-DVVYASFSTLGDTIFHVVRAEM  171



>ref|XP_009400066.1| PREDICTED: uncharacterized protein LOC103984307 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 80/149 (54%), Gaps = 18/149 (12%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKK  798
            KLERK +EKNRR H+K+L + L SL+P  +  +   DQLD+   YIK L+ ++++ R+ K
Sbjct  9    KLERKTVEKNRRIHMKNLCSKLSSLIPVSKNTVTQKDQLDQAFDYIKDLKERVDRLRELK  68

Query  797  EELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIR  618
            E    +SR                    P +++V +  P + V+L+ G  +   F+ +I 
Sbjct  69   E---MRSRVMIG--------------FRPAQVEVRNLDPNLEVILVCGSRTRFMFHEVIS  111

Query  617  VLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            VL +++G++V NA+F   G+      H Q
Sbjct  112  VL-EEEGVEVINASFSTVGDRIFHSIHCQ  139



>ref|XP_008782439.1| PREDICTED: uncharacterized protein LOC103701976 [Phoenix dactylifera]
Length=186

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 79/157 (50%), Gaps = 11/157 (7%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIKCLENQ  822
             A K+ERK +EKNRR H+K L   L SL+P     + ++ +   D LD    YIK L  +
Sbjct  14   SAAKMERKMVEKNRRMHMKGLCFKLSSLIPREHITSSKDALTQQDYLDLAASYIKSLRER  73

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            +E  +Q++E  L+ S     +    N +         P I+V      + VVLI+GL   
Sbjct  74   IENLKQRRE--LRTSTDVGINKGISNGMAKG---MSLPVIEVRHQESNLEVVLISGLNRS  128

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
              F+ +I +L +++G +V NA+F I G+      H Q
Sbjct  129  FTFHEVISIL-EEEGAEVVNASFSIVGDKIFHTIHSQ  164



>ref|XP_010936746.1| PREDICTED: uncharacterized protein LOC105056299 [Elaeis guineensis]
Length=179

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 82/162 (51%), Gaps = 12/162 (7%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIK  837
             ++    A K+ERK +EKNRR H+K L   L SL+P     + ++ +   D LD+   YIK
Sbjct  3     SSNGGSAAKMERKMVEKNRRMHMKRLCFKLSSLIPREHISSSKDVLTQQDYLDQAASYIK  62

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLIN  657
              L+ ++E  + ++E  LQ S    N     N +P        P I+V      + VVLI+
Sbjct  63    SLQGRIENLKHRRE--LQTSTNGIN-KDISNEMPIG---MRLPVIEVRHQESNLEVVLIS  116

Query  656   GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             GL     F+ +I +L +++G +V NA F + G+      H Q
Sbjct  117   GLNRSFTFHEVISIL-EEEGAEVVNANFSVVGDKIFHTIHSQ  157



>ref|XP_002318646.1| hypothetical protein POPTR_0012s08050g [Populus trichocarpa]
 gb|EEE96866.1| hypothetical protein POPTR_0012s08050g [Populus trichocarpa]
Length=179

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 83/160 (52%), Gaps = 11/160 (7%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLEN  825
            + + +L+RK +E+NRR H+K L   L SLLP H     ++ ++  DQL+    YIK L  
Sbjct  6    SESSRLDRKTVERNRRIHMKDLCLKLASLLPPHLFKPSKDMLSQQDQLELAACYIKQLRE  65

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++E  ++ KEE  Q    T  SSS +  +         P +++ D    + VVLI+GL  
Sbjct  66   RVEGLKRVKEE--QAITTTRTSSSAKTSMMIG---LRLPVVELRDFGSTIEVVLISGLNK  120

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               FY +I VL   +G +V +A++   G+      H QVR
Sbjct  121  NFMFYEVINVL-SDEGAEVISASYSTVGDKVFHTIHAQVR  159



>ref|XP_010940038.1| PREDICTED: uncharacterized protein LOC105058719 [Elaeis guineensis]
Length=179

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 82/156 (53%), Gaps = 12/156 (8%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIKCLENQL  819
            A K+ERK +EKNRR H+KSL   L SL+P       ++ +   D LD    YIK L++++
Sbjct  9    AAKMERKTVEKNRRLHMKSLCLKLSSLIPKEHISTSKDVLTQQDHLDLATSYIKMLQDRI  68

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            EK +Q++E  LQ S +  ++   R            P I+V      + VVLI GL    
Sbjct  69   EKLKQRRE--LQTSVEGISNDISREMTIG----IRLPVIEVRHQDSNLEVVLITGLNKSF  122

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             F+ +I +L +++G +V +A+F   G+    + H +
Sbjct  123  MFHEVISIL-EEEGAEVVSASFSAVGDKIFHIIHSK  157



>gb|KCW74559.1| hypothetical protein EUGRSUZ_E03273 [Eucalyptus grandis]
Length=159

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 82/139 (59%), Gaps = 10/139 (7%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTP  765
            +K+L+++L SL+P     ++ ++LPDQL E   YI+ L+ ++EK R++KE+LL+  +   
Sbjct  1    MKALFSELHSLVPPRSPTEKTLSLPDQLGEAANYIRSLQVKVEKMREQKEQLLELGK---  57

Query  764  NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVT  585
              ++  N  P  G ++  PEI++ +    + VVL+ GL+    F   +RV+H ++G  + 
Sbjct  58   -INTTMNSGPMIGFKS--PEIRIWNNKSILEVVLVTGLDGQFMFNETVRVIH-EEGADIV  113

Query  584  NATFQIHGNSTLQVAHEQV  528
            NA+    G++ L   H +V
Sbjct  114  NASSSYVGDAMLHTIHAKV  132



>ref|XP_006447290.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
 gb|ESR60530.1| hypothetical protein CICLE_v10016466mg [Citrus clementina]
Length=169

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 20/164 (12%)
 Frame = -2

Query  890  QERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP  711
            QE ++LPDQ+DE + YIK LE +L++ ++KKE L  + R     S             + 
Sbjct  4    QEELSLPDQVDEAINYIKMLETKLKECKKKKESLQGRERSHACISDGTEARLMTSSSPKA  63

Query  710  PEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            PEI++ +    + V+L +G++    FY +IR+LH Q G ++ NA F + GN+   V H +
Sbjct  64   PEIEIHEMGSNLEVILTSGVDDQFIFYDVIRILH-QDGAEILNANFSVVGNTIFHVIHAE  122

Query  530  VRWLLIMLSCLPKFISD*PGFFQVGKSEMGMIAERLKVVIKGCP  399
            +R                   F  G ++   I+ERLK  + GC 
Sbjct  123  IR----------------DSMFGFGAAK---ISERLKGFVSGCA  147



>ref|XP_006476761.1| PREDICTED: uncharacterized protein LOC102614927 [Citrus sinensis]
Length=181

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 88/159 (55%), Gaps = 11/159 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQL  819
            + K +RK IEKNRR+H+KSL   L SL+P+H     ++ ++  DQLD    YIK L  ++
Sbjct  8    SSKPDRKTIEKNRRDHMKSLCFKLSSLIPSHHFKASKDMISQQDQLDLASCYIKQLRERV  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ-TEPPEIQVVDTSPGMSVVLINGLESI  642
            +K +  KE  ++  +  PN  S  N +    +  +  P +++ D    + V+LI+GL+  
Sbjct  68   DKLKGMKERAMKSIK--PN--SINNIMDEKNDFCSNLPVVELRDLGSSIEVILISGLQRS  123

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               Y +I +L +++G +V +A+F   G+      H QV+
Sbjct  124  FMLYEVISIL-EEEGAEVVSASFSTVGDKVFHSVHAQVK  161



>ref|XP_011028585.1| PREDICTED: uncharacterized protein LOC105128559 [Populus euphratica]
Length=178

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 83/162 (51%), Gaps = 12/162 (7%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCL  831
            + +   KL+RK +EKNRR H+K L   L SL+P H     ++ ++  DQL+    YIK +
Sbjct  4    SNSETSKLDRKTVEKNRRVHMKDLCFKLASLVPHHFFKPSKDMLSQQDQLELAACYIKQM  63

Query  830  ENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL  651
              ++EK ++ KE+ +          + R+ + +       P I++ D    + VVL++GL
Sbjct  64   RERVEKLKRAKEQAI------TTIQTSRSSMASMMIGLRLPVIELRDFGSSIEVVLVSGL  117

Query  650  ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                 FY +I VL   +G +V +A++   G+      H QVR
Sbjct  118  NKNFMFYEVISVL-SDEGAEVVSASYSTVGDKVFHTIHAQVR  158



>ref|XP_008369936.1| PREDICTED: transcription factor bHLH36-like [Malus domestica]
Length=233

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 102/167 (61%), Gaps = 13/167 (8%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQ  822
            +++ + K+ER+ +EKNRRNHLK LY+ L+SLLP    +E  +L +Q DE + YIK  E++
Sbjct  20   SQSSSTKVERRVVEKNRRNHLKLLYSKLYSLLPNQNPKEPPSLNEQTDEAINYIKSKESK  79

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPA--------AGEQTEPPEIQVVDTSPGMSVV  666
            L+K+++KKE L+  +RK  N+++  N            +   T+ P+IQ+ +T   + VV
Sbjct  80   LQKAKEKKESLM-GTRKRSNATAFVNVESMEPKTLNIESVRSTKAPQIQIHETGSTVEVV  138

Query  665  LINGLESISQ-FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            L +GLE+    FY IIR+L ++Q   + +A+F   G++   V   ++
Sbjct  139  LTSGLENHQFIFYQIIRILDEEQA-DIVHASFSTLGDTVFHVVRAEM  184



>ref|XP_011044317.1| PREDICTED: uncharacterized protein LOC105139543 [Populus euphratica]
 ref|XP_011044318.1| PREDICTED: uncharacterized protein LOC105139543 [Populus euphratica]
Length=179

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 81/160 (51%), Gaps = 11/160 (7%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLEN  825
            +   +L+RK +E+NRR H+K L   L SLLP H     ++  +  DQL+    YIK L  
Sbjct  6    SETSRLDRKTVERNRRIHMKDLCWKLASLLPPHLSEPSKDMQSQQDQLELAACYIKQLRE  65

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++E  ++ KEE  Q    T  SSS    I         P +++ D    + VVLI+GL  
Sbjct  66   RVEGLKRVKEE--QAITTTRTSSSAMTSIMIG---LRLPMVELRDFGSTIEVVLISGLNK  120

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               FY +I VL  ++G +V +A++   G+      H QVR
Sbjct  121  NFMFYEVINVL-SEEGAEVVSASYSTVGDKVFHTIHAQVR  159



>ref|XP_006442006.1| hypothetical protein CICLE_v10024201mg [Citrus clementina]
 gb|ESR55246.1| hypothetical protein CICLE_v10024201mg [Citrus clementina]
Length=181

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 91/164 (55%), Gaps = 13/164 (8%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-----MALPDQLDETVKYIKC  834
            + K+  P  ERK IEKNRR+H+KSL   LFSL+P+H  R     ++  D+LD    +IK 
Sbjct  5    SDKSSKP--ERKNIEKNRRDHMKSLCFKLFSLVPSHHFRASKSMLSQEDRLDLACCHIKQ  62

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGE-QTEPPEIQVVDTSPGMSVVLIN  657
            L  +++K ++ KE+ ++  +  PNS++  N +       +  P +++ D    + VVLI+
Sbjct  63   LRERIDKLKRMKEQAMKSIK--PNSNN--NIMDETNNICSNLPVVELRDLGYSIEVVLIS  118

Query  656  GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            G++     Y +I +L +++G QV +A+F   G+        Q +
Sbjct  119  GVQRNFMLYEVISIL-EEEGAQVVSASFSTIGDKIFHTVRAQAK  161



>ref|XP_008787951.1| PREDICTED: uncharacterized protein LOC103705848 [Phoenix dactylifera]
Length=179

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 84/162 (52%), Gaps = 12/162 (7%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIK  837
             +++   A K+ERK +EKNRR H+KSL   L SL+P       ++ +   D LD    YIK
Sbjct  3     SSSGGSAAKMERKTVEKNRRMHMKSLCMKLASLIPKEHISTSKDVLTQQDHLDVATSYIK  62

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLIN  657
              L++++E  +Q++E  L+ S    N+                P I+V      + VVLI+
Sbjct  63    KLQDRIENLKQRRE--LRTSIDGINNDMSSGMTIG----IRLPVIEVRHQDSNLEVVLIS  116

Query  656   GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             GL+    F+ +I +L +++G +V +A+F   G+    V H +
Sbjct  117   GLDKRFMFHEVISIL-EEEGAEVVSASFSAVGDKIFHVIHSK  157



