BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24609_g1_i1 len=1285 path=[5696:0-130 12488:131-133 11162:134-343
7571:344-368 12588:369-370 7597:371-541 12376:542-633 9453:634-769
3227:770-793 9612:794-946 1730:947-1003 9820:1004-1082
12746:1083-1131 1129:1132-1209 1207:1210-1284]

Length=1285
                                                                      Score     E

ref|XP_009803568.1|  PREDICTED: legumin A-like                          159   1e-39   
ref|XP_009624043.1|  PREDICTED: legumin A-like                          158   2e-39   
ref|XP_009624041.1|  PREDICTED: legumin A-like                          153   1e-37   
ref|XP_009761685.1|  PREDICTED: legumin A-like                          152   2e-37   
ref|XP_011083024.1|  PREDICTED: legumin B-like                          150   9e-37   
ref|XP_009763034.1|  PREDICTED: legumin B-like                          149   3e-36   
gb|ABB60055.1|  11S globulin precursor isoform 4                        149   3e-36   Sesamum indicum [beniseed]
gb|ABB77213.1|  11S globulin-like protein                               147   7e-36   Actinidia chinensis
ref|XP_009628307.1|  PREDICTED: glutelin type-B 1-like                  146   1e-35   
gb|EYU46455.1|  hypothetical protein MIMGU_mgv1a005708mg                146   3e-35   
ref|XP_011080043.1|  PREDICTED: legumin B-like                          144   8e-35   
gb|ABI94736.1|  11S seed storage globulin B                             140   2e-33   Chenopodium quinoa
gb|AAS67037.1|  11S seed storage globulin                               140   4e-33   Chenopodium quinoa
gb|AAO38859.1|  11S globulin                                            137   3e-32   Bertholletia excelsa
ref|XP_006351673.1|  PREDICTED: legumin B-like                          136   6e-32   
gb|ABI94735.1|  11S seed storage globulin A                             135   9e-32   Chenopodium quinoa
gb|AAS67036.1|  11S seed storage globulin                               135   9e-32   Chenopodium quinoa
ref|NP_001291328.1|  uncharacterized protein LOC105171779 precursor     135   9e-32   
ref|XP_004246943.1|  PREDICTED: 12S seed storage protein CRA1-like      134   3e-31   
ref|XP_002300775.1|  legumin family protein                             133   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010679302.1|  PREDICTED: legumin A-like                          133   8e-31   
ref|XP_004234041.1|  PREDICTED: legumin B-like                          132   1e-30   
ref|XP_002530185.1|  11S globulin subunit beta precursor, putative      131   3e-30   Ricinus communis
ref|XP_010025835.1|  PREDICTED: legumin B-like                          131   3e-30   
ref|XP_006356113.1|  PREDICTED: legumin B-like                          130   6e-30   
ref|XP_009603582.1|  PREDICTED: 11S globulin subunit beta-like          130   6e-30   
gb|EYU18320.1|  hypothetical protein MIMGU_mgv1a008983mg                128   8e-30   
ref|XP_009763876.1|  PREDICTED: legumin B-like                          129   2e-29   
pdb|3QAC|A  Chain A, Structure Of Amaranth 11s Proglobulin Seed S...    127   5e-29   
emb|CAA57633.1|  11S globulin seed storage protein                      127   8e-29   Amaranthus hypochondriacus [prince's feather]
ref|XP_002307645.2|  legumin family protein                             127   1e-28   Populus trichocarpa [western balsam poplar]
gb|EPS62256.1|  hypothetical protein M569_12535                         126   1e-28   
ref|XP_006369779.1|  hypothetical protein POPTR_0001s31540g             125   4e-28   
ref|XP_009630003.1|  PREDICTED: legumin B-like                          125   4e-28   
gb|KDP40339.1|  hypothetical protein JCGZ_02337                         124   5e-28   
ref|XP_009765013.1|  PREDICTED: legumin B-like                          124   6e-28   
ref|XP_009765011.1|  PREDICTED: legumin B-like                          124   6e-28   
ref|XP_011004057.1|  PREDICTED: legumin A-like                          124   7e-28   
pdb|2EVX|A  Chain A, Crystal Structure Of Pumpkin Seed Globulin         124   9e-28   
ref|XP_006354542.1|  PREDICTED: legumin B-like                          123   1e-27   
ref|XP_010675057.1|  PREDICTED: 11S globulin subunit beta-like          123   1e-27   
ref|XP_010111925.1|  Legumin A                                          123   1e-27   
gb|AIA57958.1|  beta-globulin B2                                        122   4e-27   
gb|AIO11048.1|  11S globulin                                            121   8e-27   
ref|XP_010671027.1|  PREDICTED: legumin B-like                          120   1e-26   
sp|P13744.1|11SB_CUCMA  RecName: Full=11S globulin subunit beta; ...    120   2e-26   Cucurbita maxima [Boston marrow]
ref|XP_004289947.1|  PREDICTED: glycinin G4-like                        120   2e-26   
gb|KDP40337.1|  hypothetical protein JCGZ_02335                         120   2e-26   
gb|ABK80754.1|  11S globulin precursor isoform 3A                       120   2e-26   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_009405244.1|  PREDICTED: glutelin type-A 2-like                  119   3e-26   
gb|KDP26529.1|  hypothetical protein JCGZ_17687                         118   7e-26   
ref|XP_010104754.1|  11S globulin subunit beta                          118   1e-25   
gb|AIA57961.1|  seed storage protein 2                                  117   1e-25   
ref|XP_006370927.1|  hypothetical protein POPTR_0019s01830g             117   1e-25   
gb|ABM66807.1|  11S globulin                                            117   1e-25   Amaranthus hypochondriacus [prince's feather]
ref|XP_002533465.1|  legumin B precursor, putative                      115   3e-25   Ricinus communis
ref|XP_009777915.1|  PREDICTED: 11S globulin subunit beta-like          117   3e-25   
ref|XP_010556853.1|  PREDICTED: 12S seed storage protein CRB-like       116   3e-25   
ref|XP_004247735.1|  PREDICTED: 11S globulin subunit beta               116   4e-25   
gb|ABK80755.1|  11S globulin precursor isoform 3B                       116   4e-25   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_002532028.1|  legumin A precursor, putative                      115   4e-25   Ricinus communis
ref|XP_006370926.1|  legumin family protein                             116   5e-25   
gb|ABW86979.1|  11S legumin protein                                     115   6e-25   Carya illinoinensis [pecan]
gb|ABW86978.1|  11S legumin protein                                     115   7e-25   Carya illinoinensis [pecan]
ref|XP_002524198.1|  legumin B precursor, putative                      115   8e-25   Ricinus communis
ref|XP_010045998.1|  PREDICTED: legumin A-like                          115   9e-25   
ref|XP_009603583.1|  PREDICTED: 11S globulin subunit beta-like          115   1e-24   
gb|AIA57957.1|  beta-globulin B1                                        115   1e-24   
ref|XP_010542895.1|  PREDICTED: 12S seed storage protein CRD            114   1e-24   
gb|EYU18315.1|  hypothetical protein MIMGU_mgv1a0236971mg               111   1e-24   
gb|EYU18319.1|  hypothetical protein MIMGU_mgv1a005193mg                114   1e-24   
gb|KGN57905.1|  hypothetical protein Csa_3G384800                       114   2e-24   
ref|XP_006370928.1|  hypothetical protein POPTR_0019s01840g             114   2e-24   
gb|AHA36627.1|  Cor a 9 allergen                                        114   2e-24   
gb|AAW29810.1|  seed storage protein                                    114   3e-24   Juglans regia
ref|XP_004152049.1|  PREDICTED: 11S globulin subunit beta-like          114   3e-24   
gb|KFK42732.1|  hypothetical protein AALP_AA1G032500                    113   3e-24   
ref|XP_004155945.1|  PREDICTED: 11S globulin subunit beta-like          113   3e-24   
ref|XP_002524195.1|  legumin B precursor, putative                      113   3e-24   Ricinus communis
gb|AFJ04522.1|  legumin B precursor                                     112   4e-24   
ref|XP_006370929.1|  legumin family protein                             113   5e-24   
emb|CAA83674.1|  legumin B                                              113   5e-24   Vicia sativa [spring vetch]
ref|XP_002524605.1|  legumin A precursor, putative                      113   6e-24   Ricinus communis
ref|XP_011046347.1|  PREDICTED: legumin B-like                          112   7e-24   
gb|KDP26530.1|  hypothetical protein JCGZ_17688                         112   7e-24   
emb|CDP79027.1|  edestin 2                                              112   8e-24   
emb|CDP79029.1|  edestin 2                                              112   9e-24   
gb|KGN45554.1|  hypothetical protein Csa_7G452090                       112   9e-24   
emb|CDP79028.1|  edestin 2                                              112   9e-24   
ref|XP_008805230.1|  PREDICTED: LOW QUALITY PROTEIN: glutelin typ...    112   9e-24   
emb|CAA57846.1|  legumin precur                                         111   1e-23   Magnolia salicifolia
ref|XP_002524606.1|  legumin A precursor, putative                      111   2e-23   Ricinus communis
ref|XP_008462393.1|  PREDICTED: legumin B-like                          111   2e-23   
ref|XP_008447425.1|  PREDICTED: legumin A-like                          110   3e-23   
gb|ABU42022.1|  11S globulin                                            110   3e-23   Pistacia vera [pistachio]
gb|KGN61596.1|  hypothetical protein Csa_2G174130                       110   4e-23   
gb|AAL73404.1|AF449424_1  11S globulin-like protein                     110   5e-23   Corylus avellana [European hazelnut]
gb|ABK80752.1|  11S globulin precursor isoform 1B                       110   5e-23   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_010555095.1|  PREDICTED: cruciferin PGCRURSE5                    109   6e-23   
gb|AAN76862.1|AF453947_1  allergen Ana o 2                              109   7e-23   Anacardium occidentale [maranon]
ref|NP_199225.1|  12S seed storage protein CRA1                         109   7e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99238.1|  unnamed protein product                                109   7e-23   
sp|Q02498.1|CRU1_RAPSA  RecName: Full=Cruciferin PGCRURSE5; AltNa...    109   8e-23   Raphanus sativus
ref|XP_010522580.1|  PREDICTED: 12S seed storage protein CRB-like       109   8e-23   
gb|AFJ04523.1|  glutelin type-A 3 precursor                             109   8e-23   
ref|XP_002533466.1|  glutelin type-A 3 precursor, putative              109   9e-23   Ricinus communis
gb|ABG73110.1|  Pis v 2.0201 allergen 11S globulin precusor             109   1e-22   Pistacia vera [pistachio]
ref|XP_011046348.1|  PREDICTED: legumin B-like                          109   1e-22   
ref|XP_010111924.1|  Legumin A                                          109   1e-22   
ref|XP_002522726.1|  11S globulin subunit beta precursor, putative      107   2e-22   Ricinus communis
gb|AFQ32291.1|  12S seed storage protein                                108   2e-22   
gb|AAA32777.1|  12S storage protein CRA1                                108   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851128.1|  12S seed storage protein CRA1                         107   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ89194.1|  protein                                                 107   2e-22   Coffea canephora [robusta coffee]
emb|CAA54152.1|  12s globulin                                           108   3e-22   Avena sativa [cultivated oat]
emb|CDY38381.1|  BnaC01g09900D                                          108   3e-22   
gb|ABK80751.1|  11S globulin precursor isoform 1A                       108   3e-22   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_010671026.1|  PREDICTED: 13S globulin seed storage protein...    107   3e-22   
emb|CDY65916.1|  BnaC07g48660D                                          107   4e-22   
gb|EYU17920.1|  hypothetical protein MIMGU_mgv1a006934mg                107   4e-22   
ref|XP_002524604.1|  legumin A precursor, putative                      107   4e-22   Ricinus communis
ref|NP_001291327.1|  legumin B-like precursor                           107   5e-22   
gb|ACB55490.1|  Pis v 5.0101 allergen 11S globulin precusor             106   8e-22   Pistacia vera [pistachio]
ref|XP_006647245.1|  PREDICTED: glutelin type-A 1-like                  107   8e-22   
ref|XP_007201716.1|  hypothetical protein PRUPE_ppa003759mg             107   8e-22   
ref|XP_010481774.1|  PREDICTED: 12S seed storage protein CRA1-like      106   8e-22   
ref|XP_008447426.1|  PREDICTED: legumin A-like                          107   9e-22   
emb|CDY14908.1|  BnaA02g22500D                                          106   9e-22   
gb|AFQ32289.1|  12S seed storage protein                                106   1e-21   
ref|XP_010441951.1|  PREDICTED: 12S seed storage protein CRA1           106   1e-21   
gb|AFQ32292.1|  12S seed storage protein                                105   1e-21   
ref|NP_001289907.1|  uncharacterized protein LOC104725055 precursor     105   2e-21   
ref|XP_010262323.1|  PREDICTED: glutelin type-B 5-like                  105   2e-21   
gb|AAC61881.1|  11S storage globulin                                    105   2e-21   Coffea arabica [arabica coffee]
ref|XP_002863608.1|  hypothetical protein ARALYDRAFT_494580             105   2e-21   
emb|CDY22309.1|  BnaA06g36310D                                          105   2e-21   
emb|CAA57847.1|  globulin precursor                                     105   3e-21   Magnolia salicifolia
gb|AAC61983.1|  11S storage globulin                                    105   3e-21   Coffea arabica [arabica coffee]
emb|CAA76573.1|  11S storage protein                                    105   3e-21   Coffea arabica [arabica coffee]
gb|EEC73106.1|  hypothetical protein OsI_07091                          105   3e-21   Oryza sativa Indica Group [Indian rice]
gb|KDO60493.1|  hypothetical protein CISIN_1g046186mg                   104   3e-21   
gb|EYU46457.1|  hypothetical protein MIMGU_mgv1a005966mg                103   3e-21   
pdb|3EHK|A  Chain A, Crystal Structure Of Pru Du Amandin, An Alle...    105   5e-21   
gb|ADN39440.1|  prunin 1 precursor                                      105   5e-21   
ref|NP_001291336.1|  11S globulin seed storage protein 2 precursor      104   5e-21   
gb|EEE56924.1|  hypothetical protein OsJ_06602                          104   5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046769.1|  Os02g0453600                                       104   5e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAA86824.1|  legumin A precursor                                    104   6e-21   Vicia narbonensis
ref|XP_008235678.1|  PREDICTED: legumin type B-like                     104   6e-21   
emb|CAA55009.1|  prunin                                                 104   6e-21   Prunus dulcis [sweet almond]
ref|XP_010248272.1|  PREDICTED: legumin type B-like                     102   8e-21   
gb|AEO27677.1|  seed storage protein legumin A                          103   1e-20   
emb|CBI37121.3|  unnamed protein product                                103   1e-20   
ref|XP_010097607.1|  Legumin A                                          103   1e-20   
gb|EEC72834.1|  hypothetical protein OsI_06562                          103   1e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010935905.1|  PREDICTED: glutelin type-A 3-like isoform X2       103   1e-20   
ref|XP_006279075.1|  hypothetical protein CARUB_v10012738mg             103   1e-20   
gb|AEO27676.1|  seed storage protein legumin A                          103   1e-20   
emb|CDP79024.1|  edestin 1                                              103   1e-20   
emb|CDY35196.1|  BnaA01g08350D                                          103   1e-20   
emb|CDP79023.1|  edestin 1                                              103   1e-20   
gb|EYU46456.1|  hypothetical protein MIMGU_mgv1a005966mg                102   2e-20   
gb|AAA33072.1|  legumin precursor                                       103   2e-20   Gossypium hirsutum [American cotton]
sp|P09802.2|LEGA_GOSHI  RecName: Full=Legumin A; AltName: Full=Be...    103   2e-20   Gossypium hirsutum [American cotton]
ref|XP_004289943.1|  PREDICTED: legumin A-like                          103   2e-20   
ref|XP_006648611.1|  PREDICTED: glutelin type-A 1-like                  103   2e-20   
ref|XP_010935904.1|  PREDICTED: glutelin type-B 5-like isoform X1       102   2e-20   
prf||1306412B  storage protein C94                                      103   2e-20
gb|ABI32184.1|  allergenic protein                                      103   2e-20   Fagopyrum tataricum [Kangra buckwheat]
gb|AEO27675.1|  seed storage protein legumin A                          102   2e-20   
sp|P05190.1|LEGB4_VICFA  RecName: Full=Legumin type B; Contains: ...    102   2e-20   Vicia faba [broad bean]
gb|AEO27674.1|  seed storage protein legumin A                          102   2e-20   
gb|AAK07609.1|AF319771_1  cruciferin subunit                            102   2e-20   Brassica napus [oilseed rape]
gb|ABG73109.1|  Pis v 2.0101 allergen11S globulin precusor              102   2e-20   Pistacia vera [pistachio]
ref|XP_006647177.1|  PREDICTED: glutelin type-B 2-like                  102   3e-20   
ref|XP_009417018.1|  PREDICTED: glutelin type-A 1-like                  102   3e-20   
ref|XP_006480087.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like     102   3e-20   
gb|KHG13642.1|  Legumin A                                               102   3e-20   
ref|XP_006443837.1|  hypothetical protein CICLE_v10023766mg             102   3e-20   
emb|CAA53177.1|  ginnacin                                               102   3e-20   Ginkgo biloba [ginkgo]
gb|AFZ41189.1|  glutelin                                                102   4e-20   
ref|XP_006281468.1|  hypothetical protein CARUB_v10027551mg             101   4e-20   
gb|EAY85201.1|  hypothetical protein OsI_06564                          102   4e-20   Oryza sativa Indica Group [Indian rice]
emb|CDX89858.1|  BnaA10g02240D                                          101   5e-20   
emb|CAA90641.1|  legumin; 11S-globulin                                  101   5e-20   Ginkgo biloba [ginkgo]
emb|CDP79026.1|  edestin 1                                              102   5e-20   
ref|XP_004289944.1|  PREDICTED: legumin A-like                          101   6e-20   
emb|CAR78996.1|  legumin storage protein 5                              101   7e-20   Lotus japonicus
emb|CAA64762.1|  legumin-like protein                                   100   8e-20   Asarum europaeum
emb|CDY18193.1|  BnaC05g02160D                                          100   9e-20   
gb|EPS70989.1|  hypothetical protein M569_03772                         101   1e-19   
gb|KHN02503.1|  Glycinin G3                                             100   1e-19   
sp|P11828.1|GLYG3_SOYBN  RecName: Full=Glycinin G3; Contains: Rec...    100   1e-19   Glycine max [soybeans]
ref|XP_006418192.1|  hypothetical protein EUTSA_v10009863mg             100   1e-19   
pir||S11003  glycinin G3 precursor - soybean                            100   1e-19
gb|AGU36396.1|  11S globulin precursor                                98.6    1e-19   
gb|ABK80750.1|  11S globulin precursor isoform 2A                       100   1e-19   Ficus pumila var. awkeotsang [jelly fig]
gb|ABK80753.1|  11S globulin precursor isoform 2B                       100   1e-19   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_006647144.1|  PREDICTED: glutelin type-B 5-like isoform X1       100   1e-19   
gb|AFZ41190.1|  glutelin                                                100   1e-19   
gb|AGT59179.1|  glutelin                                                100   2e-19   
gb|EAZ22416.1|  hypothetical protein OsJ_06076                          100   2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006282820.1|  hypothetical protein CARUB_v10006612mg             100   2e-19   
ref|NP_001046435.1|  Os02g0249000                                       100   2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAF69015.1|AF261691_1  glutelin                                      100   2e-19   Elaeis guineensis
ref|XP_004294115.1|  PREDICTED: legumin B-like                          100   2e-19   
gb|AAR06951.1|  glutelin C precursor                                    100   2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010272888.1|  PREDICTED: legumin B-like                          100   2e-19   
ref|XP_010679299.1|  PREDICTED: 11S globulin seed storage protein...  99.8    2e-19   
sp|P19084.1|11S3_HELAN  RecName: Full=11S globulin seed storage p...  99.8    2e-19   Helianthus annuus
ref|NP_001046434.1|  Os02g0248800                                     99.8    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654150.1|  PREDICTED: glutelin type-A 3-like                99.4    3e-19   
ref|XP_009129556.1|  PREDICTED: cruciferin CRU1                       99.4    3e-19   
emb|CAA40980.1|  cruciferin cru4 subunit                              98.2    4e-19   Brassica napus [oilseed rape]
gb|AGU36395.1|  11S globulin precursor                                97.1    4e-19   
ref|XP_010231907.1|  PREDICTED: 12S seed storage globulin 1-like      99.0    4e-19   
gb|KEH23930.1|  legumin A2                                            99.4    4e-19   
ref|XP_009119353.1|  PREDICTED: cruciferin CRU4                       98.6    4e-19   
ref|XP_006647142.1|  PREDICTED: glutelin type-B 4-like                99.0    5e-19   
sp|P05692.1|LEGJ_PEA  RecName: Full=Legumin J; Contains: RecName:...  99.0    5e-19   Pisum sativum [garden pea]
gb|AAA50317.1|  glutelin                                              99.0    5e-19   Oryza sativa [red rice]
ref|XP_006418193.1|  hypothetical protein EUTSA_v10009410mg           98.6    5e-19   
gb|AAF05770.1|AF193433_1  glutelin                                    97.1    6e-19   Elaeis guineensis
gb|KFK42731.1|  hypothetical protein AALP_AA1G032400                  98.2    6e-19   
sp|P33522.1|CRU4_BRANA  RecName: Full=Cruciferin CRU4; AltName: F...  98.2    6e-19   Brassica napus [oilseed rape]
gb|AAF73008.1|AF262999_1  seed storage protein                        96.7    6e-19   Ricinus communis
emb|CAA67879.1|  legumin precursor                                    98.2    7e-19   Quercus robur [English oak]
ref|XP_006420240.1|  hypothetical protein CICLE_v10004854mg           98.2    7e-19   
ref|XP_006420239.1|  hypothetical protein CICLE_v10004854mg           98.2    7e-19   
ref|XP_009118685.1|  PREDICTED: 12S seed storage protein CRD          97.8    8e-19   
gb|AGU36406.1|  11S globulin precursor                                96.3    8e-19   
gb|AGU36403.1|  11S globulin precursor                                96.3    8e-19   
ref|XP_010238071.1|  PREDICTED: 12S seed storage globulin 1-like      98.2    8e-19   
ref|XP_010326169.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  98.2    8e-19   
ref|XP_008353191.1|  PREDICTED: LOW QUALITY PROTEIN: legumin type...  97.4    9e-19   
sp|P33523.2|CRU1_BRANA  RecName: Full=Cruciferin BnC1; AltName: F...  97.8    1e-18   Brassica napus [oilseed rape]
gb|AFQ32290.1|  12S seed storage protein                              96.3    1e-18   
dbj|BAO50872.1|  13S globulin                                         97.4    1e-18   
emb|CDY32518.1|  BnaA09g50780D                                        97.8    1e-18   
dbj|BAO50870.1|  13S globulin                                         97.4    1e-18   
ref|XP_002889480.1|  cupin family protein                             97.4    1e-18   
ref|NP_001046512.1|  Os02g0268100                                     97.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046513.1|  Os02g0268300                                     97.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KFK31664.1|  hypothetical protein AALP_AA6G142800                  97.4    2e-18   
ref|XP_006282361.1|  hypothetical protein CARUB_v10028658mg           97.1    2e-18   
ref|XP_002526484.1|  nutrient reservoir, putative                     95.5    2e-18   Ricinus communis
gb|AGT59175.1|  glutelin                                              96.7    2e-18   
ref|XP_003566659.1|  PREDICTED: 12S seed storage globulin 1-like      97.1    2e-18   
ref|XP_009101736.1|  PREDICTED: cruciferin BnC1                       97.1    2e-18   
gb|ADB84625.1|  glutelin                                              97.1    2e-18   
ref|XP_010457408.1|  PREDICTED: 12S seed storage protein CRD          96.3    3e-18   
gb|EAY78392.1|  hypothetical protein OsI_33479                        96.7    3e-18   Oryza sativa Indica Group [Indian rice]
gb|AGU36413.1|  11S globulin precursor                                94.7    3e-18   
gb|AAA33906.1|  glutelin                                              96.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA46747.1|  glutelin                                              96.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064542.1|  Os10g0400200                                     96.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AGU36397.1|  11S globulin precursor                                94.7    3e-18   
prf||1312296A  glutelin                                               96.7    3e-18
gb|AGU36408.1|  11S globulin precursor                                94.7    3e-18   
gb|AGU36407.1|  11S globulin precursor                                94.7    3e-18   
prf||1311273A  glutelin                                               96.7    3e-18
gb|ABL74545.1|  glutelin                                              96.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AGU36402.1|  11S globulin precursor                                94.7    3e-18   
ref|XP_010445085.1|  PREDICTED: 12S seed storage protein CRC-like     96.3    3e-18   
ref|NP_001044328.1|  Os01g0762500                                     96.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
sp|P33525.1|CRU3_BRANA  RecName: Full=Cruciferin CRU1; AltName: F...  96.7    3e-18   Brassica napus [oilseed rape]
dbj|BAC80213.1|  cruciferin                                           96.3    3e-18   Brassica napus [oilseed rape]
ref|XP_009109088.1|  PREDICTED: cruciferin PGCRURSE5-like             96.3    4e-18   
gb|AGT59174.1|  glutelin                                              95.9    4e-18   
pir||S26688  legumin K - garden pea                                   95.9    4e-18
emb|CAA29150.1|  glutelin                                             95.9    5e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAA29149.1|  glutelin                                             95.9    5e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AGU36400.1|  11S globulin precursor                                94.4    5e-18   
ref|XP_006412944.1|  hypothetical protein EUTSA_v10027035mg           95.9    5e-18   
pdb|3KGL|A  Chain A, Crystal Structure Of Procruciferin, 11s Glob...  95.5    5e-18   
ref|XP_007200723.1|  hypothetical protein PRUPE_ppa004418mg           95.9    6e-18   
emb|CDY14237.1|  BnaA08g13680D                                        95.9    6e-18   
gb|AAP15457.1|  13S globulin                                          95.5    6e-18   Fagopyrum esculentum
gb|ACT53401.1|  mutant glycinin subunit A1aB1b                        94.4    6e-18   Glycine max [soybeans]
prf||1603218A  glutelin                                               95.5    6e-18
gb|AAA32989.1|  cruciferin precursor                                  95.5    6e-18   
gb|KFK29566.1|  hypothetical protein AALP_AA7G151400                  95.5    6e-18   
dbj|BAA00462.1|  prepro-glutelin                                      95.5    7e-18   
dbj|BAO50861.1|  13S globulin                                         95.5    7e-18   
prf||1210248A  glutelin precursor                                     95.5    7e-18
ref|XP_009354982.1|  PREDICTED: legumin type B-like                   95.5    7e-18   
ref|XP_010265035.1|  PREDICTED: 11S globulin subunit beta-like        95.9    7e-18   
sp|P12615.1|SSG1_AVESA  RecName: Full=12S seed storage globulin 1...  95.5    7e-18   
dbj|BAC55937.1|  glycinin A1bB2-445                                   95.1    7e-18   
gb|EAY75915.1|  hypothetical protein OsI_03835                        95.5    8e-18   
ref|XP_009123931.1|  PREDICTED: cruciferin BnC2                       95.1    8e-18   
prf||1515394A  seed storage globulin                                  95.5    8e-18
ref|XP_006647120.1|  PREDICTED: glutelin type-B 2-like                95.1    9e-18   
gb|AGU36399.1|  11S globulin precursor                                93.6    9e-18   
ref|XP_010257107.1|  PREDICTED: glutelin type-B 5-like                94.7    1e-17   
emb|CDY10094.1|  BnaC08g43570D                                        94.7    1e-17   
ref|XP_009387667.1|  PREDICTED: glutelin type-A 1-like                94.7    1e-17   
ref|XP_010475020.1|  PREDICTED: 12S seed storage protein CRD-like     94.4    1e-17   
ref|XP_006351693.1|  PREDICTED: 11S globulin seed storage protein...  94.7    1e-17   
gb|AAF19607.1|  legumin-like protein                                  94.4    1e-17   
ref|XP_010482699.1|  PREDICTED: 12S seed storage protein CRD-like     94.4    1e-17   
gb|ABD14346.1|  cruciferin-like protein                               94.4    1e-17   
ref|NP_001289909.1|  uncharacterized protein LOC104754510 precursor   94.4    2e-17   
gb|ABK92180.1|  11S seed storage globulin precursor B1                92.0    2e-17   
ref|XP_004289945.1|  PREDICTED: 12S seed storage protein CRU1-like    94.7    2e-17   
ref|NP_171885.1|  12S seed storage protein CRD                        94.0    2e-17   
gb|ACT53400.1|  mutant glycinin subunit A1aB1b                        93.2    2e-17   
ref|XP_006306303.1|  hypothetical protein CARUB_v10012169mg           94.0    2e-17   
gb|ABB77214.1|  11S globulin-like protein                             91.7    2e-17   
ref|XP_010272923.1|  PREDICTED: legumin type B-like                   90.5    2e-17   
gb|AAA68981.1|  legumin-like storage protein                          94.4    2e-17   
ref|XP_010928048.1|  PREDICTED: glutelin type-A 3-like                93.6    2e-17   
gb|EEE56664.1|  hypothetical protein OsJ_06085                        94.0    2e-17   
gb|KEH23931.1|  legumin A2                                            94.4    2e-17   
sp|P33524.2|CRU2_BRANA  RecName: Full=Cruciferin BnC2; AltName: F...  94.0    2e-17   
ref|XP_010433207.1|  PREDICTED: 12S seed storage protein CRC          93.6    3e-17   
emb|CAA33838.1|  unnamed protein product                              94.0    3e-17   
ref|XP_006403138.1|  hypothetical protein EUTSA_v10003387mg           93.6    3e-17   
prf||1309256A  Glycinin A1aBx                                         93.6    3e-17
ref|NP_001046441.1|  Os02g0249800                                     93.6    3e-17   
gb|AGU36401.1|  11S globulin precursor                                92.0    3e-17   
ref|XP_010457405.1|  PREDICTED: 12S seed storage protein CRB isof...  93.2    3e-17   
dbj|BAO50862.1|  13S globulin                                         93.6    3e-17   
pdb|1UCX|A  Chain A, Crystal Structure Of Proglycinin C12g Mutant     93.2    3e-17   
pdb|1FXZ|A  Chain A, Crystal Structure Of Soybean Proglycinin A1a...  93.2    4e-17   
sp|P04776.2|GLYG1_SOYBN  RecName: Full=Glycinin G1; Contains: Rec...  93.2    4e-17   
dbj|BAO50865.1|  13S globulin                                         93.2    4e-17   
ref|XP_010928127.1|  PREDICTED: glutelin type-A 1-like                93.6    4e-17   
dbj|BAO50866.1|  13S globulin                                         93.2    4e-17   
dbj|BAO50867.1|  13S globulin                                         93.2    4e-17   
emb|CAA57848.1|  legumin precursor                                    92.8    4e-17   
ref|XP_006648504.1|  PREDICTED: glutelin type-B 2-like                92.8    5e-17   
gb|ADN39441.1|  prunin 2 precursor                                    92.8    5e-17   
ref|XP_011004062.1|  PREDICTED: 11S globulin seed storage protein...  91.3    6e-17   
emb|CAA55010.1|  pru2                                                 92.8    6e-17   
ref|XP_004162393.1|  PREDICTED: legumin J-like                        91.3    6e-17   
dbj|BAO50864.1|  13S globulin                                         92.8    6e-17   
ref|XP_009624040.1|  PREDICTED: 11S globulin seed storage protein...  92.8    6e-17   
dbj|BAO50868.1|  13S globulin                                         92.4    6e-17   
gb|EEC72839.1|  hypothetical protein OsI_06572                        92.4    6e-17   
sp|O23880.1|13S2_FAGES  RecName: Full=13S globulin seed storage p...  92.8    6e-17   
sp|P14812.1|SSG2_AVESA  RecName: Full=12S seed storage globulin 2...  92.4    7e-17   
ref|XP_006303676.1|  hypothetical protein CARUB_v10011751mg           92.4    7e-17   
gb|AGT59178.1|  glutelin                                              92.4    8e-17   
gb|AGT59177.1|  glutelin                                              92.4    8e-17   
gb|ACJ54337.1|  Gt3                                                   92.0    9e-17   
emb|CAA77568.1|  pine globulin-1                                      92.0    9e-17   
gb|AAX77384.1|  11S globulin precursor                                92.0    9e-17   
gb|KDO57580.1|  hypothetical protein CISIN_1g048197mg                 92.0    1e-16   
gb|AGT59176.1|  glutelin                                              91.7    1e-16   
emb|CAA38211.1|  glutelin                                             91.7    1e-16   
ref|NP_001050413.1|  Os03g0427300                                     91.7    1e-16   
ref|NP_001235827.1|  glycinin G1 precursor                            91.7    1e-16   
ref|XP_009624045.1|  PREDICTED: 11S globulin seed storage protein...  91.7    1e-16   
ref|XP_006403137.1|  hypothetical protein EUTSA_v10003429mg           91.7    1e-16   
gb|KHN10744.1|  Glycinin G1                                           91.7    1e-16   
ref|XP_006396330.1|  hypothetical protein EUTSA_v10029458mg           91.3    2e-16   
gb|EEE59300.1|  hypothetical protein OsJ_11349                        91.7    2e-16   
ref|XP_009766463.1|  PREDICTED: 11S globulin seed storage protein...  91.3    2e-16   
ref|XP_009761684.1|  PREDICTED: 11S globulin seed storage protein...  91.3    2e-16   
sp|P11090.1|CRUA_BRANA  RecName: Full=Cruciferin; AltName: Full=1...  90.9    2e-16   
gb|ADN39438.1|  11S globulin isoform 2                                91.3    2e-16   
gb|ADN39437.1|  11S globulin isoform 1                                91.3    2e-16   
gb|AAA32988.1|  cruciferin precursor                                  90.9    2e-16   
ref|XP_002539761.1|  hypothetical protein RCOM_2131030                86.7    3e-16   
dbj|BAM63382.1|  major allergenic storage protein                     90.9    3e-16   
ref|XP_004152048.1|  PREDICTED: 11S globulin seed storage protein...  90.1    3e-16   
ref|XP_002889479.1|  hypothetical protein ARALYDRAFT_470363           90.5    3e-16   
ref|XP_006644747.1|  PREDICTED: glutelin type-A 1-like                90.5    3e-16   
sp|Q9XFM4.1|13S3_FAGES  RecName: Full=13S globulin seed storage p...  90.5    3e-16   
gb|EAY85211.1|  hypothetical protein OsI_06573                        89.4    3e-16   
ref|XP_010263163.1|  PREDICTED: 11S globulin subunit beta-like        90.5    4e-16   
emb|CAA38212.1|  glutelin                                             90.5    4e-16   
ref|XP_002306851.2|  hypothetical protein POPTR_0005s24580g           90.1    4e-16   
ref|XP_006420241.1|  hypothetical protein CICLE_v10004871mg           90.1    4e-16   
ref|XP_004162394.1|  PREDICTED: 11S globulin seed storage protein...  90.1    4e-16   
gb|KGN57908.1|  hypothetical protein Csa_3G386810                     90.1    5e-16   
ref|NP_001236840.1|  glycinin A1bB2-784 precursor                     89.7    5e-16   
gb|AAA32778.1|  12S storage protein CRB                               89.7    5e-16   
ref|NP_171884.1|  cruciferin 2                                        89.7    6e-16   
ref|XP_004167380.1|  PREDICTED: legumin A-like                        86.3    6e-16   
ref|XP_008447662.1|  PREDICTED: 13S globulin seed storage protein...  89.4    7e-16   
ref|XP_010104750.1|  11S globulin subunit beta                        88.2    8e-16   
dbj|BAO50860.1|  13S globulin                                         89.4    9e-16   
ref|XP_010447969.1|  PREDICTED: 12S seed storage protein CRC-like     89.0    9e-16   
pdb|1UD1|A  Chain A, Crystal Structure Of Proglycinin Mutant C88s     89.0    9e-16   
gb|AEO27679.1|  seed storage protein legumin B                        88.6    1e-15   
ref|NP_001235810.1|  glycinin G2 precursor                            88.6    1e-15   
ref|XP_002869496.1|  cruciferin PGCRURSE5 precursor                   88.6    1e-15   
emb|CAA26575.1|  unnamed protein product                              88.6    1e-15   
ref|XP_004152050.1|  PREDICTED: legumin A-like                        88.6    1e-15   
ref|XP_008364259.1|  PREDICTED: legumin A-like                        89.0    1e-15   
gb|KHG07690.1|  Legumin B                                             88.6    2e-15   
gb|AEO27678.1|  seed storage protein legumin B                        88.2    2e-15   
gb|EAY85161.1|  hypothetical protein OsI_06516                        88.2    2e-15   
gb|AAO22139.1|  glutelin precursor                                    88.2    2e-15   
gb|AFZ41188.1|  glutelin                                              88.2    2e-15   
dbj|BAO50869.1|  13S globulin                                         87.8    2e-15   
ref|XP_008447427.1|  PREDICTED: 13S globulin seed storage protein...  88.2    2e-15   
ref|NP_001078459.1|  cruciferin 3                                     87.4    2e-15   
ref|NP_849464.1|  cruciferin 3                                        87.4    2e-15   
gb|ACN12800.1|  GluB-5 long variant                                   87.8    2e-15   
ref|NP_001046409.1|  Os02g0242600                                     87.8    3e-15   
dbj|BAD28254.1|  glutelin precursor                                   87.8    3e-15   
ref|XP_009783514.1|  PREDICTED: 11S globulin seed storage protein...  87.8    3e-15   
dbj|BAO50859.1|  13S globulin                                         87.8    3e-15   
gb|ABG47337.1|  glutelin precursor                                    87.4    3e-15   
gb|EEC75527.1|  hypothetical protein OsI_12139                        87.8    3e-15   
gb|AAA50316.1|  glutelin                                              87.4    3e-15   
emb|CAA64788.1|  legumin                                              87.4    3e-15   
gb|AIX48756.1|  legumin-like protein                                  87.4    4e-15   
gb|AAO22140.1|  glutelin precursor                                    87.4    4e-15   
gb|AAL91248.1|  AT4g28520/F20O9_210                                   87.4    4e-15   
sp|O23878.1|13S1_FAGES  RecName: Full=13S globulin seed storage p...  87.4    4e-15   
ref|XP_010262494.1|  PREDICTED: legumin B-like                        85.9    4e-15   
ref|NP_194581.1|  cruciferin 3                                        87.0    4e-15   
gb|AAA50314.2|  glutelin                                              86.7    4e-15   
ref|NP_001289908.1|  12S seed storage protein CRB precursor           86.7    5e-15   
ref|XP_009388146.1|  PREDICTED: glutelin type-A 1-like                86.7    6e-15   
gb|KHN10743.1|  Glycinin G2                                           86.7    6e-15   
gb|KGN57909.1|  hypothetical protein Csa_3G386820                     85.1    7e-15   
dbj|BAO50857.1|  13S globulin                                         86.3    8e-15   
prf||1404367A  glutelin                                               86.3    8e-15
ref|XP_004162395.1|  PREDICTED: 11S globulin seed storage protein...  85.9    1e-14   
emb|CBI37119.3|  unnamed protein product                              85.9    1e-14   
gb|AAX77383.1|  11S globulin precursor                                85.9    1e-14   
dbj|BAO50858.1|  13S globulin                                         85.9    1e-14   
gb|EEE56662.1|  hypothetical protein OsJ_06082                        85.5    1e-14   
gb|ABL74554.1|  glutelin                                              85.5    2e-14   
ref|XP_010279433.1|  PREDICTED: legumin A-like                        85.5    2e-14   
gb|AAX85990.1|  glutelin precursor                                    85.5    2e-14   
gb|ABL74556.1|  glutelin                                              85.1    2e-14   
gb|ABL74555.1|  glutelin                                              85.1    2e-14   
ref|NP_001046439.2|  Os02g0249600                                     85.1    2e-14   
dbj|BAO50856.1|  13S globulin                                         85.1    2e-14   
ref|XP_010940966.1|  PREDICTED: glutelin type-A 3-like                83.6    2e-14   
pir||S30142  pseudotsugin precursor - Douglas fir                     85.1    2e-14
ref|XP_004247523.1|  PREDICTED: 11S globulin seed storage protein...  84.7    2e-14   
ref|XP_010253028.1|  PREDICTED: legumin B-like                        84.0    2e-14   
gb|AFZ41187.1|  glutelin                                              84.7    3e-14   
gb|AIA57960.1|  seed storage protein 1                                83.2    3e-14   
ref|XP_008235677.1|  PREDICTED: legumin J-like                        84.7    3e-14   
ref|XP_002278201.1|  PREDICTED: cruciferin CRU1-like                  84.3    3e-14   
ref|XP_004152047.1|  PREDICTED: 11S globulin seed storage protein...  84.3    3e-14   
emb|CAA52764.1|  11S globulin                                         84.3    3e-14   
emb|CAA64761.1|  legumin-like protein                                 84.0    4e-14   
sp|P09800.1|LEGB_GOSHI  RecName: Full=Legumin B; AltName: Full=Be...  84.0    4e-14   
gb|AEO27680.1|  seed storage protein legumin B                        84.0    5e-14   
sp|Q647H2.1|AHY3_ARAHY  RecName: Full=Arachin Ahy-3; Contains: Re...  83.6    5e-14   
emb|CAA38110.1|  glutelin                                             83.6    5e-14   
ref|XP_009354949.1|  PREDICTED: cruciferin CRU1-like                  84.0    6e-14   
ref|XP_006351695.1|  PREDICTED: 11S globulin seed storage protein...  83.6    6e-14   
ref|XP_006857275.1|  hypothetical protein AMTR_s00067p00022330        83.6    6e-14   
gb|EPS68852.1|  hypothetical protein M569_05912                       83.6    6e-14   
ref|XP_006647170.1|  PREDICTED: LOW QUALITY PROTEIN: glutelin typ...  83.6    7e-14   
ref|XP_007050296.1|  Legumin A, putative                              83.2    9e-14   
gb|ABI17154.1|  iso-Ara h3                                            82.4    1e-13   
gb|AAT39430.1|  glycinin                                              82.4    1e-13   
gb|ADQ53859.1|  Ara h 3 allergen                                      82.0    2e-13   
ref|XP_004289946.1|  PREDICTED: legumin A-like                        82.0    2e-13   
ref|XP_002278346.1|  PREDICTED: legumin A-like                        81.6    2e-13   
emb|CDO99985.1|  unnamed protein product                              79.3    3e-13   
gb|ABG47461.1|  glutelin precursor                                    81.3    3e-13   
emb|CDP03744.1|  unnamed protein product                              80.9    3e-13   
ref|XP_010652369.1|  PREDICTED: legumin A-like                        81.3    3e-13   
gb|EEE56928.1|  hypothetical protein OsJ_06612                        80.9    4e-13   
emb|CAA64792.1|  legumin                                              81.3    4e-13   
gb|EAY85208.1|  hypothetical protein OsI_06570                        80.5    4e-13   
emb|CAA81285.1|  legumin; legumin-related high molecular weight p...  76.3    5e-13   
ref|XP_004141669.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  80.9    5e-13   
gb|KDP26533.1|  hypothetical protein JCGZ_17691                       80.1    7e-13   
ref|XP_010046000.1|  PREDICTED: 11S globulin seed storage protein...  80.1    7e-13   
emb|CAA64789.1|  legumin                                              80.1    8e-13   
gb|AEO27681.1|  seed storage protein legumin B                        80.1    9e-13   
emb|CAA64793.1|  legumin                                              79.7    1e-12   
ref|XP_010026826.1|  PREDICTED: 11S globulin subunit beta-like        79.7    1e-12   
gb|ACN11532.1|  mutant glycinin A3B4                                  79.3    1e-12   
ref|XP_010272922.1|  PREDICTED: 13S globulin basic chain-like         77.0    2e-12   
emb|CAA54153.1|  12s globulin                                         78.6    2e-12   
gb|ABK92181.1|  11S seed storage globulin precursor B2                76.3    3e-12   
pdb|3KSC|A  Chain A, Crystal Structure Of Pea Prolegumin, An 11s ...  77.8    4e-12   
emb|CAA10722.1|  legA class precursor                                 77.8    4e-12   
emb|CAA81262.1|  legumin; legumin-related high molecular weight p...  77.8    4e-12   
sp|P15838.1|LEGA2_PEA  RecName: Full=Legumin A2; Contains: RecNam...  77.8    5e-12   
gb|ACU17712.1|  unknown                                               77.0    6e-12   
emb|CAA64787.1|  legumin                                              77.0    7e-12   
emb|CAA26720.1|  legumin                                              77.0    7e-12   
sp|P02857.1|LEGA_PEA  RecName: Full=Legumin A; Contains: RecName:...  77.0    7e-12   
emb|CAA64763.1|  legumin-like protein                                 77.0    8e-12   
gb|AGE34644.1|  11S globulin isoform 3                                77.0    8e-12   
sp|P04347.1|GLYG5_SOYBN  RecName: Full=Glycinin; Contains: RecNam...  76.6    1e-11   
ref|XP_008372197.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like   76.3    1e-11   
gb|EEC73108.1|  hypothetical protein OsI_07099                        75.9    1e-11   
dbj|BAA19059.1|  glycinin                                             76.3    1e-11   
gb|AAB24084.1|  legumin propolypeptide alpha chain                    74.3    2e-11   
pir||JC2097  legumin type B alpha chain precursor (clone LeB4, B4...  74.3    2e-11
ref|NP_849465.1|  cruciferin 3                                        75.9    2e-11   
gb|KEH23928.1|  glycinin G4                                           75.9    2e-11   
emb|CAI83773.2|  legumin-like protein                                 75.9    2e-11   
emb|CAA47809.1|  legumin (minor small)                                75.9    2e-11   



>ref|XP_009803568.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=475

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 138/243 (57%), Gaps = 29/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK--------GSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G YGI+  GC ET+Q S++        GS   D++Q+I  + +GDII  PA A HW Y
Sbjct  97    GQGFYGIMQSGCPETFQSSQQLQQGERGAGSRFQDRHQRIGQFRQGDIIAFPAGAAHWVY  156

Query  792   NQNREPTILVVLQ----RANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LVVL+     AN +      FF+AG P    Q Q++     + L  E+    
Sbjct  157   NEGNEELVLVVLEDSSNNANQLGRTSRRFFIAGNPQQGQQQQQQGQYGARSLRREQF-QS  215

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgr  1109
             GN+  GFDVQ++ +A   D+ETA+++ G   + RGHIV +QQ      P   +++ +   
Sbjct  216   GNVFNGFDVQVLAEAFGVDQETAKRLQGQEDQ-RGHIVNIQQGLRVVRPPFSQEQEEREE  274

Query  1110  qgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             +          N +EET+C+A   QNIDN  RADIY+  AGR TT+NS TLP LS++RLS
Sbjct  275   RQEQGQYGPRMNGIEETICSAKVRQNIDNPSRADIYNPHAGRFTTVNSLTLPILSFLRLS  334

Query  1275  AAR  1283
             AAR
Sbjct  335   AAR  337


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL+++    PT  I AE G TE WDPN++QFQC G    RH+IQ  G+ LPSY + PL
Sbjct  31   ECQLNRLSPQEPTVRIQAEAGVTELWDPNNQQFQCAGVSLIRHVIQSRGMLLPSYVNTPL  90

Query  355  VAYVLQG  375
            +AYV +G
Sbjct  91   LAYVERG  97



>ref|XP_009624043.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=475

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 137/243 (56%), Gaps = 29/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK--------GSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G YGI+  GC ET+Q S++        GS   D++Q+I  + +GDII  PA A HW Y
Sbjct  97    GRGFYGIMQSGCPETFQSSQQMQQGERGAGSRFQDRHQRIGQFRQGDIIAFPAGAAHWVY  156

Query  792   NQNREPTILVVLQ----RANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LVVL+     AN +      FF+AG P    Q Q++     + L  E+    
Sbjct  157   NEGNEELVLVVLEDSSNNANQLGRTSRRFFIAGNPQQGQQQQQQGQYGGRSLRREQF-QS  215

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgr  1109
             GN+  GFDVQ++ +A   D+ETA ++ G   + RGHIV +QQ      P   +++ +   
Sbjct  216   GNVFNGFDVQVLAEAFGVDQETARRLQGQEDQ-RGHIVNIQQGLRVVRPPFSQEQEEREE  274

Query  1110  qgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             +          N +EET+C+A   QNIDN  RADIY+  AGR TT+NS TLP LS++RLS
Sbjct  275   RQEQGQYGPRMNGIEETICSAKVRQNIDNPSRADIYNPHAGRFTTVNSLTLPILSFLRLS  334

Query  1275  AAR  1283
             AAR
Sbjct  335   AAR  337


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL+++    PT  I AE G TE WDPN++QFQC G    RH+IQ  G+ LPSY + PL
Sbjct  31   ECQLNRLSPQEPTVRIQAEAGVTELWDPNNQQFQCAGVSLIRHVIQSRGMLLPSYVNTPL  90

Query  355  VAYVLQG  375
            +AYV +G
Sbjct  91   LAYVERG  97



>ref|XP_009624041.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=473

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 135/243 (56%), Gaps = 31/243 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK--------GSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G YGI+  GC ET+Q S++        GS   D++Q+I  + +GDII  PA A HW Y
Sbjct  97    GRGFYGIMQSGCPETFQSSQQMQQGERGAGSRFQDRHQRIGQFRQGDIIAFPAGAAHWAY  156

Query  792   NQNREPTILVVLQ----RANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LV L+     AN +      FF+AG P      Q++     + L  ER    
Sbjct  157   NEGNEELVLVCLEDSSNNANQLGQFSRRFFIAGNPQQG--QQQQGQYGGKSLRRERF-ES  213

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgr  1109
             GN+  GFDV+++ +A   DRE A ++ G + + RGHIV +QQ      P   +++ +   
Sbjct  214   GNVFNGFDVEVLAEAFGVDREIARRLQGQDDQ-RGHIVNIQQGLRVVRPPFSQEQEEREE  272

Query  1110  qgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             +          N +EET+C+A   QNIDN  RADIY+  AGR TT+NS TLP LS++RLS
Sbjct  273   RQEQGQYGPRMNGIEETICSAKVRQNIDNPSRADIYNPHAGRFTTVNSLTLPILSFLRLS  332

Query  1275  AAR  1283
             AAR
Sbjct  333   AAR  335


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL+++    PT  I AE G TE WD N++QFQC G    RH+IQ  G+ LPSY + PL
Sbjct  31   ECQLNRLSPQEPTTRIQAEAGVTELWDQNNQQFQCAGVSLIRHVIQSRGMLLPSYVNTPL  90

Query  355  VAYVLQG  375
            +AYV +G
Sbjct  91   LAYVERG  97



>ref|XP_009761685.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=473

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 135/243 (56%), Gaps = 31/243 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK--------GSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G YGI+  GC ET+Q S++        GS   D++Q+I  + +GDII  PA A HW Y
Sbjct  97    GRGFYGIMQSGCPETFQSSQQMQQGERGAGSRFQDRHQRIGQFRQGDIIAFPAGAAHWAY  156

Query  792   NQNREPTILVVLQ----RANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LV L+     AN +      FF+AG P      Q++     + L  ER    
Sbjct  157   NEGNEELVLVCLEDSSNNANQLGQFSRRFFIAGNPQQG--QQQQGQYGGKSLRRERF-ES  213

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgr  1109
             GN+  GFDV+++ +A   DRE A ++ G + + RGHIV +QQ      P   +++ +   
Sbjct  214   GNVFNGFDVEVLAEAFGVDREIARRLQGQDDQ-RGHIVNIQQGLRVVRPPFSQEQEEREE  272

Query  1110  qgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             +          N +EET+C+A   QNIDN  RADIY+  AGR TT+NS TLP LS++RLS
Sbjct  273   RQEQGQYGPRMNGIEETICSAKVRQNIDNPSRADIYNPNAGRFTTVNSLTLPILSFLRLS  332

Query  1275  AAR  1283
             AAR
Sbjct  333   AAR  335


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL+++    PT  I AE G TE WD N++QFQC G    RH+IQ  G+ LPSY + PL
Sbjct  31   ECQLNRLSPQEPTTRIQAEAGVTELWDQNNQQFQCAGVSLIRHVIQSRGMLLPSYVNTPL  90

Query  355  VAYVLQG  375
            +AYV +G
Sbjct  91   LAYVERG  97



>ref|XP_011083024.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=460

 Score =   150 bits (379),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 131/241 (54%), Gaps = 29/241 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-------ILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G YG+++ GC ET++ S++  E         D++QKI  + +GDI+  PA A HW YN
Sbjct  96    GRGMYGVMISGCPETFESSQQQFEEGRGAQRFRDRHQKIGQFREGDILAFPAGAAHWAYN  155

Query  795   QNREPTILVVLQR---------ANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD-  944
                +  ++VVLQ           NP SFFLAG P       +EQ     +L  +R  +  
Sbjct  156   NGDQELVIVVLQDNANNANQLDPNPRSFFLAGNPAGR---GQEQQEYAPQLGRKRGQHQF  212

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--------LPSrpekrrq  1100
             GN+  GFDVQI+ +    D +TA  + G N   RGHI+ V +        L      R++
Sbjct  213   GNVFRGFDVQILSEVFGVDEQTARSLQGENDE-RGHIITVARGLQVISPPLQREEYGRQE  271

Query  1101  pgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAA  1280
                  G   N LEET+C+A   +NID   RADIY+ RAGR +T+NS TLP LS+++LSAA
Sbjct  272   EEPYYGRRDNGLEETICSAKLRENIDKPSRADIYNPRAGRFSTINSLTLPILSFLQLSAA  331

Query  1281  R  1283
             R
Sbjct  332   R  332


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  151  HGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFL  330
             G   Q  +C++S+I+A  PT  I AEGG +EFWD N ++FQC G    RH +Q   L L
Sbjct  22   RGSTWQQGQCRISRINAQEPTRRIQAEGGVSEFWDHNSDEFQCAGVSIHRHRLQARALML  81

Query  331  PSYTSAPLVAYVLQG  375
            P+Y +AP++AYV QG
Sbjct  82   PAYHNAPILAYVQQG  96



>ref|XP_009763034.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=483

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 136/240 (57%), Gaps = 27/240 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE------KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G YGI+  GC ET+Q S+      +G    D++QKI  + +GDI+  PA A HW YN+
Sbjct  98    GRGFYGIMNSGCPETFQSSQQTQQRIRGRTFQDRHQKIEQFRQGDIMAFPAGAAHWLYNE  157

Query  798   NREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
               E  +LVVL+ A+  +         FF+AG P    Q Q  Q       M       GN
Sbjct  158   GNEEVVLVVLEDASNNANQLDQTSRRFFIAGNPQQGQQQQGRQYGGST--MRREQFRSGN  215

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqg  1115
             +  GFD++I+ +A   DRE A ++ G +   RGHIV VQ+      P   +++ +   QG
Sbjct  216   VFNGFDIEILSEAFGVDREMARRLQGQDDM-RGHIVSVQEGLRVIRPPFSQEQEEQQEQG  274

Query  1116  ggS----SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                    +N +EET+CTA   +NIDN  RADIY+ RAGRL+T+NSFTLP LS++RLSAAR
Sbjct  275   QYGRGPMTNGIEETICTAKVRENIDNPARADIYNPRAGRLSTVNSFTLPILSFLRLSAAR  334


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            +++++   P+  + AE G TEF+D N++QFQC G   FRH+IQ  GL LPSYT++PL+AY
Sbjct  35   INRLNPQEPSFRMQAEAGVTEFFDTNNQQFQCAGVSLFRHVIQSRGLLLPSYTNSPLLAY  94

Query  364  VLQG  375
            V+QG
Sbjct  95   VVQG  98



>gb|ABB60055.1| 11S globulin precursor isoform 4 [Sesamum indicum]
Length=469

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 130/241 (54%), Gaps = 29/241 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-------ILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G YG+++ GC ET++ S++  E         D++QKI  + +GDI+  PA A HW YN
Sbjct  96    GRGMYGVMISGCPETFESSQQQFEEGRGAQRFRDRHQKIGQFREGDILAFPAGAAHWAYN  155

Query  795   QNREPTILVVLQR---------ANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD-  944
                +  ++VVLQ           NP SFFLAG P       +EQ     +L  +R  +  
Sbjct  156   NGDQELVIVVLQDNANNANQLDPNPRSFFLAGNPAGR---GQEQQEYAPQLGRKRGQHQF  212

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--------LPSrpekrrq  1100
             GN+  GFDVQI+ +    D + A  + G N   RGHI+ V +        L      R++
Sbjct  213   GNVFRGFDVQILSEVFGVDEQAARSLQGENDE-RGHIITVARGLQVISPPLQREEYGRQE  271

Query  1101  pgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAA  1280
                  G   N LEET+C+A   +NID   RADIY+ RAGR +T+NS TLP LS+++LSAA
Sbjct  272   EEPYYGRRDNGLEETICSAKLRENIDKPSRADIYNPRAGRFSTINSLTLPILSFLQLSAA  331

Query  1281  R  1283
             R
Sbjct  332   R  332


 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  151  HGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFL  330
             G   Q  +C++S+I+A  PT  I AEGG +EFWD N ++FQC G    RH +Q   L L
Sbjct  22   RGSTWQQGQCRISRINAQEPTRRIQAEGGVSEFWDHNSDEFQCAGVSIHRHRLQARALML  81

Query  331  PSYTSAPLVAYVLQG  375
            P+Y +AP++AYV QG
Sbjct  82   PAYHNAPILAYVQQG  96



>gb|ABB77213.1| 11S globulin-like protein [Actinidia chinensis]
Length=462

 Score =   147 bits (372),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 129/236 (55%), Gaps = 29/236 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-------ILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+++PGC ETYQ S++  E         D++QKIR +++GD+I +PA   HW YN
Sbjct  103   GRGITGVMIPGCPETYQSSQQSREGDVSHRQFRDQHQKIRRFQQGDVIALPAGVAHWCYN  162

Query  795   QNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
                   + V ++           NP  FFLAG P    +    +  QQQ        + G
Sbjct  163   DGDSDLVTVSVEDTGNRQNQLDNNPRRFFLAGNPQQQQKEMYAKRPQQQ--------HSG  214

Query  948   NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPSrpekrrqpgrqg  1115
             N+  GFD +++ +    D E A ++ G +   RGHI+ V++    +     +  Q  ++ 
Sbjct  215   NVFRGFDTEVLAETFGVDMEMARRLQGKDDY-RGHIIQVERELKIVRPPRTREEQEQQER  273

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             G   N +EET+CTA   +NIDN  RADI++ RAGRLT++NSF LP L+Y+RLSA +
Sbjct  274   GERDNGMEETICTARLVENIDNPSRADIFNPRAGRLTSVNSFNLPILNYLRLSAEK  329


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  139  RQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPN  318
            RQ    Q+ Q  +CQ+ +++A  P   I AE G TEFWD   +QFQC G  A R++IQP 
Sbjct  25   RQPSKYQQQQKGECQIQRLNAQEPQQRIQAEAGVTEFWDWTDDQFQCAGVAACRNMIQPR  84

Query  319  GLFLPSYTSAPLVAYVLQG  375
            GL LPSYT+AP + Y+L+G
Sbjct  85   GLLLPSYTNAPTLIYILKG  103



>ref|XP_009628307.1| PREDICTED: glutelin type-B 1-like [Nicotiana tomentosiformis]
Length=437

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/240 (41%), Positives = 135/240 (56%), Gaps = 27/240 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE------KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G YGI+  GC ET+Q S+      +G    D++QKI  + +GDI+  PA A HW YN+
Sbjct  52    GRGFYGIMNSGCPETFQSSQQTQQRIRGRRFQDRHQKIEQFRQGDIMAFPAGAAHWLYNE  111

Query  798   NREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
               E  +LVVL+ A+  +         FF+AG P    Q Q  Q       M       GN
Sbjct  112   GNEEVVLVVLEDASNNANQLDQTSRRFFIAGNPQQGQQQQGSQYGGST--MRREQFRSGN  169

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL-----PSrpekrrqpgrqg  1115
             +  GFD++I+ +A    RE A ++ G +   RGHIV VQ+      P   +++ +   QG
Sbjct  170   VFNGFDIEILSEAFGVGREMARRLQGQDDM-RGHIVSVQERLRVIRPPFSQEQEEQQEQG  228

Query  1116  ggS----SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                    +N +EET+CTA   +NIDN  RADIY+ RAGRL+T+NSFTLP LS++RLSAAR
Sbjct  229   QYGRGPMTNGIEETICTAKVRENIDNPSRADIYNPRAGRLSTVNSFTLPILSFLRLSAAR  288


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  220  IPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            + AE G TEF+D N++QFQC G   FRH+IQ  GL LPSYT++PL+AYV+QG
Sbjct  1    MQAEAGVTEFFDTNNQQFQCAGVSLFRHVIQSRGLLLPSYTNSPLLAYVVQG  52



>gb|EYU46455.1| hypothetical protein MIMGU_mgv1a005708mg [Erythranthe guttata]
Length=473

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 132/242 (55%), Gaps = 29/242 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G +G+++ GC ETY+ S         ++     D++QKI    +GDI+ IPA A HW 
Sbjct  98    GRGIFGLMISGCPETYESSQQSREQSQEDRSRSFRDRHQKIGESRQGDIVAIPAGAAHWA  157

Query  789   YNQNREPTILVVLQR---------ANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN  +E  +L+VL            NP SF+LAG PG   + Q  +    +    E+   
Sbjct  158   YNDGQEELVLLVLHDDSNNANQLDQNPRSFYLAGNPGRGQEQQPYREHGSRH--GEQQQQ  215