>ref|XP_007148151.1| hypothetical protein PHAVU_006G184600g [Phaseolus vulgaris]
 gb|ESW20145.1| hypothetical protein PHAVU_006G184600g [Phaseolus vulgaris]
Length=178

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 12/157 (8%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ--ERMALPDQLDETVKYIKCLENQLE  816
             P+  ++RK+ E+NRRN +K+L+  L SL+P HQ  + ++LPDQL E   YIK L+  +E
Sbjct  4    NPSSSVDRKFTERNRRNQMKALFRKLNSLVP-HQRTKAVSLPDQLGEATNYIKKLQMNME  62

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ--TEPPEIQVVDTSPGMSVVLINGLESI  642
            K ++KK  LL    + PN       +   GE    + P I++      + VVLI GL+S 
Sbjct  63   KMKKKKSMLLGII-EGPNVR-----MNEGGESLGLKSPRIEIQQMGSALEVVLITGLDSQ  116

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
              F   IRVLH ++G+ V NA++ +  +      H Q
Sbjct  117  FMFGETIRVLH-EEGVHVVNASYNVIEDEVFHSIHCQ  152



>ref|XP_006439795.1| hypothetical protein CICLE_v10022480mg [Citrus clementina]
 gb|ESR53035.1| hypothetical protein CICLE_v10022480mg [Citrus clementina]
Length=181

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 88/159 (55%), Gaps = 11/159 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQL  819
            + K +RK IEKNRR+H+KSL   L SL+P+H     ++ ++  DQLD    YIK L  ++
Sbjct  8    SSKPDRKTIEKNRRDHMKSLCFKLSSLIPSHHFKASKDMISQQDQLDLASCYIKQLRERV  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ-TEPPEIQVVDTSPGMSVVLINGLESI  642
            +K +  KE  ++  +  PN  +  N +    +  +  P +++ D    + V+LI+GL+  
Sbjct  68   DKLKGMKERAMKSIK--PN--NINNIMDETNDFCSNLPVVELRDLGSSIEVILISGLQRS  123

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               Y +I +L +++G +V +A+F   G+      H QV+
Sbjct  124  FMLYEVISIL-EEEGAEVVSASFSTVGDKVFHSVHAQVK  161



>ref|XP_002322161.1| hypothetical protein POPTR_0015s08580g [Populus trichocarpa]
 gb|EEF06288.1| hypothetical protein POPTR_0015s08580g [Populus trichocarpa]
Length=178

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 83/162 (51%), Gaps = 12/162 (7%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCL  831
            + +   KL+RK +EKNRR H+K L   L SL+P H     ++ ++  DQL+    YIK +
Sbjct  4    SNSETSKLDRKTVEKNRRVHMKDLCFKLASLVPHHFFKPSKDMLSQQDQLELAACYIKQM  63

Query  830  ENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL  651
              ++EK ++ KE+ +          + R+ + +       P I++ D    + VVL++GL
Sbjct  64   RERVEKLKRVKEQAI------TTIQTSRSGMTSMMIGLRLPVIELRDFGSSIEVVLVSGL  117

Query  650  ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                 FY +I VL   +G +V +A++   G+      H QVR
Sbjct  118  NKNFMFYEVITVL-SDEGAEVVSASYSTVGDKVFHTIHAQVR  158



>ref|XP_011087146.1| PREDICTED: uncharacterized protein LOC105168709 [Sesamum indicum]
Length=189

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 83/156 (53%), Gaps = 7/156 (4%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEK  813
            KLERK IEKNRR  +K+L   L SL+P H     +E ++  DQL++   YIK L  ++E+
Sbjct  16   KLERKTIEKNRRILMKTLCFKLVSLIPDHHFKPPKELLSQQDQLEQATTYIKLLAARVEE  75

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             +++K + +  S     + S +N     G +++PP +++ +    + VVLI+GL      
Sbjct  76   MKRRKTQAVMTSTTANPTRSSKNNAGFMG-RSKPPVVKIRELGSNLEVVLISGLCKTVML  134

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            + +I ++ +Q+G +V N              H QV+
Sbjct  135  HQVISII-EQEGAEVVNVNLSNIAGQIFHTIHAQVK  169



>emb|CDP12372.1| unnamed protein product [Coffea canephora]
Length=181

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 89/159 (56%), Gaps = 12/159 (8%)
 Frame = -2

Query  983  AP-KLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQ  822
            AP KL+RK IE+NRR  +K L ++L SL+P       +E +   DQ+D+ V YI  L+ +
Sbjct  9    APRKLDRKTIERNRRIRMKGLISELASLVPPQHFKPSKEMLNQKDQIDQVVTYIMQLKER  68

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            +EK   K++E+L+   +T  ++   + IP+    +  P ++++++   + VVL+ GL   
Sbjct  69   VEKL-NKRKEMLKSEHQTKGTNPRNSAIPS----SRIPVLKIMESDSSLEVVLVTGLRKN  123

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               + +I+VLH  QGL+V + +          + H QV+
Sbjct  124  FALHEVIQVLHG-QGLEVVSVSISTIEEKIYHILHAQVK  161



>ref|XP_009393604.1| PREDICTED: uncharacterized protein LOC103979252 [Musa acuminata 
subsp. malaccensis]
Length=178

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 79/157 (50%), Gaps = 12/157 (8%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQ  822
               K+ERK +EKNRR H+K L   L SL+P       ++ ++  D LD+   YIK L+ +
Sbjct  7    ATAKMERKTVEKNRRMHMKRLCMKLASLIPKEYATNSKDMLSQVDHLDQATSYIKDLQGR  66

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            +E+ +Q+         +T    + ++       +   P ++V      + VVLI+GLE  
Sbjct  67   IERMKQR------GGIRTSAEGTNKDVDREMTTEFRLPVVEVRHQDLNLEVVLISGLEKR  120

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             +F+ +I VL +++G +V NA F + G       H Q
Sbjct  121  FKFHQVISVL-EEEGAEVLNANFSVVGEMIFHTIHSQ  156



>ref|XP_010037569.1| PREDICTED: transcription factor bHLH100-like [Eucalyptus grandis]
 gb|KCW49294.1| hypothetical protein EUGRSUZ_K02849 [Eucalyptus grandis]
Length=191

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 84/160 (53%), Gaps = 15/160 (9%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEKSR  807
            ERK +EKNRR  +K L + L SL+P H     +E ++  DQLD+   YIK L+  ++  +
Sbjct  14   ERKTVEKNRRIRMKILCSKLASLIPQHHITTSKELLSQQDQLDQAASYIKQLKENIDGLK  73

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP-----PEIQVVDTSPGMSVVLINGLESI  642
             +KE+ + +S     S S    + ++ +Q        P  ++ D   G+ V+LI+G    
Sbjct  74   LRKEQAVLQSEGMDTSCS----LTSSDDQENKLGFVLPVFELRDHGLGLEVILISGRRRN  129

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
               Y +I +L +++G +V +A+F + G+      H QVR 
Sbjct  130  FMLYEVISIL-EEEGAEVVSASFSVIGDKIFHTLHAQVRL  168



>ref|XP_004248475.1| PREDICTED: uncharacterized protein LOC101259985 [Solanum lycopersicum]
Length=182

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 97/201 (48%), Gaps = 36/201 (18%)
 Frame = -2

Query  881  MALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEI  702
            MA+PDQ+D  V YI+ L+  LEK+++  EEL    ++  + +      P       P +I
Sbjct  1    MAVPDQIDAAVNYIEKLKMNLEKNKKHLEELKMGLKRAQSLNQTNEPGPITK---SPTQI  57

Query  701  QVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
            +  +    M VVLI  L +I+ F  IIR+ H ++ ++V +  F ++GNSTLQ++HE    
Sbjct  58   EFHEMGLNMVVVLITSLNNIATFNNIIRLCH-EEDVEVVSTNFTLNGNSTLQISHET---  113

Query  521  LLIMLSCLPKFISD*PGFFQVGKSEMGMIAERLKVVIKG-CPGGEAIESEPLNSWDNNYD  345
                               ++ KS   +  +++K +I G    G  ++S+ L+ WD  Y 
Sbjct  114  -------------------KMNKSSTTLF-DKMKELIYGPSHDGNDVDSQ-LHLWD--YK  150

Query  344  IERDNLGFPVLEQFLVQCQNP  282
            IE     F  LE      QNP
Sbjct  151  IE-----FDALELLPTTSQNP  166



>ref|XP_003528456.2| PREDICTED: transcription factor bHLH55-like [Glycine max]
Length=171

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 93/198 (47%), Gaps = 37/198 (19%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMAL--PDQLDETVKYIKCLENQLEKS  810
            + + + K IE+NRRN +K L++ L S++P    R A   PD++ E   YIK L+ +LEK 
Sbjct  7    SSRTDTKSIEQNRRNQMKDLFSKLNSVVPHQSSRDATSRPDKIGEATNYIKNLQIKLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++K+  L+   R        +N     G   + P+ ++      + +VL+ G++    F 
Sbjct  67   KEKRNNLIDIERS-------KNASMNMG--LKSPQFKIQQMGSALEIVLVTGMDCQFMFN  117

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKS  450
              IRVL +++G  + NA++ +  N+     H           C            QVG S
Sbjct  118  ETIRVL-QEEGSDIVNASYTVVENAVFHTIH-----------C------------QVGGS  153

Query  449  EMGM--IAERLKVVIKGC  402
              G   I+E++K  + GC
Sbjct  154  ANGALRISEKIKKYLNGC  171



>ref|XP_009388818.1| PREDICTED: uncharacterized protein LOC103975545 [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 80/154 (52%), Gaps = 18/154 (12%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEK  813
            KLERK  EK RR H+K+LY  L S++PA      ++ M   D LD+   YIK L  ++EK
Sbjct  12   KLERKMAEKYRRLHMKTLYLKLSSIIPAEHRTTAKDIMTKQDNLDQAASYIKYLGERIEK  71

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             +Q         R+   +S+ RN +   G     P I+V      + ++LI+G+     F
Sbjct  72   LKQ---------RRLVQTSAARNEM---GTGYLLPIIEVKYQDLNLEILLISGVNKSFMF  119

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            + +I VL +++G +V +A+F + G+      H Q
Sbjct  120  HEVINVL-EEEGAEVIHASFSVVGDKIYHTIHSQ  152



>ref|XP_010039148.1| PREDICTED: transcription factor ORG2-like [Eucalyptus grandis]
Length=170

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 80/152 (53%), Gaps = 7/152 (5%)
 Frame = -2

Query  959  IEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEKSRQKKE  795
            +EKNRR H+  L + L SL+P H     ++ +   DQLD+   YIK L+ +++  + +K+
Sbjct  1    MEKNRRIHMNILCSKLASLIPQHDVTTSKDSLLQQDQLDQAASYIKQLKERIDGLKLRKD  60

Query  794  ELLQKSRKTPNSSSCRNCIP-AAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIR  618
            + + KS     SSS  + I   A      P  Q+ +   G+ V+LI+G       Y +I 
Sbjct  61   QAVLKSEGIDTSSSLTSSIDQEAKLGFVLPVFQLREYGLGLEVILISGRRKNFMLYEVIN  120

Query  617  VLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
            +L +++G +V +A+F + G+      H QVR 
Sbjct  121  IL-EEEGAEVVSASFSVVGDKIFHTLHAQVRL  151



>ref|XP_010101195.1| hypothetical protein L484_014999 [Morus notabilis]
 gb|EXB87869.1| hypothetical protein L484_014999 [Morus notabilis]
Length=187

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 86/170 (51%), Gaps = 19/170 (11%)
 Frame = -2

Query  992  KTPA--PKLERKYIEKNRRNHLKSLYTDLFSLLPAH------QERMALPDQLDETVKYIK  837
            K+P+   KL+RK IE+NRR H+K L   L SL+P H      +E +   DQ+D    YI 
Sbjct  3    KSPSETAKLDRKTIERNRRIHMKDLCFKLASLVPHHHSKHYSKEMLTQQDQIDLAASYIS  62

Query  836  CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQ------TEPPEIQVVDTSPGM  675
             L  ++EK + KKE+    + K+ N S+  +      +          P I++ D    +
Sbjct  63   QLRERIEKLKAKKEQ----ATKSLNGSTDMSGSEVLDDHQRMRIGARLPVIELKDLGCSI  118

Query  674  SVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             V+LI+GL+     Y +I VL +++G +V +A+F    +      H QV+
Sbjct  119  EVILISGLQKSFMLYEVISVL-EEEGAEVVSASFSTVDDKVFYTLHAQVK  167



>ref|XP_009388820.1| PREDICTED: uncharacterized protein LOC103975547 [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 80/154 (52%), Gaps = 18/154 (12%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEK  813
            KLERK  EK RR H+K+LY  L S++PA      ++ M   D LD+   YIK L  ++EK
Sbjct  12   KLERKLAEKYRRLHMKTLYLKLSSIIPAEHRTTAKDIMTKQDNLDQAASYIKYLGERIEK  71

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             +Q         R+   +S+ RN +   G     P I+V      + ++LI+G+     F
Sbjct  72   LKQ---------RRLVQTSAARNEM---GTGYLLPIIEVKYQDLNLEILLISGVNKSFMF  119

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            + +I VL +++G +V +A+F + G+      H Q
Sbjct  120  HEVINVL-EEEGAEVIHASFSVVGDKIYHTIHSQ  152



>ref|XP_008239751.1| PREDICTED: uncharacterized protein LOC103338332 isoform X3 [Prunus 
mume]
Length=186

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 88/160 (55%), Gaps = 9/160 (6%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLEN  825
            + KL+RK +E+NRR H+K L   L SL+P    +       ++  +QLD    YIK L  
Sbjct  9    SSKLDRKTVERNRRIHMKDLCFKLASLIPPQHSKPSNSKDTLSQQNQLDLASSYIKQLRE  68

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++E  +++KE+ + +S+   +++S  +   A   ++  P I++ D+   + V+LI+GL  
Sbjct  69   RIENLKERKEKAM-RSQLGIDANSTIDADNAMTVRSRLPVIELKDSGSVIEVMLISGLNK  127

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                Y +I VL +++G +V +A+F   G+      H QV+
Sbjct  128  NFMLYEVIGVL-EEEGAEVISASFSTVGDKVFHSLHAQVK  166



>ref|XP_008239750.1| PREDICTED: uncharacterized protein LOC103338332 isoform X2 [Prunus 
mume]
Length=186

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 88/161 (55%), Gaps = 9/161 (6%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLE  828
             + KL+RK +E+NRR H+K L   L SL+P    +       ++  +QLD    YIK L 
Sbjct  8    SSSKLDRKTVERNRRIHMKGLCFKLASLVPPQHSKASNSKDTLSQQNQLDLASSYIKQLR  67

Query  827  NQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
             ++E  +++KE+ + +S+   +++S  +   A   ++  P I++ D+   + V+LI+GL 
Sbjct  68   ERIENLKERKEKAM-RSQLGMDANSTIDADNAMMVRSRLPVIELKDSGSVIEVMLISGLN  126

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                 Y +I VL +++G +V +A+F   G+      H QV+
Sbjct  127  KNFMLYEVIGVL-EEEGAEVISASFSTVGDKVFHSLHAQVK  166



>gb|AHA11095.1| bHLH transcription factor [Gossypium hirsutum]
Length=184

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 76/155 (49%), Gaps = 11/155 (7%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEKSR  807
            +RK IEK RRN +K L + L SL+P H     +E  +  DQLD    YIK L  ++EK +
Sbjct  15   DRKAIEKKRRNDMKILCSKLASLIPHHNFKPSKEIASQQDQLDLAAVYIKHLRERIEKLK  74

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            + KEE +   R    SSS      + G     P +++ D    + +VLI GL      Y 
Sbjct  75   RLKEEAM---RSMEASSSMMERTASVG--LTSPVLELRDLGSSIELVLITGLNKNFMLYE  129

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
            +I +  +Q+G +V +A+F   G       H Q + 
Sbjct  130  VISIF-EQEGAEVVSASFSTVGGKIFHTLHAQAKL  163



>ref|XP_010925444.1| PREDICTED: uncharacterized protein LOC105047972 [Elaeis guineensis]
Length=176

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 13/156 (8%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-----ERMALPDQLDETVKYIKCLENQL  819
            A KLERK +EKNRR ++K+L   L SL+P  Q     + +   DQLD+   Y+K L+ ++
Sbjct  7    ATKLERKTVEKNRRLYMKNLCFKLASLIPKDQYTISKDTLTQEDQLDQAASYVKKLKERV  66

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            E+ +Q+KE  L+   + P++ S R            P I V      + V +++GL    
Sbjct  67   ERLKQRKEMALRS--RGPDNISGR-----VLSSFSLPVIDVRHLDSTLEVFIVSGLSKGI  119

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             F  ++ VL  ++G +  NA+F I G+      H Q
Sbjct  120  IFRDVLCVLE-EEGAEAINASFSIAGDKIFCTIHSQ  154



>gb|KHN18464.1| Transcription factor bHLH36 [Glycine soja]
Length=188

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 85/163 (52%), Gaps = 11/163 (7%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            T  + +PKL+RK IE+NRR H+KSL   L S +P++     ++ ++  DQL     YIK 
Sbjct  6    TNTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNYLKTSKDMLSQQDQLHLAATYIKH  65

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L  ++EK + +KE   +       S+   N I   G  +E P +++ D   G+ V+LI+G
Sbjct  66   LRERIEKLKGEKE---KAMNMMMMSNQSNNRIFNTG--SELPLLEIKDLGSGIEVMLISG  120

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            L      Y +I VL +++G +V  A F    +      H QV+
Sbjct  121  LNKNFMLYEVISVL-EEEGAEVVAANFSTVADKIFYTFHAQVK  162



>ref|XP_008239749.1| PREDICTED: uncharacterized protein LOC103338332 isoform X1 [Prunus 
mume]
Length=187

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 87/160 (54%), Gaps = 9/160 (6%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLE  828
             + KL+RK +E+NRR H+K L   L SL+P    +       ++  +QLD    YIK L 
Sbjct  8    SSSKLDRKTVERNRRIHMKGLCFKLASLVPPQHSKASNSKDTLSQQNQLDLASSYIKQLR  67

Query  827  NQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
             ++E  +++KE+ + +S+   +++S  +   A   ++  P I++ D+   + V+LI+GL 
Sbjct  68   ERIENLKERKEKAM-RSQLGMDANSTIDADNAMMVRSRLPVIELKDSGSVIEVMLISGLN  126

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
                 Y +I VL +++G +V +A+F   G+      H QV
Sbjct  127  KNFMLYEVIGVL-EEEGAEVISASFSTVGDKVFHSLHAQV  165



>ref|XP_010251286.1| PREDICTED: uncharacterized protein LOC104593221 isoform X2 [Nelumbo 
nucifera]
Length=206

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 84/161 (52%), Gaps = 10/161 (6%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ----ERMALPDQLDETVKYIKCLE  828
            T   + K +RK IE+NRR H+K L   L +L+P HQ    +     D+LD    YI  L 
Sbjct  3    TCGGSTKPDRKTIERNRRIHMKRLCFKLDALIPKHQNVYRDATNQRDRLDRAASYIMQLR  62

Query  827  NQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
             ++E+ +++++ ++       N    R+ +    +    P +++ D+ P + VVLI+GL 
Sbjct  63   ERIEELKERRQLVMCIKGINRNM---RDSMKI--DDVGLPVLELRDSGPNLEVVLISGLN  117

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                FY II VL +++G +V NA+F   G+      H QV+
Sbjct  118  KSFTFYEIICVL-EEEGAEVVNASFACVGDRIFHTIHAQVK  157



>ref|XP_009413847.1| PREDICTED: transcription factor bHLH36-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=174

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (55%), Gaps = 17/148 (11%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLP---AHQERMA--LPDQLDETVKYIKCLENQLEKSR  807
            +RK IEKNRR H+K+LY+ L SLLP   + QE  A  L D+L+E + YIK  +  LE+ +
Sbjct  11   DRKTIEKNRRIHMKALYSKLLSLLPTPSSQQEGGAVTLADRLNEAINYIKGKQEMLERMQ  70

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVV-LINGLESISQFY  630
            ++K +L      T ++ +      A    +  P+I V D  PG+ V+ +I+  +    F 
Sbjct  71   KRKRQL------TGSAGTASEVATA----SRSPKIDVQDLRPGLRVIAVISPCDHHLIFC  120

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQ  546
             I+RVL   +G+ +  A++ + G+    
Sbjct  121  EIVRVL-GAEGVDIITASYAVVGDRAFH  147



>ref|XP_009413848.1| PREDICTED: transcription factor bHLH36-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 16/147 (11%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLL--PAHQERMA--LPDQLDETVKYIKCLENQLEKSRQ  804
            +RK IEKNRR H+K+LY+ L SLL  P+ QE  A  L D+L+E + YIK  +  LE+ ++
Sbjct  11   DRKTIEKNRRIHMKALYSKLLSLLPTPSSQEGGAVTLADRLNEAINYIKGKQEMLERMQK  70

Query  803  KKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVV-LINGLESISQFYG  627
            +K +L      T ++ +      A    +  P+I V D  PG+ V+ +I+  +    F  
Sbjct  71   RKRQL------TGSAGTASEVATA----SRSPKIDVQDLRPGLRVIAVISPCDHHLIFCE  120

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTLQ  546
            I+RVL   +G+ +  A++ + G+    
Sbjct  121  IVRVL-GAEGVDIITASYAVVGDRAFH  146



>gb|KHN35247.1| hypothetical protein glysoja_042317 [Glycine soja]
Length=197

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 112/214 (52%), Gaps = 30/214 (14%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLEKSRQKKEEL--LQKSRKT  768
            +K L   L SLLP++  +E + LPDQ+DE + YIK LE +++ +++KKE L  ++K  + 
Sbjct  1    MKILCNKLNSLLPSYNPKEALPLPDQVDEAINYIKSLEAKVKMAQEKKECLQGIRKRSRD  60

Query  767  PNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQV  588
              S++  N    +    + P++++ +    + VVL  GL+    F  IIR+LH ++ + V
Sbjct  61   CFSNNSTNFAATSAGFPKSPQLEIHEVGSSLQVVLTCGLDHQFIFSEIIRMLH-EENIDV  119

Query  587  TNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEMGMIAERLKVVIK  408
             +A   + G+S L V H ++          P+         Q G ++   +++RLK  + 
Sbjct  120  RSANSSLAGDSMLHVVHAEI----------PQ------SLLQFGATK---VSQRLKRFVN  160

Query  407  GCPGGEAIESEPLNSWDNNYDIERDNL-GFPVLE  309
            G      +E++P   WD  ++I  D++ G  +L+
Sbjct  161  G--SCSDVETQP-ELWD--FEIGTDDMWGLYILQ  189



>ref|XP_011087147.1| PREDICTED: uncharacterized protein LOC105168711 [Sesamum indicum]
Length=181

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 84/167 (50%), Gaps = 19/167 (11%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--------AHQERMALPDQLDETVK  846
             TT +  + KLERK IEKNRRN +KSL   L SL+P        +  E ++  DQ+++   
Sbjct  6     TTGEGSSGKLERKTIEKNRRNLMKSLCFKLVSLIPPPHRHFDSSKVEELSQKDQVEQATT  65

Query  845   YIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVV  666
             YIK L  ++E+ R++K + L        ++S    I      ++ P +++ +    + VV
Sbjct  66    YIKLLTQRVEEMRRRKSQALM-------TASASTSIMGG---SKLPVLEIRELGSNLEVV  115

Query  665   LINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             LI+GL      + II +L +++G +V N         T    H QV+
Sbjct  116   LISGLCKTFMLHQIISIL-QEEGAEVVNVNVSNIAGQTFHTIHAQVK  161



>ref|XP_004236112.1| PREDICTED: uncharacterized protein LOC101248004 [Solanum lycopersicum]
Length=184

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLEN  825
            T + K+ERK  EK RR  +K L + LFSL+P H     +E +   D++D  + YIK L+ 
Sbjct  10   TASEKIERKTQEKIRRIQMKYLTSKLFSLIPPHHHQSTKEVLTKQDKIDAAITYIKQLKE  69

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
            ++E   ++KEE++  +++T + S  +  +P      + P ++V +    + V+L++GL+ 
Sbjct  70   RIEVLERRKEEVV--AQETCDDS--KKSMPTTTCSIKSPMVEVKELDSTLEVILVSGLQK  125

Query  644  ISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                  +I+++ +Q+G QV +A +    ++   + H QV+
Sbjct  126  NFILQEVIKII-EQEGAQVVSANYSTIDDTIYYMIHAQVK  164



>ref|XP_010686489.1| PREDICTED: uncharacterized protein LOC104900696 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=201

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 96/204 (47%), Gaps = 40/204 (20%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            +RK IEKNRRN++K L + L S++  H    +E + L DQ+DE  KYIK  E  + + +Q
Sbjct  14   DRKIIEKNRRNYMKCLCSQLNSIVHHHASSSRESLTLSDQIDEATKYIKQKEEIIAELKQ  73