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--------LPSrpekrr  1097
              GNI  GFDV+ + +    D ETA K+ G N   RGH+++VQ+        L      RR
Sbjct  216   FGNIFRGFDVETLAEVFGVDEETARKLQGHNDE-RGHLILVQRGLQVIRPPLRGEEYGRR  274

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             +     GG  N +EET+C+A   +N+D   RADIY+ RAGR +T+NS++LP L +++LSA
Sbjct  275   EEEGYYGGRDNGIEETICSAKIRENLDKASRADIYNPRAGRFSTVNSYSLPILKFLQLSA  334

Query  1278  AR  1283
             AR
Sbjct  335   AR  336


 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +CQ+  I+A  P+ +I AE G T+FWD  +++FQC G    RH IQ  GL LP Y +
Sbjct  29   QKGECQIGNINAQEPSYSIRAEAGETQFWDFKNDEFQCAGVSILRHRIQQRGLLLPVYHN  88

Query  346  APLVAYVLQG  375
            +P++ YVL+G
Sbjct  89   SPVLVYVLKG  98



>ref|XP_011080043.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=464

 Score =   144 bits (364),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 133/241 (55%), Gaps = 34/241 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEKGSE------ILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G YG+++ GC ET+   QQ+EK S+        D++QKI  + +GDI+ IPA A HW 
Sbjct  96    GRGIYGLMISGCPETFESSQQTEKQSKEERRQRFRDRHQKIEEFREGDIVAIPAGAAHWA  155

Query  789   YNQNREPTILVVLQR---------ANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN   +  ++VVL            NP SF LAG P    + Q+   R Q+EL       
Sbjct  156   YNDGDQELVVVVLHDNTNNANQLDQNPRSFLLAGNPERGQEQQQGSRRGQREL-------  208

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LP--Srpekrrq  1100
              GN+  GFDV ++ +    D ETA ++ G +   RGHIVIV+       P   R E  R+
Sbjct  209   -GNVFRGFDVHMLTEVFGVDEETARRLQGEHDT-RGHIVIVEHGLHVIRPPFRRREYGRE  266

Query  1101  pgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAA  1280
                   G +N LEET+C A   +N+D   RAD+Y+ RAGR +T+NS TLP L +++LSAA
Sbjct  267   EEEGYYGGNNGLEETVCNAKIRENLDKPSRADVYNPRAGRFSTVNSLTLPILGFLQLSAA  326

Query  1281  R  1283
             R
Sbjct  327   R  327


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            +  G   Q  +CQ+  I+A  P+ ++ AEGG TEFWD  +++FQC G    RH +QP  L
Sbjct  20   AVRGGTWQQGECQIRSINAREPSYSLQAEGGVTEFWDFKNDEFQCAGVSIRRHRLQPRAL  79

Query  325  FLPSYTSAPLVAYVLQG  375
             LP Y +AP++ YV+QG
Sbjct  80   MLPLYHNAPILVYVVQG  96



>gb|ABI94736.1| 11S seed storage globulin B [Chenopodium quinoa]
Length=479

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 125/245 (51%), Gaps = 33/245 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------------QSEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G+G  G+++PGC ET++            +  +G    D++QKIR+  +G I  +PA   
Sbjct  102   GNGISGLMIPGCPETFESMSQESWREGMERGMRGGRFQDQHQKIRHLRQGHIFAMPAGVA  161

Query  780   HWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
             HW YN   EP + V+L      AN      P  F+LAGKP   H     +G +       
Sbjct  162   HWAYNSGNEPLVAVILIDTSNHANQLDKDYPKRFYLAGKPQQEHSRHHHRGGES---QRG  218

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-------LPSrpe  1088
               G DGN+ +G D + V  +     + AEK+       RG+IV+VQ+         SR  
Sbjct  219   EHGSDGNVFSGLDTKSVAQSFGVSEDIAEKLQAKQDE-RGNIVLVQEGLHVIKPPSSRSY  277

Query  1089  krrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVR  1268
                +  R     SN LEET+C+A  ++NID+  +AD+Y   AGRLTTLNSF LP LS +R
Sbjct  278   DDEREQRHRSPRSNGLEETICSARLSENIDDPSKADVYSPEAGRLTTLNSFNLPILSNLR  337

Query  1269  LSAAR  1283
             LSA +
Sbjct  338   LSAEK  342


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC G+ +    +E Q  +CQ+ ++ A+ PT  I AEGG TE WD   +QFQC G    
Sbjct  20   LNGCMGQGRM---REMQGNECQIDRLTALEPTHRIQAEGGLTEVWDTQDQQFQCSGVSVI  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            R  I+PNGL LPS+TS P + Y+ QG 
Sbjct  77   RRTIEPNGLLLPSFTSGPELIYIEQGN  103



>gb|AAS67037.1| 11S seed storage globulin [Chenopodium quinoa]
Length=479

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 125/245 (51%), Gaps = 33/245 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------------QSEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G+G  G+++PGC ET++            +  +G    D++QKIR+  +G I  +PA   
Sbjct  102   GNGISGLMIPGCPETFESMSQESWREGMERGMRGGRFQDQHQKIRHLRQGHIFAMPAGVA  161

Query  780   HWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
             HW YN   EP + V+L      AN      P  F+LAGKP   H     +G +       
Sbjct  162   HWAYNSGNEPLVAVILIDTSNHANQLDKDYPKRFYLAGKPQQEHSRHHHRGGES---QRG  218

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-------LPSrpe  1088
               G DGN+ +G D + V  +     + AEK+       RG+IV+VQ+         SR  
Sbjct  219   EHGSDGNVFSGLDTKSVVQSFGVSEDIAEKLQAKQDE-RGNIVLVQEGLHVIKPPSSRSY  277

Query  1089  krrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVR  1268
                +  R     SN LEET+C+A  ++NID+  +AD+Y   AGRLTTLNSF LP LS +R
Sbjct  278   DDEREQRHRSPRSNGLEETICSARLSENIDDPSKADVYSPEAGRLTTLNSFNLPILSNLR  337

Query  1269  LSAAR  1283
             LSA +
Sbjct  338   LSAEK  342


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC G+ +    +E Q  +CQ+ ++ A+ PT  I AEGG TE WD   +QFQC G    
Sbjct  20   LNGCMGQGRM---REMQGNECQIDRLTALEPTYRIQAEGGLTEVWDTQDQQFQCSGVSVI  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            R  I+PNGL LPS+TS P + Y+ QG 
Sbjct  77   RRTIEPNGLLLPSFTSGPELIYIEQGN  103



>gb|AAO38859.1| 11S globulin [Bertholletia excelsa]
Length=465

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 132/249 (53%), Gaps = 43/249 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ----------QSEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             + G G  G+++PGC ET+Q          Q E+     D++QK+ + +KGDII IPA   
Sbjct  94    TQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVA  153

Query  780   HWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              W YN   E  + V++Q           NP  FFLAG    S + +            ER
Sbjct  154   LWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQR-----------GER  202

Query  933   LGYDG-------NILAGFDVQIVKDALN--TDRETAEKIIGGNARGRGHIVIVQQ---LP  1076
              G  G       N+  GF+++ + D L    D ETA K+ G + + RGHIV V+Q   + 
Sbjct  203   YGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQ-RGHIVRVEQGLKVI  261

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
               P  R +  +Q GG  N LEET+C+ATF QNIDN   AD Y+ RAGRLTT+NS  +P L
Sbjct  262   RPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPIL  321

Query  1257  SYVRLSAAR  1283
             ++++LSA +
Sbjct  322   TFLQLSAMK  330


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ ++ A  P   + AE G +E WD   +QF+C G  A R+ I+P GL LP YT+AP 
Sbjct  30   ECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPK  89

Query  355  VAYVLQG  375
            + YV QG
Sbjct  90   LYYVTQG  96



>ref|XP_006351673.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=474

 Score =   136 bits (343),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 131/243 (54%), Gaps = 30/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ--------QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G +GI+  GC ET+Q        +   GS   D++QKI  +++GDII  PA A HW Y
Sbjct  97    GRGFFGIMNSGCPETFQSSQQFQQGERGAGSRFQDRHQKIGQFKQGDIIAFPAGAAHWAY  156

Query  792   NQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LV  + +         N   FF+AG P    + Q+ Q    +    E+    
Sbjct  157   NEGNEELVLVCFEDSGNSANQLDQNSRRFFIAGNP-QQGEQQQGQQGGARSFQKEQF-QS  214

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----------LPSrpekr  1094
             GN+  GF+++++ +A    +ETA K+ G   + RGHIV + Q                + 
Sbjct  215   GNVFRGFELELLAEAFGVSKETARKLQGEEDQ-RGHIVNIDQGLRVVRPPFSQEQEEREE  273

Query  1095  rqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             RQ   Q G  +N +EET+C+A   QNIDN  RAD+Y+ +AGR TT+NS TLP LS++RLS
Sbjct  274   RQEQGQYGPRANGIEETICSAKLRQNIDNPSRADVYNPQAGRFTTVNSLTLPILSFLRLS  333

Query  1275  AAR  1283
             AAR
Sbjct  334   AAR  336


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            L++++   PT  I AE G TE WD N++QFQC G    RH+IQ  G+ LPSY + PL+AY
Sbjct  34   LNRLNPQEPTVRIQAEAGVTELWDKNNQQFQCAGVSLVRHVIQSRGMLLPSYLNTPLLAY  93

Query  364  VLQG  375
            V QG
Sbjct  94   VEQG  97



>gb|ABI94735.1| 11S seed storage globulin A [Chenopodium quinoa]
Length=480

 Score =   135 bits (341),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 128/246 (52%), Gaps = 34/246 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------------QSEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G+G  G+++PGC ET++            +  +G    D++QKIR+  +G I  +PA   
Sbjct  102   GNGISGLMIPGCPETFESMSQELWREGMERGMRGGRFQDQHQKIRHLRQGHIFAMPAGVA  161

Query  780   HWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
             HW YN   EP + V+L      AN      P  F+LAGKP   H   + +G + Q    E
Sbjct  162   HWAYNTGNEPLVAVILIDTSNHANQLDKDYPKRFYLAGKPQQEHSRHQHRGGESQR--GE  219

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ------LPSrpek  1091
             R G  GN+ +G   + +  +     + AEK+       RG+IV+VQ+       PS    
Sbjct  220   R-GSGGNVFSGLGTKTIAQSFGVSEDIAEKLQAEQDE-RGNIVLVQEGLHVIKPPSSRSY  277

Query  1092  rrqpgrqgggS--SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
               +  ++   S  SN LEET+C+A  ++NID   +AD+Y   AGRLTTLNSF LP LS +
Sbjct  278   DDEREQRRHRSPRSNGLEETICSARLSENIDEPSKADVYSPEAGRLTTLNSFNLPILSNL  337

Query  1266  RLSAAR  1283
             RLSA +
Sbjct  338   RLSAEK  343


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC G+ +    +E Q  +CQ+ ++ A+ PT  I AEGG TE WD   +QFQC G    
Sbjct  20   LNGCMGQGRM---REMQGNECQIDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSGVSVI  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+PNGL LPS+TS P + Y+ QG
Sbjct  77   RRTIEPNGLLLPSFTSGPELIYIEQG  102



>gb|AAS67036.1| 11S seed storage globulin [Chenopodium quinoa]
Length=480

 Score =   135 bits (341),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 128/246 (52%), Gaps = 34/246 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------------QSEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G+G  G+++PGC ET++            +  +G    D++QKIR+  +G I  +PA   
Sbjct  102   GNGISGLMIPGCPETFESMSQESWREGMKRGMRGGRFQDQHQKIRHLRQGHIFAMPAGVA  161

Query  780   HWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
             HW YN   EP + V+L      AN      P  F+LAGKP   H   + +G + Q    E
Sbjct  162   HWAYNTGNEPLVAVILIDTSNHANQLDKDYPKRFYLAGKPQQEHSRHQHRGGESQR--GE  219

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ------LPSrpek  1091
             R G  GN+ +G   + +  +     + AEK+       RG+IV+VQ+       PS    
Sbjct  220   R-GSGGNVFSGLGTKTIAQSFGVSEDIAEKLQAEQDE-RGNIVLVQEGLHVIKPPSSRSY  277

Query  1092  rrqpgrqgggS--SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
               +  ++   S  SN LEET+C+A  ++NID   +AD+Y   AGRLTTLNSF LP LS +
Sbjct  278   DDEREQRRHRSPRSNGLEETICSARLSENIDEPSKADVYSPEAGRLTTLNSFNLPILSNL  337

Query  1266  RLSAAR  1283
             RLSA +
Sbjct  338   RLSAEK  343


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC G+ +    +E Q  +CQ+ ++ A+ PT  I AEGG TE WD   +QFQC G    
Sbjct  20   LNGCMGQGRM---REMQGNECQIDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSGVSVI  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+PNGL LPS+TS P + Y+ QG
Sbjct  77   RRTIEPNGLLLPSFTSGPELIYIEQG  102



>ref|NP_001291328.1| uncharacterized protein LOC105171779 precursor [Sesamum indicum]
 gb|AAK15087.1|AF240004_1 11S globulin [Sesamum indicum]
Length=497

 Score =   135 bits (341),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 126/233 (54%), Gaps = 23/233 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ-----SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G ++PGCAET+++      ++    +D++QK+R + +GDI+ +PA    WFYN  
Sbjct  114   GRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNG  173

Query  801   REPTILVVL----QRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
              EP I V L      AN +      FFLAG P    Q    + +       ++ G   NI
Sbjct  174   GEPLITVALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYFGRPQT-----EKQQGETKNI  228

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP---SrpekrrqpgrqgggS  1124
               GFD +I+ DA   D +TA ++ G +   RG IV  ++L       E+  +  R     
Sbjct  229   FNGFDDEILADAFGVDVQTARRLKGQDDL-RGRIVRAERLDIVLPGEEEEERWERDPYSG  287

Query  1125  SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +N LEETLCTA   +N+D   RAD+Y+   GR+++LNS TLP LS++RLSA +
Sbjct  288   ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEK  340


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 9/87 (10%)
 Frame = +1

Query  142  QSFHGQESQNEK---------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            Q F+ Q+ Q+++         C++ ++ A  PT    +E G TEFWD N++QF+C G  A
Sbjct  28   QDFYWQDLQSQQQHKLQARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAA  87

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQG  375
             R++IQP GL LP Y +AP + YV++G
Sbjct  88   VRNVIQPRGLLLPHYNNAPQLLYVVRG  114



>ref|XP_004246943.1| PREDICTED: 12S seed storage protein CRA1-like [Solanum lycopersicum]
Length=474

 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 130/243 (53%), Gaps = 30/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ--------QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G YGI+  GC ET+Q        +   GS   D++QKI  +++GDII  PA A HW Y
Sbjct  97    GRGFYGIMNSGCPETFQSSQQFQQGERGAGSRFQDRHQKIGQFKQGDIIAFPAGAAHWAY  156

Query  792   NQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+  E  +LV  + +         N   FF+AG P    + Q+ Q    +    E+    
Sbjct  157   NEGNEELVLVCFEDSGNSANQLDQNSRRFFIAGNP-QQGEQQQGQQGGARSFQKEQF-QS  214

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----------LPSrpekr  1094
             GN+  GF+++++ +A     ETA K+ G   + RGHIV + Q                + 
Sbjct  215   GNVFRGFELELLAEAFGVSTETARKLQGEEDQ-RGHIVNIDQGLRVVRPPFSQEQEEREE  273

Query  1095  rqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             RQ   Q G  +N +EET+C+A   QNIDN  RAD+Y+ +AGR TT+NS TLP LS++RLS
Sbjct  274   RQEQGQYGPRANGIEETICSAKLRQNIDNPARADVYNPQAGRFTTVNSLTLPILSFLRLS  333

Query  1275  AAR  1283
             AA+
Sbjct  334   AAK  336


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            L++++ + PT  I AE G TE WD N++QFQC G    RH+IQ  G+ LPSY + PL+AY
Sbjct  34   LNRLNPMEPTVRIQAEAGVTELWDKNNQQFQCAGVSLIRHVIQSRGMLLPSYLNTPLLAY  93

Query  364  VLQG  375
            V +G
Sbjct  94   VERG  97



>ref|XP_002300775.1| legumin family protein [Populus trichocarpa]
 gb|EEE80048.1| legumin family protein [Populus trichocarpa]
Length=480

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 130/239 (54%), Gaps = 29/239 (12%)
 Frame = +3

Query  651   GIIVPGCAETYQQSEKGS-----EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTI  815
             G ++PGC ET+Q+S++          D++QK+R + +GD+I +PA   HWF+N+  EP +
Sbjct  107   GTLMPGCPETFQESQESRGQDSRRFQDQHQKVRQFREGDVIALPAGVAHWFFNEGNEPVV  166

Query  816   LV----VLQRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG------  947
              V    V   AN      P +F+LAG P    +   +Q R+  E  T R  Y G      
Sbjct  167   AVSVIDVAHSANQLDVLSPRNFYLAGNPEDEFRQVEDQPRRHGEQQTGRESYRGHGQQQC  226

Query  948   -NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------QLPSrpekrrqpg  1106
              N+  G D + + +A N + + A ++ G + R RG+IV V+      + PS  ++ +   
Sbjct  227   NNVFCGMDTRFLAEAFNINEQVARRLQGESDR-RGNIVRVKGGLQIVRPPSLRQEEQIQQ  285

Query  1107  rqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             ++ G   N LEET+CT    +NI +  RAD++   AGR++T+NS  LP L Y++LSA R
Sbjct  286   QRPGEQFNGLEETMCTMRIGENIGDPSRADVFTPEAGRISTVNSHNLPILRYIQLSAER  344


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  GCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRH  303
            G  GRR     Q+ Q  +CQL +++A+RP   I  E G  E WDPNH+QFQC G    R 
Sbjct  19   GSLGRRADRPCQQQQQGQCQLDRLNALRPDDRIKCEAGVIESWDPNHDQFQCAGVAVVRR  78

Query  304  IIQPNGLFLPSYTSAPLVAYVLQG  375
             I+PNGL LPSYT+AP + Y++QG
Sbjct  79   TIEPNGLLLPSYTNAPQLVYIVQG  102



>ref|XP_010679302.1| PREDICTED: legumin A-like [Beta vulgaris subsp. vulgaris]
Length=475

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 130/244 (53%), Gaps = 33/244 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---QSEKGSEIL-----------DKYQKIRYYEKGDIIVIPAS  773
             G G  G+++PGC E+++   Q + G E +           D++QKIR+  +GDI  +P+ 
Sbjct  101   GRGISGLMIPGCPESFESMSQQQFGEERMERGQMRGGSYQDQHQKIRHLRQGDIFALPSG  160

Query  774   AVHWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqgrqqqeLM  923
               HW YN   EP + +VL     +AN      P  F+LAGKP   H   + +  + Q   
Sbjct  161   VAHWAYNHGDEPLVAIVLIDTSNQANQLDKDYPRRFYLAGKPQQEHGQHQYRAGESQR--  218

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPSrpek  1091
              ER    GN+ +GFD + + ++     E A+++       RG+IV VQ+    +      
Sbjct  219   GER--GTGNVFSGFDTRTLAESFGVSEEIAQRL-QAEQDDRGNIVRVQEGLHVIKPPSRS  275

Query  1092  rrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +  ++ G   N LEET+C+A  +QNID+  +ADIY   AGRLT++NSF LP LSY+ L
Sbjct  276   WEEREQRRGSRYNGLEETICSARLSQNIDDPSKADIYTPEAGRLTSINSFNLPILSYLHL  335

Query  1272  SAAR  1283
             SA +
Sbjct  336   SAEK  339


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC G+ +       Q  +CQ  ++ A+ PT  I AEGG TE WD   +QFQC G    
Sbjct  20   FNGCMGQGRI----TKQGNQCQFDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSGVSVV  75

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+PNGL LPS+TS P + Y+ QG
Sbjct  76   RRTIEPNGLLLPSFTSGPELIYIEQG  101



>ref|XP_004234041.1| PREDICTED: legumin B-like [Solanum lycopersicum]
Length=493

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/265 (35%), Positives = 132/265 (50%), Gaps = 41/265 (15%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETY----------QQSEKGSEILDKYQK  728
             +G  LP+ +          GSG +  I PGCAET+          Q  ++G   LD++QK
Sbjct  96    NGLLLPYYSNTPQLIYIVQGSGVHSTIFPGCAETFETESPLDRRAQSGDRGQRSLDRHQK  155

Query  729   IRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRANPVS---------FFLAGKPGSSH  881
             +R +  GDI+ +PA   HW YN   EP I V L   + V+         FFLAG P    
Sbjct  156   VRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNVANQLDLTFRKFFLAGNPQRGV  215

Query  882   qgqreqgrqqqeLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
             Q Q    +Q+      R G +    GN+L+GFD Q++ +A N D E   KI    A  RG
Sbjct  216   QQQVLGRQQETTSQYGRRGSEQEKGGNMLSGFDPQVLSEAFNVDVEVIRKI-QEEAPERG  274

Query  1050  HIVIVQQL----PSrpekrrqpgrqgggSS---NALEETLCTATFTQNIDNRERADIYDS  1208
              IV+ + L    P   E+  +            N LEET CT    +NI +  R+D+Y+ 
Sbjct  275   VIVLAENLRFLLPEEKEEEEEEREWHSRRGFPLNGLEETFCTMKLRENIGHPTRSDVYNP  334

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             R GR++T+NS +LP L++++LSA R
Sbjct  335   RGGRISTVNSNSLPVLNWLQLSAER  359


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +++A  P     +E G  EFWD   EQF+C G  A RH I+ NGL LP Y++ P 
Sbjct  49   ECQIERLNAQEPNRRFESEAGVVEFWDATQEQFECAGVQAVRHEIRRNGLLLPYYSNTPQ  108

Query  355  VAYVLQGT  378
            + Y++QG+
Sbjct  109  LIYIVQGS  116



>ref|XP_002530185.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
 gb|EEF32199.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
Length=480

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/243 (38%), Positives = 131/243 (54%), Gaps = 28/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G+G  G + PGC ETYQ      S +GS   D++QK+R   +GD+I +PA    W YN  
Sbjct  108   GNGVQGSVFPGCPETYQSPSQSHSAQGSSQRDQHQKVRQIHEGDVIALPAGVAQWIYNNG  167

Query  801   REPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD--G  947
             R   IL+ ++  +NP +        FFLAG P    Q QR Q RQ +   + R   +  G
Sbjct  168   RSSLILLQIIDTSNPANQLDQNHRDFFLAGNPQQQLQSQRGQRRQSRGGQSTRGREERSG  227

Query  948   NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrq  1112
             N+ +GFD +++ +A N D E A K+ GG +  RG IV V+Q      P R ++  +  R+
Sbjct  228   NVFSGFDERLISEAFNIDTELARKM-GGKSDNRGIIVSVEQDLEMLTPQRSQEEERYQRE  286

Query  1113  gggSS------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
                        N LEET C A    NI++  +AD Y+  AGRLTT+NS +LP L+Y+RLS
Sbjct  287   EVSEERGGRAYNGLEETFCNARLEYNINDPSQADTYNPNAGRLTTINSNSLPILAYLRLS  346

Query  1275  AAR  1283
               +
Sbjct  347   VQK  349


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 49/93 (53%), Gaps = 6/93 (6%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQN------EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQC  279
            F+GC  + +      SQ       ++CQL +I +  P+    +E G TE WD N EQF C
Sbjct  17   FHGCIAQMEQVTSPPSQQKRQLRQDQCQLRRITSAEPSRRFQSEAGVTEIWDENDEQFHC  76

Query  280  GGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
             G  A RH IQ  GL LP Y + P + YVLQG 
Sbjct  77   VGVVAMRHTIQARGLLLPQYVNGPRLIYVLQGN  109



>ref|XP_010025835.1| PREDICTED: legumin B-like [Eucalyptus grandis]
 gb|KCW57368.1| hypothetical protein EUGRSUZ_H00153 [Eucalyptus grandis]
Length=501

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 140/279 (50%), Gaps = 59/279 (21%)
 Frame = +3

Query  612   GYFLPFST----------GSGEYGIIVPGCAETYQQSE-------------KGSEILDKY  722
             G FLP  T          G G  G++ PGC ETYQ  E             +G    D++
Sbjct  91    GLFLPAFTNAPELMYVVQGRGFQGVVFPGCPETYQSPEGSQHSQSRYGGQMRGERTQDQH  150

Query  723   QKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKPGS  875
             QK++   +GDII +PA A HW YNQ +   ++V V+  +N  +        FFLAG P  
Sbjct  151   QKVQQIREGDIIALPAGATHWIYNQGQSELVIVSVVDLSNQENQLDHSFRKFFLAGNPQQ  210

Query  876   SHqgqreqgrqqqeLMTERLGYD------GNILAGFDVQIVKDALNTDRETAEKIIGGNA  1037
                 +++QG   Q     R G        GNI +GFD QI+ ++   D E A+K+   + 
Sbjct  211   G---RQQQGGSSQSWGPRRRGGSSQQESFGNIFSGFDEQILSESFAIDTELAQKLKCQDD  267

Query  1038  RGRGHIVIVQ---QLPS--------------rpekrrqpgrqgggSSNALEETLCTATFT  1166
             + RGHIV VQ   Q+ S              + E+  + GR  G   N LEETLCT    
Sbjct  268   Q-RGHIVEVQNELQIVSPRYREGEQEGESEWKREREWRGGRGRGTRDNGLEETLCTMRLR  326

Query  1167  QNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +NI+  E+ADIY+ R GR TTLNSF+LP LS++ LSA R
Sbjct  327   ENINKPEKADIYNPRGGRFTTLNSFSLPILSFIGLSATR  365


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +++ + P+  I AE G +E WD +  Q QC G    RHIIQ  GLFLP++T+AP 
Sbjct  43   ECQIERLNTLEPSRRIEAEAGVSELWDEDEGQLQCAGVAVVRHIIQKRGLFLPAFTNAPE  102

Query  355  VAYVLQG  375
            + YV+QG
Sbjct  103  LMYVVQG  109



>ref|XP_006356113.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=483

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 132/264 (50%), Gaps = 40/264 (15%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQ----------QSEKGSEILDKYQK  728
             +G  LP+ +          G+G +  I PGCAET++            ++G   LD++QK
Sbjct  87    NGLLLPYYSNTPQLIYIVQGNGVHSAIFPGCAETFETESPLDRRARSGDRGQRSLDRHQK  146

Query  729   IRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRANPVS---------FFLAGKPGSSH  881
             +R +  GDI+ +PA   HW YN   EP I V L   + V+         FFLAG P    
Sbjct  147   VRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNVANQLDLTFRKFFLAGNPQRGV  206

Query  882   qgqreqgrqqqeLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
             Q Q    +Q+      R G +    GN+L+GFD Q++ +A N D E   KI    A  RG
Sbjct  207   QEQVLGRQQETGSQYGRRGSEQEKGGNMLSGFDAQVLSEAFNVDVEVIRKI-QEQAPERG  265

Query  1050  HIVIVQQLPSrpekrrqpgrqgggSS------NALEETLCTATFTQNIDNRERADIYDSR  1211
              IV  + L     + ++   +    S      N LEET CT    +NI +  R+D+Y+ R
Sbjct  266   VIVQAENLRFLLPEAKEEEEEREWHSRRGIPLNGLEETFCTMKLRENIGHPTRSDVYNPR  325

Query  1212  AGRLTTLNSFTLPALSYVRLSAAR  1283
              GR++T+NS TLP L++++LSA R
Sbjct  326   GGRISTVNSNTLPVLNWLQLSAER  349


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +++A  P     +E G  EFWD   EQF+C G  A RH I+ NGL LP Y++ P 
Sbjct  40   ECQIERLNAQEPNRRFESEAGVVEFWDATQEQFECAGVQAVRHEIRRNGLLLPYYSNTPQ  99

Query  355  VAYVLQGT  378
            + Y++QG 
Sbjct  100  LIYIVQGN  107



>ref|XP_009603582.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=496

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 133/264 (50%), Gaps = 40/264 (15%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQS-------EKGSEILDKYQKIRY  737
             +G  LP+ T          G G +  ++PGCAETY+         E+     D++QK+R 
Sbjct  98    NGLLLPYYTNTPMLMYIIQGRGIHSTVIPGCAETYETESGEYRTGERRRSFNDRHQKLRR  157

Query  738   YEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgq  890
             +  GD++ +PA    W YN   EP + V L      AN +     SFFLAG P    Q Q
Sbjct  158   FRAGDVLALPAGVTFWMYNDAEEPIVTVSLLDTSNHANQLDLTFRSFFLAGNPQRGLQQQ  217

Query  891   reqgrqqqeLM-----TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHI  1055
                 +Q+  +       E+    GNI  GFD +I+ +A N D ET  K+ G N   RG I
Sbjct  218   FVGRQQETTMQERRSEQEKTSKGGNIFNGFDTEILSEAFNVDVETIRKLQGQNEE-RGVI  276

Query  1056  VIVQQL----PSrpekrrqpgrqgggSS----NALEETLCTATFTQNIDNRERADIYDSR  1211
             V  ++L    P   E+  +  +Q         N LEET+CT    +NI +  R+D+Y+ R
Sbjct  277   VRAEELRLTLPEESEQEERREQQQREGGRWPLNGLEETICTLKLRENIGHPSRSDVYNPR  336

Query  1212  AGRLTTLNSFTLPALSYVRLSAAR  1283
              GR++T+NS +LP L++++LSA R
Sbjct  337   GGRVSTVNSLSLPILNFLQLSAER  360


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +++A  PT    +E G  EFWD  HEQF+C G  A RH I+ NGL LP YT+ P+
Sbjct  51   ECQIERLNAQEPTRRFESEAGVIEFWDATHEQFECAGVQAVRHQIRRNGLLLPYYTNTPM  110

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  111  LMYIIQG  117



>gb|EYU18320.1| hypothetical protein MIMGU_mgv1a008983mg [Erythranthe guttata]
Length=356

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 132/236 (56%), Gaps = 25/236 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G+++PGCAET++      QS++     D++QK+R +++GD++ +PA    W YN 
Sbjct  115   GRGVLGVVIPGCAETFETETQQAQSDRRRRFSDRHQKVRQFKQGDVLALPAGFTLWLYNN  174

Query  798   NREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
               E  + V L      AN +     +FFLAG P    Q    +   ++    E+ G   N
Sbjct  175   GDEQLVTVALLDTGNEANQLDQTFRNFFLAGTPQYGQQTSFRREGAEE----EQAGRKNN  230

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPSrpekrrqpgrqgg  1118
             I  GF+ +++ +  + DRETA K+ G + R RG IV  ++    LP   E+  +  R   
Sbjct  231   IFYGFEDELLAEVFDVDRETAAKLKGQDDR-RGQIVRAEKFNIVLPEAEEEEERRERGAP  289