Query  803  KKEELLQ-----KSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            KK+ L+       SRK  + +S             P +I+V      + V+L+ GLE   
Sbjct  74   KKDHLVDVNGKLSSRKGYSLNS-------------PVQIEVHVKGSALEVILVTGLECEF  120

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHE-----------QVRWLLIMLSCLPK  492
             F   IR++ ++   +V NA++ + G +     H             ++ + + ++C+  
Sbjct  121  VFTEAIRIVLEEHA-EVVNASYSVVGTTVFHSIHAKGKKSAQKKKLHLQKIRLTIACISV  179

Query  491  FISD*PGFFQVGKSEMGMIAERLK  420
               D        + E+  I ERLK
Sbjct  180  IGED------AARPEVARITERLK  197



>ref|XP_009618665.1| PREDICTED: transcription factor ORG3-like [Nicotiana tomentosiformis]
Length=184

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 86/158 (54%), Gaps = 9/158 (6%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-----ERMALPDQLDETVKYIKCLENQL  819
            + K +RK +E+NRR ++K L + L SL+P H      E ++  DQ+D+T+ YI+ L+ ++
Sbjct  11   SEKPDRKTVERNRRIYMKYLCSKLISLIPPHHFKPSTEMLSQQDQVDQTITYIEQLKERV  70

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            E  +++K+EL+ +     +S+S +          E P ++V +    + V+LI+GL+   
Sbjct  71   EVLKRRKDELVAQGTGERSSTSKKVMTTCT---LETPAVEVRELGSTLEVILISGLKKNF  127

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                +I VL +++G QV  A F    +      H QV+
Sbjct  128  ALQEVINVL-EEEGAQVVTAHFSTICDKVFYTIHAQVK  164



>ref|XP_010686490.1| PREDICTED: uncharacterized protein LOC104900696 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=177

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 23/157 (15%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALPDQLDETVKYIKCLENQLEKSRQ  804
            +RK IEKNRRN++K L + L S++  H    +E + L DQ+DE  KYIK  E  + + +Q
Sbjct  14   DRKIIEKNRRNYMKCLCSQLNSIVHHHASSSRESLTLSDQIDEATKYIKQKEEIIAELKQ  73

Query  803  KKEELLQ-----KSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            KK+ L+       SRK  + +S             P +I+V      + V+L+ GLE   
Sbjct  74   KKDHLVDVNGKLSSRKGYSLNS-------------PVQIEVHVKGSALEVILVTGLECEF  120

Query  638  QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
             F   IR++ ++   +V NA++ + G +     H ++
Sbjct  121  VFTEAIRIVLEEHA-EVVNASYSVVGTTVFHSIHAKI  156



>ref|XP_008393119.1| PREDICTED: uncharacterized protein LOC103455312 [Malus domestica]
Length=187

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 84/162 (52%), Gaps = 11/162 (7%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLEN  825
            + K +RK +E+NRR H+KSL   L SL+P    +       M+  +QLD    YIK L  
Sbjct  9    SSKPDRKTVERNRRIHMKSLCFKLASLVPPQHFKTTNSKGTMSQQNQLDTAASYIKKLRE  68

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIP--AAGEQTEPPEIQVVDTSPGMSVVLINGL  651
            ++E  +++ E+ +  S+   + S      P   A   +  P I++ D+   + V+LI+GL
Sbjct  69   RIENLKERXEKAMX-SQLGSSKSDIGYIDPEKTAMMGSRLPVIELRDSGSSIEVMLISGL  127

Query  650  ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                 FY +I VL +++G +V +A+F   G+      H QV+
Sbjct  128  NKNFMFYEVISVL-EEEGAEVVSASFTTIGDKVFHSVHAQVK  168



>ref|XP_007155415.1| hypothetical protein PHAVU_003G199500g [Phaseolus vulgaris]
 gb|ESW27409.1| hypothetical protein PHAVU_003G199500g [Phaseolus vulgaris]
Length=196

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 85/163 (52%), Gaps = 12/163 (7%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            TT T + KL+RK IE+NRR H+K L   L S++P+      ++ ++  DQLD    YIK 
Sbjct  6    TTITASSKLDRKTIERNRRIHMKGLCFKLVSIIPSKDLKPTKDMLSQQDQLDLAATYIKH  65

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L  +LEK + +KE+ +   R T  ++   N       +++ P +++ +   G+ V+LI+G
Sbjct  66   LRERLEKLKGEKEKAMNMMRTTQTNNGIFNI------ESQLPLLEIKELGSGIEVMLISG  119

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            +      Y +I VL ++    VT A F    N      H +V+
Sbjct  120  VNKNFMLYEVISVLEEEGVEVVT-ANFTTVANKIFYTVHAKVK  161



>ref|XP_002279841.1| PREDICTED: uncharacterized protein LOC100253569 [Vitis vinifera]
 emb|CBI15047.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 12/164 (7%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-----ERMALPDQLDETVKYIK  837
             T    P  K +RK  E+NRR H+KSL   L SL+P +Q     + ++  DQL++   YIK
Sbjct  2     TKMNGPPLKPDRKTTERNRRIHMKSLCFKLSSLIPPNQFKTSKDMLSQQDQLEQAANYIK  61

Query  836   CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLIN  657
              L+ ++E+ + +KE        T  + +  N I A       P I + D    + V+LI+
Sbjct  62    QLKERIEELKGRKE------LATRVAGTNNNLIDAVMIGLRLPVIDLRDLGSSLEVMLIS  115

Query  656   GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             GL      Y +I VL +++G +V +A+    G+      H QV+
Sbjct  116   GLNKNFMLYEVISVL-EEEGAEVVSASVSTVGDKVFHSLHAQVK  158



>ref|XP_008442634.1| PREDICTED: transcription factor ORG2-like [Cucumis melo]
Length=248

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMA---LPDQLDETVKYIKCLENQLE  816
            P P+ +RK++E+NRR  +KSL++ L SLLP H  R A   +PDQL++   YIK L+  ++
Sbjct  44   PTPQSDRKFVERNRRKEMKSLFSTLNSLLPNHTSREAPRTVPDQLEDATNYIKELQKNIQ  103

Query  815  KSRQKKEELLQKSR  774
            K ++KKEEL+ K++
Sbjct  104  KLKEKKEELMGKNK  117



>ref|XP_007044631.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY00463.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=164

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 75/146 (51%), Gaps = 21/146 (14%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKK  798
            ++ R  IE+ RR ++K+LY +LF+LLP    +M++P+ +D+   Y+K L+ +LEK +Q K
Sbjct  9    RINRCLIERERRRNMKTLYANLFALLPPQPSKMSVPELVDQATAYVKHLQKKLEKYKQMK  68

Query  797  EELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE---SISQFYG  627
             +L  K               A      PP + + D    + V LI GL    ++S F  
Sbjct  69   VQLEDKR--------------ATAYTIRPPVLNIRDLGSNLEVHLITGLNMEFALSDFIS  114

Query  626  IIRVLHKQQGLQVTNATFQIHGNSTL  549
            I+    +++G ++ +AT    G+  +
Sbjct  115  IL----QEEGAEIVSATCHHTGDRAI  136



>ref|XP_010028270.1| PREDICTED: transcription factor ORG2-like [Eucalyptus grandis]
 gb|KCW83444.1| hypothetical protein EUGRSUZ_B00366 [Eucalyptus grandis]
Length=196

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAHQER------MALPDQLDETVKYIKCLENQLEKS  810
            +RK +E+NRR H+KSL   L SL+P+HQ R      ++  DQ+++   YI  L+ +++  
Sbjct  15   DRKTVERNRRIHMKSLCFKLASLVPSHQPRSTPKDMLSQQDQIEQAAAYIAQLKEKVDML  74

Query  809  RQKKE---ELLQKSRKTPNSSSCRNCIP-----AAGEQTEPPEIQVVDTSPGMSVVLING  654
            + KKE     L  SR+         C P     AA + +  P + + D   G+ V LI+G
Sbjct  75   KAKKELAVARLDVSRRRGGG----ECGPAFDGAAARQASALPFVSIRDWDSGVEVTLISG  130

Query  653  LESISQF--YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              +   F  Y +I +L +++G +V +A+    G+      H QVR
Sbjct  131  CGASKNFMLYEVIGIL-EEEGAEVVSASISNIGDKVFYTLHAQVR  174



>ref|XP_010251287.1| PREDICTED: uncharacterized protein LOC104593222 [Nelumbo nucifera]
Length=189

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 83/163 (51%), Gaps = 17/163 (10%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPD--------QLDETVKYIK  837
            ++ + KL+RK IE+NRR H+K L   L SL+  H    A  D         LD  + YIK
Sbjct  6    RSESAKLDRKIIERNRRIHMKGLCFKLASLIAKHHN--ASKDASSEGDKLDLDHAISYIK  63

Query  836  CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLIN  657
             L  ++E+ + +K+     S K  N +  R+ +     +   P +++ D  P + V+L++
Sbjct  64   QLRERVEELKGRKQ--FTMSIKGIN-TDFRDTMKI---EFTLPILELRDLGPNLEVLLVS  117

Query  656  GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            G +    FY +I +L +++G +V NA+F   G+      H QV
Sbjct  118  GFDKNFLFYEVISLL-EEEGAEVVNASFSCIGDKIFHTIHAQV  159



>emb|CDP21802.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALPDQLDETVKYIKCLENQLEKS  810
            KL+RK  E+NRR  +KS   +L SL+P      +ER++  DQL     YI  L  ++EK 
Sbjct  12   KLDRKTTERNRRIRMKSSILELISLVPQQFNPSKERLSPKDQLHRVTAYITQLRERVEKL  71

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++ KE L+ K     N+S     IP +G     P +++ +    + VVL+ GL      +
Sbjct  72   KKMKEMLISKF----NTSG----IPGSG----IPVVKITEIGSNLEVVLVTGLSKKFGLH  119

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRW  522
             +I VLH  QG++V + +     +    + H QV+ 
Sbjct  120  EVILVLHG-QGVEVVSISISTMADRIYHILHAQVKM  154



>gb|KDP31114.1| hypothetical protein JCGZ_11490 [Jatropha curcas]
Length=182

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 84/156 (54%), Gaps = 10/156 (6%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA-----HQERMALPDQLDETVKYIKCLENQLEK  813
            KL+RK +EKNRR H+K+L   L S++P+     H++ ++  DQLD    YIK L+ ++EK
Sbjct  10   KLDRKTVEKNRRIHMKALCFKLASVIPSQHFKHHKDMLSQQDQLDHAAAYIKNLKERIEK  69

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
              +KKE  L     + + ++  N +         P  ++ D    + VVLI+G +     
Sbjct  70   LEKKKERTLG----SLSEANNNNAMNEMMMSLTLPMFELRDLGNSIEVVLISGSKRNFML  125

Query  632  YGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            + +I +L +++G +V +A++   G+      H QV+
Sbjct  126  HEVITIL-EEEGAEVVSASYTTVGDKVFHTIHAQVK  160



>ref|XP_007211000.1| hypothetical protein PRUPE_ppa020940mg [Prunus persica]
 gb|EMJ12199.1| hypothetical protein PRUPE_ppa020940mg [Prunus persica]
Length=186

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 87/161 (54%), Gaps = 9/161 (6%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLE  828
             + KL+RK +E+NRR H+K L   L SL+P    +       ++   QLD    YIK L 
Sbjct  8    SSSKLDRKTVERNRRIHMKGLCFKLASLVPPQHSKASNSKDTLSQQKQLDLASSYIKQLR  67

Query  827  NQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
             ++E  +++KE+ + +S+   +++S  +   A   ++  P +++ D+   + V+LI+GL 
Sbjct  68   ERIENLKERKEKAM-RSQLGIDANSTIDADNAMMVRSRLPVLELRDSGSIIEVMLISGLN  126

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                 + +I VL +++G +V +A+F   G+      H QV+
Sbjct  127  KNFMLFEVISVL-EEEGAEVVSASFSTVGDKIFHSLHAQVK  166



>ref|XP_007208890.1| hypothetical protein PRUPE_ppa026684mg [Prunus persica]
 gb|EMJ10089.1| hypothetical protein PRUPE_ppa026684mg [Prunus persica]
Length=186

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 86/157 (55%), Gaps = 9/157 (6%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQER-------MALPDQLDETVKYIKCLENQLE  816
            L+RK +E+NRR H+K L   L SL+P    +       ++  +Q D    YIK L  ++E
Sbjct  12   LDRKTVERNRRIHMKDLCFKLASLIPPQHSKPSNSKDTLSQQNQFDLASSYIKQLRERIE  71

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
              +++KE+ + +S+   +++S  +   A   +++ P +++ D+   + V+LI+GL     
Sbjct  72   NLKERKEKAM-RSQLGIDANSTIDADNAMMVRSKLPVLELRDSGSIIEVMLISGLNKNFM  130

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             Y +I VL +++G +V +A+F   G+      H QV+
Sbjct  131  LYEVISVL-EEEGAEVISASFSTIGDKVFHSLHAQVK  166



>ref|XP_009108520.1| PREDICTED: uncharacterized protein LOC103834211 [Brassica rapa]
Length=162

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 76/134 (57%), Gaps = 3/134 (2%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSS  756
            ++ LY +L SLLP     + LPDQLDE   YIK L+  +EK+R++K +L+  +     +S
Sbjct  1    MEDLYLELNSLLPQTSRELPLPDQLDEAANYIKELQVSVEKNRERKRKLVTTAALEKLNS  60

Query  755  SCRNCIPAAGEQTEP---PEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVT  585
            +  + + ++ + + P   P I++ +T P   + L+  LE    F+ IIRVL ++ G  +T
Sbjct  61   TGSSSMSSSVDVSVPKRLPRIEIQETGPIFHISLVTSLEHKFMFHEIIRVLTEELGAGLT  120

Query  584  NATFQIHGNSTLQV  543
            +A + I  ++   +
Sbjct  121  HAGYSIVDDAVFHI  134



>ref|XP_010318915.1| PREDICTED: transcription factor bHLH27-like [Solanum lycopersicum]
Length=180

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 88/166 (53%), Gaps = 20/166 (12%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH------QERMALPDQLDETVKYIKCLE  828
            T   KL+RK  EKNRR  +K L + LFSL+P H      ++ +   DQ+D+ + YI+ L+
Sbjct  4    TSPEKLDRKTQEKNRRIQMKYLSSKLFSLIPPHHHQYSAKDMVTQQDQIDQAITYIEKLK  63

Query  827  NQLEKSRQKKEELLQK-----SRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVL  663
             +++   ++K++++ +     S+K   S+SC N         + P I+V +    + V+L
Sbjct  64   ERVDVLMRRKDKIIAQGTSDDSKKFMPSTSCSN--------IKLPMIEVRELGSTIEVIL  115

Query  662  INGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            ++ L+       +I +L +++G+QV  A F   G+      H QV+
Sbjct  116  VSCLQKKFTMQEVIIIL-EEEGVQVVTANFSTIGDKVYYTIHAQVK  160



>ref|NP_001239892.1| uncharacterized protein LOC100787505 [Glycine max]
 gb|ACU20212.1| unknown [Glycine max]
Length=161

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 80/147 (54%), Gaps = 11/147 (7%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            T  + +PKL+RK IE+NRR H+KSL   L S +P++     ++ ++  DQL     YIK 
Sbjct  6    TNTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNYLKTSKDMLSQQDQLHLAATYIKH  65

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L  ++EK + +KE   +       S+   N I   G  +E P +++ D   G+ V+LI+G
Sbjct  66   LRERIEKLKGEKE---KAMNMMMMSNQSNNRIFNTG--SELPLLEIKDLGSGIEVMLISG  120

Query  653  LESISQFYGIIRVLHKQQGLQVTNATF  573
            L      Y +I VL +++G +V  A F
Sbjct  121  LNKNFMLYEVISVL-EEEGAEVVAANF  146



>ref|XP_008353777.1| PREDICTED: uncharacterized protein LOC103417363 isoform X2 [Malus 
domestica]
Length=222

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = -2

Query  887  ERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPP  708
            E ++  DQ+DE + YIK  E+ L+K ++KKE L+ ++RK   +++C N    +    + P
Sbjct  39   EPLSQTDQIDEAINYIKSQESNLQKLKEKKESLM-RTRKRSYATACVNV--ESTRSAKAP  95

Query  707  EIQVVDTSPGMSVVLINGLESIS-QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             I++ +    + VVLI+GLE+    FY IIR+L ++    V +A F   G+ST  +   +
Sbjct  96   HIKIHEIDSTLEVVLISGLENHQFMFYDIIRLLDEEHA-NVVHANFSTLGDSTFHIVRAE  154

Query  530  V-RWL  519
            + +W+
Sbjct  155  ICQWI  159



>gb|KEH39150.1| hypothetical protein MTR_2g090500 [Medicago truncatula]
Length=230

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 101/217 (47%), Gaps = 42/217 (19%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSL-----------YTDLFSLLPAHQERMALPDQLDETVKYIKCLE  828
            L++ Y  +N R   K++           YT ++      +E + LPDQ+DE + YIK LE
Sbjct  23   LDKGYFGQNHRAREKAVGWEKFTKQEYRYTSIYECTV--EEALPLPDQVDEAINYIKSLE  80

Query  827  NQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
              +  +++KKE L+   +++      R    A G   + P+I++ +  P + V++  G++
Sbjct  81   TNIMLAKEKKESLMGNKKRS------RGGYGAKGSIIKLPKIEIHEMGPTLQVIVTCGVD  134

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGF  468
                F  I+R+LH ++ ++V ++   + G+S L   H Q+   L+               
Sbjct  135  KHFIFCEIMRILH-EENVEVISSNSSLTGDSLLHTVHAQIPQTLL---------------  178

Query  467  FQVGKSEMGMIAERLKVVIKGCPGGEAIESEPLNSWD  357
             Q G ++   I+ERLK  + G       ES+    WD
Sbjct  179  -QFGATK---ISERLKEFVNGSMSDVETESQV---WD  208



>ref|XP_010537647.1| PREDICTED: transcription factor bHLH36-like [Tarenaya hassleriana]
Length=156

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 82/178 (46%), Gaps = 30/178 (17%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAHQ---ERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTP  765
            +K+LY++L SLLP  Q   E   + DQLDE   YIK L+ ++EK + +K +L    R+ P
Sbjct  1    MKALYSELNSLLPGFQTSREPSTVADQLDEAANYIKKLQVKVEKMKGRKRKLEGLERRDP  60

Query  764  NSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVT  585
              S  R            P I++ +  P +++VL+ G      FY I+R+L   +G  + 
Sbjct  61   VCSGSRESSGVG------PIIEIHEVGPILNIVLVTGFHHKFLFYDILRLL-TDEGTDIV  113

Query  584  NATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEMGMIAERLKVVI  411
            +++F +  ++       +V                     + G    G I+ERLK ++
Sbjct  114  HSSFSVADDTAFHTLQCEVE--------------------EYGYGAGGRISERLKRLV  151



>ref|XP_007036186.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY20687.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=210

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 86/186 (46%), Gaps = 39/186 (21%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQER--------------MALP--------  870
            A K +RK IE+NRR H+K+L   L SL+P  + +              ++LP        
Sbjct  9    ASKPDRKTIERNRRIHMKALCFKLASLVPQQRFKPSKVYICIYIELLILSLPSFFLSQEY  68

Query  869  -----------DQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGE  723
                       DQLD  V YIK L  ++EK +  KE+++   +    SS+  N   + G 
Sbjct  69   LTDFWEIVSQTDQLDLGVAYIKHLRERIEKLKVIKEQMM---KSVEASSNIMNNNASGG-  124

Query  722  QTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQV  543
                P +++ D    + V+LI+GL      Y +I +L +Q+G +V +A+F   G      
Sbjct  125  -LGLPVVEIRDLGSSIEVILISGLNKNFMLYEVIGIL-EQEGAEVVSASFSTVGGKIFHN  182

Query  542  AHEQVR  525
             H QV+
Sbjct  183  LHAQVK  188



>ref|XP_006449356.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
 gb|ESR62596.1| hypothetical protein CICLE_v10016846mg [Citrus clementina]
Length=152

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -2

Query  890  QERMALPDQLDETVKYIKCLENQLEKSRQKKEELL--QKSRKTPNSSSCRNCIPAAGEQT  717
            QE  +LPDQLDE  KYIK L+  LE+ +++KE L+  +K      +SS  N         
Sbjct  4    QEATSLPDQLDEATKYIKRLQTNLERMKERKERLMGIEKPDAAAATSSSGNSSGTITTGL  63

Query  716  EPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
              P+I++ +    + VVL  GL+    F   IR+LH ++G+++ NA+F +  ++     H
Sbjct  64   RSPQIEIHEMGSALEVVLTTGLDFQFMFIETIRLLH-EEGVEIVNASFNVVEDTIFHTIH  122

Query  536  EQV  528
             ++
Sbjct  123  SKI  125



>ref|XP_010251285.1| PREDICTED: uncharacterized protein LOC104593221 isoform X1 [Nelumbo 
nucifera]
Length=221

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 85/176 (48%), Gaps = 25/176 (14%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQE--RMALP----------------  870
            T   + K +RK IE+NRR H+K L   L +L+P HQ   R  +                 
Sbjct  3    TCGGSTKPDRKTIERNRRIHMKRLCFKLDALIPKHQNVYRSCICHHPLWRSSSMKDATNQ  62

Query  869  -DQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVV  693
             D+LD    YI  L  ++E+ +++++ ++       N    R+ +    +    P +++ 
Sbjct  63   RDRLDRAASYIMQLRERIEELKERRQLVMCIKGINRNM---RDSMKI--DDVGLPVLELR  117

Query  692  DTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            D+ P + VVLI+GL     FY II VL +++G +V NA+F   G+      H QV+
Sbjct  118  DSGPNLEVVLISGLNKSFTFYEIICVL-EEEGAEVVNASFACVGDRIFHTIHAQVK  172



>ref|XP_008791819.1| PREDICTED: uncharacterized protein LOC103708585 [Phoenix dactylifera]
Length=156

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 72/141 (51%), Gaps = 12/141 (9%)
 Frame = -2

Query  935  LKSLYTDLFSLLP-----AHQERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRK  771
            +K+L + L SLLP          + LPD+L+E   YIK L+ +LE+ +++K +L++    
Sbjct  1    MKALCSQLDSLLPNPPTSREGATLPLPDRLEEAANYIKSLQRRLERMKERKRKLME----  56

Query  770  TPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQ  591
            +  +S     +   G +   P+I+V D   G+ VV+ N       FY  +RV+ ++ G +
Sbjct  57   SEGTSRGTGSVERGGMRL--PQIEVQDLGSGLRVVITNSPGDRRMFYEAVRVMEEEGG-E  113

Query  590  VTNATFQIHGNSTLQVAHEQV  528
            + NA F + G+      H  V
Sbjct  114  ILNANFLVVGDKAFHSIHSMV  134



>ref|XP_010057408.1| PREDICTED: uncharacterized protein LOC104445269 isoform X2 [Eucalyptus 
grandis]
Length=145

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -2

Query  902  LPAHQERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGE  723
            + + ++ ++LPDQL E   YI+ L+ ++EK R++KE+LL+  +     ++  N  P  G 
Sbjct  1    MSSMEKTLSLPDQLGEAANYIRSLQVKVEKMREQKEQLLEVGK----INTTMNSGPMIGF  56

Query  722  QTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQV  543
            ++  PEI++ +    + VVL+ GL+    F   ++V+H ++G  + NA+    G++ L  
Sbjct  57   KS--PEIRIWNNKSILEVVLVTGLDGQFMFNETVQVIH-EEGADIVNASSSYVGDAMLHT  113

Query  542  AHEQV  528
             H +V
Sbjct  114  IHAKV  118



>gb|KHN07252.1| Transcription factor bHLH125 [Glycine soja]
Length=179

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 92/206 (45%), Gaps = 45/206 (22%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMAL--PDQLDETVKYIKCLENQLEKS  810
            + + + K IE+NRRN +K L++ L S++P    R A   PD++ E   YIK L+ +LEK 
Sbjct  7    SSRTDTKSIEQNRRNQMKDLFSKLNSVVPHQSSREATSQPDKIGEATNYIKNLQIKLEKM  66

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++K+  L+   R        +N     G   + P+ ++      + +VL+ G++    F 
Sbjct  67   KEKRNNLIDIERS-------KNASMNMG--LKSPQFKIQQMGSALEIVLVTGMDCQFMFA  117

Query  629  G--------IIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*P  474
                      IR L +++G  + NA++ +  N+     H           C         
Sbjct  118  WQNIFFLTETIRAL-QEEGYDIVNASYTVVENAVFHTIH-----------C---------  156

Query  473  GFFQVGKSEMGM--IAERLKVVIKGC  402
               QVG S  G   I+E++K  + GC
Sbjct  157  ---QVGGSANGALRISEKIKKYLNGC  179



>ref|XP_011072116.1| PREDICTED: uncharacterized protein LOC105157401 [Sesamum indicum]
Length=187