Query  1119  gSS-NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              S+ N LEET+C+A   +N+D   RAD+Y+ R GR+++LNS  LP LS++RLSA +
Sbjct  290   WSAANGLEETICSAKLRENLDEPSRADVYNPRGGRISSLNSQKLPILSWLRLSAEK  345


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = +1

Query  142  QSFHGQESQNEK----CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            QS H Q+    +    C++ ++ A  PT  + +E G TEFWD N++QFQC G  A R+ I
Sbjct  34   QSLHQQQQHRLRARTDCRVDRLTAQEPTIRLDSEAGRTEFWDRNNQQFQCAGVSAVRNTI  93

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            +  GL LP Y +AP + YV++G
Sbjct  94   ERRGLLLPHYNNAPQLLYVVRG  115



>ref|XP_009763876.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=496

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 133/264 (50%), Gaps = 40/264 (15%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQS-------EKGSEILDKYQKIRY  737
             +G  LP+ T          G G +  ++PGCAETY+         E+     D++QK+R 
Sbjct  98    NGLLLPYYTNSPLLMYIIQGRGIHSTVIPGCAETYETESGESRTGERRRSFNDRHQKLRR  157

Query  738   YEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgq  890
             +  GD++ +PA    W YN   EP + V L      AN +     SFFLAG P    Q Q
Sbjct  158   FRAGDVLALPAGVTFWMYNDAEEPIVTVSLLDTSNHANQLDLTFRSFFLAGNPQRGVQQQ  217

Query  891   reqgrqqqeLMTERLGYD-----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHI  1055
                 +Q+  +   R   +     GNI  GFD +I+ +A N D ET  ++ G N   RG I
Sbjct  218   FVGRQQETTMQERRSEQETTSKGGNIFNGFDTEILSEAFNVDVETIRRLQGQNEE-RGVI  276

Query  1056  VIVQQL----PSrpekrrqpgrqgggSS----NALEETLCTATFTQNIDNRERADIYDSR  1211
             V  ++L    P   E+  +  +Q         N LEET+CT    +NI +  R+D+Y+ R
Sbjct  277   VRAEELRLTLPEESEQEERREQQQREGGRWPLNGLEETICTMKLRENIGHPSRSDVYNPR  336

Query  1212  AGRLTTLNSFTLPALSYVRLSAAR  1283
              GR++T+NS +LP L++++LSA R
Sbjct  337   GGRVSTVNSLSLPILNFLQLSAER  360


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +++A  PT    +E G  EFWD  HEQF+C G  A RH I+ NGL LP YT++PL
Sbjct  51   ECQIERLNAQEPTRRFESEAGVIEFWDATHEQFECAGVQAVRHQIRRNGLLLPYYTNSPL  110

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  111  LMYIIQG  117



>pdb|3QAC|A Chain A, Structure Of Amaranth 11s Proglobulin Seed Storage Protein 
From Amaranthus Hypochondriacus L.
Length=465

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 127/254 (50%), Gaps = 43/254 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE---------------------KGSEILDKYQKIRYYEKGD  752
             G+G  G+++PGC ETY+                        +G    D++QKIR+  +GD
Sbjct  79    GNGITGMMIPGCPETYESGSQQFQGGEDERIREQGSRKFGMRGDRFQDQHQKIRHLREGD  138

Query  753   IIVIPASAVHWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqg  902
             I  +PA   HW YN   +P + V+L      AN      P  F+LAGKP   H G+ +  
Sbjct  139   IFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSGEHQFS  198

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSr  1082
             R+ +    ER    GNI  GF+ +++ ++     E A+K+       RG+IV VQ+    
Sbjct  199   RESRR--GER--NTGNIFRGFETRLLAESFGVSEEIAQKL-QAEQDDRGNIVRVQEGLHV  253

Query  1083  pekrrqpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
              +   +   +    S       N +EET+C+A    N+D+  +AD+Y   AGRLTT+NSF
Sbjct  254   IKPPSRAWEEREQGSRGSRYLPNGVEETICSARLAVNVDDPSKADVYTPEAGRLTTVNSF  313

Query  1242  TLPALSYVRLSAAR  1283
              LP L ++RLSAA+
Sbjct  314   NLPILRHLRLSAAK  327


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +CQ+ ++ A+ PT  I AE G TE WD N ++F+C G    R  I+P+GL LPS+TS
Sbjct  10   QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVSVIRRTIEPHGLLLPSFTS  69

Query  346  APLVAYVLQGT  378
            AP + Y+ QG 
Sbjct  70   APELIYIEQGN  80



>emb|CAA57633.1| 11S globulin seed storage protein [Amaranthus hypochondriacus]
Length=501

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 127/254 (50%), Gaps = 43/254 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE---------------------KGSEILDKYQKIRYYEKGD  752
             G+G  G+++PGC ETY+                        +G    D++QKIR+  +GD
Sbjct  115   GNGITGMMIPGCPETYESGSQQFQGGEDERIREQGSRKFGMRGDRFQDQHQKIRHLREGD  174

Query  753   IIVIPASAVHWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqg  902
             I  +PA   HW YN   +P + V+L      AN      P  F+LAGKP   H G+ +  
Sbjct  175   IFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSGEHQFS  234

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSr  1082
             R+ +    ER    GNI  GF+ +++ ++     E A+K+       RG+IV VQ+    
Sbjct  235   RESRR--GER--NTGNIFRGFETRLLAESFGVSEEIAQKL-QAEQDDRGNIVRVQEGLHV  289

Query  1083  pekrrqpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
              +   +   +    S       N +EET+C+A    N+D+  +AD+Y   AGRLTT+NSF
Sbjct  290   IKPPSRAWEEREQGSRGSRYLPNGVEETICSARLAVNVDDPSKADVYTPEAGRLTTVNSF  349

Query  1242  TLPALSYVRLSAAR  1283
              LP L ++RLSAA+
Sbjct  350   NLPILRHLRLSAAK  363


 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +1

Query  118  FNGCFG--RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAY  291
            FNGC G  R + F     Q  +CQ+ ++ A+ PT  I AE G TE WD N ++F+C G  
Sbjct  32   FNGCMGEGRFREFQ----QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAGVS  87

Query  292  AFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
              R  I+P+GL LPS+TSAP + Y+ QG 
Sbjct  88   VIRRTIEPHGLLLPSFTSAPELIYIEQGN  116



>ref|XP_002307645.2| legumin family protein [Populus trichocarpa]
 gb|EEE94641.2| legumin family protein [Populus trichocarpa]
Length=479

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 124/242 (51%), Gaps = 27/242 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS-----EILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G ++PGC ET+Q+S++        + D++QK+  + +GD+I +PA   HW YN  
Sbjct  103   GRGMTGTLMPGCPETFQESQESQGQGRRRLQDQHQKVHRFREGDVIALPAGVAHWCYNDG  162

Query  801   REPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG-  947
             +E  I V           L   NP +F+LAG P    Q  + Q R + E  T R  + G 
Sbjct  163   KERVIAVTVLDMANSANQLDDMNPRNFYLAGNPQEEFQQVQGQPRHRGEQRTGREPFRGH  222

Query  948   ------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV----QQLPSrpekrr  1097
                   NI  G D + + +A N   + A+K+   + R RG+IV V    Q +     +  
Sbjct  223   GQQQCNNIFCGMDTRFLAEAFNVSEQVAKKLQSESDR-RGNIVRVKGGLQIVMPPLRQEE  281

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             Q   Q G   N LEET+CT    +NI +  RAD++   AGR++T+NS  LP L Y++LSA
Sbjct  282   QEQGQRGEHRNGLEETMCTMRIRENIGDPSRADVFTPEAGRISTVNSHNLPILRYIQLSA  341

Query  1278  AR  1283
              R
Sbjct  342   ER  343


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL +++A++P   I +E G TE WDPNH+QFQC G    R  I+PNGL LPSY++AP 
Sbjct  37   QCQLDRLNALKPGNRIKSEAGETESWDPNHDQFQCAGVAVVRRTIEPNGLLLPSYSNAPQ  96

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  97   LVYIVQG  103



>gb|EPS62256.1| hypothetical protein M569_12535, partial [Genlisea aurea]
Length=476

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 129/261 (49%), Gaps = 47/261 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE------------------ILDKYQKIRYYEKGDIIV  761
             G G +G +VPGC ETY+ SE GSE                    D++QK+    KGDI+ 
Sbjct  81    GRGTFGHLVPGCPETYE-SESGSEREGGGEQERERYGEMGRRFRDRHQKVGQLRKGDIVA  139

Query  762   IPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqq  914
              PA    W YN   E  +LV L+           NP SF+LAG P S  +G +++ R+  
Sbjct  140   SPAGIARWVYNDGDEELVLVALEETSNRANQLDENPRSFYLAGNPRSGGEGGQQRQRESA  199

Query  915   eLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----  1070
                  + G      GN+  GFD Q + +    D ETA K+ G +   RGHI+ V++    
Sbjct  200   FRHHGQGGRGQPEFGNVFRGFDAQWLSEIFQVDEETARKLQGEDE-NRGHIITVERSLQV  258

Query  1071  ----------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGR  1220
                          R E+R+  GR G    N LEET+C+A   +NID   RAD+Y+  AGR
Sbjct  259   LSPPHRGEEERYRRGERRQYGGRGGSSWGNGLEETVCSARVKENIDRPSRADVYNPEAGR  318

Query  1221  LTTLNSFTLPALSYVRLSAAR  1283
              +T+N FTLP L ++ LSA +
Sbjct  319   YSTVNCFTLPILRFLGLSAGK  339


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +C++ +I    PT    AEGG TEFWD N ++F+C G    RH ++ N L LP YT+
Sbjct  12   QQGECRIDRIETREPTYRFEAEGGVTEFWDHNEQEFRCAGVSFHRHTLRRNSLLLPYYTT  71

Query  346  APLVAYVLQG  375
            AP + YVLQG
Sbjct  72   APSLVYVLQG  81



>ref|XP_006369779.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
 gb|ERP66348.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
Length=470

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 125/243 (51%), Gaps = 29/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G +G ++PGC ET+Q S + S        D +QK+R   +GD++ +P+    WFYN  
Sbjct  111   GRGFHGAVIPGCPETFQSSGQNSRDRRESSQDHHQKVRQVREGDVVALPSGVADWFYNNG  170

Query  801   REPTILV-VLQRANPVS--------FFLAGKPG----SSHqgqreqgrqqqeLMTERLGY  941
               P +LV +L  +N  +        FFLAG P     S     +    + +    E+  Y
Sbjct  171   DSPLVLVQLLDTSNAANQLDQDFRKFFLAGNPQQELQSQRSSYQSGQHEGESRRHEQERY  230

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---------QLPSrpekr  1094
               NI  GFD +++ +A N D + A ++   N   RG IV VQ         Q     E+ 
Sbjct  231   R-NIFGGFDERLLAEAFNVDTKLARRMKNEND-NRGIIVRVQHELQVVSPQQSREEEERE  288

Query  1095  rqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             R+  R+ GG  N LEET C A    NI+N ERAD+++  AGRLTT+NS  LP L Y++LS
Sbjct  289   REHQRRPGGRGNGLEETFCNARLKHNINNPERADVFNPHAGRLTTVNSLNLPILRYLQLS  348

Query  1275  AAR  1283
             A R
Sbjct  349   AQR  351


 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ  +I+A+ P     +E G TE WD N +QFQC G    RH I   GL LP+Y++ P 
Sbjct  45   ECQFDRINALEPARKFRSEAGVTEIWDENDQQFQCAGVVVIRHTINQRGLLLPAYSNTPK  104

Query  355  VAYVLQG  375
            + Y+ QG
Sbjct  105  LIYIDQG  111



>ref|XP_009630003.1| PREDICTED: legumin B-like [Nicotiana tomentosiformis]
Length=500

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 134/271 (49%), Gaps = 47/271 (17%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQSEK----------------GSEI  710
             +G  LP+ +          GSG +  + PGCAET++                    G   
Sbjct  96    NGLLLPYYSNTPQLIYIIQGSGVHSTVFPGCAETFETESPQSRRGERGERGERGEAGQRF  155

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAG  863
              D++QK+R +  GDI+ +PA   HW YN   EP I V L     +AN +      FFLAG
Sbjct  156   NDRHQKVRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNQANQLDLTFRKFFLAG  215

Query  864   KPGSSHqgqreqgrqqqeLMTERLGYD--GNILAGFDVQIVKDALNTDRETAEKIIGGNA  1037
              P    Q Q    +Q++  +  R   +  GNIL+GFD Q++ DA N D E   ++    A
Sbjct  216   NPQRGVQQQMLGRQQEEAGLGRRGEQERGGNILSGFDAQLLSDAFNVDPEIIRRL-QEQA  274

Query  1038  RGRGHIVIVQQL----PSrpekrrqpgrqgggSS-----NALEETLCTATFTQNIDNRER  1190
               RG IV  + L    P   E+++Q   Q G        N LEETLCT    +NI +  R
Sbjct  275   PERGVIVRAENLRFLRPEESEEQQQQQWQQGRRGGSWPLNGLEETLCTMKLRENIGHPTR  334

Query  1191  ADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             AD+Y+ R GR++T+N  TLP L++++LSA R
Sbjct  335   ADVYNPRGGRISTVNGLTLPVLNFLQLSAER  365


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ +++A  PT    +E G TEFWD   EQF+C G  A RH I+ NGL LP Y++ P 
Sbjct  49   ECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAGVQAVRHEIRRNGLLLPYYSNTPQ  108

Query  355  VAYVLQGT  378
            + Y++QG+
Sbjct  109  LIYIIQGS  116



>gb|KDP40339.1| hypothetical protein JCGZ_02337 [Jatropha curcas]
Length=448

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 116/238 (49%), Gaps = 22/238 (9%)
 Frame = +3

Query  633   TGSGEYGIIVPGCAETYQQ------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             TG+G  G ++PGC ETYQ        E+     D++QK+R   +GD++ +PA    W YN
Sbjct  81    TGNGVQGALIPGCPETYQSPSESEYRERRQSQGDQHQKVRQLREGDVVALPAGVAQWIYN  140

Query  795   QNREPTILV-VLQRANPVS--------FFLAGKPG----SSHqgqreqgrqqqeLMTERL  935
               R P +LV ++  +NP +        FFLAG P     S       +    +       
Sbjct  141   NGRSPLVLVQIIDTSNPANQLDQSHRLFFLAGNPHRKVQSQRGESERRHEWSRGESLRSH  200

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqg  1115
                GN+ +G D Q++ +A N +R+ A ++ G N   RG IV V+        RR    + 
Sbjct  201   QRSGNVFSGLDEQLLAEAFNVNRDIARRLKGEND-NRGIIVSVEGELEYFSPRRNQEEEK  259

Query  1116  ggSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                   N +EET CTA    NI++  RADIY+ R G +T +NS   P L ++RLS  +
Sbjct  260   RERQFVNGIEETFCTARLKHNINDPSRADIYNPRGGHVTNVNSHNFPILRHLRLSVQK  317



>ref|XP_009765013.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 127/270 (47%), Gaps = 46/270 (17%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQSEK-------------GSEILDK  719
             +G  LP+ +          GSG +  + PGCAET++                 G    D+
Sbjct  96    NGLLLPYYSNTPQLIYIIQGSGVHSTVFPGCAETFETESAQSRRGERGERGEAGQRFNDR  155

Query  720   YQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPG  872
             +QK+R +  GDI+ +PA   HW YN   EP I V L     +AN +      FFLAG P 
Sbjct  156   HQKVRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNQANQLDLTFRKFFLAGNPQ  215

Query  873   SSHqgqreqgrqqqeLMTERLGYD---GNILAGFDVQIVKDALNTDRETAEKIIGGNARG  1043
                Q Q    +Q+      R G     GNIL+GFD Q++ DA N D E   + +   A  
Sbjct  216   RGVQQQMLGRQQEGAAGLGRRGEQERGGNILSGFDAQLLSDAFNVDPEIIRR-LQEQAPE  274

Query  1044  RGHIVIVQQLPSrpekrrqpgrqgggSS----------NALEETLCTATFTQNIDNRERA  1193
             RG IV  + L     +  +  +Q               N LEET CT    +NI +  RA
Sbjct  275   RGVIVRAENLRFLQPEESEEEQQQQQWQQGRRGGSWPLNGLEETFCTMKLRENIGHPTRA  334

Query  1194  DIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             D+Y+ R GR++T+N  TLP L++++LSA R
Sbjct  335   DVYNPRGGRISTVNGLTLPVLNFLQLSAER  364


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ +++A  PT    +E G TEFWD   EQF+C G  A RH I+ NGL LP Y++ P 
Sbjct  49   ECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAGVQALRHEIRRNGLLLPYYSNTPQ  108

Query  355  VAYVLQGT  378
            + Y++QG+
Sbjct  109  LIYIIQGS  116



>ref|XP_009765011.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 127/270 (47%), Gaps = 46/270 (17%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQSEK-------------GSEILDK  719
             +G  LP+ +          GSG +  + PGCAET++                 G    D+
Sbjct  96    NGLLLPYYSNTPQLIYIIQGSGVHSTVFPGCAETFETESAQSRRGERGERGEAGQRFNDR  155

Query  720   YQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPG  872
             +QK+R +  GDI+ +PA   HW YN   EP I V L     +AN +      FFLAG P 
Sbjct  156   HQKVRRFRAGDILALPAGVTHWTYNDGEEPIISVSLIDTSNQANQLDLTFRKFFLAGNPQ  215

Query  873   SSHqgqreqgrqqqeLMTERLGYD---GNILAGFDVQIVKDALNTDRETAEKIIGGNARG  1043
                Q Q    +Q+      R G     GNIL+GFD Q++ DA N D E   + +   A  
Sbjct  216   RGVQQQMLGRQQEGAAGLGRRGEQERGGNILSGFDAQLLSDAFNVDPEIIRR-LQEQAPE  274

Query  1044  RGHIVIVQQLPSrpekrrqpgrqgggSS----------NALEETLCTATFTQNIDNRERA  1193
             RG IV  + L     +  +  +Q               N LEET CT    +NI +  RA
Sbjct  275   RGVIVRAENLRFLQPEESEEEQQQQQWQQGRRGGSWPLNGLEETFCTMKLRENIGHPTRA  334

Query  1194  DIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             D+Y+ R GR++T+N  TLP L++++LSA R
Sbjct  335   DVYNPRGGRISTVNGLTLPVLNFLQLSAER  364


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ +++A  PT    +E G TEFWD   EQF+C G  A RH I+ NGL LP Y++ P 
Sbjct  49   ECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAGVQAVRHEIRRNGLLLPYYSNTPQ  108

Query  355  VAYVLQGT  378
            + Y++QG+
Sbjct  109  LIYIIQGS  116



>ref|XP_011004057.1| PREDICTED: legumin A-like [Populus euphratica]
Length=480

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 121/243 (50%), Gaps = 28/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE----KGSEIL-DKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G ++PGC ET Q+S+    +GS  L D +QK+  + +GD+I +PA   HW YN  
Sbjct  103   GRGMTGTLMPGCPETLQESQESQGQGSRRLQDLHQKVHRFREGDVIALPAGVAHWCYNDG  162

Query  801   REPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG-  947
              E  I V           L   NP +F+LAG P    Q  + Q R   E  T R  + G 
Sbjct  163   NERVIAVTVLDMANSANQLDDMNPRNFYLAGNPQEEFQQVQGQPRHLGEQRTGREPFRGH  222

Query  948   ------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ-----QLPSrpekr  1094
                   NI  G D + + +A N   + A K+   + R RG+IV V+      +P    + 
Sbjct  223   GHQQCNNIFCGMDTRFLTEAFNVSEQVASKLQSESDR-RGNIVRVKGGLQIAMPPSLRRE  281

Query  1095  rqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
              Q   Q G   N LEET+CT    +NI +  RAD++   AGR++ +NS  LP L Y++LS
Sbjct  282   EQEQGQRGEHRNGLEETMCTMRIRENIGDPSRADVFTPEAGRISAVNSHNLPILRYIQLS  341

Query  1275  AAR  1283
             A R
Sbjct  342   AER  344


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL +++A++P   I +E G TE WDPNH+QFQC G    R  I+PNGL LPSY++AP 
Sbjct  37   QCQLDRLNALKPGNRIKSEAGETESWDPNHDQFQCAGVAVVRRTIEPNGLLLPSYSNAPQ  96

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  97   LVYIVQG  103



>pdb|2EVX|A Chain A, Crystal Structure Of Pumpkin Seed Globulin
 pdb|2E9Q|A Chain A, Recombinant Pro-11s Globulin Of Pumpkin
Length=459

 Score =   124 bits (310),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 122/244 (50%), Gaps = 33/244 (14%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ-----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             + G G  GI +PGCAETYQ         GS   D++QKIR + +GD++V+PA   HW YN
Sbjct  90    AQGFGIRGIAIPGCAETYQTDLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHWMYN  149

Query  795   QNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLG---  938
             + +   +L+V      V+         F+LAG+P    +G  E  R      + R G   
Sbjct  150   RGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQVERGVEEWER------SSRKGSSG  203

Query  939   -YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrq  1100
                GNI +GF  + +++A   D     K+ G +   R  IV V +     LP + E+ R 
Sbjct  204   EKSGNIFSGFADEFLEEAFQIDGGLVRKLKGEDDE-RDRIVQVDEDFEVLLPEKDEEERS  262

Query  1101  p---grqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
                       S N LEET+CT    QNI   ERAD+++ R GR++T N  TLP L  VRL
Sbjct  263   RGRYIESESESENGLEETICTLRLKQNIGRSERADVFNPRGGRISTANYHTLPILRQVRL  322

Query  1272  SAAR  1283
             SA R
Sbjct  323   SAER  326


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C+L  + A  P     AE G TE WD ++++FQC G    RH I+P GL LP +++AP +
Sbjct  27   CRLENLRAQDPVRRAEAEAGFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKL  86

Query  358  AYVLQG  375
             +V QG
Sbjct  87   IFVAQG  92



>ref|XP_006354542.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=489

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 131/251 (52%), Gaps = 37/251 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-------------QSEKGSEIL---DKYQKIRYYEKGDIIVIP  767
             GSG  G ++PGCAET++             +SE GS+     D++QK+R + +GD++ +P
Sbjct  92    GSGILGTVIPGCAETFESPQREKSMRGEQGRSEGGSQYRTGGDRHQKVRQFRQGDVLALP  151

Query  768   ASAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKP------GSSHqgqreqg  902
             A    WFYN  +E  + V +L  +NPV+        FFLAG P      GS ++ +    
Sbjct  152   AGITLWFYNNGQERLVTVALLDVSNPVNQLDLQFRHFFLAGNPNPKGLSGSRYEEEIRSR  211

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL---  1073
             ++ ++    +    GN+  GFD+ I+ D  N DR  A K + G    RG I+  +     
Sbjct  212   KEHEQGEEPQQQQSGNLFDGFDLDILADVFNVDRNLA-KNLQGREDQRGQIIRAENFDVL  270

Query  1074  -PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLP  1250
              P   E+ +  G   G   N LE T+C     +N+ +  RAD+Y+ R GR++TLNS  LP
Sbjct  271   SPKFEEEEQSHGPGKGSQPNGLE-TICAMRLRENLGHPSRADVYNPRGGRVSTLNSHKLP  329

Query  1251  ALSYVRLSAAR  1283
              L++++LSA +
Sbjct  330   ILNWLQLSAEK  340


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            Q  H +      C++S ++A  PT    +E GTTEFWD N E+F+C G  A R+ IQPNG
Sbjct  15   QQQHRRGRAKTDCRISSLNAREPTYKFNSEAGTTEFWDRNSEEFECAGVAAVRNDIQPNG  74

Query  322  LFLPSYTSAPLVAYVLQGT  378
            L LP Y +AP + Y++QG+
Sbjct  75   LLLPHYNNAPQLLYIVQGS  93



>ref|XP_010675057.1| PREDICTED: 11S globulin subunit beta-like [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 127/253 (50%), Gaps = 45/253 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ--------------SEKGSEILDKYQKIRYYEKGDIIVIPAS  773
             G+G  G I+PGC ETY+               +E+G  + D++QK+ ++ +GDI+ +PA 
Sbjct  112   GNGILGTIMPGCPETYESFQQEGRRILGRRGRTERGQTMDDQHQKLHFFRQGDILALPAG  171

Query  774   AVHWFYNQNREPTILVVLQ----RANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMT  926
               HW+YN      ++VV+       N +      F+LAG PG+         +    L  
Sbjct  172   VAHWWYNDGDANIVMVVMHDIGSHLNQLDQHLRKFYLAGNPGAQ-------AQHTVSLRE  224

Query  927   ERLGYD--GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrp  1085
              RL ++   NI  GFDV+++ ++     +TA ++   N R RG IV V +      P R 
Sbjct  225   RRLAHNIGSNIFKGFDVELLAESFGVSLDTARQLQCENDR-RGSIVRVYEGLGVVRPPRT  283

Query  1086  ekrrqpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
              + R        S+       N LEET C+    +NI++ ERAD+Y +  GR++T+ SF 
Sbjct  284   IRGRWIVNNSTTSTDNNEMMENGLEETFCSMRIRENIEDPERADVYTAVGGRISTITSFD  343

Query  1245  LPALSYVRLSAAR  1283
             LP L +++LSA R
Sbjct  344   LPILQHIKLSAKR  356


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAP  351
            E+C++  ++A  P   +  E G TE W+ ++EQ QC    A RHII+PNGL+LP++ +AP
Sbjct  45   ERCEIRSLNAREPNHRVQHEAGVTEMWEQDNEQMQCANVAAARHIIEPNGLYLPNFHNAP  104

Query  352  LVAYVLQG  375
            ++AY++QG
Sbjct  105  MLAYIVQG  112



>ref|XP_010111925.1| Legumin A [Morus notabilis]
 gb|EXC31959.1| Legumin A [Morus notabilis]
Length=487

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 130/255 (51%), Gaps = 40/255 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE--ILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREP  809
             G G  G++ PGC ET+++S++G+     D++QKI+++ +GD+I +PA   +W YN    P
Sbjct  99    GKGVLGLVFPGCPETFEESQQGTSRSSQDRHQKIQHFREGDVIALPAGVAYWCYNDGDSP  158

Query  810   TILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL--------G  938
              + V L            NP  F+LAGKP +       + + ++     R          
Sbjct  159   VVSVSLLDVSNHDNQLDRNPRRFYLAGKPHNEFLQSSRREQYREGSQERRREEQQQEQGS  218

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ-----------------  1067
             +  N+ +GF V+ +++A N D ETA +I   N + RG I+ V+                 
Sbjct  219   HVNNVFSGFSVEFIQEAFNVDAETARRIQSQNDK-RGSIIRVKDRLQLVRPGRSREEQEH  277

Query  1068  ---QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
                Q   R  +R    RQGG   N +EET CT    +NI +  RAD+Y  +AGR++ +NS
Sbjct  278   EMRQEEQRQTEREHARRQGGSRHNGVEETFCTMRLRENIGDPSRADVYSPQAGRVSNVNS  337

Query  1239  FTLPALSYVRLSAAR  1283
             + LP L++++LSA R
Sbjct  338   YNLPILNWLQLSAER  352


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC  RR    G+  + ++CQL+++ A  P   +  E GT E W+PNHEQFQC G    
Sbjct  17   FHGCLARRT---GKYQRQDECQLNKLEAHEPDNRLECEAGTVESWNPNHEQFQCVGVALV  73

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQPNGL LPSY++AP + ++++G
Sbjct  74   RTTIQPNGLHLPSYSNAPRLVHIIRG  99



>gb|AIA57958.1| beta-globulin B2 [Jatropha curcas]
Length=478

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 115/237 (49%), Gaps = 22/237 (9%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G+G  G ++PGC ETYQ        E+     D++QK+R   +GD++ +PA    W YN 
Sbjct  112   GNGVQGALIPGCPETYQSPSESEYRERRQSQGDQHQKVRQLREGDVVALPAGVAQWIYNN  171

Query  798   NREPTILV-VLQRANPVS--------FFLAGKPG----SSHqgqreqgrqqqeLMTERLG  938
              R P +LV ++  +NP +        FFLAG P     S       +    +        
Sbjct  172   GRSPLVLVQIIDTSNPANQLDQSHRLFFLAGNPHRKVQSQRGESERRHEWSRGESLRSHQ  231

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgg  1118
               GN+ +G D Q++ +A N +R+ A ++ G N   RG IV V+        RR    +  
Sbjct  232   RSGNVFSGLDEQLLAEAFNVNRDIARRLKGEND-NRGIIVSVEGELEYFSPRRNQEEEKR  290

Query  1119  gSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N +EET CTA    NI++  RADIY+ R G +T +NS   P L ++RLS  +
Sbjct  291   ERQFVNGIEETFCTARLKHNINDPSRADIYNPRGGHVTNVNSHNFPILRHLRLSVQK  347


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            +Q ++C+L  ++A  P+ +  +E G TE WD N EQFQC G  A RHIIQ  GL LP Y 
Sbjct  42   AQQDQCRLDNLNAAEPSRSFQSEAGVTEVWDENDEQFQCTGVVAIRHIIQQRGLLLPQYA  101

Query  343  SAPLVAYVLQGT  378
            + P + YV+QG 
Sbjct  102  NGPKLIYVVQGN  113



>gb|AIO11048.1| 11S globulin [Murraya paniculata]
Length=474

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 123/249 (49%), Gaps = 34/249 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----DKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             GSG +G + PGCAETYQ S++          D++QK+R   +GDII +PA A HW YN  
Sbjct  113   GSGIHGAVFPGCAETYQDSQQQQSFQGSRSQDQHQKVRQLREGDIIALPAGAAHWIYNNG  172

Query  801   REPTILVVL----QRANPV-----SFFLAGKP-----GSSHqgqreqgrqqqeLMTERLG  938
             R+  +LV L       N +      F+L G P     G S          Q     +R  
Sbjct  173   RDQLVLVALVDVGNSQNQLDQYFRKFYLGGNPQPELQGYSQSQGSRDQGSQGSEGGDRSR  232

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV--------------QQLP  1076
               GNI +GFD +++ +A N + +  +++     + RG IV V              Q+  
Sbjct  233   RGGNIFSGFDERLLAEAFNVNPDVIKRLQSPQMQ-RGIIVRVEEELRVLSPQRGGEQEEE  291

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
              + ++     +      N +EETLCT    QNI++   AD+Y+ RAGR+TT+N F LP L
Sbjct  292   FQGKETMASRKLSVQGDNGIEETLCTMKLKQNINDPSAADVYNPRAGRVTTVNRFNLPIL  351

Query  1257  SYVRLSAAR  1283
              Y++LSA +
Sbjct  352   RYLQLSAEK  360


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 11/98 (11%)
 Frame = +1

Query  118  FNGCFGRRQSFHG-----------QESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNH  264
            FN CF + +   G           ++    +C    ++A+ P   + +E G TEFWD N+
Sbjct  17   FNACFAQIEQVTGITREERQQRQQRQRFQTQCNFQNLNALEPQQKVESEAGVTEFWDQNN  76