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 81/164 (49%), Gaps = 9/164 (5%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLL------PAHQERMALPDQLDETVKYIK  837
            T+ +   K+ERK IEKNRR  +K L   L SL+      PA +E +   DQL++   YI+
Sbjct  7    TSSSAGSKVERKIIEKNRRIQMKDLCLKLVSLIPPQHSRPAEKENLTQQDQLEQAASYIQ  66

Query  836  CLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLIN  657
             L  ++E+ R++K + L  +    N+S+ R   P +  +   P ++       + VVLI+
Sbjct  67   QLSARVEEMRRRKAQALAAAAAAANASTKRG--PPSTSRLVSPVLKFRVFGQSLEVVLIS  124

Query  656  GLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            GL      + ++ +L + +G +V        G+      H QV+
Sbjct  125  GLTRNFSLHKVVSIL-EDEGAEVNTVNLSTIGDKVFHTIHAQVK  167



>ref|XP_009336213.1| PREDICTED: transcription factor bHLH36-like [Pyrus x bretschneideri]
Length=244

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP--AHQERMALPDQLDETVKYIKCLENQL  819
            ++ + K+ER+ +EKNRRN +K LY++L+SLLP    +E ++  +Q+DE +KYIK  E++L
Sbjct  8    ESSSTKVERRVVEKNRRNRMKLLYSNLYSLLPKQTFKEPLSQTEQIDEAIKYIKSQESKL  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESIS  639
            +K ++KKE L+ ++RK   +++C N         + P I++ +    + VVLI+GLE+  
Sbjct  68   QKLKEKKESLM-RTRKRSYATACVNV--ENTRSAKAPLIKIHEIDSTLEVVLISGLENHQ  124

Query  638  -QFYGIIRVLHKQQGLQVTNATFQIHGNSTLQ  546
              FY IIR+L  +    V +A F   G+S   
Sbjct  125  FMFYEIIRLLDAEHA-NVVHANFSTLGDSVFH  155



>ref|XP_006345192.1| PREDICTED: uncharacterized protein LOC102584256 [Solanum tuberosum]
Length=183

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 90/161 (56%), Gaps = 15/161 (9%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLENQLE  816
            + + K++RK  E+NRR  +K L + LFSL+P++  +E     D +D+ + YI  L+ ++E
Sbjct  12   STSQKIDRKTQERNRRIQMKYLSSKLFSLIPSNYSKEVRTKQDHVDQAISYIGELKERVE  71

Query  815  KSRQKKEELLQ----KSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
              +++KEE+ Q     SRK+ +++SC    P         E++ +D++  + ++L +GL+
Sbjct  72   VLKKRKEEVAQGTSDHSRKSMSTTSCTIKTPMV-------EVRELDSTLEV-IILTSGLQ  123

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
                   +I+++ +++G QV  A +    ++     H QV+
Sbjct  124  KNFTLQEVIKII-EEEGAQVVTANYSTIEDAIYYTIHAQVK  163



>ref|XP_007204917.1| hypothetical protein PRUPE_ppa024966mg [Prunus persica]
 gb|EMJ06116.1| hypothetical protein PRUPE_ppa024966mg [Prunus persica]
Length=243

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 81/160 (51%), Gaps = 2/160 (1%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-ERMALPDQLDETVKYIKCLEN  825
             ++  T A KL     E++RR  + SLY+ + SLLPA Q +++++PD +   +KYI  L+ 
Sbjct  64    SSGSTMAKKLNHNASERDRRKKINSLYSSMRSLLPADQAKKLSIPDTISRVLKYIPELQK  123

Query  824   QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLES  645
             Q+E   +K+EELL ++    +       + +    +  P +     S     + I+ L++
Sbjct  124   QVEGLIRKREELLSRASNQEDVMREEKDMKSTARSSSLPAVSTYRLSDRELAIQISTLKT  183

Query  644   ISQFYGIIRVLHKQQGLQVTNATF-QIHGNSTLQVAHEQV  528
              +     I +  +++GLQV NA+F +  G       H QV
Sbjct  184   HNNLLSEILLNLEEEGLQVLNASFLESSGERVFYNLHLQV  223



>emb|CDM80000.1| unnamed protein product [Triticum aestivum]
 emb|CDM80013.1| unnamed protein product [Triticum aestivum]
Length=225

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 82/182 (45%), Gaps = 32/182 (18%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA------------------HQERMALPDQLDET  852
            K+ERK +EKNRR H+K L   L SL+PA                  +++     DQLD  
Sbjct  26   KMERKDVEKNRRLHMKGLCLKLSSLVPASPSSDHHLRHYSSSPPSSNKDAATQLDQLDSA  85

Query  851  VKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP-------PEIQVV  693
              YIK L  +++  +++K+  +        ++ C + I     +  P       P I+V 
Sbjct  86   AAYIKQLRGRIDDLKRRKQAAVS------GTAGCSSSISTGDYKGAPSTATTALPVIEVR  139

Query  692  DTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLI  513
                 + V L++ +    + + +I VL +Q+G +V +A+F + G+      H Q  +  I
Sbjct  140  HQDGTLDVALVSEVGRPFRLHEVIAVL-EQEGAEVVSASFSVVGDKIFYTVHSQALYPRI  198

Query  512  ML  507
             L
Sbjct  199  GL  200



>gb|EMS45882.1| hypothetical protein TRIUR3_14872 [Triticum urartu]
Length=213

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 81/170 (48%), Gaps = 24/170 (14%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP---------------AHQERMALPDQLDETV  849
            A K+ERK +EKNRR H+K L   L SL+P               ++++     DQLD   
Sbjct  16   ASKMERKDVEKNRRLHMKGLCLKLSSLVPPSSAHYSSTSSSPPSSNKDAATQLDQLDSAA  75

Query  848  KYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP---PEIQVVDTSPG  678
             YIK L  +++  +++K+  L     +  ++ C + + A   +++    P I+V      
Sbjct  76   AYIKQLRGRIDDLKRRKQAAL-----SGGTAGCSSSVSAGDYKSQTASLPVIEVRHQDGT  130

Query  677  MSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQV  528
            + V L +      + + +I VL +Q+G +V +A+F + G+      H Q 
Sbjct  131  LDVALASESGRPFRLHEVIAVL-EQEGAEVVSASFSVVGDKIFYTVHSQA  179



>ref|XP_008364666.1| PREDICTED: uncharacterized protein LOC103428336 [Malus domestica]
Length=181

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = -2

Query  869  DQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSS-SCRNCIPAAGEQTEPPEIQVV  693
            +QLD  V YIK L  ++E  +++KE+ ++    + NS  S      A    +  P +++ 
Sbjct  47   NQLDTAVSYIKQLRERIENLKERKEKAMRSQLGSSNSDISAIAAENAVMTGSRLPVLELR  106

Query  692  DTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
            D+   + V+LI+GL     FY +IRVL ++QG +V +A+F   G+      H QV+
Sbjct  107  DSGSCIEVMLISGLNKNFMFYEVIRVL-EEQGAEVVSASFSTVGDKVFHSVHAQVK  161



>gb|KHN40119.1| hypothetical protein glysoja_044767 [Glycine soja]
Length=173

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (50%), Gaps = 26/149 (17%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKC  834
            T+ + +PKL RK I++NRR H+KSL     S +P++     ++ +   DQLD    YIK 
Sbjct  6    TSTSGSPKLHRKTIQRNRRIHMKSLCFKYLSSIPSNDLKPTKDMLYQQDQLDLAATYIKH  65

Query  833  LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
            L+ +++K + +KE                  I   G Q   P I++ D   G+ V+LI+G
Sbjct  66   LKERIQKLKGEKE------------------IFNIGSQL--PLIEIKDLGLGIGVMLISG  105

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQI  567
            L      Y +I VL ++ G +V    + +
Sbjct  106  LNKNLMLYEVISVL-EEDGAEVVTVAWGL  133



>ref|XP_007009593.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY18403.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=161

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 77/135 (57%), Gaps = 12/135 (9%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKKE  795
            ++R  IE+ RR++LK+LY+ LFSLLP    +M+L D+L+    +IK L+ Q+E+ +Q+K 
Sbjct  1    MQRNLIERERRSNLKNLYSKLFSLLPPQPAKMSLLDKLELATVHIKQLQRQVEELKQRKM  60

Query  794  ELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF-YGIIR  618
            +L  +  +  N          +G  T  P + ++D+   M V L+ G  S  +F  G I 
Sbjct  61   QLDDQESEAWNRVK-------SGRIT--PVLNIIDSDSIMEVNLVTG--SDMKFTLGEII  109

Query  617  VLHKQQGLQVTNATF  573
             + +++G +V  AT+
Sbjct  110  NIIEEEGAEVIGATY  124



>emb|CDP12371.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 82/159 (52%), Gaps = 11/159 (7%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQ  822
             + K++RK +E+NRR  +K L  +L SL+P       +E ++  DQ+D+   YI  L  +
Sbjct  9    ASTKIDRKTVERNRRIRMKGLIHELTSLVPPQHFVPSKELLSQRDQIDQVAAYIMQLRER  68

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            +E  ++ K EL++   +T  + S  + IP +      P +++ +    + VVL+ G    
Sbjct  69   VENLKKSK-ELVKSKVETKGTKSRNSAIPGSS----IPIVKIREIGSNLEVVLVTGSTKN  123

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               + +I +L ++QG++V + +     +    + H QV+
Sbjct  124  FALHEVILIL-EEQGVEVVSISISTMDDKICHILHAQVK  161



>ref|XP_010651083.1| PREDICTED: uncharacterized protein LOC104879556 [Vitis vinifera]
Length=173

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 70/136 (51%), Gaps = 6/136 (4%)
 Frame = -2

Query  992  KTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEK  813
            ++   KL+R  +E+NRR H+K L++ L  L+P    + +L   LD    YIK L+ ++E 
Sbjct  5    RSNLSKLDRSAVERNRRMHMKDLFSRLAFLVPTRPSKSSLHVSLDHATTYIKQLQKRIET  64

Query  812  SRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
             +Q K +LLQ S  T  +   R  +  A   +  P I V D    + ++LI+G     + 
Sbjct  65   LKQTK-QLLQGS--TDETGGVRCQMSGA---SRSPVITVRDMGSSLELLLISGSNKKFRL  118

Query  632  YGIIRVLHKQQGLQVT  585
            + +I VL ++    VT
Sbjct  119  HEVISVLEEEAAQVVT  134



>ref|XP_007009590.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY18400.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=163

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (48%), Gaps = 29/191 (15%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKKE  795
            ++R  IE+ RR+++ +L + LF LLP    +M++PD +     Y K L+ QLE+ +++K 
Sbjct  1    MDRNSIERERRSNMSNLLSRLFRLLPPQPTKMSIPDMVQLATIYAKQLQRQLEELKKRKM  60

Query  794  ELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRV  615
            +L  +S+     + CR        +T  P + ++D++  M+V LI G         II V
Sbjct  61   QLEGESK-----AVCR-----VTSETICPVLDIIDSNSTMTVNLITGSNVEFTPSEIISV  110

Query  614  LHKQQGLQVTNATFQIHGNSTLQVAHEQVRWLLIMLSCLPKFISD*PGFFQVGKSEMGMI  435
            + +++G  V   T+   G +            + +LS   K I    G       E   +
Sbjct  111  I-EEEGAAVIGVTYNNAGGT------------MNILSIHCKAICSRIGI------ESSRL  151

Query  434  AERLKVVIKGC  402
             ERLK +I+ C
Sbjct  152  GERLKTLIEEC  162



>gb|KHN34305.1| hypothetical protein glysoja_016633 [Glycine soja]
Length=165

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 73/142 (51%), Gaps = 11/142 (8%)
 Frame = -2

Query  935  LKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEKSRQKKEELLQKSRK  771
            +KSL   L S +P++     ++ ++  DQLD    YIK L+ ++EK + +KE+++     
Sbjct  1    MKSLCFKLVSTIPSNDLKPTKDMLSQQDQLDLATTYIKRLKERIEKLKGEKEKIMNMMM-  59

Query  770  TPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIRVLHKQQGLQ  591
              +S+   N I   G Q   P +++ D   G+ V+LI+GL      Y +I VL +++G +
Sbjct  60   --SSNQNNNSIFNIGSQL--PLLEIKDLGSGIEVMLISGLNKNFMLYEVISVL-EEEGAE  114

Query  590  VTNATFQIHGNSTLQVAHEQVR  525
            V  A F    +      H QV+
Sbjct  115  VVTANFSTVADKIFYTVHAQVK  136



>ref|XP_010678925.1| PREDICTED: uncharacterized protein LOC104894404 [Beta vulgaris 
subsp. vulgaris]
Length=179

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 78/155 (50%), Gaps = 15/155 (10%)
 Frame = -2

Query  971  ERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLEKSR  807
            ++K  EKN R  +  L +DL S++P       +  ++  D++++   YI  L+ +++   
Sbjct  15   QKKVAEKNWRARINDLCSDLTSIIPPEHFQPFKNMLSQADKIEQATNYIVELKERVDNLN  74

Query  806  QKKEELLQ-KSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            ++K +L   + ++T N ++  N        +  P I + D    + V L+  LE     +
Sbjct  75   KRKGQLGDDRVQRTLNDATMVN--------SALPIIDIKDLGSSLEVQLVMALEDNIMLH  126

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
             +IRVL +++G +V NATF   GN  +   H +VR
Sbjct  127  EVIRVL-EEEGAEVVNATFSTSGNKVIHTLHAKVR  160



>ref|XP_004967963.1| PREDICTED: uncharacterized protein LOC101784195 [Setaria italica]
Length=219

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 74/167 (44%), Gaps = 22/167 (13%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMAL------------------PDQLDET  852
            KLERK +EKNRR H+K L   L SL+P      +L                   DQLD  
Sbjct  33   KLERKDVEKNRRLHMKGLCLKLSSLIPPAARHASLLSEAAASASNPNKDTVTQLDQLDSA  92

Query  851  VKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMS  672
              YIK L+ ++E  +++KE           +++              P I+V      + 
Sbjct  93   AAYIKQLKERIEALKRRKEGRGGGKGGAGAAAAPVGGGAG---GVRMPVIEVRYQDGTLD  149

Query  671  VVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            VVLI+  E   + + +I VL +Q+G +V +A+F + G+      H Q
Sbjct  150  VVLISEAERPFKLHEVITVL-EQEGAEVVSASFSVVGDKIFYTVHSQ  195



>ref|XP_003565225.1| PREDICTED: uncharacterized protein LOC100830809 [Brachypodium 
distachyon]
Length=206

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 82/174 (47%), Gaps = 18/174 (10%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP----AHQERMALPDQLDETVKYIKC  834
             +  K+    +ERK IE+ RR H+K L   L SL+P    +  + M     LDE   YIK 
Sbjct  12    SKAKSIGMTMERKEIERKRRQHMKGLCLKLASLIPKQHYSSADTMTQLSSLDEAASYIKK  71

Query  833   LENQLEKSRQKKE--ELLQKSRKTPNSSSCRN-------CIPAAGEQTEPPEIQVVDT--  687
             L++++++ RQKK   + +  SR+   +S  R+        +     +     + VV+   
Sbjct  72    LKDRVDELRQKKNSAQAMASSREVGGASKMRDRTMLSELEVEEEAGEALSASVPVVEVRH  131

Query  686   --SPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
                  M VVLI   +   +F+ +I VL +++G ++ NA + +  +      H +
Sbjct  132   HDDSSMDVVLICNAKRPLKFHEVITVL-EEEGAEIINANYSVGDDKIFYTIHSR  184



>ref|XP_008243130.1| PREDICTED: transcription factor ORG2-like [Prunus mume]
Length=243

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 78/154 (51%), Gaps = 2/154 (1%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-ERMALPDQLDETVKYIKCLENQLEKSR  807
            A KL     E++RR  + SLY+ + SLLPA Q +++++P+ +   +KYI  L+ Q+E   
Sbjct  70   AKKLNHNASERDRRKKINSLYSSMRSLLPADQAKKLSIPNTISRVLKYIPELQKQVEGLI  129

Query  806  QKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYG  627
            +K+EELL ++ K  +       + +    +    +     S     + I+ L++ +    
Sbjct  130  RKREELLSRASKQEDVMQEEKDMKSTARSSSLSAVSTYRLSDREVAIQISTLKTHNNLLS  189

Query  626  IIRVLHKQQGLQVTNATF-QIHGNSTLQVAHEQV  528
             I +  +++GLQV NA+F +  G       H QV
Sbjct  190  EILLNLEEEGLQVLNASFLESSGERVFYNLHLQV  223



>ref|XP_008439139.1| PREDICTED: transcription factor bHLH36-like [Cucumis melo]
 ref|XP_008439141.1| PREDICTED: transcription factor bHLH36-like [Cucumis melo]
 ref|XP_008439142.1| PREDICTED: transcription factor bHLH36-like [Cucumis melo]
Length=221

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 72/136 (53%), Gaps = 11/136 (8%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLEN  825
            TT+    K+  + +E+ RR  + SL T+L SLLP    + R +  D +DE V YI+ L  
Sbjct  47   TTQNEEKKIMHRDVERERRKQMASLLTNLRSLLPLEFIKGRRSRVDIVDEAVNYIEYLRG  106

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL--  651
            ++ +   K++ ++ K     +SSSC N IP+         + +   S G+ +V+ NG+  
Sbjct  107  KINELHLKRDAIV-KRLHLESSSSCNNDIPST------SCVVIKQYSGGLEIVISNGIIS  159

Query  650  ESISQFYGIIRVLHKQ  603
            E   Q  G++RVL +Q
Sbjct  160  EQNFQLSGVMRVLIEQ  175



>ref|XP_008438283.1| PREDICTED: uncharacterized protein LOC103483440 [Cucumis melo]
Length=190

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 85/159 (53%), Gaps = 12/159 (8%)
 Frame = -2

Query  995  TKTPAPKLERKYIEKNRRNHLKSLYTDLFSLL-PAH----QERMALPDQLDETVKYIKCL  831
            T + + +L+RK +EKNRR+H+KSL ++LF+L+ P+H    +E ++  +Q+   + YI  L
Sbjct  10   TSSSSAELDRKTMEKNRRSHMKSLCSNLFNLVPPSHFKIPKELISQQNQICHVIAYINEL  69

Query  830  ENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGM-SVVLING  654
            + ++E   ++K+ L    R   +SS   +      + T P  I++ D    +  ++LI+ 
Sbjct  70   KERVENLEKRKQAL----RLQTHSSHIHDQANNNNDVTLPI-IEINDLGNDIVHIMLISS  124

Query  653  LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
            +      + II V+ +++G QV NA     GN      H
Sbjct  125  VNRSFMLHQIISVI-EEEGGQVVNAGLSTIGNKVFHSLH  162



>ref|XP_007149839.1| hypothetical protein PHAVU_005G102700g [Phaseolus vulgaris]
 gb|ESW21833.1| hypothetical protein PHAVU_005G102700g [Phaseolus vulgaris]
Length=178

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 82/153 (54%), Gaps = 16/153 (10%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSL-----YTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKS  810
            LER+ +EKNRRNH+K+L          + +P   E ++  D +DE   YIK LE +++ +
Sbjct  16   LERRIVEKNRRNHMKNLCSNLNSLLPNNNIPREGE-LSRGDLIDEATNYIKNLETKVKMA  74

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            +QKKE LL + +++ ++SS            E P+I++ +    + ++L+   ++     
Sbjct  75   QQKKESLLLQKKRSRSASS---------SSYEAPKIEIHEMDSSLQIILMCTHDNQFILT  125

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             IIR+L  ++ ++V +    I GNS L V   Q
Sbjct  126  EIIRIL-LEETIEVISVNSSITGNSMLHVVKAQ  157



>ref|XP_007149841.1| hypothetical protein PHAVU_005G102900g [Phaseolus vulgaris]
 gb|ESW21835.1| hypothetical protein PHAVU_005G102900g [Phaseolus vulgaris]
Length=178

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 82/153 (54%), Gaps = 16/153 (10%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSL-----YTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKS  810
            LER+ +EKNRRNH+K+L          + +P   E ++  D +DE   YIK LE +++ +
Sbjct  16   LERRIVEKNRRNHMKNLCSNLNSLLPNNNIPREGE-LSRGDLIDEATNYIKNLETKVKMA  74

Query  809  RQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFY  630
            +QKKE LL + +++ ++SS            E P+I++ +    + ++L+   ++     
Sbjct  75   QQKKESLLLQKKRSRSASS---------SSYEAPKIEIHEMDSSLQIILMCTHDNQFILT  125

Query  629  GIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
             IIR+L  ++ ++V +    I GNS L V   Q
Sbjct  126  EIIRIL-LEETIEVISVNSSITGNSMLHVVKAQ  157



>ref|XP_009404833.1| PREDICTED: transcription factor bHLH120-like [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 77/161 (48%), Gaps = 23/161 (14%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLP----AHQERMALPDQLDETVKYIKC  834
              +      K+ER+ +E+NRR  +K+L   L SL+P      +  M   DQLD+   YIK 
Sbjct  3     ASAGVEGAKIERRTVERNRRICMKNLCFKLTSLIPRDTTMSKRAMRDQDQLDQAFNYIKE  62

Query  833   LENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLING  654
             L+ ++EK +QKKE      R T            A       E++ +D++  + V  ++G
Sbjct  63    LQGRVEKLKQKKE----MRRMT------------ADLHFLLVEVRSMDST--LLVSFVSG  104

Query  653   LESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
               S   F  +I VL +++G +V +A+F + G       H Q
Sbjct  105   SRSSYMFGKVIGVL-EEEGAEVISASFNLVGGRIFHTIHCQ  144



>ref|XP_010927034.1| PREDICTED: transcription factor bHLH100-like [Elaeis guineensis]
Length=260

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 32/169 (19%)
 Frame = -2

Query  986  PAPKLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEK  813
            P  KL     E++RR  L +LY+ L SLLP     +++++P  +   +KYI  L+ Q+EK
Sbjct  78   PTRKLNHNAYERDRRKKLNTLYSSLRSLLPETDQSKKLSIPSTVSRVLKYIPELQRQVEK  137

Query  812  SRQKKEE-LLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
              ++KEE LL  SR+  +  +    I                  P +S   +N  E + Q
Sbjct  138  LTRRKEEILLMVSRQEEHGHNSTGGI----------------IYPIVSATCLNNKEVMLQ  181

Query  635  -----------FYGIIRVLHKQQGLQVTNA-TFQIHGNSTLQVAHEQVR  525
                       F  ++RVL + +GLQ+ NA TF  H + T    H Q R
Sbjct  182  ICFLHKAVCLPFSKVLRVL-EGEGLQLMNASTFTTHADKTFYTLHLQAR  229



>ref|XP_004148147.1| PREDICTED: transcription factor bHLH36-like [Cucumis sativus]
 gb|KGN57317.1| hypothetical protein Csa_3G178580 [Cucumis sativus]
Length=222

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 72/136 (53%), Gaps = 11/136 (8%)
 Frame = -2

Query  998  TTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLEN  825
            TT+    K+  + +E+ RR  + SL T+L SLLP    + R +  D +DE V YI+ L  
Sbjct  48   TTQNEEKKIMHRDLERERRKQMTSLLTNLRSLLPLEFIKGRRSRVDIVDEAVNYIEYLRG  107

Query  824  QLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGL--  651
            ++ +   K++ ++ K     +SSSC N IP+         + +   S G+ +V+ NG+  
Sbjct  108  RMNELHVKRDAIV-KRLHLESSSSCNNDIPSTS------CVVIKQYSGGLEIVISNGIIS  160

Query  650  ESISQFYGIIRVLHKQ  603
            E   Q  G++RVL +Q
Sbjct  161  EQNFQLSGVMRVLIEQ  176



>ref|NP_001140429.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83823.1| unknown [Zea mays]
 tpg|DAA53807.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04359.1| bHLH transcription factor, partial [Zea mays]
Length=229

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 74/173 (43%), Gaps = 25/173 (14%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA------------------------HQERMALP  870
            KLERK +EKNRR H+K L   L SL+P                          Q+ +   
Sbjct  30   KLERKDVEKNRRLHMKGLCLKLSSLIPPAAATTHASLLSDAASAAVSSNPGNKQDAVTQL  89

Query  869  DQLDETVKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVD  690
            DQLD    YIK L+ ++E  +Q+K            +++        G     P I+V  
Sbjct  90   DQLDSAAAYIKQLKERIEALKQRKAGCCNGGGAATEAATAAAGSTGGGGGVRMPVIEVRC  149

Query  689  TSPGMSVVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
                + VVLI+      + + +I VL +Q+G +V +A+F + G+      H Q
Sbjct  150  QDGTLDVVLISEAARPFKLHEVITVL-EQEGAEVVSASFSVIGDKIFYTVHSQ  201



>ref|XP_007044624.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY00456.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=173

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 64/143 (45%), Gaps = 10/143 (7%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALPDQLDETVKYIKCLENQLEKSRQKK  798
            K+ R  +EK RR  L++LY+ L SLLP    +M+  D L++   YI  L  ++E+ +Q K
Sbjct  13   KINRTLVEKERRMRLRNLYSQLSSLLPPQPRKMSTHDVLEQATLYINQLRKRVEELKQMK  72