Query  265  EQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            EQ QC     FRH IQ  GL +P+YT+ P + YV+QG+
Sbjct  77   EQLQCANVAVFRHRIQQRGLLVPAYTNTPEIFYVVQGS  114



>ref|XP_010671027.1| PREDICTED: legumin B-like [Beta vulgaris subsp. vulgaris]
Length=516

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 129/255 (51%), Gaps = 40/255 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------------QSEKGSE-ILDKYQKIRYYEKGDIIVIPASA  776
             G   +G+   GC ETY+            +S++GSE I D++QKIR   +G II +PA  
Sbjct  124   GRALFGVSGLGCPETYESGSPESFSEESRRSQRGSEEIRDQHQKIRRVHQGHIIALPAGV  183

Query  777   VHWFYNQNREPTILVVLQRANPV---------SFFLAGKP-------GSSHqgqreqgrq  908
               WFYN   EP   + L   N           SFFLAG P       G   + +R     
Sbjct  184   NKWFYNDGEEPLTCITLFDTNNYQNELDEILRSFFLAGNPQGRGGEQGRHQEIRRHHEST  243

Query  909   qqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----L  1073
             ++ +         NI +GFD Q++ +A   +R+T   + G N   RG I+ V+      +
Sbjct  244   RRHIRRSHQNAGKNIFSGFDDQLLAEAFGVERDTISSLKGEND-NRGSIIRVEGDLELLI  302

Query  1074  PSrpekrrqpgrqgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
             P    + ++  R  GG       N LEET+C+A  T+NIDN E+AD+++ + GRLT+LNS
Sbjct  303   PEWDREEQRSERHHGGRGRGGRYNGLEETICSAKLTENIDNPEKADVFNPQGGRLTSLNS  362

Query  1239  FTLPALSYVRLSAAR  1283
               LP L++++LSA +
Sbjct  363   HKLPILNFLQLSAEK  377


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  GQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQ-FQCGGAYAFRHIIQPNGLFL  330
            GQ++ N+ CQ++Q+ A  PT  + AE G TE WDPN +Q FQC G    RH ++P GL L
Sbjct  51   GQQALND-CQINQLSAAEPTIRLQAEAGVTEIWDPNDQQEFQCVGVTVVRHEVEPRGLVL  109

Query  331  PSYTSAPLVAYVLQG  375
            P Y +AP + Y+++G
Sbjct  110  PHYNNAPSLTYIIRG  124



>sp|P13744.1|11SB_CUCMA RecName: Full=11S globulin subunit beta; Contains: RecName: Full=11S 
globulin gamma chain; AltName: Full=11S globulin acidic 
chain; Contains: RecName: Full=11S globulin delta chain; 
AltName: Full=11S globulin basic chain; Flags: Precursor [Cucurbita 
maxima]
 pir||FWPU1B 11S globulin beta subunit precursor - cucurbita cv. Kurokawa 
Amakuri [Cucurbita cv. Kurokawa Amakuri]
 gb|AAA33110.1| 11-S globulin beta-subunit precursor [Cucurbita pepo]
Length=480

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/244 (36%), Positives = 121/244 (50%), Gaps = 33/244 (14%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ-----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             + G G  GI +PGCAETYQ         GS   D++QKIR + +GD++V+PA   HW YN
Sbjct  111   AQGFGIRGIAIPGCAETYQTDLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHWMYN  170

Query  795   QNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLG---  938
             + +   +L+V      V+         F+LAG+P    +G  E  R      + R G   
Sbjct  171   RGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQVERGVEEWER------SSRKGSSG  224

Query  939   -YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrq  1100
                GNI +GF  + +++A   D     K+ G +   R  IV V +     LP + E+ R 
Sbjct  225   EKSGNIFSGFADEFLEEAFQIDGGLVRKLKGEDDE-RDRIVQVDEDFEVLLPEKDEEERS  283

Query  1101  p---grqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
                       S N LEET+CT    QNI    RAD+++ R GR++T N  TLP L  VRL
Sbjct  284   RGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRL  343

Query  1272  SAAR  1283
             SA R
Sbjct  344   SAER  347


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C+L  + A  P     AE   TE WD ++++FQC G    RH I+P GL LP +++AP +
Sbjct  48   CRLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKL  107

Query  358  AYVLQG  375
             +V QG
Sbjct  108  IFVAQG  113



>ref|XP_004289947.1| PREDICTED: glycinin G4-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 126/272 (46%), Gaps = 57/272 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE--------------------------------ILDK  719
             G G  G+++PGC ET++++E+  E                                 LD+
Sbjct  100   GMGHLGMVLPGCPETFEETEQSVEEQRQSQGQQGRRQQIIRREGQMGQQGQQESYDQLDR  159

Query  720   YQKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRAN--------PVSFFLAGKPG  872
             +QK+R   +GD+I IPA    W YN   EP + V +L  +N        P  F+LAG P 
Sbjct  160   HQKVRRVREGDVIAIPAGVTCWSYNDANEPLVFVSLLDMSNQHNQLDRIPRRFYLAGNPQ  219

Query  873   SSHqgqreqgrqqqeLMTERLGYDGN---ILAGFDVQIVKDALNTDRETAEKIIGGNARG  1043
                  Q +  R +++    R    GN   + +GFD Q++ DALN D++TA+++ G N   
Sbjct  220   DEFTQQGQSPRIRRQQGKSRHQMQGNYNNVFSGFDTQLLADALNIDQQTAQQLQGMND-N  278

Query  1044  RGHIVIVQ------QLPSrpekrrqpgrqggg------SSNALEETLCTATFTQNIDNRE  1187
             R  IV VQ      Q P    + RQ               N +EE  C     QNI    
Sbjct  279   RPQIVRVQGRLDFIQPPESMREERQIQGTQMQGQQGQYEENGMEELFCHMKMRQNIGRPT  338

Query  1188  RADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              AD++  +AGR++TLN+FT+P L  +RLSA R
Sbjct  339   MADVFSPQAGRISTLNAFTMPILRRLRLSAER  370


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  118  FNGCFG-RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            F+GC   RRQ+   Q SQ  +C L++I A  P   I  E G  E WD N + FQC G   
Sbjct  17   FHGCLASRRQT---QFSQQNECMLNRIQAREPDNRIETEAGRIESWDYNQDDFQCAGVAV  73

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQG  375
             +  I+ NGL LPSY + P + YV++G
Sbjct  74   QKITIENNGLHLPSYVNTPRLVYVVRG  100



>gb|KDP40337.1| hypothetical protein JCGZ_02335 [Jatropha curcas]
Length=508

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 123/265 (46%), Gaps = 50/265 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ------------SEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G G +G + PGC ET+Q              E+ S   D++QK+R   +GD+I +PA   
Sbjct  112   GRGIHGAVFPGCPETFQSPSEPQERYGFGAGERESRRFDQHQKVRSLRQGDVIALPAGVA  171

Query  780   HWFYNQNREPTILV-VLQRANPV--------SFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              W YN  R P +LV ++   N          +FFLAG P    Q +R   R  +  +  R
Sbjct  172   QWIYNSGRTPLVLVQIIDTGNAANQLDENHRAFFLAGNPQRDVQSKRCAFRGSRMPLAGR  231

Query  933   LG------YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPS  1079
                       GNI +G D Q++ DA N + E A KI G N   RG IV V++      P 
Sbjct  232   ESRRPSEERSGNIFSGLDEQLLADAFNVNVEVARKIKGQND-NRGLIVSVERDFELLFPP  290

Query  1080  rpekrrqpgrqgggSS-----------------NALEETLCTATFTQNIDNRERADIYDS  1208
             R  +  +  R+                      N +EET CTA    NI++  RAD+++ 
Sbjct  291   RSAEEERREREEETQKQLEGTGYRPGGGQGRFVNGVEETFCTARLVHNINDPSRADVFNP  350

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             RAGRLT +N   LP LSY++LS  +
Sbjct  351   RAGRLTNINGQDLPILSYIQLSVQK  375


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 53/96 (55%), Gaps = 10/96 (10%)
 Frame = +1

Query  118  FNGCFG----------RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHE  267
            F  CFG          R   F  Q SQ + C+L +I+A+ P+  I +E G T+ WD N E
Sbjct  17   FQTCFGQLEQLTTENRRPWQFRDQRSQQDACRLERINAVEPSRRIQSEAGVTDIWDENDE  76

Query  268  QFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            QF+C G  A RH IQ  GL LP Y + P + YVLQG
Sbjct  77   QFRCAGVVAMRHTIQERGLLLPLYANGPKLIYVLQG  112



>gb|ABK80754.1| 11S globulin precursor isoform 3A [Ficus pumila var. awkeotsang]
Length=493

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 134/261 (51%), Gaps = 46/261 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE--ILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREP  809
             G G  G++ PGC ET+++ ++G+    LD++Q IR+  +GDII IPA   +W YN    P
Sbjct  100   GRGVLGMMFPGCPETFEEPQQGTSRYSLDRHQNIRHVREGDIIAIPAGVAYWCYNDGDSP  159

Query  810   TILVVLQRAN---------PVSFFLAGKPGS----SHq---------gqreqgrqqqeLM  923
             T+ V L   +         P  F+LAG P +    SH+          Q+ + +++ E  
Sbjct  160   TVSVTLLDVSNHENQLDRFPRRFYLAGNPHNEFLQSHRSREQYYREGSQQHERQREGEQQ  219

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpe  1088
              ++  Y  N+ +GF++Q +++A   D ETA +I   N R RG I+ V+       P R  
Sbjct  220   QQQGSYINNVFSGFNLQFIQEAFKVDSETARRIQSQNDR-RGSIIRVKDRLDLVRPGRSR  278

Query  1089  krrqpgrqgggSS----------------NALEETLCTATFTQNIDNRERADIYDSRAGR  1220
             + ++   +                     N +EETLCT    +NI +  RAD++  +AGR
Sbjct  279   EEQEREMRLEEQRQTEREHARQQGRGGRYNGIEETLCTMRVRENIGDPSRADVFTPQAGR  338

Query  1221  LTTLNSFTLPALSYVRLSAAR  1283
             L+ +NS+ LP L++++LSA R
Sbjct  339   LSHVNSYNLPILNWLQLSAER  359


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +1

Query  124  GCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRH  303
            GC  RR    GQ  + ++C+L+++ A  P   +  E G  E WDPNHEQ QC G    R 
Sbjct  20   GCLARRT---GQFQRQDECRLTRLEAREPDNRVQCEAGLIESWDPNHEQCQCAGVALVRT  76

Query  304  IIQPNGLFLPSYTSAPLVAYVLQG  375
             +QPNGL LPSY++AP + ++++G
Sbjct  77   TVQPNGLHLPSYSNAPQLIHIIRG  100



>ref|XP_009405244.1| PREDICTED: glutelin type-A 2-like [Musa acuminata subsp. malaccensis]
Length=468

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 119/236 (50%), Gaps = 30/236 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTI  815
             G G  G ++PGC ETYQ  ++  E  D++Q+I  + +GDII +PA   HW YN    P +
Sbjct  108   GRGIAGTVIPGCPETYQSFQQQREGGDEHQRIHSFHEGDIIALPAGVAHWCYNNGEAPVV  167

Query  816   LVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--NILA  959
              +           L R + V F LAG+   + QG             ERL      ++L 
Sbjct  168   AITVSYTSSSANQLDRQHRVRFLLAGRERRAQQGAHT---------EERLEQQKGVSLLN  218

Query  960   GFDVQIVKDALNTDRETAEKIIGGNARGRGHIV-------IVQQLP-Srpekrrqpgrqg  1115
             GF+++++ +AL+ D+E   KI   +  GRG IV       ++Q L  +  ++R+      
Sbjct  219   GFELELLAEALSVDKEVVRKIQNPDD-GRGEIVRVDRGLQLLQPLQRNEEQERQDGDDIR  277

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                SN LEE  CT  + QNI +   +D YD  AGR+T LNS   P L ++++SA R
Sbjct  278   RRESNGLEEAFCTMDYKQNIGDTTLSDQYDPNAGRITVLNSRKFPVLRFMQMSAVR  333


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ ++ A+ PT  +P+E G TE+ D NHEQF+C G    R  I P GL LPSY++AP 
Sbjct  42   RCRIERLSALEPTMRVPSEAGFTEYVDQNHEQFRCAGVAVHRRTILPRGLLLPSYSNAPS  101

Query  355  VAYVLQG  375
            + YV+QG
Sbjct  102  LVYVVQG  108



>gb|KDP26529.1| hypothetical protein JCGZ_17687 [Jatropha curcas]
Length=476

 Score =   118 bits (296),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 125/246 (51%), Gaps = 33/246 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG---SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G+G  G + PGCAETYQ+S+     S +  ++QKIR +  GDII +PA   HW YN   E
Sbjct  97    GTGMTGALFPGCAETYQESQGSGGSSRVEAQHQKIRRFRPGDIIALPAGVAHWCYNDGNE  156

Query  807   PTILV-VLQRAN--------PVSFFLAGKP---------GSSHqgqreqgrqqqeLMTER  932
             P + V VL  AN        P  F LAG P         G    G +E+    +    ER
Sbjct  157   PVVAVSVLDTANSANQLDMNPRHFNLAGNPEDEFPQLHEGRREGGSQEKYPGGRRASRER  216

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ-------QLPSrpek  1091
              G   N+  G D + V +A N D   A K+   N   RG+I+ V+       + P   ++
Sbjct  217   -GSCNNLFCGMDSRFVAEAFNIDESLARKLQSEND-NRGNIISVEDGELQVVRPPRTQQE  274

Query  1092  rrqpgrqgggSS---NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              +Q   + G  S   N LEET+C+    +NI +  RAD+Y   AGR++T+NS  LP L +
Sbjct  275   AQQQEEREGCPSGRDNGLEETICSMRIGENIADPSRADVYVPEAGRVSTVNSHNLPILRW  334

Query  1263  VRLSAA  1280
             ++LSA+
Sbjct  335   LQLSAS  340


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  187  SQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYV  366
             ++ A+ P  +I +E G  E W+PN +QFQC G    R  IQP GL LPSY++AP + Y+
Sbjct  35   DRLDALEPDNSIQSEAGVVESWNPNQDQFQCAGVAIVRLTIQPKGLLLPSYSNAPQLVYI  94

Query  367  LQGT  378
            +QGT
Sbjct  95   VQGT  98



>ref|XP_010104754.1| 11S globulin subunit beta [Morus notabilis]
 gb|EXC01804.1| 11S globulin subunit beta [Morus notabilis]
Length=490

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/262 (33%), Positives = 122/262 (47%), Gaps = 39/262 (15%)
 Frame = +3

Query  612   GYFLPFSTGS-------------GEYGIIVPGCAETYQQSEKGSEILDKYQ--KIRYYEK  746
             G  LPF T +             G  G ++PGC ETY+  +       + Q  K+R   +
Sbjct  96    GLLLPFFTNAPDLTYIIQGMYSRGIQGAVIPGCPETYESGQSQQSQRSQQQHQKVREIRE  155

Query  747   GDIIVIPASAVHWFYNQNREPTILV----VLQRANPVS-----FFLAGKPGSSHqgqreq  899
             GDI+  PA    WFYN    P +LV    V  +AN +      F L G P    + ++E 
Sbjct  156   GDIVAAPAGVAQWFYNNGDSPLVLVSFVDVGNQANQLDLTARRFHLGGNPQKDQRTEQEM  215

Query  900   grqqqeLMTE-----RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV  1064
               Q +   +E     R   +GNI +GFDV+I+ ++ N D E A K+   N R R  IV V
Sbjct  216   RLQSRSRRSEKGAGERRNPNGNIFSGFDVKILAESFNIDTELARKLQSKNDR-RERIVRV  274

Query  1065  Q---------QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAG  1217
             +         ++     +            N +EET CT     NID   RADI++ R G
Sbjct  275   RDELQILSPSRIHEEERRHEYRRGYDYEEYNGMEETFCTLRMRHNIDRPSRADIFNPRGG  334

Query  1218  RLTTLNSFTLPALSYVRLSAAR  1283
             RLTT+NSF LP L +++L+A R
Sbjct  335   RLTTVNSFNLPILRFLQLTAER  356


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWD-PNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAP  351
            +C+L +++A++P+  + +E G +E+WD  N ++ QC G  A RH I   GL LP +T+AP
Sbjct  47   ECRLDRLNALQPSRRVESEAGISEYWDLENEDELQCAGVSAVRHTIHRRGLLLPFFTNAP  106

Query  352  LVAYVLQGTY  381
             + Y++QG Y
Sbjct  107  DLTYIIQGMY  116



>gb|AIA57961.1| seed storage protein 2, partial [Jatropha curcas]
Length=392

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 120/260 (46%), Gaps = 50/260 (19%)
 Frame = +3

Query  651   GIIVPGCAETYQQ------------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G + PGC ET+Q              E+ S   D++QK+R   +GD+I +PA    W YN
Sbjct  1     GAVFPGCPETFQSPSEPQERYGFGAGERESRRFDQHQKVRSLRQGDVIALPAGVAQWIYN  60

Query  795   QNREPTILV-VLQRANPV--------SFFLAGKPGSSHqgqreqgrqqqeLMTERLG---  938
               R P +LV ++   N          +FFLAG P    Q +R   R  +  +  R     
Sbjct  61    SGRTPLVLVQIIDTGNAANQLDENHRAFFLAGNPQRDVQSKRCAFRGSRMPLAGRESRRP  120

Query  939   ---YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekr  1094
                  GNI +G D Q++ DA N + E A KI G N   RG IV V++      P R  + 
Sbjct  121   SEERSGNIFSGLDEQLLADAFNVNVEVARKIKGQND-NRGLIVSVERDFELLFPPRSAEE  179

Query  1095  rqpgrqgggSS-----------------NALEETLCTATFTQNIDNRERADIYDSRAGRL  1223
              +  R+                      N +EET CTA    NI++  RAD+++ RAGRL
Sbjct  180   ERREREEETQKQLEGTGYRPGGGQGRFVNGVEETFCTARLVHNINDPSRADVFNPRAGRL  239

Query  1224  TTLNSFTLPALSYVRLSAAR  1283
             T +N   LP LSY++LS  +
Sbjct  240   TNINGQDLPILSYIQLSVQK  259



>ref|XP_006370927.1| hypothetical protein POPTR_0019s01830g [Populus trichocarpa]
 gb|ERP48724.1| hypothetical protein POPTR_0019s01830g [Populus trichocarpa]
Length=495

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 122/260 (47%), Gaps = 53/260 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----DKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGC ET+Q S   S+       D++QK+R   +GD++ +P+    WFYN  
Sbjct  111   GRGIQGAVFPGCPETFQSSGNSSQDRRESSEDQHQKVRQVREGDVVALPSGVADWFYNNG  170

Query  801   REPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--  947
               P +LV +L  +NP +        FFLAG P    Q QR           +R  Y+G  
Sbjct  171   DSPLVLVQLLDTSNPANQLDQDFREFFLAGNPRQESQSQRSSY--------QRGQYEGQH  222

Query  948   -----------------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--  1070
                              N+ +GF+ +I+ +A N D + A ++   N   RG IV  Q   
Sbjct  223   GRQYEDESRREQHERSRNVFSGFNERILAEAFNIDTKLARRMQNEND-NRGIIVRAQHEL  281

Query  1071  ---------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRL  1223
                           ++  +   +     N +EET CTA    NI++ E AD+++ RAGRL
Sbjct  282   QVISPRQSQEEEERQQESRRSPRRSHEDNGVEETFCTARLKLNINDPEDADVFNPRAGRL  341

Query  1224  TTLNSFTLPALSYVRLSAAR  1283
             TT+NS  LP L YV+LSA R
Sbjct  342   TTVNSLNLPILRYVQLSAER  361


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 9/95 (9%)
 Frame = +1

Query  118  FNGCFGRRQ---SFHGQESQNE------KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQ  270
            FN CF + +   S HGQ+ Q +      +CQ+ +I+A+ P   I +E G TE WD N EQ
Sbjct  17   FNCCFAQIEQVSSRHGQQQQRQRRSQRSECQIDRINALEPARKIRSEAGVTEIWDENDEQ  76

Query  271  FQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            FQC G    RH I   GL LP+Y++ P + YV QG
Sbjct  77   FQCAGVVVIRHTINNRGLLLPAYSNTPKLIYVEQG  111



>gb|ABM66807.1| 11S globulin [Amaranthus hypochondriacus]
Length=487

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 124/254 (49%), Gaps = 43/254 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE---------------------KGSEILDKYQKIRYYEKGD  752
             G+G  G+++P C +TY+                        +G    D++QKIR+  +GD
Sbjct  101   GNGITGMMIPACPQTYESGSQQFQGGEDERIREQGSRKFGMRGDRFQDQHQKIRHLREGD  160

Query  753   IIVIPASAVHWFYNQNREPTILVVL----QRAN------PVSFFLAGKPGSSHqgqreqg  902
             I  +PA   HW Y+    P + V+L      AN      P   +LAGKP   H G+ +  
Sbjct  161   IFAMPAGVFHWAYHNGDHPLVPVILIDTANHANQLDKNFPTRSYLAGKPQQEHSGEHQFS  220

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSr  1082
             R+ +    ER    GNI  GF+ +++ ++     E A+K+       RG+IV VQ+    
Sbjct  221   RESRR--GER--NTGNIFRGFETRLLAESFGVSEEIAQKL-QAEQDDRGNIVRVQEGLHV  275

Query  1083  pekrrqpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
              +   +   +    S       N +EET+C+A    N+D+  +AD+Y   AGRLTT+NSF
Sbjct  276   IKPPSRAWEEREQGSRGSRYLPNGVEETICSARLAVNVDDPSKADVYTPEAGRLTTVNSF  335

Query  1242  TLPALSYVRLSAAR  1283
              LP L ++RLSAA+
Sbjct  336   NLPILRHLRLSAAK  349


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +1

Query  118  FNGCFG--RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAY  291
            FNGC G  R + F     Q  +CQ+ ++ A+ PT  I AE G TE WD N ++F+C G  
Sbjct  18   FNGCMGEGRFREFQ----QGNECQIDRLTALEPTNRIQAEAGLTEVWDSNEQEFRCAGVS  73

Query  292  AFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
              R  I+P+GL LPS+TSAP + Y+ QG 
Sbjct  74   VIRRTIEPHGLLLPSFTSAPELIYIEQGN  102



>ref|XP_002533465.1| legumin B precursor, putative [Ricinus communis]
 gb|EEF28917.1| legumin B precursor, putative [Ricinus communis]
Length=403

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 119/256 (46%), Gaps = 37/256 (14%)
 Frame = +3

Query  615   YFLPFSTGSGEYGIIVPGCAETYQQSE--------KGSEILDKYQKIRYYEKGDIIVIPA  770
             +F   + G G  G + PGC ETYQ           +G    D++QK+R    GD+I + A
Sbjct  6     FFFMVNAGRGIQGSVFPGCPETYQSPSESESESRGQGQSRRDQHQKVRQIRAGDVIALHA  65

Query  771   SAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKP----GSSHqgqreqgrqq  911
                 W YN  R P +LV ++  +NP +        FFLAG P     S          + 
Sbjct  66    GVAQWIYNNGRSPLVLVQIIDTSNPANQLDQNHREFFLAGNPQREVQSQRGESGRTRIRG  125

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-------  1070
             Q   T +     NI +G D Q++ +A N + + A K+ G N   RG IV V+        
Sbjct  126   QSTGTGQQERSRNIFSGIDEQMIAEAFNINVDLARKMRGEND-NRGIIVSVEHDLEMLAP  184

Query  1071  --------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLT  1226
                          E +RQ  R   GS N LEET CTA    +I+N  +ADIY+ RAGR+T
Sbjct  185   QRSQEEERQEREEEAQRQLERGREGSYNGLEETFCTARMKHSINNPSQADIYNPRAGRVT  244

Query  1227  TLNSFTLPALSYVRLS  1274
              LN+   P L Y++LS
Sbjct  245   NLNNHNFPILRYLQLS  260



>ref|XP_009777915.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana sylvestris]
Length=518

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 127/256 (50%), Gaps = 41/256 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-----------QSEKGSEIL----DKYQKIRYYEKGDIIVIPA  770
             GSG  G ++PGCAETY+           +S +G        D++QK+R + +GD++ +PA
Sbjct  115   GSGLLGSVIPGCAETYESRQRERGMRGEESREGERQFRSGGDQHQKVRQFREGDVLALPA  174

Query  771   SAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKPGSS-------Hqgqreqg  902
                 WFYN  +E  + V +L  +NP +        FFLAG P  S        +  R + 
Sbjct  175   GVTLWFYNNGQERLVTVALLDTSNPANQLDLHFRHFFLAGNPNPSGQSGSRYEEEIRGRR  234

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL---  1073
              Q+Q    ++    GN+  GFD  ++ D  N D E    + G   + RG I+ V++    
Sbjct  235   EQEQGEQQQQRRQTGNLFDGFDQNLLADVFNVDPELVRNLQGREDQ-RGRIIRVERFDVL  293

Query  1074  -PSrpekrrqpgrqgg-----gSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLN  1235
              P   E+  Q   +          N LEET+CT    +N+    RAD+Y+ R GR++TLN
Sbjct  294   SPEFEEREEQRPSREREGRGGSQPNGLEETICTMRLGENLGRPSRADVYNPRGGRISTLN  353

Query  1236  SFTLPALSYVRLSAAR  1283
             S  LP L++++LSA R
Sbjct  354   SHKLPILNWLQLSAER  369


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +1

Query  118  FNGCFGR---RQSF----------HGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDP  258
            FNGCF +   +Q F          H +     +C++  ++A  PT    +E GTTEFWD 
Sbjct  17   FNGCFAQIEQQQRFLWQKLQQQQQHRRGRARTECRIQSLNAREPTYKFDSEAGTTEFWDR  76

Query  259  NHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            N+E+F+C G  A R++IQP GL LP Y +AP + Y++QG+
Sbjct  77   NNEEFECAGVAAVRNVIQPQGLLLPHYNNAPQLLYIVQGS  116



>ref|XP_010556853.1| PREDICTED: 12S seed storage protein CRB-like [Tarenaya hassleriana]
Length=479

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 109/231 (47%), Gaps = 27/231 (12%)
 Frame = +3

Query  633   TGSGEYGIIVPGCAETYQQSE----KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
              G G  G ++PGCAET+  S     +G    D +QK+ +  +GD I  PA    W +N  
Sbjct  127   NGRGLMGRVIPGCAETFMDSAGGQWQGQGFRDMHQKVEHLRRGDTIANPAGISQWIHNNG  186

Query  801   REPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
              EP I+V           L R NP +F LAG                  L   +     N
Sbjct  187   NEPLIIVSVFDIGNNQNQLDR-NPRAFHLAGNNPQGQVW----------LRKSQQEPQNN  235

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggSSN  1130
             + +GFD Q++  A      TA+++       RG+IV VQ  P    +    G Q     N
Sbjct  236   MFSGFDPQVLAQAFKIKLNTAQQL-QNQKDNRGNIVRVQG-PFGVIRPPVRGEQRQEQDN  293

Query  1131  ALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              LEET CT   T N+D+  RAD+Y  + G ++TLNS+TLP L ++RLSA R
Sbjct  294   GLEETFCTMRCTDNLDDPSRADVYKPQLGYISTLNSYTLPMLRFLRLSALR  344


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++ + P+  +  E G  E WD +  Q +C G    R +I+P GL+LP+Y +AP 
Sbjct  62   ECQLDQLNVLEPSHVLKCEAGRIEIWDHHAPQLRCSGVSFDRIVIEPQGLYLPTYFNAPK  121

Query  355  VAYVLQG  375
            +++V+ G
Sbjct  122  LSFVVNG  128



>ref|XP_004247735.1| PREDICTED: 11S globulin subunit beta [Solanum lycopersicum]
Length=509

 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 128/250 (51%), Gaps = 35/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-------------QSEKGSEIL---DKYQKIRYYEKGDIIVIP  767
             GSG  G ++PGCAET++             +SE GS+     D++QK+R + +GD++ +P
Sbjct  112   GSGILGTVIPGCAETFESPQRERSMRGEEGRSEGGSQYRTGGDRHQKVRRFRQGDVLALP  171

Query  768   ASAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKP------GSSHqgqreqg  902
             A    W YN  +E  + V +L  +NP +        FFLAG P      GS ++ +    
Sbjct  172   AGITLWLYNNGQEQLVTVALLDVSNPANQLDLQFRHFFLAGNPNPKGLSGSRYEEEIRSR  231

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL---  1073
             +Q ++    +    GN+  GFD+ I+ +  N D+  A K + G    RG I+  + L   
Sbjct  232   KQHEQGGQPQQQQPGNLFDGFDLDILAEVFNVDQNLA-KNLQGREDQRGQIIRAENLDVL  290

Query  1074  PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                 E+ +      G   N LEET+C     +N+    RAD+Y+ R GR++TLNS  LP 
Sbjct  291   SPEFEEEQPHRPGRGSRPNGLEETICAMRLRENLGRTSRADVYNPRGGRVSTLNSHKLPI  350

Query  1254  LSYVRLSAAR  1283
             L++++LSA +
Sbjct  351   LNWLQLSAEK  360


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 13/100 (13%)
 Frame = +1

Query  118  FNGCFGR---RQSFHGQESQNEK----------CQLSQIHAIRPTGNIPAEGGTTEFWDP  258
            F+ CF +   +QSF  Q+ Q ++          C++S + A  PT    +E GTTEFWD 
Sbjct  14   FSCCFSQIEQQQSFLWQKLQYQQQHRRGRAKTDCRISSLSAREPTYKFNSEAGTTEFWDR  73

Query  259  NHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            N E+F+C G  A R+ IQPNGL LP Y +AP + Y++QG+
Sbjct  74   NSEEFECAGVAAVRNEIQPNGLLLPHYNNAPQLLYIVQGS  113



>gb|ABK80755.1| 11S globulin precursor isoform 3B [Ficus pumila var. awkeotsang]
Length=487

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 129/255 (51%), Gaps = 40/255 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE--ILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREP  809
             G G  G + PGC ET+++S++G+     D++QK+    +GD++ +PA   +W YN   +P
Sbjct  100   GRGVVGTLFPGCPETFEESQRGTSQSSQDRHQKVHRIREGDVLALPAGVAYWSYNDGDQP  159

Query  810   TILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgr-----------qqqeLMTE  929
              ++V L   +         P  F+LAG P       R Q +           ++++   E
Sbjct  160   LVVVSLFDVSNHENQLDRFPRRFYLAGNPHQEFLKSRRQEQYGEQGSQQERRREEQQQQE  219

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------------  1067
             +  Y  N+ +GF++Q +++A   D ETA +I     R RG I+ V+              
Sbjct  220   QGSYINNVFSGFNLQFIQEAFKVDTETARRIQSQKDR-RGSIIRVKEKLDFVRPSTSREE  278