Query  797  EELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQFYGIIR  618
             +L            C          T  P I + D    + V LI G +   +   II+
Sbjct  73   LQL----------QECEGATETTSGPTISPVINISDLDSTLEVNLITGWDGKFKLSDIIK  122

Query  617  VLHKQQGLQVTNATFQIHGNSTL  549
            VL ++     T A     G+ T+
Sbjct  123  VLMEEGAEVKTVAANHNAGDRTI  145



>ref|XP_009409207.1| PREDICTED: uncharacterized protein LOC103991458 [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 22/157 (14%)
 Frame = -2

Query  980  PKLERKYIEKNRRNHLKSLYTDLFSLLPAHQERMALP-------DQLDETVKYIKCLENQ  822
             ++ERK +EK RR H+KSL   L S++P  +E M          D LD+   YIK LE +
Sbjct  11   SRMERKTVEKYRRMHMKSLCLQLSSIIP--KEHMTTSKNGLTQNDSLDQATSYIKKLEER  68

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESI  642
            +E  +Q         R+   + +  N +       + P ++V      + ++LI+ +   
Sbjct  69   IENLKQ---------RRLTWAMTETNGVTVG---FQLPILEVRHRDMDLEILLISRVSKR  116

Query  641  SQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
              F+ +I VL +++G  V NA+F   G+      H +
Sbjct  117  FMFHEVINVL-EEEGADVVNASFSTVGDKIFHTIHSK  152



>ref|XP_002451822.1| hypothetical protein SORBIDRAFT_04g008260 [Sorghum bicolor]
 gb|EES04798.1| hypothetical protein SORBIDRAFT_04g008260 [Sorghum bicolor]
Length=200

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 76/167 (46%), Gaps = 32/167 (19%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLL------------------PAHQERMALPDQLDET  852
            K +RK +E+NRRN + +LY+ L SL+                  PA    M  PD+L+E 
Sbjct  23   KPDRKTVERNRRNQMNALYSRLDSLVRAGSSPSSSAAAAVQRGPPA----MTRPDRLEEA  78

Query  851  VKYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMS  672
              YI+    ++E+ +++K ELL  +R + +  S               E++V     G+ 
Sbjct  79   AAYIRQTTERVERLKERKRELLTSARASSSQGSGSGS-------GAAAEVEVQHLGSGLH  131

Query  671  VVLINGL--ESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAH  537
             +L+ G      + F+  +R + ++ G +V NA F + G   +   H
Sbjct  132  AILVTGAPPSEGASFHRAVRAV-EEAGGEVQNAHFSVVGARAIYTIH  177



>ref|XP_009398132.1| PREDICTED: uncharacterized protein LOC103982820 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 75/155 (48%), Gaps = 18/155 (12%)
 Frame = -2

Query  980  PKLERKYIEKNRRNHLKSLYTDLFSLLPAH-----QERMALPDQLDETVKYIKCLENQLE  816
             K+ERK  EK RR H+K+L   L S++P       ++ +   D  D+   YIK L  ++E
Sbjct  12   SKVERKTTEKYRRMHMKNLCFKLSSIIPEEHRTISKDVLTQQDNFDQATSYIKKLRERIE  71

Query  815  KSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQ  636
            + +Q+K  L+Q S    +++           +   P I+V      + +++I+ L     
Sbjct  72   RLKQRK--LMQTSTVRRDTTM----------RFASPIIEVRHQDLNLEILVISDLNKRFM  119

Query  635  FYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQ  531
            F+ +I V+ +++G +V  A F I G+      H Q
Sbjct  120  FHEVINVI-EEEGAEVVTANFSIVGDKIYHTIHSQ  153



>ref|XP_002457514.1| hypothetical protein SORBIDRAFT_03g008570 [Sorghum bicolor]
 gb|EES02634.1| hypothetical protein SORBIDRAFT_03g008570 [Sorghum bicolor]
Length=191

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 82/178 (46%), Gaps = 29/178 (16%)
 Frame = -2

Query  974  LERKYIEKNRRNHLKSLYTDLFSLLP----AHQERMALPDQLDETVKYIKCLENQLEKSR  807
            ++RK +E+ RR  +KSL   L SL+P    + ++ M     LDE   YIK L+ ++E+ R
Sbjct  14   VQRKEVERRRRQQMKSLCVKLASLIPKEHYSSKDAMTQLGSLDEAATYIKKLKERVEELR  73

Query  806  QKK--EELLQKSR-----------------KTPNSSSCRNCIPAAGEQ--TEPPE-IQVV  693
            QK+    LL  +                   T  +S        AG+     PP  ++V 
Sbjct  74   QKRTSARLLAAAAGMRRGGGGAGGASTSPAATTTASGGAGSSEEAGDHMPVAPPAVVEVR  133

Query  692  DTSPGMS--VVLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
              S G S  VVLI+ +E   + + ++ VL +++G +  NA F + G       H +VR
Sbjct  134  QHSDGSSLDVVLISSVERPFKLHEVVTVL-QEEGAETINANFSVAGTKIFYTIHCRVR  190



>ref|XP_009339562.1| PREDICTED: transcription factor ORG2-like [Pyrus x bretschneideri]
Length=251

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 81/156 (52%), Gaps = 7/156 (4%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLPAHQ-ERMALPDQLDETVKYIKCLENQLEKSR  807
            A KL     E++RR  + +LY  L SLLPA Q +++++P+ +   +KYI  L+ Q+E   
Sbjct  79   AKKLNHNASERDRRKKINNLYASLRSLLPADQTKKLSIPNTISHALKYIPELQKQVEGLN  138

Query  806  QKKEELLQKSRKTPNSSSCRNCI--PAAGEQTEPPEIQVVDTSPGMSVVLINGLESISQF  633
            +K+EELL ++ K  ++      I   A   Q+     ++ D    + +       ++   
Sbjct  139  RKREELLSRASKQEDAMHKEKKIKSTARSSQSAVSTYRLNDREVAIQISTFKTHNNL--L  196

Query  632  YGIIRVLHKQQGLQVTNAT-FQIHGNSTLQVAHEQV  528
            + I++ L +++GLQ+ NA+ F+ +G       H QV
Sbjct  197  FEILQHL-EEEGLQLENASFFESYGGRVFYNLHLQV  231



>ref|XP_009625858.1| PREDICTED: transcription factor ORG2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=255

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            KL     E++RR  + +LY+ L SLLPA  H +++++P  +   +KYI+ L+N++E+  Q
Sbjct  74   KLNHNASERDRRKKINTLYSSLRSLLPASDHAKKLSIPSTISRVLKYIQELQNEVERLIQ  133

Query  803  KKEELLQKSRKTPNSSSCRN  744
            KKEEL+ ++     +S+  N
Sbjct  134  KKEELISRTNSNKENSADFN  153



>gb|EMS50762.1| hypothetical protein TRIUR3_01157 [Triticum urartu]
Length=177

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (48%), Gaps = 17/157 (11%)
 Frame = -2

Query  983  APKLERKYIEKNRRNHLKSLYTDLFSLLP---------------AHQERMALPDQLDETV  849
            A K+ERK +EKNRR H+K L   L SL+P               ++++     DQLD   
Sbjct  16   ASKMERKDVEKNRRLHMKGLCLKLSSLVPPSSAHYSSTSSSPPSSNKDAATQLDQLDSAA  75

Query  848  KYIKCLENQLEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSV  669
             YIK L  +++  +++K+  L     +  S+      P+        E++  D S  + V
Sbjct  76   AYIKQLRPRIDHLKRRKQAALTGGCSSSVSAGDYKGAPSTSTALPVIEVRCQDGS-ALDV  134

Query  668  VLINGLESISQFYGIIRVLHKQQGLQVTNATFQIHGN  558
             L +      + + +I VL +Q+G +V +A+F + G+
Sbjct  135  ALASEAGRPFRLHEVIAVL-EQEGAEVVSASFSVVGD  170



>ref|XP_010678747.1| PREDICTED: uncharacterized protein LOC104894259 [Beta vulgaris 
subsp. vulgaris]
Length=187

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 79/161 (49%), Gaps = 7/161 (4%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH----QERMALPDQLDETVKYIKCLENQ  822
            + + +LE+   +K+ RN +  L +DL S++P      +  ++  DQ+++   YI  L  +
Sbjct  9    SSSKRLEKSIAQKSWRNRITELCSDLTSIIPPQHFQSKNMVSQADQIEQATNYIVELRER  68

Query  821  LEKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEP--PEIQVVDTSPGMSVVLINGLE  648
            ++   + KE+L     +   S + +N I        P  P ++V D    ++V L+    
Sbjct  69   VDNLNKSKEQLKLLVNQEETSINQQNAILNDATVANPRFPIVEVKDLGSSLAVQLVIEQG  128

Query  647  SISQFYGIIRVLHKQQGLQVTNATFQIHGNSTLQVAHEQVR  525
               + + IIRVL + +G +V NAT+   GN+ +   H + R
Sbjct  129  YDIKLHEIIRVL-EDEGAEVVNATYSTSGNNIIHTLHAKAR  168



>ref|XP_009625857.1| PREDICTED: transcription factor ORG2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=256

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA--HQERMALPDQLDETVKYIKCLENQLEKSRQ  804
            KL     E++RR  + +LY+ L SLLPA  H +++++P  +   +KYI+ L+N++E+  Q
Sbjct  74   KLNHNASERDRRKKINTLYSSLRSLLPASDHAKKLSIPSTISRVLKYIQELQNEVERLIQ  133

Query  803  KKEELLQKSRKTPNSSSCRN  744
            KKEEL+ ++     +S+  N
Sbjct  134  KKEELISRTNSNKENSADFN  153



>ref|XP_009127274.1| PREDICTED: transcription factor bHLH36-like [Brassica rapa]
Length=188

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -2

Query  1001  TTTKTPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH--QERMALPDQLDETVKYIKCLE  828
             +T      K+  + IE+ RR  + SLY  L SLLP H  Q + +  DQ++E V YI  LE
Sbjct  17    STDNNDMEKMMHREIERQRRQEMASLYASLRSLLPLHFIQGKRSTSDQVNEAVNYITYLE  76

Query  827   NQLEKSRQKKEELLQKSRKTP  765
              ++++   +++EL+  SR TP
Sbjct  77    KKIKELSLRRDELMLLSRGTP  97



>ref|XP_006345193.1| PREDICTED: transcription factor ORG2-like [Solanum tuberosum]
Length=165

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 64/117 (55%), Gaps = 22/117 (19%)
 Frame = -2

Query  989  TPAPKLERKYIEKNRRNHLKSLYTDLFSLLPAH---QERMALPDQLDETVKYIKCLENQL  819
            +   K +RK  EKNRR ++K L++ LF+L+P H   +  +A  DQ+D+ + YI+ L+ ++
Sbjct  8    SAVKKPDRKTQEKNRRINMKCLFSKLFALIPPHHFSKAMLARQDQVDQVISYIEELKERV  67

Query  818  EKSRQKKEELLQKSRKTPNSSSCRNCIPAAGEQTEPPEIQVVDTSPGMSVVLINGLE  648
            E  +++K+           ++SC           + P ++V +    + V+L++GL+
Sbjct  68   EVLKRRKD----------GTTSC---------SIKTPMVEVRELDSTLEVILVSGLQ  105



>ref|XP_004290411.1| PREDICTED: transcription factor ORG2-like [Fragaria vesca subsp. 
vesca]
Length=244

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 81/170 (48%), Gaps = 18/170 (11%)
 Frame = -2

Query  977  KLERKYIEKNRRNHLKSLYTDLFSLLPA-HQERMALPDQLDETVKYIKCLENQLEKSRQK  801
            KL     E++RR  + +LY+ L SL+PA H +R+++P  +   +KYI  L+ Q+E   QK
Sbjct  70   KLNHNASERDRRKKINNLYSSLRSLVPADHAKRLSIPATVSRVLKYIPELQQQVEGLIQK  129

Query  800  KEELLQKSRKTPNSSSCRNCIPAAGEQTEP------PEIQVVDTSPGMSVVLINGLESIS  639
            ++ELL       N S   N I    +Q +         +  V TS      L   + ++ 
Sbjct  130  RDELLS------NMSKQENVILQEEKQLQSTARRSGSSLSAVSTSRLSDTELAIQISTVK  183

Query  638  QFYGII-RVLH--KQQGLQVTNA-TFQIHGNSTLQVAHEQVRWLLIMLSC  501
              + II R+L   ++ GL++ NA TF+  G       H QV  +   L C
Sbjct  184  STHNIISRILQSLEEDGLEILNASTFESSGGRVFYNLHLQVD-MFYRLEC  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2242237191290