Query  1068  ---QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
                ++    +++ +         N LEET CT +  +NI +  RAD++  +AGRL+++NS
Sbjct  279   QEHEMRQEEQRQTERQFAREQGHNGLEETFCTMSLRENIGDPSRADVFSPQAGRLSSVNS  338

Query  1239  FTLPALSYVRLSAAR  1283
             + LP L++++LSA R
Sbjct  339   YNLPILNWLQLSAER  353


 Score = 86.7 bits (213),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC  RR    GQ  + ++CQL+++ A  P   +  EGG  E W+PNHEQFQC G    
Sbjct  18   FHGCSARRT---GQFQRQDECQLNRLEAREPDNRLQCEGGLLESWNPNHEQFQCVGVALV  74

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQPNGL LPSYT++P + ++++G
Sbjct  75   RLTIQPNGLHLPSYTNSPQLVHIVRG  100



>ref|XP_002532028.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF30344.1| legumin A precursor, putative [Ricinus communis]
Length=461

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 122/236 (52%), Gaps = 22/236 (9%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTI  815
             G G  G + PGCAET+Q+S++     D++QKI ++ +GD+I + A   HW YN   EP I
Sbjct  93    GRGMIGTLFPGCAETFQESQESGRTQDQHQKIHHFREGDVIALAAGVAHWCYNDGNEPVI  152

Query  816   LVVL---------QRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG-----NI  953
              V +            NP +F LAG P +  Q  ++ G + +   + + G        N+
Sbjct  153   TVTVIDTTNIANQLDMNPRNFHLAGNPENEFQKFQQAGERGRREYSHQGGKGQQGSCRNL  212

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV-------IVQQLPSrpekrrqpgrq  1112
               G D +++ ++ N D + A K+ G N   RG IV       +V+   +  E+  +  + 
Sbjct  213   FCGIDTRLISESFNIDEQLATKLQGQNDF-RGSIVKVEGGLRVVRPPRTEQERLEEEEQG  271

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAA  1280
              GGS N LEET CT    +NI +  RAD+Y    GR++T+NS  L  L  ++LSA+
Sbjct  272   QGGSYNGLEETFCTMRIKENIADPSRADVYVPEVGRVSTVNSNNLRILRLLQLSAS  327


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 9/86 (10%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+G F R Q+         +CQL ++ A+ P   I  + G  E W+PNH QFQC G    
Sbjct  17   FHGSFARLQN---------ECQLDRLDALEPDNRIQCDAGMVEVWNPNHGQFQCAGVAMV  67

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            RH I+P GL LPSY++AP + Y+++G
Sbjct  68   RHTIEPRGLVLPSYSNAPQLTYIVKG  93



>ref|XP_006370926.1| legumin family protein [Populus trichocarpa]
 gb|ERP48723.1| legumin family protein [Populus trichocarpa]
Length=495

 Score =   116 bits (290),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/252 (33%), Positives = 121/252 (48%), Gaps = 37/252 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----DKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGC ET+Q S   S+       D++QK+R   +GD++ +P+    WFYN  
Sbjct  111   GRGIQGAVFPGCPETFQSSGNSSQDRRESSEDQHQKVRQVREGDVVALPSGVADWFYNNG  170

Query  801   REPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--  947
               P +LV +L  +NP +        FFLAG P    Q QR   ++ Q        YD   
Sbjct  171   DSPLVLVQLLDTSNPANQLDQDFREFFLAGNPRQESQSQRSSYQRGQYEGQHGRQYDDES  230

Query  948   ---------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----------  1070
                      N+ +GF+ +I+ +A N D + A ++   N   RG IV  Q           
Sbjct  231   RREQHERSRNVFSGFNERILAEAFNIDTKLARRMQNEND-NRGIIVQAQHELQVISPRQS  289

Query  1071  -LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
                   ++  +   +     N +EET CTA    NI++ E AD+++ RAGRLT +NS  L
Sbjct  290   QEEEERQQESRRSTRRHHEDNGVEETFCTARLKLNINDPEDADVFNPRAGRLTAVNSLNL  349

Query  1248  PALSYVRLSAAR  1283
             P L +V+LSA R
Sbjct  350   PILRHVQLSAER  361


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +I+A+ P   + +E G TE WD N +QFQC G    RH I   GL LP+Y++ P 
Sbjct  45   ECQIDRINALEPARKVRSEAGVTEIWDENDDQFQCAGVVVIRHTINNRGLLLPAYSNTPK  104

Query  355  VAYVLQG  375
            + YV QG
Sbjct  105  LIYVEQG  111



>gb|ABW86979.1| 11S legumin protein [Carya illinoinensis]
Length=505

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 129/269 (48%), Gaps = 52/269 (19%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWF  788
             + G G  G++ PGC ET+++S++ S+         D++QKIR++ +GDII  PA   HW 
Sbjct  100   ARGRGITGVLFPGCPETFEESQRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWC  159

Query  789   YNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + + L            NP +F+LAG P    + Q +Q  +Q     +    
Sbjct  160   YNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQR  219

Query  942   DG-----------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--QLP--  1076
              G           N+ +GFD + + DA N D ETA ++   N   RG IV V+  QL   
Sbjct  220   RGEHGEQQRDLGNNVFSGFDAEFLADAFNVDTETARRLQSENDH-RGSIVRVEGRQLQVI  278

Query  1077  --------------------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERAD  1196
                                       R+  R+GG   N LEET+CT +  +NI +  RAD
Sbjct  279   RPRWSREEQEHEERKERERERESGSERRQSRRGGRDDNGLEETICTLSLRENIGDPSRAD  338

Query  1197  IYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             IY   AGR++T+NS  LP L +++LSA R
Sbjct  339   IYTEEAGRISTVNSHNLPILRWLQLSAER  367


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = +1

Query  118  FNGCF----GRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGG  285
            FNGC     GR+Q   GQ      CQL+++ A+ PT  I AE G  E WDPNH+Q QC G
Sbjct  19   FNGCLAQSGGRQQHKFGQ------CQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAG  72

Query  286  AYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
                R  I+PNGL LP Y++AP + Y+ +G
Sbjct  73   VAVVRRTIEPNGLLLPHYSNAPQLVYIARG  102



>gb|ABW86978.1| 11S legumin protein [Carya illinoinensis]
Length=505

 Score =   115 bits (289),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 130/269 (48%), Gaps = 52/269 (19%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWF  788
             + G G  G++ PGC ET+++S++ S+         D++QKIR++ +GDII  PA   HW 
Sbjct  100   ARGRGITGVLFPGCPETFEESQRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWC  159

Query  789   YNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + + L            NP +F+LAG P    + Q +Q  +Q     +    
Sbjct  160   YNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQR  219

Query  942   DG-----------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--QLP--  1076
              G           N+ +GFD + + DA N D ETA ++   N   RG IV V+  QL   
Sbjct  220   RGEHGEQQRDLGNNVFSGFDAEFLADAFNVDTETARRLQSENDH-RGSIVRVEGRQLQVI  278

Query  1077  --------------------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERAD  1196
                                    E  R+  R+GG   N LEET+CT +  +NI +  RAD
Sbjct  279   RPRWSREEQEHEERKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRAD  338

Query  1197  IYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             IY   AGR++T+NS  LP L +++LSA R
Sbjct  339   IYTEEAGRISTVNSHNLPILRWLQLSAER  367


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = +1

Query  118  FNGCF----GRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGG  285
            FNGC     GR+Q   GQ      CQL+++ A+ PT  I AE G  E WDPNH+Q QC G
Sbjct  19   FNGCLAQSGGRQQHKFGQ------CQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAG  72

Query  286  AYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
                R  I+PNGL LP Y++AP + Y+ +G
Sbjct  73   VAVVRRTIEPNGLLLPHYSNAPQLVYIARG  102



>ref|XP_002524198.1| legumin B precursor, putative [Ricinus communis]
 gb|AAF73007.1|AF262998_1 legumin-like protein [Ricinus communis]
 gb|EEF38213.1| legumin B precursor, putative [Ricinus communis]
Length=476

 Score =   115 bits (288),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 122/243 (50%), Gaps = 29/243 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG---SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G  G+++PGCAET Q+S++    S + D++QKIR++ KGD+I +PA   HW YN   E
Sbjct  98    GRGMTGVLLPGCAETLQESQQSGGSSRVRDQHQKIRHFRKGDVIALPAGVAHWCYNDGNE  157

Query  807   PTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD-----  944
             P + + VL  A        NP  F+LAG              ++ +    R         
Sbjct  158   PVVTISVLDTANIGNQLDRNPRDFYLAGNTEDVFPRLPRGDYERGQHQFSRRPSQPPHVS  217

Query  945   -GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV------IVQQLPSrpekrrqp  1103
               N+  G D +++ +A N D + A K + G +  RG IV      +V + P   ++R + 
Sbjct  218   CNNLFCGIDSRVLAEAFNVDEQLARK-LQGQSDFRGSIVNVEGRLLVVRPPRTQQEREEQ  276

Query  1104  grqgggSS----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +         N +EET CT    +NI +  R+D++    GR++T+NS  LP L +++L
Sbjct  277   REREQEGRPGRYNGVEETFCTMRMKENIADPSRSDVFVPEVGRVSTVNSHNLPILRWLQL  336

Query  1272  SAA  1280
             SA+
Sbjct  337   SAS  339


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  124  GCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRH  303
            G   RR+   G E     CQL++++A+ P   I  E G  E W+PN +QFQC G    R 
Sbjct  20   GSLARREFQQGNE-----CQLNKLYALEPDKRIQTEAGLVESWNPNRDQFQCAGVAVVRR  74

Query  304  IIQPNGLFLPSYTSAPLVAYVLQG  375
             I PNGL LPSY++AP + YV+QG
Sbjct  75   TIHPNGLLLPSYSNAPQLLYVVQG  98



>ref|XP_010045998.1| PREDICTED: legumin A-like [Eucalyptus grandis]
 gb|KCW84737.1| hypothetical protein EUGRSUZ_B01551 [Eucalyptus grandis]
Length=503

 Score =   115 bits (288),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 121/262 (46%), Gaps = 48/262 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK-----------------GSEILDKYQKIRYYEKGDIIVI  764
             G+G  G ++PGC ET+Q S++                 G    D++QKI  + +GD+I +
Sbjct  105   GNGILGTVIPGCPETFQSSQQSQFGPQFGQGGQMRGGEGQRFQDQHQKISRFRQGDVIAL  164

Query  765   PASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqe  917
             P     W YN    P I V L            NP  FFLAG P   H+   +Q + ++ 
Sbjct  165   PTGVAQWVYNDGNRPIIAVTLLDVTNNENQLDINPRRFFLAGNPQDEHEQGGQQRQGRRP  224

Query  918   LMTERLGYDG-------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---  1067
                + LG +G       N+  GFD + + +A N D ETA ++   N   R +IV V+   
Sbjct  225   QQRQ-LGEEGQQRGQCNNVFCGFDARFLAEAFNVDLETARRLQNEND-NRNNIVRVEGGL  282

Query  1068  ----------QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAG  1217
                             E+ R+    G    N LEETLCT    +NI +  RAD+Y  +AG
Sbjct  283   QVVRPPREHGGRGWEEERERERYGGGRYDVNGLEETLCTMRLRENIGDPSRADVYTQQAG  342

Query  1218  RLTTLNSFTLPALSYVRLSAAR  1283
              ++ LNS  LP L +++LSA +
Sbjct  343   HISALNSHKLPILYWLQLSAEK  364


 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQE---SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGA  288
            F+GC GR++    Q+    +  +C++ ++ A+ PT  I  E G  E WDPNHE FQC G 
Sbjct  17   FHGCLGRQRYGASQQHSLREQGECRIDRLDALEPTNRIQCEAGVVESWDPNHEMFQCAGI  76

Query  289  YAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
               RHII+PNGL LPS+T++P + Y+++G 
Sbjct  77   AVVRHIIEPNGLVLPSFTNSPQLTYIVEGN  106



>ref|XP_009603583.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=521

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 130/259 (50%), Gaps = 44/259 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL---------------DKYQKIRYYEKGDIIVIPA  770
             GSG  G ++PGCAETY+  E+   +                D++QK+R + +GD++ +PA
Sbjct  115   GSGVLGTVIPGCAETYESPERERSMRGEESREGERQYRTGGDQHQKVRQFRQGDVLALPA  174

Query  771   SAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGKP------GSSHqgq--req  899
                 WFYN  +E  + V +L  +NP +        FFLAG P      GS ++ +    +
Sbjct  175   GITLWFYNNGQERLVTVALLDTSNPANQLDLQFRHFFLAGNPNPRGQSGSRYEEEIRGRR  234

Query  900   grqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP-  1076
              ++Q E   ++    GN+  GFD  ++ D  N D E    + G   + RG I+ V++   
Sbjct  235   EQEQGEQQQQQRRQTGNLFDGFDQNLLADVFNVDPELVRNLQGREDQ-RGRIIRVERFDV  293

Query  1077  ----------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLT  1226
                        R   RR+   + G   N LEET+CT    +N+    RAD+Y+ R GR++
Sbjct  294   LSPEFEEREEERRPSRREREGRRGSEPNGLEETICTMRLKENLGQPSRADVYNPRGGRIS  353

Query  1227  TLNSFTLPALSYVRLSAAR  1283
             +LNS  LP L++++LSA R
Sbjct  354   SLNSHKLPILNWLQLSAER  372


 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +1

Query  118  FNGCFGR---RQSF----------HGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDP  258
            FNGCF +   +Q F          H +     +C++  ++A  PT    +E GTTEFWD 
Sbjct  17   FNGCFAQIEQQQRFLWQKLQQQQQHRRGRARTECRIQSLNAREPTYKFDSEAGTTEFWDR  76

Query  259  NHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            N+E+F+C G  A R++IQP GL LP Y +AP + Y++QG+
Sbjct  77   NNEEFECAGVAAVRNVIQPQGLLLPHYNNAPQLLYIVQGS  116



>gb|AIA57957.1| beta-globulin B1 [Jatropha curcas]
Length=508

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 120/265 (45%), Gaps = 50/265 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ------------SEKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             G G +G + PGC ET+Q              E+ S   D++QK+R   +GD+I +PA   
Sbjct  112   GRGIHGAVFPGCPETFQSPSEPQERYGFGAGERESRRFDQHQKVRSLRQGDVIALPAGVA  171

Query  780   HWFYNQNREPTILV-VLQRANPV--------SFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              W YN  R   +LV ++   N          +FFLAG P    Q +R   R  +  +  R
Sbjct  172   QWIYNSGRTSLVLVQIIDTGNAANQLDENHRAFFLAGNPQRDVQSKRCAFRGSRMPLAGR  231

Query  933   LG------YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPS  1079
                       GNI +G D Q++ DA N + E A KI G N   RG IV V++      P 
Sbjct  232   ESRRPSEERSGNIFSGLDEQLLADAFNVNVEVARKIKGQND-NRGLIVSVERDFELLFPP  290

Query  1080  rpekrrqpgrqgggSS-----------------NALEETLCTATFTQNIDNRERADIYDS  1208
             R  +     R+                      N +EET C A    NI++  RAD+++ 
Sbjct  291   RSAEEEGREREEETQKQLEGTGYRPGGGQGRFVNGVEETFCAARLVHNINDPSRADVFNP  350

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             RAGRLT +N   LP LSY++LS  +
Sbjct  351   RAGRLTNINGQDLPILSYIQLSVQK  375


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = +1

Query  118  FNGCFG----------RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHE  267
            F  CFG          R   F  Q SQ + C+   I+A+ P+  I +E G T+ WD N +
Sbjct  17   FQTCFGQLEQLTTENRRPWQFRDQRSQQDACRHECINAVEPSRRIQSEAGVTDIWDENDK  76

Query  268  QFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            QF+C G  A RH IQ  GL LP Y + P + YVLQG
Sbjct  77   QFRCAGVVAMRHTIQERGLLLPLYANGPKLIYVLQG  112



>ref|XP_010542895.1| PREDICTED: 12S seed storage protein CRD [Tarenaya hassleriana]
Length=449

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 113/237 (48%), Gaps = 39/237 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS-----EKGSEIL-DKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G++ PGC ETY +      E G     D +QK+  + +G +  + A   HW YN 
Sbjct  100   GEGVMGMVRPGCPETYDEGGMEAGETGRRRFGDMHQKVENFRRGHVFALLAGISHWCYNN  159

Query  798   NREPTILVVL----QRAN-----PVSFFLAG------KPGSSHqgqreqgrqqqeLMTER  932
                P ++V+L     R N     P  F +AG      + G  H     +           
Sbjct  160   GDSPVVIVLLLDITNRDNHLDQKPRVFQIAGSGERGGRTGKGHVWVSSK-----------  208

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
                  NI +GFD +I+ +A   D +TA+K+       RG+IV V+         R    +
Sbjct  209   -----NIFSGFDPKIIAEAFKIDLQTAKKL-QSQRDDRGNIVRVKG-KLHFVSPRIEQGR  261

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N +EET+C+A   +NID+  RAD Y SRAGR++TLNSFTLP L  VRL+A R
Sbjct  262   AWERDNGVEETICSARMHENIDDPSRADFYSSRAGRISTLNSFTLPVLRLVRLNAVR  318


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = +1

Query  127  CFGRRQSFHGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGA  288
            C      F G E++ ++      C+  +++++ PT     EGG  EFWD    + +CGG 
Sbjct  12   CLALLVIFDGGETRQQEVPLTSACRFERLNSLEPTETAEMEGGRMEFWDHTSPELRCGGV  71

Query  289  YAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
               R  I+P  +FLPS+ ++P +AYV+QG
Sbjct  72   AMARVTIEPKSIFLPSFFTSPGLAYVVQG  100



>gb|EYU18315.1| hypothetical protein MIMGU_mgv1a0236971mg, partial [Erythranthe 
guttata]
Length=251

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 125/247 (51%), Gaps = 33/247 (13%)
 Frame = +3

Query  639   SGEYGIIVPGCAETYQQS----EKGSEIL----DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             SG +G ++PGCAETY+      E GS+      D++QK+R +  GDI+ +P    HW YN
Sbjct  1     SGIHGTVIPGCAETYESESSYEEGGSQSKGRRSDRHQKLRRFRSGDILALPQGITHWAYN  60

Query  795   QNREPTILV-VLQRANPVS--------FFLAG---KPGSSHqgqreqgrqqqeLMTERLG  938
                 P I V +L  AN  +        FFLAG   + G S +G R +         E  G
Sbjct  61    DGDTPIISVSILDVANEGNQLDLNFRKFFLAGSSREGGQSEEGGRRRQEGGSRRGREEEG  120

Query  939   YDG----NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP--------Sr  1082
               G    NI  GFD +I+ +  N D E   K+       RG IV  ++L           
Sbjct  121   ERGQRMRNIFNGFDEEILSEIFNVDSEIVRKL-QAKEDNRGFIVRAEKLDLVLPEWGREE  179

Query  1083  pekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              ++  +    GGG +N +EETLC+    QNI +  RAD Y+ R GRL++LNS TLP LS+
Sbjct  180   QQRGERRREGGGGYNNGIEETLCSMKIRQNIGHPTRADEYNPRGGRLSSLNSQTLPILSF  239

Query  1263  VRLSAAR  1283
             +RLSA R
Sbjct  240   LRLSAER  246



>gb|EYU18319.1| hypothetical protein MIMGU_mgv1a005193mg [Erythranthe guttata]
Length=493

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 129/266 (48%), Gaps = 43/266 (16%)
 Frame = +3

Query  612   GYFLPFST----------GSGEYGIIVPGCAETYQQS----EKGSEIL----DKYQKIRY  737
             G  LP+ T          GSG +G ++PGCAETY+      E GS+      D++QK+R 
Sbjct  94    GLLLPYYTNTPQLVYIIKGSGIHGTVIPGCAETYESESSYEEGGSQSKGRRSDRHQKLRR  153

Query  738   YEKGDIIVIPASAVHWFYNQNREPTILV-VLQRANP--------VSFFLAGKP---GSSH  881
             +  GDI+ +P    HW YN    P I V +L  AN           FFLAG     G S 
Sbjct  154   FRSGDILALPQGITHWAYNDGDTPIISVSILDVANEGNQLDLNFRKFFLAGSSREGGQSE  213

Query  882   qgqreqgrqqqeLMTERLGYDG----NILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
             +G R +         E  G  G    NI  GFD +I+ +  N D E   K+       RG
Sbjct  214   EGGRRRQEGGSRRGREEEGERGQRMRNIFNGFDEEILAEIFNVDSEIVRKL-QAKEDNRG  272

Query  1050  HIVIVQQLP--------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYD  1205
              IV  ++L            ++  +    GGG +N +EETLC+    QNI +  RAD Y+
Sbjct  273   FIVRAEKLDLVLPEWGREEQQRGERRREGGGGYNNGIEETLCSMKIRQNIGHPTRADEYN  332

Query  1206  SRAGRLTTLNSFTLPALSYVRLSAAR  1283
              R GRLT+LNS TLP LS++RLSA R
Sbjct  333   PRGGRLTSLNSQTLPILSFLRLSAER  358


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++ Q+ A  P+    +E G TEFWD N  +F+C G    RH+IQP GL LP YT+ P 
Sbjct  46   QCRIDQLTASEPSYTYDSEAGVTEFWDSNANEFECAGIQFVRHVIQPKGLLLPYYTNTPQ  105

Query  355  VAYVLQGT  378
            + Y+++G+
Sbjct  106  LVYIIKGS  113



>gb|KGN57905.1| hypothetical protein Csa_3G384800 [Cucumis sativus]
Length=501

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/252 (33%), Positives = 122/252 (48%), Gaps = 36/252 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS-EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPT  812
             G G  G+++PGC ETYQ+S++ + E  D++QKI +   GD+  +PA + HW YN   E  
Sbjct  110   GRGIKGVVLPGCPETYQESQQSAGEFRDRHQKIHHVRAGDLFAVPAGSAHWAYNDGNEKL  169

Query  813   ILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMTERL---GYDGNIL  956
             I VVL      AN     P +F+LAG P       R Q + +Q   + R        NI 
Sbjct  170   IAVVLLDVSNHANQLDFHPRAFYLAGNPEEEFPEWRSQWKGEQGRHSGRKEGSSNKNNIF  229

Query  957   AGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP--------------------  1076
               FD +++ + LN + E A KI GG+   R  I +  QL                     
Sbjct  230   YAFDDRVLAEILNINIELATKIRGGDDFRRNIIKVEGQLQVIRPPRSRGGRRGEEQEWEE  289

Query  1077  ---SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
                   +++R+  +      N L+ET+C+    +NI +  RAD+Y   AGRL+T NS   
Sbjct  290   EQEEEMQRQRERHQGRRWDDNGLDETICSMRMKENIGDASRADMYTPEAGRLSTTNSHRF  349

Query  1248  PALSYVRLSAAR  1283
             P L +++LSA R
Sbjct  350   PILRWLQLSAER  361


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 8/94 (9%)
 Frame = +1

Query  118  FNGCFGRRQS-------FHGQ-ESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQF  273
            FNGC    ++       ++G+ +S+  +C+L ++ A+ P+  I AEGG  E WDP+HE F
Sbjct  17   FNGCLATDENLRDVSRRYYGEGQSRYRECRLDRLDALEPSRRIEAEGGIIEMWDPSHEMF  76

Query  274  QCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            +C G    R+II PNGL LP YT+AP + YV +G
Sbjct  77   RCAGVAVQRYIIDPNGLLLPQYTNAPRLIYVERG  110



>ref|XP_006370928.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
 gb|ERP48725.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
Length=494

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 116/250 (46%), Gaps = 35/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS-----EKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGC ET+Q S     ++     D++QK+R   +GD++ +P+    WFYN  
Sbjct  111   GRGIQGAVFPGCPETFQSSGQFSRDRSQRSEDQHQKVRQVREGDVVALPSGVADWFYNDG  170

Query  801   REPTILV-VLQRANPV--------SFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--  947
               P +LV +L  +NP         +FFLAG P       +    Q+ +   +R   D   
Sbjct  171   DSPLVLVQLLDTSNPANQLDQDFRNFFLAGNP-QRELQSQRSSYQRDQFEGQRERQDEGE  229

Query  948   ----------NILAGFDVQIVKDALNTDRETAEKI--------IGGNARGRGHIVIVQQL  1073
                       N+  GFD +I+ +A N D   A  +        I   A     +V   Q 
Sbjct  230   SRRHQQDRHRNVFGGFDEKILAEAFNIDTRLARSMRNEKDNRGIIVRAEHELQVVSPHQS  289

Query  1074  PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                 E+  +     GG  N +EET CTA    NI++ ERAD ++ RAGRLTT+NS  LP 
Sbjct  290   REEEEREIEYRGGRGGGFNGIEETFCTARLKHNINDPERADFFNPRAGRLTTVNSLNLPI  349

Query  1254  LSYVRLSAAR  1283
             L  V+LS  R
Sbjct  350   LRSVQLSVER  359


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 9/95 (9%)
 Frame = +1

Query  118  FNGCFGRRQ---SFHGQES------QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQ  270
            FN CF + +   S H Q+       Q  +CQL +I+A+ P   I +E G TE WD N EQ
Sbjct  17   FNCCFAQIEQVTSRHDQQQARRRSFQQSECQLQRINALEPARRIKSEAGVTEIWDENDEQ  76

Query  271  FQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            FQC G    RH IQ  GL LP+Y++AP + YV QG
Sbjct  77   FQCAGVAVIRHTIQQRGLLLPAYSNAPKLVYVEQG  111



>gb|AHA36627.1| Cor a 9 allergen [Corylus avellana]
Length=514

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 126/267 (47%), Gaps = 51/267 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----------DKYQKIRYYEKGDIIVIPASAVH  782
             G G  G++ PGC ET++  ++ S+             D++QKIRY+++GDII +PA   H
Sbjct  103   GRGITGVLFPGCPETFEDPQQQSQQGQGQGQSQRSEQDRHQKIRYFQEGDIIALPAGVAH  162

Query  783   WFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER-  932
             W YN    P + V L            NP  F+LAG P   HQ Q +Q   Q+    +  
Sbjct  163   WCYNDGDSPVVAVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHS  222

Query  933   ---------LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGR------GHIVIVQ  1067
                       G   N+ +GFD + + DA N D +TA ++     + R      G + +V+
Sbjct  223   RGKEGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQMVR  282

Query  1068  QLPSrpekrrqpgrqgggSS---------------NALEETLCTATFTQNIDNRERADIY  1202
                SR E  RQ  ++                    N  EET+C+    +NI +R RADIY
Sbjct  283   PERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLMENIGSRSRADIY  342

Query  1203  DSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               + GR+ T+NS TLP L +++LSA R
Sbjct  343   TEQVGRINTVNSNTLPVLRWLQLSAER  369


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQN-EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            FNGC G       Q+ ++  +C L +++A+ PT  I AE G  E WD N +QFQC G   
Sbjct  17   FNGCLGIDVGLRRQQQRHFGECNLDRLNALEPTNRIEAEAGQIESWDHNDQQFQCAGVAV  76

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQG  375
             R  I+PNGL LP Y++AP + Y+ +G
Sbjct  77   IRRTIEPNGLLLPQYSNAPELIYIERG  103



>gb|AAW29810.1| seed storage protein [Juglans regia]
Length=507

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 129/269 (48%), Gaps = 52/269 (19%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWF  788
             + G G  G++ PGC ET+++S++ S+         D++QKIR++ +GDII  PA   HW 
Sbjct  99    ARGRGITGVLFPGCPETFEESQRQSQQGQSREFQQDRHQKIRHFREGDIIAFPAGVAHWS  158

Query  789   YNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMT-----  926
             YN    P + + L            NP +F+LAG P    + Q +Q  +Q          
Sbjct  159   YNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQR  218

Query  927   ------ERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--QLP--  1076
                   ++ G   N+ +GFD   + DA N D ETA ++   N   R  IV V+  QL   
Sbjct  219   PGEHGQQQRGLGNNVFSGFDADFLADAFNVDTETARRLQSENDHRRS-IVRVEGRQLQVI  277

Query  1077  --------------------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERAD  1196
                                    E  R+  R+GG   N LEET+CT    +NI +  RAD
Sbjct  278   RPRWSREEQEREERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRAD  337

Query  1197  IYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             IY   AGR++T+NS TLP L +++LSA R
Sbjct  338   IYTEEAGRISTVNSHTLPVLRWLQLSAER  366


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC    QS   Q+ Q  +CQL+++ A+ PT  I AE G  E WDPN++QFQC G    
Sbjct  18   FNGCLA--QSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVV  75

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+PNGL LP Y++AP + Y+ +G
Sbjct  76   RRTIEPNGLLLPQYSNAPQLVYIARG  101



>ref|XP_004152049.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
 gb|KGN57907.1| hypothetical protein Csa_3G386310 [Cucumis sativus]
Length=494

 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 123/253 (49%), Gaps = 36/253 (14%)
 Frame = +3

Query  633   TGSGEYGIIVPGCAETYQQSEKGS-EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREP  809
             +G G  G+++PGC +TYQ+S+K +    D++QKIR+   GD+  +PA + HW YN   E 
Sbjct  109   SGRGIKGVVLPGCPQTYQESQKSAGAFRDQHQKIRHVRAGDLFAVPAGSAHWTYNDGNEK  168

Query  810   TILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMTERL---GYDGNI  953
              I VVL      AN     P +F+LAG P       R Q + +Q   + R        NI
Sbjct  169   LIAVVLLDVSNHANQLDFHPRAFYLAGNPEEEFPEWRSQWKGEQGRHSGRKEGSSNKNNI  228

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP-------------------  1076
                FD +++ + LN + E A K+ GG+   R  I +  QL                    
Sbjct  229   FYAFDDRVLAEILNINIELASKLRGGDDFRRNIIKVEGQLQVIRPPRSRGGRRGEEQEWE  288

Query  1077  ----SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
                    +++R+  +      N L+ET+C+    +NI +  RAD+Y   AGRL+T NS  
Sbjct  289   EEQEEEMQRQRERHQGRRWDDNGLDETICSMRMKENIGDASRADMYTPEAGRLSTTNSHR  348

Query  1245  LPALSYVRLSAAR  1283
              P L +++LSA R
Sbjct  349   FPILRWLQLSAER  361


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQ-------ESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQ  276
            FNGC   +++FH         +S+  +C+L  + A+ P+  I AEGG  E WDP+HE F+
Sbjct  18   FNGCLATKENFHDVSRRFREGQSRYRECRLDMLEALEPSRRIEAEGGVIEMWDPSHEMFR  77

Query  277  CGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            C G    R+II PNGL LP YT+AP + Y+  G
Sbjct  78   CAGVAIQRYIIDPNGLLLPQYTNAPRLMYIESG  110



>gb|KFK42732.1| hypothetical protein AALP_AA1G032500 [Arabis alpina]
Length=442

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 116/233 (50%), Gaps = 31/233 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---SEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G  G IV GC ETY++   S  G E       D +QK+  + +GD+    A    W+Y
Sbjct  99    GKGVIGTIVSGCPETYEEVEGSRGGGEDQPRRFEDMHQKLESFRRGDVFASLAGVSQWWY  158

Query  792   NQ-NREPTILVVLQRAN--------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
             N+ N +  I++VL   N        P  F +AG      Q            +T  LG  
Sbjct  159   NRGNSDVVIVMVLDVTNRENQLDQTPRMFQIAGSKTQEQQQP----------LTWPLG--  206

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggS  1124
              N+L+GFD  I+ +A   D ETA K +      RG+IV  +  P          RQ  G 
Sbjct  207   NNVLSGFDPNIIAEAFKIDIETA-KDLQNQKENRGNIVKAKG-PLHFVTPSPRQRQQDGI  264

Query  1125  SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +N +EET CTA   +NID+ ER+D + +RAGR++TLNS  LP LS VRL+A R
Sbjct  265   ANGIEETYCTARLHENIDDPERSDFFSTRAGRISTLNSLNLPVLSIVRLNAVR  317


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = +1

Query  151  HGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQ  312
            HG E++ ++      CQ S I+++ P      E G  E WD    + QC G    R  +Q
Sbjct  19   HGGEARQQESPLQHACQFSSINSLGPAQTTKFEAGQMEVWDHTSPELQCAGVTLARITLQ  78

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
             N +FLP++ S P +AYV+QG
Sbjct  79   ANSIFLPAFFSPPALAYVVQG  99



>ref|XP_004155945.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
Length=476

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 120/236 (51%), Gaps = 26/236 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G+G  G+ +PGC ETY+    +S+      D++QKIR + +GD++V+PA   HW YN+ +
Sbjct  114   GTGIRGVAMPGCPETYETDLRRSQSSGNFRDQHQKIREFREGDLLVVPAGVSHWMYNRGQ  173

Query  804   EPTILVVL-------QRANPVS--FFLAGKPGSSHqgqreqgrqqqeLMTERLG-YDGNI  953
                IL+V         + +P +  F+LAG+P         +G ++     E  G   GN+
Sbjct  174   SDLILIVFVDTRNVANQIDPFARKFYLAGRP-----EMMRRGEREGRSFRESTGEKSGNV  228

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqp-grqg  1115
              +GF  + +++AL  D     ++  G +  R  IV  ++     +P + ++ R       
Sbjct  229   FSGFADEFLEEALQIDSGLVRRL-KGESDERDRIVFAEEDFDVLMPEKDDQERSRGRYIE  287

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               S N  EET+CT     NI   E AD+++ R GRL+T N   LP L  VRLSA R
Sbjct  288   KESENGFEETVCTLRLKHNIGRSEHADVFNPRGGRLSTANFNNLPFLRQVRLSAER  343


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  118  FNGCFGRRQ-SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            F G   R+Q  FH  ++    C L  + A  P   I AE G TE W+PN+E+FQC G   
Sbjct  32   FQGSEARQQHRFHSPKA----CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAGVNM  87

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
             RH I+P GL LP +T+AP + +V+QGT
Sbjct  88   VRHTIRPKGLLLPGFTNAPKLIFVVQGT  115



>ref|XP_002524195.1| legumin B precursor, putative [Ricinus communis]
 gb|EEF38210.1| legumin B precursor, putative [Ricinus communis]
Length=476

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 125/242 (52%), Gaps = 27/242 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG---SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G  G+++ GCAET Q+S++    S + D++QKIR++ KGD+I +PA   HW YN   E
Sbjct  98    GRGMTGVLLLGCAETLQESQQSGGSSRVRDQHQKIRHFRKGDVIALPAGVAHWCYNDGNE  157

Query  807   PTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD-----  944
             P + + VL  A        NP +F+LAG              ++ +    R         
Sbjct  158   PVVTISVLDTANIGNQLDRNPRNFYLAGNTEDEFPQLPRGDYERGQHQFARRPSRPPHVS  217

Query  945   -GNILAGFDVQIVKDALNTDRETAEKIIGGNA-RG-----RGHIVIVQQLPSrpekrrqp  1103
               N+  G D +++ +A N D + A K+ G N  RG      G +++V+   S+ E+  Q 
Sbjct  218   CNNLFCGIDSRVLAEAFNVDEQLARKLQGQNDFRGSIVNVEGRLLVVRPPRSQQEREEQR  277

Query  1104  grqgggSS---NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
              R+  G     N +EET CT    +NI +  R+DI+    GR++T+NS  LP L +++LS
Sbjct  278   EREQEGRPGRYNGVEETFCTMRMKENIADPSRSDIFVPEVGRVSTVNSHNLPILRWLQLS  337

Query  1275  AA  1280
             A+
Sbjct  338   AS  339


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q   CQL++++A+ P   I  E G  E W+PN +QFQC G    R  I PNGL LPSY++
Sbjct  29   QGNGCQLNKLYALEPDKRIQTEAGLVESWNPNRDQFQCAGVAVVRRTIHPNGLLLPSYSN  88

Query  346  APLVAYVLQG  375
            AP + Y++QG
Sbjct  89   APQLLYIVQG  98



>gb|AFJ04522.1| legumin B precursor, partial [Vernicia fordii]
Length=415

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 119/252 (47%), Gaps = 38/252 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK---GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G  G + PGCAET+Q+S++    S + D++QKIR + +GDI+ +PA   HW YN   E
Sbjct  29    GRGMTGALFPGCAETFQESQQQGGSSRVQDRHQKIRRFRQGDILALPAGVAHWCYNDGNE  88

Query  807   PTILV-VLQRAN--------PVSFFLAG-------KPGSSHqgqreqgrqqqeLMTERLG  938
             P + V VL  +N        P  F+LAG       +   S +               + G
Sbjct  89    PVVAVYVLDTSNSNNQLDMSPRHFYLAGNVEEEFRQQFESGREGSRPEPYSTSRRKRQQG  148

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV------------------  1064
                N+  G D +++ +A N D   A K +   +  RG IV V                  
Sbjct  149   SCNNLFCGIDSRLLAEAFNIDLSLARK-LQSESDFRGSIVRVEGVELDIVRPARTEQERI  207

Query  1065  QQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
             +Q+    +  R P    GG  N +EET CT    +NI +  RAD++    GRL+T+NS  
Sbjct  208   EQVEPCRDGGRCPVGGAGGHCNGIEETFCTMRMRENIADPSRADVFVPEVGRLSTVNSHN  267

Query  1245  LPALSYVRLSAA  1280
             LP L ++RLSA+
Sbjct  268   LPILRWLRLSAS  279



>ref|XP_006370929.1| legumin family protein [Populus trichocarpa]
 gb|ERP48726.1| legumin family protein [Populus trichocarpa]
Length=493

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 118/250 (47%), Gaps = 36/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS-----EKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGC ET+Q S     ++     D++QK+R   +GD++ +P+    WFYN  
Sbjct  111   GRGIQGAVFPGCPETFQSSGQVSRDQSQSSEDQHQKVRQVREGDVVALPSGVADWFYNDG  170

Query  801   REPTILV-VLQRANPV--------SFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--  947
               P +LV +L  +NP         +FFLAG P       +    Q+ +   +R   D   
Sbjct  171   DSPLVLVQLLDTSNPANQLDQDFRNFFLAGNP-QRELQSQRSSYQRDQFEGQRGRQDEGE  229

Query  948   ----------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QLPSrpe  1088
                       N+  GFD +I+ +A N D   A + +      RG IV  +   Q+ S  +
Sbjct  230   SRRHQQDRHRNVFGGFDEKILAEAFNIDTRLA-RSMRNEKDNRGIIVRAEHELQVVSPHQ  288

Query  1089  krrqpgrqgggSS-----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
              R +              N +EET CTA    NI++ ERAD ++ RAGRLTT+NS  LP 
Sbjct  289   SREEEREIEYRGGRGGGFNGIEETFCTARLKHNINDPERADFFNPRAGRLTTVNSLNLPI  348

Query  1254  LSYVRLSAAR  1283
             L  V+LS  R
Sbjct  349   LRSVQLSVER  358


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 9/95 (9%)
 Frame = +1

Query  118  FNGCFGRRQ---SFHGQES------QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQ  270
            FN CF + +   S H Q+       Q  +CQL +I+A+ P   I +E G TE WD N EQ
Sbjct  17   FNCCFAQIEQVTSRHDQQQARRRSFQQSECQLQRINALEPARRIKSEAGVTEIWDENDEQ  76

Query  271  FQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            FQC G    RH IQ  GL LP+Y++AP + YV QG
Sbjct  77   FQCAGVAVIRHTIQQRGLLLPAYSNAPKLVYVEQG  111



>emb|CAA83674.1| legumin B [Vicia sativa]
Length=485

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 127/252 (50%), Gaps = 39/252 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-----QSEKGS--EILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+ +PGC E Y+     QS +GS  +  D +QKIR + KGDII IP+   +W YN
Sbjct  103   GKGVLGLTLPGCPEPYEEPRSSQSRQGSRPQQPDSHQKIRRFRKGDIIAIPSGIPYWTYN  162

Query  795   QNREPTILV-VLQRAN--------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLG---  938
                EP + + +L  +N        P  F+L G P +     +E  +++  L   R     
Sbjct  163   NGDEPLVAISLLDTSNIANRLDSTPRVFYLGGNPKAEFPETQEGQQERHSLPVGRRAGQH  222

Query  939   ---------YDGN-ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----L  1073
                       +GN +L+GF  + +    NT+ + A+++     + R  IV V+       
Sbjct  223   QQEKESEEQNEGNSVLSGFSSEFLAQTFNTEEDIAKRLRSPRDQ-RNQIVKVEGGLRIIN  281

Query  1074  PSrpekrrqpgrqgggSS----NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
             P   ++ ++   +    S    N LEET+C+A   +NI N  RAD+Y+ RAGR++T NS 
Sbjct  282   PEGQQEEKEEEEEEKHRSEQGRNGLEETICSAKIRENIANPARADLYNPRAGRISTANSL  341

Query  1242  TLPALSYVRLSA  1277
             TLP L Y+RLSA
Sbjct  342   TLPILRYLRLSA  353


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL  I+A+ P   + +E G TE W+PNH + +C G    R  I PNGL LPS++ +P 
Sbjct  37   QCQLHNINALEPDHRVESEAGLTETWNPNHPELRCAGVSLIRRTIDPNGLHLPSFSPSPQ  96

Query  355  VAYVLQG  375
            + +++QG
Sbjct  97   LIFIIQG  103



>ref|XP_002524605.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37813.1| legumin A precursor, putative [Ricinus communis]
Length=508

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 124/248 (50%), Gaps = 35/248 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDK---YQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G +G++ PGC+ET+Q+S++ S    +   +QKIR++ +GDII +PA A HW YN   E
Sbjct  127   GRGMFGVMFPGCSETFQESQQSSSSSGQQEQHQKIRHFRRGDIIALPAGAAHWCYNDGNE  186

Query  807   PTILVV----------LQRANPVSFFLAGKPGSSHqgqreq-------grqqqeLMTERL  935
             P + V           L R NP +F+LAG P    Q Q  +                 R 
Sbjct  187   PVVAVTVFDTANNANQLDR-NPRNFYLAGNPEDEFQKQSRRPGEREQGRYSLSGASERRR  245

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------QLPSrpekrr  1097
             G   N+  G D +++ +A N + + A K+   N   RG+IV V+      + P   ++R 
Sbjct  246   GSCNNVFCGMDSRLIAEAFNINEQLARKLQSEND-FRGNIVWVEGDLQVTRPPRTQQERE  304

Query  1098  qpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
             +   +    S       N +EET CT    +NI +  RADI+    GR++T+NS  LP L
Sbjct  305   EQEAREYEESRGHERTYNGIEETFCTMRMKENIADPSRADIFVPEVGRMSTVNSHNLPIL  364

Query  1257  SYVRLSAA  1280
               +RLSA+
Sbjct  365   RSLRLSAS  372


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +1

Query  148  FHGQES-----QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQ  312
            FHG  +     Q  +CQL++++A  P   I +E GT E W+PNH+QFQC G    RH I+
Sbjct  47   FHGSSAGSSFQQQNECQLNRLNAFEPDNRIQSEAGTIESWNPNHDQFQCAGVAVTRHTIE  106

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
            P GL LP+Y++AP + Y++QG
Sbjct  107  PRGLLLPAYSNAPQLVYIVQG  127



>ref|XP_011046347.1| PREDICTED: legumin B-like [Populus euphratica]
Length=495

 Score =   112 bits (281),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 83/260 (32%), Positives = 120/260 (46%), Gaps = 53/260 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS-----EKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGC ET+Q S     ++     D++QKIR   +GD++ +P+    WFYN  
Sbjct  111   GRGIQGAVFPGCPETFQSSGNYSQDRRESSEDQHQKIRQVREGDVVALPSGVADWFYNNG  170

Query  801   REPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG--  947
               P +LV +L  +NP +        FFLAG P    Q QR           +R  Y+G  
Sbjct  171   DSPLVLVQLLDTSNPANQLDQDFREFFLAGNPRQESQSQRSSY--------QRGQYEGQH  222

Query  948   -----------------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--  1070
                              NIL+GF+ +I+ +A N D +   ++   N   RG IV  Q   
Sbjct  223   GRQYEDESQREQHERSRNILSGFNERILAEAFNIDTKLVRRMQNEND-NRGIIVRAQHEL  281

Query  1071  ---------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRL  1223
                           ++  +   +     N +EET CTA    NI++ E AD+++ RAG L
Sbjct  282   QVISPRQSQEEEERQQESRRSPRRRHEDNGVEETFCTARLKLNINDIEDADVFNPRAGSL  341

Query  1224  TTLNSFTLPALSYVRLSAAR  1283
             T +NS  LP L YV+LSA R
Sbjct  342   TNVNSLNLPILRYVQLSAER  361


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ +I+A+ P   I +E G TE WD N EQFQC G    RH I   GL LP+Y++ P 
Sbjct  45   ECQIDRINALEPARKIRSEAGVTEIWDENDEQFQCAGVVVIRHTINNRGLLLPAYSNTPK  104

Query  355  VAYVLQG  375
            + YV QG
Sbjct  105  LIYVEQG  111



>gb|KDP26530.1| hypothetical protein JCGZ_17688 [Jatropha curcas]
Length=491

 Score =   112 bits (281),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 116/250 (46%), Gaps = 36/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG---SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G  G + PGC ET+Q+ +     S + D++QK+R++  GDII +PA   HW YN   E
Sbjct  106   GRGITGEMFPGCPETFQEYQGAGGSSRVEDQHQKVRHFRPGDIIALPAGVAHWCYNDGNE  165

Query  807   PTILVVLQRA---------NPVSFFLAGKP---------GSSHqgqreqgrqqqeLMTER  932
             P + + L            NP  F+LAG P         G    G             E 
Sbjct  166   PVVAIYLLDTANSDNQLDMNPRHFYLAGNPEDEFRQLYEGRREPGSGRHEGFSSRRRPEG  225

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QLPSrpekrrqp  1103
              G   N+  G D +++ +A N D   A K+   N   RG I+ V+   Q+      + + 
Sbjct  226   RGTCNNLFCGLDSRLISEAFNIDESLARKLQSENDY-RGSIINVEGKLQVVRPARTQSER  284

Query  1104  grqgggS-----------SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLP  1250
              +Q GGS            N LEET C+    +NI +  RAD+Y    GR++T+NS  LP
Sbjct  285   EQQVGGSGAGGPYLGGGGCNGLEETFCSMRLKENIADPSRADVYIPEVGRVSTINSHNLP  344

Query  1251  ALSYVRLSAA  1280
              L +++LSA+
Sbjct  345   ILRFLQLSAS  354


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQE----SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGG  285
            FN  F   Q     E     Q  +C+L +I A+ P   I +E GT E W+P+ +QFQC G
Sbjct  17   FNVSFASEQVKQENECPQLQQQHQCRLDRIEALEPDTRIQSEAGTIESWNPSRDQFQCAG  76

Query  286  AYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
                R +IQPNGL LP+Y++A  +A+++QG
Sbjct  77   VAIVRRVIQPNGLLLPAYSNAHQLAFIVQG  106



>emb|CDP79027.1| edestin 2 [Cannabis sativa]
Length=491

 Score =   112 bits (280),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 122/248 (49%), Gaps = 38/248 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS----------EKGSEILDKYQKIRYYEKGDIIVIPASAVHW  785
             G G +G ++PGC ET+++            +G+   +++QK+R  ++GD++ +PA    W
Sbjct  117   GRGIHGAVIPGCPETFERGTSSPSSRGYRSEGASSDEQHQKVREIKEGDMVAMPAGVADW  176

Query  786   FYNQNREPTILVVL----QRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN    P +L+       +AN +      F LAG P    + Q++   + Q     R  
Sbjct  177   VYNNGDSPLVLIAFVDVGNQANQLDQFSRRFHLAGNPHREQKTQQQVRARSQSRSQLRRE  236

Query  939   Y-----DGNILAGFDVQIVKDALNTDRETAEKIIGGN--------ARGRGHIVIVQQLPS  1079
                   +GNI +GFD +I+ ++ N D E A K+   +         RG    +I    PS
Sbjct  237   SGEQTPNGNIFSGFDTRILAESFNVDTELAHKLQNRDDMRERIVRVRGEDLQIIA---PS  293

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
             R ++  +         N LEET CT    QNID   +ADI++ R GRL TLN++ LP L 
Sbjct  294   RIQEEERRHYSR---DNGLEETFCTLRLRQNIDRPSQADIFNPRGGRLNTLNNYNLPILR  350

Query  1260  YVRLSAAR  1283
             +++L+A R
Sbjct  351   FLQLTAER  358


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWD---PNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            +CQ  +++A +P   +  E G +E+WD      ++  C G    RH IQ  GL LPS+ +
Sbjct  48   QCQFQRLNARQPNRRVECEAGVSEYWDIQNTEDDELHCAGVETARHTIQRRGLLLPSFLN  107

Query  346  APLVAYVLQG  375
            AP++ YV+QG
Sbjct  108  APMMFYVIQG  117



>emb|CDP79029.1| edestin 2 [Cannabis sativa]
Length=491

 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 122/248 (49%), Gaps = 38/248 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS----------EKGSEILDKYQKIRYYEKGDIIVIPASAVHW  785
             G G +G ++PGC ET+++            +G+   +++QK+R  ++GD++ +PA    W
Sbjct  117   GRGIHGAVIPGCPETFERGTSSPSSRGYRSEGASSDEQHQKVREIKEGDMVAMPAGVADW  176

Query  786   FYNQNREPTILVVL----QRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN    P +L+       +AN +      F LAG P    + Q++   + Q     R  
Sbjct  177   VYNNGDSPLVLIAFVDVGNQANQLDQFSRRFHLAGNPHREQKTQQQVRARSQSRSQLRRE  236

Query  939   Y-----DGNILAGFDVQIVKDALNTDRETAEKIIGGN--------ARGRGHIVIVQQLPS  1079
                   +GNI +GFD +I+ ++ N D E A K+   +         RG    +I    PS
Sbjct  237   SGEQTPNGNIFSGFDTRILAESFNVDTELAHKLQNRDDMRERIVRVRGEDLQIIA---PS  293

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
             R ++  +         N LEET CT    QNID   +ADI++ R GRL TLN++ LP L 
Sbjct  294   RIQEEERRHYSR---DNGLEETFCTLRLRQNIDRPSQADIFNPRGGRLNTLNNYNLPILR  350

Query  1260  YVRLSAAR  1283
             +++L+A R
Sbjct  351   FLQLTAER  358


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWD---PNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            +CQ  +++A +P   +  E G +E+WD      ++  C G    RH IQ  GL LPS+ +
Sbjct  48   QCQFQRLNARQPNRRVECEAGVSEYWDIQNTEDDELHCAGVETARHTIQRRGLLLPSFLN  107

Query  346  APLVAYVLQG  375
            AP++ YV+QG
Sbjct  108  APMMFYVIQG  117



>gb|KGN45554.1| hypothetical protein Csa_7G452090 [Cucumis sativus]
Length=476

 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 120/236 (51%), Gaps = 26/236 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G+G  G+ +PGC ETY+    +S+      D++QKIR + +GD++V+PA   HW YN+ +
Sbjct  114   GTGIRGVAMPGCPETYETDLRRSQSSGNFRDQHQKIREFREGDLLVVPAGVSHWMYNRGQ  173

Query  804   EPTILVVL-------QRANPVS--FFLAGKPGSSHqgqreqgrqqqeLMTERLG-YDGNI  953
                IL+V         + +P +  F+L+G+P         +G ++     E  G   GN+
Sbjct  174   SDLILIVFVDTRNVANQIDPFARKFYLSGRP-----EMMRRGEREGRSFRESTGEKSGNV  228

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqp-grqg  1115
              +GF  + +++AL  D     ++  G +  R  IV  ++     +P + ++ R       
Sbjct  229   FSGFADEFLEEALQIDSGLVRRL-KGESDERDRIVFAEEDFDVLMPEKDDQERSRGRYIE  287

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               S N  EET+CT     NI   E AD+++ R GRL+T N   LP L  VRLSA R
Sbjct  288   KESENGFEETVCTLRLKHNIGRSEHADVFNPRGGRLSTANFNNLPFLRQVRLSAER  343


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  118  FNGCFGRRQ-SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            F G   R+Q  FH  ++    C L  + A  P   I AE G TE W+PN+E+FQC G   
Sbjct  32   FQGSEARQQHRFHSPKA----CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAGVNM  87

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
             RH I+P GL LP +T+AP + +V+QGT
Sbjct  88   VRHTIRPKGLLLPGFTNAPKLIFVVQGT  115



>emb|CDP79028.1| edestin 2 [Cannabis sativa]
Length=491

 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 122/248 (49%), Gaps = 38/248 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS----------EKGSEILDKYQKIRYYEKGDIIVIPASAVHW  785
             G G +G ++PGC ET+++            +G+   +++QK+R  ++GD++ +PA    W
Sbjct  117   GRGIHGAVIPGCPETFERGTSSPSSRGYRSEGASSDEQHQKVREIKEGDMVAMPAGVADW  176

Query  786   FYNQNREPTILVVL----QRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN    P +L+       +AN +      F LAG P    + Q++   + Q     R  
Sbjct  177   VYNNGDSPLVLIAFVDVGNQANQLDQFSRRFHLAGNPHREQKTQQQVRARSQSRSQLRRE  236

Query  939   Y-----DGNILAGFDVQIVKDALNTDRETAEKIIGGN--------ARGRGHIVIVQQLPS  1079
                   +GNI +GFD +I+ ++ N D E A K+   +         RG    +I    PS
Sbjct  237   SGEQTPNGNIFSGFDTRILAESFNVDTELAHKLQNRDDMRERIVRVRGEDLQIIA---PS  293

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
             R ++  +         N LEET CT    QNID   +ADI++ R GRL TLN++ LP L 
Sbjct  294   RIQEEERRHYSR---DNGLEETFCTLRLRQNIDRPSQADIFNPRGGRLNTLNNYNLPILR  350

Query  1260  YVRLSAAR  1283
             +++L+A R
Sbjct  351   FLQLTAER  358


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWD---PNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            +CQ  +++A +P   +  E G +E+WD      ++  C G    RH IQ  GL LPS+ +
Sbjct  48   QCQFQRLNARQPNRRVECEAGVSEYWDIQNTEDDELHCAGVETARHTIQRRGLLLPSFLN  107

Query  346  APLVAYVLQG  375
            AP++ YV+QG
Sbjct  108  APMMFYVIQG  117



>ref|XP_008805230.1| PREDICTED: LOW QUALITY PROTEIN: glutelin type-A 3-like [Phoenix 
dactylifera]
Length=470

 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 114/232 (49%), Gaps = 20/232 (9%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---------QSEKGSEIL--DKYQKIRYYEKGDIIVIPASAVH  782
             G G YG ++PGC ET+Q         Q  +G   +  D++Q+I ++++GD+I I A   H
Sbjct  108   GRGIYGTVIPGCPETFQSFQQAESEQQGHEGQSRMSRDEHQRIHHFKQGDVIAIAAGVAH  167

Query  783   WFYNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAG  962
             W YN    P I   +   + V        G+S+    +          ++       LA 
Sbjct  168   WCYNDGDTPVIAFTVSDISTVPISSMKTIGNSYWLGDKGVASSNPGKNKKRAQRATSLAD  227

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL-----PSrpekrrqpgrqgggSS  1127
                   + A+  DRE A K+ G + R RG IV V++      PS  ++ R+   +    +
Sbjct  228   STPSYSRXAIGVDREVARKLQGEDDR-RGEIVRVEKALEVLRPSSEKQEREEKGR---GT  283

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LEE +C+    +NID+   AD+Y  R GR+TTLNS  LP LS+++LSA R
Sbjct  284   NGLEEVMCSMRSRENIDSPRHADVYTPRGGRITTLNSQKLPMLSFIQLSAER  335


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  FGRR--QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRH  303
            FGR   QS   Q  +  +C++ +++A+ PT  + +E G TE++D N+ QF+C G  AFR 
Sbjct  26   FGRSPWQSVR-QSGEQSECRVEKLNALEPTREVRSEAGVTEYYDQNNAQFECAGVAAFRR  84

Query  304  IIQPNGLFLPSYTSAPLVAYVLQG  375
             I+P GL LPS+++AP + Y++QG
Sbjct  85   TIEPRGLLLPSFSNAPRLVYIIQG  108



>emb|CAA57846.1| legumin precur [Magnolia salicifolia]
Length=470

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 122/239 (51%), Gaps = 28/239 (12%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ------QSEKGSEIL----DKYQKIRYYEKGDIIVIPASAV  779
             + G G  G I+PGC E++Q      Q E+G        D++QKI+++ +GDII IPA   
Sbjct  104   AQGRGITGAIIPGCPESFQSFQQSEQREQGQSPRQRQRDQHQKIQHFRQGDIIAIPAGVA  163

Query  780   HWFYNQNREPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTER  932
             HW YN    P +LV VL  +N  +        F LAG        Q++  +  Q+  T  
Sbjct  164   HWTYNDGESPVVLVSVLDTSNYANQLDQNHRRFRLAGS------EQQQSRQSYQQQQTRE  217

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
              G   NI  GF+V+ + +A    RETA K+   +   RG IV V+         R+   +
Sbjct  218   QGPSDNIFNGFNVETLAEAFGVSRETARKLQSQDD-NRGSIVRVENGLQVVRPLRREEDE  276

Query  1113  gggSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                    N LEE  C++  T NI +  RAD+Y+ +AGR+T+LNS  LP L+ ++LSA R
Sbjct  277   EQEQFRLNGLEEIQCSSKLTYNIADPTRADVYNPQAGRITSLNSQKLPILNVLQLSAER  335


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+  + A+ P     +E G TE WD N+EQ +C G  A RH I P GL LPS+ +AP 
Sbjct  40   ECQVESLSALEPNRRYESEAGVTEHWDQNNEQLECAGVAATRHTIAPRGLLLPSFDNAPR  99

Query  355  VAYVLQG  375
            + YV QG
Sbjct  100  LVYVAQG  106



>ref|XP_002524606.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37814.1| legumin A precursor, putative [Ricinus communis]
Length=478

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 128/248 (52%), Gaps = 35/248 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDK---YQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             G G +G++ PGCAET+Q+S++ S    +   +QKIR++ +GDII +PA A HW YN   E
Sbjct  97    GRGMFGVMFPGCAETFQESQQSSSSSRQQEQHQKIRHFRRGDIIALPAGAAHWCYNDGSE  156

Query  807   PTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqe-------LMTERL  935
             P + V           L R NP +F+LAG P    Q Q  +  ++++           R 
Sbjct  157   PVVAVTIFDTANNANQLDR-NPRNFYLAGNPEDEFQKQSRRPGEREQGRYSLSGDSERRR  215

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------QLPSrpekrr  1097
             G   N+  G D +++ +A N + + A K+   N   RG+IV V+      + P   ++R 
Sbjct  216   GPCNNVFCGMDSRLIAEAFNINEQLARKLQSEND-FRGNIVRVEGDLQVTRPPRTQQERE  274

Query  1098  qpgrqgggSS-------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
             +   +    S       N +EET CT    +NI +  RAD++    GR++T+NS  LP L
Sbjct  275   EQEAREYEESRGRERTYNGIEETFCTMRMKENIADPSRADLFVPEVGRMSTVNSHNLPIL  334

Query  1257  SYVRLSAA  1280
               +RLSA+
Sbjct  335   RSLRLSAS  342


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +1

Query  148  FHGQES-----QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQ  312
            FHG  +     Q  +CQL++++A  P   I +E GT E W+PNH+QFQC G    RH I+
Sbjct  17   FHGSSAGSSFQQQNECQLNRLNAFEPDNRIQSEAGTIESWNPNHDQFQCAGVAVTRHTIE  76

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
            P GL LP+Y++AP + Y++QG
Sbjct  77   PRGLLLPAYSNAPQLVYIVQG  97



>ref|XP_008462393.1| PREDICTED: legumin B-like [Cucumis melo]
Length=476

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 119/236 (50%), Gaps = 26/236 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G+G  G+ +PGC ETY+    +S+      D++QKIR++ +GD++V+PA    W YN+ +
Sbjct  114   GAGIRGVAMPGCPETYETDLRRSQSSGNFRDQHQKIRHFREGDLLVLPAGVSQWIYNRGQ  173

Query  804   EPTILVVL-------QRANPVS--FFLAGKPGSSHqgqreqgrqqqeLMTERLG-YDGNI  953
                ILVV         + +P +  F+LAG+P         +G ++     E  G   GN+
Sbjct  174   SDLILVVFVDTRNVANQIDPFARKFYLAGRP-----EMMRRGEREGRSFRESTGEKSGNV  228

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqp-grqg  1115
              +GF  + +++A   D     ++ G N   R  IV  ++     +P R ++ R       
Sbjct  229   FSGFADEFLEEAFQVDSGLVRRLKGEND-DRDRIVFTEEDFDVLMPERDDQERSRGRYVE  287

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               S N  EET+CT     NI   E AD+++ R GR++T N   LP L  VRLSA R
Sbjct  288   KESENGFEETVCTLRLKHNIGRSEHADVFNPRGGRISTANFNNLPFLRQVRLSAER  343


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  118  FNGCFGRRQ-SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            F G   R+Q  FH  ++    C L  + A  P   I AE G TE W+PN+E+FQC G   
Sbjct  32   FQGSEARQQHRFHSPKA----CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAGVNM  87

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
             RH I+P GL LP +T+AP + +V+QG 
Sbjct  88   VRHTIRPKGLLLPGFTNAPKLIFVVQGA  115



>ref|XP_008447425.1| PREDICTED: legumin A-like [Cucumis melo]
Length=500

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 122/252 (48%), Gaps = 36/252 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS-EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPT  812
             G G  G+++PGC ETYQ+S++ + E  D++QKI +   GD+  +PA + HW YN   E  
Sbjct  109   GRGFKGVVLPGCPETYQESQQSAGEFRDRHQKIHHVRAGDLFAVPAGSAHWTYNDGNEKL  168

Query  813   ILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMTERL---GYDGNIL  956
             I VVL      AN     P +F+LAG P       R Q + +Q   + R        NI 
Sbjct  169   IAVVLLDVSNHANQLDFHPRAFYLAGNPEEEFPEWRSQWKGEQGRHSGRREGSSNKNNIF  228

Query  957   AGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP--------------------  1076
               FD +++ + LN + E A K+ G +   R  I +  QL                     
Sbjct  229   FAFDDRVLAEILNINIELARKLRGEDDFRRNIIKVEGQLEVIRPPRSRGGRRGEEQEWEE  288

Query  1077  ---SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
                   +++R+  ++     N L+ET+C+    +NI +  RAD+Y   AGRL+T NS   
Sbjct  289   EQEEEMQRQRERHQRRRWDDNGLDETICSMRMKENIGDASRADMYTPEAGRLSTTNSHRF  348

Query  1248  PALSYVRLSAAR  1283
             P L +++LSA R
Sbjct  349   PILRWLQLSAER  360


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = +1

Query  118  FNGCFGRRQS-------FHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQ  276
            FNGC    ++       F   +S+  +C+L ++ A+ P+  I AEGG  E WDP+HE F+
Sbjct  17   FNGCLATDENLREVSRRFGEGQSRYRECRLDRLDALEPSRRIEAEGGVIEMWDPSHEMFR  76

Query  277  CGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            C G    R++I PNGL LP YT+AP + Y+ +G
Sbjct  77   CAGVAIQRYVIDPNGLLLPQYTNAPRLIYIERG  109



>gb|ABU42022.1| 11S globulin [Pistacia vera]
Length=472

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 118/237 (50%), Gaps = 27/237 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS------------EKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             GSG +G + PGC ET+Q+             E+  +  +++QK+R+  +GDII +PA   
Sbjct  108   GSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVA  167

Query  780   HWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTER  932
             HW YN  +   +LV L       N +      F L G P    + Q       Q   + +
Sbjct  168   HWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSP--QQEIQGGGQSWSQSRSSRK  225

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
                  NIL+ FD +I+  +LN D +  +K+     + RG IV V++     +      ++
Sbjct  226   GQQSNNILSAFDEEILAQSLNIDTQLVKKL-QREEKQRGIIVRVKE---DLQVLSPQRQE  281

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                S N LEET CT T   NI++  RAD+Y+ R GR+T++N+  LP L +++LS  +
Sbjct  282   KEYSDNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEK  338


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            +  ++A+ P   I +E G TEFWD N EQ QC     FRH IQ  GL +PSY +AP + Y
Sbjct  45   IQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVY  104

Query  364  VLQGT  378
            V+QG+
Sbjct  105  VVQGS  109



>gb|KGN61596.1| hypothetical protein Csa_2G174130 [Cucumis sativus]
Length=487

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 122/235 (52%), Gaps = 24/235 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ----QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G+G  G+ +PGC ETYQ    +S+      D++QKIR + +GD++V+PA   HW YN+ +
Sbjct  128   GTGIRGVAMPGCPETYQTDLRRSQSSGNFRDQHQKIRQFREGDLLVVPAGVSHWMYNRGQ  187

Query  804   EPTILVVL-------QRANPVS--FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNIL  956
                IL+V         + +P +  F+LAG+P    +G+ E    +     +     GN++
Sbjct  188   SDLILIVFVDTRNVANQIDPFARKFYLAGRPEMMRRGEWEGRSYRGSSGEK----SGNVV  243

Query  957   AGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqp-grqgg  1118
             +GF  + +++A   D     K+ G +   R  IV+ ++     +P R ++ R        
Sbjct  244   SGFADEFLEEAFQVDSGLVRKLKGEDDE-RDRIVLAEEDFDVLMPERDDQERSRGRYVES  302

Query  1119  gSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              + N  EET+CT     +I   E AD++++R GR++T N   LP L  VRLSA R
Sbjct  303   ETENGFEETVCTLRLKHSIGRSEHADVFNTRGGRISTANFNNLPFLRQVRLSAER  357


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 5/88 (6%)
 Frame = +1

Query  118  FNGCFGRRQ-SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYA  294
            F G   R+Q  FH  +     C L  + A  P   I AEGG TE W+PN E+ QC G   
Sbjct  46   FQGSEARQQHRFHSPKP----CHLENLRAQDPVRRIEAEGGFTELWEPNSEELQCAGVNM  101

Query  295  FRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
             RH I+P GL LP +T+AP + +V+QGT
Sbjct  102  VRHTIRPRGLLLPGFTNAPKLVFVVQGT  129



>gb|AAL73404.1|AF449424_1 11S globulin-like protein [Corylus avellana]
Length=515

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 124/269 (46%), Gaps = 53/269 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------------DKYQKIRYYEKGDIIVIPASA  776
             G G  G++ PGC ET++  ++ S+               D++QKIR++ +GDII +PA  
Sbjct  103   GRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGV  162

Query  777   VHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
              HW YN    P + V L            NP  F+LAG P   HQ Q +Q   Q+    +
Sbjct  163   AHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQ  222

Query  930   R----------LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGR------GHIVI  1061
                         G   N+ +GFD + + DA N D +TA ++     + R      G + +
Sbjct  223   HSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQV  282

Query  1062  VQQLPSrpekrrqpgrqgggSS---------------NALEETLCTATFTQNIDNRERAD  1196
             V+   SR E  RQ  ++                    N  EET+C+    +NI  R RAD
Sbjct  283   VRPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRAD  342

Query  1197  IYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             IY  + GR+ T+NS TLP L +++LSA R
Sbjct  343   IYTEQVGRINTVNSNTLPVLRWLQLSAER  371


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 9/91 (10%)
 Frame = +1

Query  118  FNGCFG-----RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCG  282
            FNGC G     RRQ    Q+    +C L +++A+ PT  I AE    E WD N +QFQC 
Sbjct  17   FNGCLGINVGLRRQ----QQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCA  72

Query  283  GAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            G    R  I+PNGL LP Y++AP + Y+ +G
Sbjct  73   GVAVIRRTIEPNGLLLPQYSNAPELIYIERG  103



>gb|ABK80752.1| 11S globulin precursor isoform 1B [Ficus pumila var. awkeotsang]
Length=508

 Score =   110 bits (275),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 128/266 (48%), Gaps = 50/266 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG-----SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G + PGCAET+++S++G     S   D++QK+R++ +GDI+ IPA   +W YN  
Sbjct  108   GRGILGTVFPGCAETFEESQRGAQGRRSRPEDRHQKLRHFREGDIVAIPAGVAYWTYNNG  167

Query  801   REPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGY----  941
              +  + V L            NP  F+LAG P      +++Q +Q QE            
Sbjct  168   DQQLVSVTLLDTSNVENQLDQNPRRFYLAGNPEDEFDPEQQQHQQYQEQQGRDRSRRQRS  227

Query  942   ---DGNILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIVIVQQLPSrpekr  1094
                  NI  G + + +++A N D ETA +I G N       + +G + +V  L    ++R
Sbjct  228   SGNKHNIFRGLNTRFIEEAFNVDSETARRIQGQNDNRNNIIKVKGRLDLVSPLIRSSQER  287

Query  1095  rqpgrqgggS-----------------------SNALEETLCTATFTQNIDNRERADIYD  1205
             ++ G +                           +N L+ET C     +NI +  RADI+ 
Sbjct  288   QREGEREETWEEEREREQQERERDWRRSPRGDYNNGLKETFCAMRLKENIGDPSRADIFT  347

Query  1206  SRAGRLTTLNSFTLPALSYVRLSAAR  1283
              +AGR++T+NSF LP L ++RLSA R
Sbjct  348   PQAGRISTVNSFNLPILRHLRLSAER  373


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            QNE CQ   + A+ P   I AE G  E W+P+HEQFQC G    R  I+PNGL LPSYT+
Sbjct  40   QNE-CQFDNLQALEPDTRIQAEAGLIESWNPDHEQFQCAGVAVVRRTIEPNGLHLPSYTN  98

Query  346  APLVAYVLQG  375
            AP + Y+++G
Sbjct  99   APQLIYIVRG  108



>ref|XP_010555095.1| PREDICTED: cruciferin PGCRURSE5 [Tarenaya hassleriana]
Length=472

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 114/236 (48%), Gaps = 30/236 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS------EILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G ++PGCAETY  S+         +  D +QK+ +   GD+   P+   HW YN 
Sbjct  100   GRGLAGRVIPGCAETYMDSQGLGGEQGQQKFRDMHQKVEHVRHGDVFAWPSGTAHWCYNS  159

Query  798   NREPTILVVL---------QRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
               +P + + L            NP +F LAG               +       +  + N
Sbjct  160   GDQPLVTISLIDIANQHNQLDRNPRAFRLAG---------TNPKGSRGVGGGRGMQQEQN  210

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqg  1115
             I +GFD QI+ D+     +TA+++       RG+IV V+   Q+  P   ++      + 
Sbjct  211   IFSGFDPQILADSYKISLQTAQQLQN-QQDNRGNIVHVKGPFQVVRPPLRQEYESEEWRQ  269

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                 N LEET C+  F ++ID+  RAD+Y  + GR+TT+NS+TLP L YVRLSA R
Sbjct  270   PRGQNGLEETFCSMRFHESIDDPARADVYKPQLGRVTTVNSYTLPILQYVRLSATR  325


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +1

Query  127  CFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHI  306
            C  R++     + +NE C+L  + A+ PT  IP E G  E+WD  H Q +C G    R +
Sbjct  19   CEARQELGVPPQMRNE-CELDNLDALEPTDTIPCEAGRIEYWDHTHPQLRCAGVSVVRRV  77

Query  307  IQPNGLFLPSYTSAPLVAYVLQG  375
            IQP GL+LP++ +AP + YV+QG
Sbjct  78   IQPGGLYLPTFHNAPQITYVVQG  100



>gb|AAN76862.1|AF453947_1 allergen Ana o 2 [Anacardium occidentale]
Length=457

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/246 (33%), Positives = 114/246 (46%), Gaps = 43/246 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ------QSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  GI  PGC ETYQ      Q  +     D++QKIR + +GDII IPA   HW YN+
Sbjct  90    GEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNE  149

Query  798   NREPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
                P + V L   +         P  F LAG P    Q Q++   + +           N
Sbjct  150   GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGR-----------N  198

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ------LPSrpekrrqpgrq  1112
             + +GFD +++ +A   D    +++   +   RG IV V+        PSR +  R    +
Sbjct  199   LFSGFDTELLAEAFQVDERLIKQLKSED--NRGGIVKVKDDELRVIRPSRSQSERGSESE  256

Query  1113  gg---------gSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
                           N +EET+CT    +NI++  RADIY    GRLTTLNS  LP L ++
Sbjct  257   EESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL  316

Query  1266  RLSAAR  1283
             +LS  +
Sbjct  317   QLSVEK  322


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC   RQ +     Q ++CQ+ ++ A+ P   +  E GT E WDPNHEQF+C G    
Sbjct  9    FHGCLASRQEWQ----QQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALV  64

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            RH IQPNGL LP Y++AP + YV+QG
Sbjct  65   RHTIQPNGLLLPQYSNAPQLIYVVQG  90



>ref|NP_199225.1| 12S seed storage protein CRA1 [Arabidopsis thaliana]
 sp|P15455.2|CRU1_ARATH RecName: Full=12S seed storage protein CRA1; AltName: Full=Cruciferin 
1; Short=AtCRU1; AltName: Full=Cruciferin A1; AltName: 
Full=Legumin-type globulin storage protein CRA1; Contains: 
RecName: Full=12S seed storage protein CRA1 alpha chain; 
AltName: Full=12S seed storage protein CRA1 acidic chain; Contains: 
RecName: Full=12S seed storage protein CRA1 beta chain; 
AltName: Full=12S seed storage protein CRA1 basic chain; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10979.1| legumin-like protein [Arabidopsis thaliana]
 gb|AAL50071.1| AT5g44120/MLN1_4 [Arabidopsis thaliana]
 gb|AED95062.1| 12S seed storage protein CRU1 [Arabidopsis thaliana]
Length=472

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 112/249 (45%), Gaps = 45/249 (18%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSE----------KGSEILDKYQKIRYYEKGDIIVIPASAV  779
             + G G  G ++PGCAET+Q S           +     D +QK+ +   GD I       
Sbjct  99    AKGRGLMGKVIPGCAETFQDSSEFQPRFEGQGQSQRFRDMHQKVEHIRSGDTIATTPGVA  158

Query  780   HWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              WFYN  +EP ++V V   A        NP  F+LAG                  L    
Sbjct  159   QWFYNDGQEPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW----------LQGRE  208

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------------QLP  1076
                  NI  GF  +++  AL  D +TA+++   +   RG+IV VQ            Q P
Sbjct  209   QQPQKNIFNGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRPPLRGQRP  267

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                E+      +     N LEET+C+A  T N+D+  RAD+Y  + G ++TLNS+ LP L
Sbjct  268   QEEEEEEGRHGR---HGNGLEETICSARCTDNLDDPSRADVYKPQLGYISTLNSYDLPIL  324

Query  1257  SYVRLSAAR  1283
              ++RLSA R
Sbjct  325   RFIRLSALR  333


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R+II+  GL+LPS+ +   
Sbjct  35   ECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYIIESKGLYLPSFFNTAK  94

Query  355  VAYVLQG  375
            +++V +G
Sbjct  95   LSFVAKG  101



>emb|CDO99238.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 130/268 (49%), Gaps = 55/268 (21%)
 Frame = +3

Query  615   YFLPFSTGSGEYGIIVPGCAETYQ-----------QSEKGSE------------ILDKYQ  725
             +  P   G+G  G ++PGCAET++           Q  KG E              D++Q
Sbjct  49    FRFPSEAGTGVQGTVIPGCAETFESQGESFSGGQEQPGKGQEGSKGGQEGQRQRFPDRHQ  108

Query  726   KIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSS  878
             K+R ++KGD++++      W YN    P + V L      AN +      FFLAG P   
Sbjct  109   KLRRFQKGDVLILLPGFTQWTYNDGDVPLVTVALLDVANEANQLDLQSRKFFLAGNPQQG  168

Query  879   HqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV  1058
                +  QG+QQQ           NI +GFD Q++ DA N D +  +K+ G   + RG  V
Sbjct  169   GGKEGHQGQQQQHR---------NIFSGFDDQLLADAFNVDLKIIQKLKGPKDQ-RGSTV  218

Query  1059  IVQQL----PSrpekrrqpgrqgggS---------SNALEETLCTATFTQNIDNRERADI  1199
               ++L    P   E+ + P +Q             SN LEETLCT   ++NI   + AD+
Sbjct  219   RAEKLQLFLPEYSEQEQHPQQQQEQQQHGVGRGWRSNGLEETLCTVKLSENIGLPQEADV  278

Query  1200  YDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             ++ RAGR+TT+NS  +P LS ++LSA R
Sbjct  279   FNPRAGRITTVNSQKIPILSSLQLSAER  306



>sp|Q02498.1|CRU1_RAPSA RecName: Full=Cruciferin PGCRURSE5; AltName: Full=11S globulin; 
AltName: Full=12S storage protein; Contains: RecName: Full=Cruciferin 
PGCRURSE5 alpha chain; Contains: RecName: Full=Cruciferin 
PGCRURSE5 beta chain; Flags: Precursor [Raphanus 
sativus]
 emb|CAA42478.1| cruciferin precursor [Raphanus sativus]
Length=479

 Score =   109 bits (273),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 125/272 (46%), Gaps = 63/272 (23%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSEK----------------GSEIL  713
             G +LP  FS+        G G  G +VPGCAET+  S+                      
Sbjct  84    GLYLPTFFSSPKIAYVVQGMGISGRVVPGCAETFMDSQPMQGQGQQGQQGQQGQQQQGFR  143

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGK  866
             D +QK+ +   GD+I I A + HW YN   +P ++V L            NP +F LAG 
Sbjct  144   DMHQKVEHVRHGDVIAITAGSAHWIYNTGDQPLVIVCLLDIANYQNQLDRNPRTFRLAGN  203

Query  867   --PGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNAR  1040
                G SHQ Q++Q +              N+L+GFD Q++  AL      A+++      
Sbjct  204   NPQGGSHQQQQQQQQ--------------NMLSGFDPQVLAQALKMQLRLAQEL-QNQQD  248

Query  1041  GRGHIVIVQ-----------QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRE  1187
              RG+IV V+           Q     + R   G       N LEET+C+    +NID+  
Sbjct  249   NRGNIVRVKGPFQVVRPPLRQQYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPA  308

Query  1188  RADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             RAD+Y    GR+T++NS+TLP L Y+RLSA R
Sbjct  309   RADVYKPNLGRVTSVNSYTLPILQYIRLSATR  340


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R QS          C L  +  ++PT  I +E G  E+WD NH Q +C G    
Sbjct  18   LNGCLAR-QSLGVPPQLGNACNLDNLDVLQPTETIKSEAGRLEYWDHNHPQLRCAGVSVS  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R II+  GL+LP++ S+P +AYV+QG
Sbjct  77   RLIIEQGGLYLPTFFSSPKIAYVVQG  102



>ref|XP_010522580.1| PREDICTED: 12S seed storage protein CRB-like [Tarenaya hassleriana]
Length=465

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 114/251 (45%), Gaps = 38/251 (15%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQS--------EKGSEILDKYQKIRY  737
             G +LP  FS+        G G  G ++PGCAET+  S         +G +  D +QK+ +
Sbjct  89    GLYLPTYFSSPRLSFVVHGRGLMGRVIPGCAETFMDSPVFQGQGQSQGEKFRDMHQKVEH  148

Query  738   YEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgq  890
                GD I  P+    WFYN   EP I+V +            NP  F LAG         
Sbjct  149   LRCGDTIGNPSGISQWFYNNGNEPLIIVSVSDIGNYQNQLDRNPRPFHLAGNNPQGQVW-  207

Query  891   reqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ  1070
                      +   +     N+ +GFD +I+  A   +   A+++       RG+IV V+ 
Sbjct  208   ---------MRGSQQQPQNNMFSGFDPKILAQAFKIELRIAQQL-QNQQDNRGNIVRVKG  257

Query  1071  LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLP  1250
               S        G +G    N LEET CT   T N+D+  RAD+Y  + G ++TLNS+ LP
Sbjct  258   QFSVIRPPIGRGEEGQQLDNGLEETFCTMRCTDNLDDPSRADVYKPQLGYISTLNSYKLP  317

Query  1251  ALSYVRLSAAR  1283
              L ++RLSA R
Sbjct  318   MLRFLRLSALR  328


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++ + P+  +  E G  E WD +  Q +C G    R +I+P GL+LP+Y S+P 
Sbjct  41   ECQLDQLNVLEPSHVLKCEAGRIEIWDHHAPQLRCSGVSFDRIVIEPQGLYLPTYFSSPR  100

Query  355  VAYVLQG  375
            +++V+ G
Sbjct  101  LSFVVHG  107



>gb|AFJ04523.1| glutelin type-A 3 precursor, partial [Vernicia fordii]
Length=498

 Score =   109 bits (273),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 125/261 (48%), Gaps = 44/261 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---QSEKGSEIL------DKYQKIRYYEKGDIIVIPASAVH  782
             + G G  G + PGC ETYQ   QS++G   L      D++QK+    +GD++ +PA    
Sbjct  106   AQGRGVQGAVFPGCPETYQSPAQSQQGGFGLSGRQRGDQHQKVLQIREGDVLALPAGVAQ  165

Query  783   WFYNQNREPTILV-VLQRANPVS--------FFLAGKPG---SSHqgqreqgrqqqeLMT  926
             W YN  R P +LV ++  +N  +        FF+ G P     S +GQ       +E +T
Sbjct  166   WVYNNGRSPLVLVEIIDTSNGANQLDENHRVFFVGGSPQEEIQSLRGQYRGSEWTRERVT  225

Query  927   ERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV-IVQQLP---------  1076
              R    GN+ +G D +++  A N + + A ++   N + RG IV +V++L          
Sbjct  226   GRTRRSGNVFSGLDERLLAQAFNINTDVARRLKSENDK-RGMIVSVVRELELLTPERSQE  284

Query  1077  ------------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGR  1220
                              R      G    N +EETLCTA    NI+N  RAD+++ RAGR
Sbjct  285   EEREESEEERERGFEHSRGGRCMNGEEECNGVEETLCTARLKHNINNPSRADVFNPRAGR  344

Query  1221  LTTLNSFTLPALSYVRLSAAR  1283
             +T +NS  LP L +++LS  R
Sbjct  345   VTNVNSLNLPILRHLQLSIQR  365


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            SQ ++CQL +I+A+ P+ +I +E G T+ WD N EQFQC G  A RH IQ  GL LP + 
Sbjct  38   SQQDECQLERINAVEPSRSIQSEAGVTDVWDENDEQFQCAGVVAIRHTIQQRGLLLPQFV  97

Query  343  SAPLVAYVLQG  375
            + P + YV QG
Sbjct  98   NGPKLIYVAQG  108



>ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricinus communis]
 gb|EEF28918.1| glutelin type-A 3 precursor, putative [Ricinus communis]
Length=497

 Score =   109 bits (273),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 124/252 (49%), Gaps = 37/252 (15%)
 Frame = +3

Query  627   FSTGSGEYGIIVPGCAETYQQSE--------KGSEILDKYQKIRYYEKGDIIVIPASAVH  782
              S+  G  G + PGC ETYQ           +G    D++QK+R   +GD+I + A    
Sbjct  114   LSSCRGIQGSVFPGCPETYQSPSESQSESQGQGQSRRDQHQKVRQIREGDVIALHAGVAQ  173

Query  783   WFYNQNREPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERL  935
             W YN  R P +LV ++  +NP +        FFLAG P    Q QR +  +  E  +   
Sbjct  174   WIYNNGRSPLVLVQIIDTSNPANQLDQNHRDFFLAGNPQREVQSQRGERGRTSERRSTST  233

Query  936   G--YD--GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpe  1088
             G  +D  GN+ +G D +++ ++ N + + A K+ G N   RG IV V+       P R +
Sbjct  234   GSAHDNSGNVFSGMDERVIAESFNINTDLARKLRGENDL-RGIIVSVEHDLEMLAPQRSQ  292

Query  1089  krrqpgrqgggSS----------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
             +  +  R+               N LEET CTA    NI+    ADIY+ RAGR+T++NS
Sbjct  293   EEEREEREEEAQRQLERSPRARFNGLEETFCTARLRHNINKPSEADIYNPRAGRVTSVNS  352

Query  1239  FTLPALSYVRLS  1274
               LP L Y++LS
Sbjct  353   HNLPILRYLQLS  364


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  157  QESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPS  336
            Q  Q ++CQL++I+A+ P+    +E G TE WD N +QFQC G  A RH IQ  GL LP 
Sbjct  38   QRGQQDQCQLNRINAVEPSRRFQSEAGLTEIWDENDQQFQCVGVVAMRHTIQQRGLLLPQ  97

Query  337  YTSAPLVAYVLQG  375
            Y + P + YV+QG
Sbjct  98   YVNGPKLIYVVQG  110



>gb|ABG73110.1| Pis v 2.0201 allergen 11S globulin precusor [Pistacia vera]
Length=472

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 117/237 (49%), Gaps = 27/237 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS------------EKGSEILDKYQKIRYYEKGDIIVIPASAV  779
             GSG +G + PGC ET+Q+             E+  +  +++QK+R+  +GDII +PA   
Sbjct  108   GSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVA  167

Query  780   HWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTER  932
             HW YN  +   +LV L       N +      F L G P    + Q       Q   + +
Sbjct  168   HWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSP--QQEIQGGGQSWSQSRSSRK  225

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
                  NIL+ FD +I+  + N D +  +K+     + RG IV V++     +      ++
Sbjct  226   GQQSNNILSAFDEEILAQSFNIDTQLVKKL-QREEKQRGIIVRVKE---DLQVLSPQRQE  281

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                S N LEET CT T   NI++  RAD+Y+ R GR+T++N+  LP L +++LS  +
Sbjct  282   KEYSDNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEK  338


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            +  ++A+ P   I +E G TEFWD N EQ QC     FRH IQ  GL +PSY +AP + Y
Sbjct  45   IQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVY  104

Query  364  VLQGT  378
            V+QG+
Sbjct  105  VVQGS  109



>ref|XP_011046348.1| PREDICTED: legumin B-like [Populus euphratica]
Length=491

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 121/249 (49%), Gaps = 33/249 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----DKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  G +  GC ET+Q S K S        D++QK+R   +GD++ +P+    WFYN  
Sbjct  108   GRGIQGAVFAGCPETFQSSGKFSRDRSQSSEDQHQKVRQVREGDVVALPSGVADWFYNNG  167

Query  801   REPTILV-VLQRANPVS--------FFLAGKPG-------SSHqgqreqgrqqqeLMTE-  929
               P +LV +L  +NP +        FFLAG P        SS+Q  +++G++ ++   E 
Sbjct  168   DSPLVLVQLLDTSNPANQLDQDFRNFFLAGNPQRELQSQRSSYQRDQDEGQRGRQDEGEG  227

Query  930   -RLGYDG--NILAGFDVQIVKDALNTDRETAEKI--------IGGNARGRGHIVIVQQLP  1076
              R   D   N+  GFD +I+ +A N D   A  I        I   A     +V   Q  
Sbjct  228   QRHQQDRHRNVFGGFDEKILAEAFNIDTRLARSIRNEKDNRGIIVRAEHELQVVSPHQSR  287

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                E+        GG  N +EET CTA    NI++ ERAD ++ RAGRLT +NS  LP L
Sbjct  288   EEEEREIGYRGGRGGGFNGIEETFCTARLKHNINDPERADFFNPRAGRLTIVNSLNLPIL  347

Query  1257  SYVRLSAAR  1283
               V+LS  R
Sbjct  348   RSVQLSVER  356


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +1

Query  118  FNGCFGRRQ---SFHGQES---QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQC  279
            FN CF + +   S HGQ+    +N +CQL +I+A+ P   I +E G T+ WD N +QFQC
Sbjct  17   FNCCFAQIEQVTSRHGQQQARRRNFQCQLQKINALEPARRIKSEAGVTDIWDENDKQFQC  76

Query  280  GGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
             G    RH IQ  GL LP+Y++ P + YV QG
Sbjct  77   AGVAVIRHRIQQRGLLLPAYSNTPKLVYVEQG  108



>ref|XP_010111924.1| Legumin A [Morus notabilis]
 gb|EXC31958.1| Legumin A [Morus notabilis]
Length=490

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 125/258 (48%), Gaps = 43/258 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS--EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREP  809
             G G  G + PGC ET+++S++G+     D++QK+ +  +GD++ +PA   +W YN    P
Sbjct  100   GRGVVGTLFPGCPETFEESQQGTSRRSQDRHQKLHHIREGDVLALPAGVAYWSYNDGDSP  159

Query  810   TILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD------  944
              ++V L   +         P  F LAG P       R + + ++    +R   +      
Sbjct  160   LVVVSLFDVSNHDNQLDRFPRRFNLAGNPQDEFLQSRREEQYREGSHEQRRREEQHQEQG  219

Query  945   ---GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrq  1100
                 NI  GF ++ +++A   D ETA +I   N + RG I+ +++      P R  + ++
Sbjct  220   SRVNNIFRGFSIEFIQEAFKVDSETARRIQSQNDK-RGSIIKLKERLDLVRPGRSREEQE  278

Query  1101  pgrqgggSS-----------------NALEETLCTATFTQNIDNRERADIYDSRAGRLTT  1229
                +                      N +EET CT    +NI +  RAD+Y  +AGRL++
Sbjct  279   HEMRQEEQRQTEREHARRQGGGGRYMNGVEETFCTMRLRENIGDPSRADVYSPQAGRLSS  338

Query  1230  LNSFTLPALSYVRLSAAR  1283
             +NS+ LP L++++LSA R
Sbjct  339   VNSYNLPILNWLQLSAER  356


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC  R     GQ  +  +CQL ++ A  P   + +EGG  E W+PNHEQFQC G    
Sbjct  18   FHGCLARPT---GQYLRQNECQLDRLEAREPDHRVQSEGGLFESWNPNHEQFQCAGVALL  74

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQPNGL LPSYT+AP + ++++G
Sbjct  75   RLTIQPNGLHLPSYTNAPQLVHIIRG  100



>ref|XP_002522726.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
 gb|EEF39577.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
Length=386

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 123/251 (49%), Gaps = 37/251 (15%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSE--------KGSEILDKYQKIRYYEKGDIIVIPASAVHW  785
             + G G  G + PGC ETYQ           +G    D++QK+R   +GD+I + A    W
Sbjct  3     NAGRGIQGSVFPGCPETYQSPSESQSESQGQGQSRRDQHQKVRQIREGDVIALHAGVAQW  62

Query  786   FYNQNREPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN  R P +LV ++   NP +        FFLAG P    Q QR +  + +E ++   G
Sbjct  63    IYNNGRSPLVLVQIIDIGNPANQLDQNHRDFFLAGNPQQEVQSQRGERGRPRERISTSRG  122

Query  939   --YD--GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpek  1091
               YD  GN+ +G D + + +A N + + A K+ G N   RG IV V+       P R ++
Sbjct  123   SAYDNSGNVFSGMDERTIAEAFNINVDLARKLKGENDL-RGIIVSVEHDLEMLAPPRSQE  181

Query  1092  rrqpgrqgggSS----------NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
               +  R+               N LEET CT     NI+    ADIY+ RAGR+T++NS 
Sbjct  182   EEREEREEEAQRQLERSPRGRLNGLEETFCTTRLRHNINKPSEADIYNPRAGRVTSVNSH  241

Query  1242  TLPALSYVRLS  1274
              LP L +++LS
Sbjct  242   YLPILRFLQLS  252



>gb|AFQ32291.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 115/248 (46%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G      D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQRFHDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN  ++P ++V V   A        NP  F+LAG      +         
Sbjct  153   ATTPGVAQWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQEW--------  204

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L   R     NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     +  
Sbjct  205   --LQGRRQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRP  261

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                 +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L 
Sbjct  262   PLRGQRPQEEEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPILR  321

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  322   FIRLSALR  329


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q QC G    R+II+  G
Sbjct  18   FHGYTAQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLQCSGVSFARYIIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>gb|AAA32777.1| 12S storage protein CRA1 [Arabidopsis thaliana]
 emb|CAA32493.1| 12S seed storage protein [Arabidopsis thaliana]
Length=472

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 112/249 (45%), Gaps = 45/249 (18%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSE----------KGSEILDKYQKIRYYEKGDIIVIPASAV  779
             + G G  G ++PGCAET+Q S           +     D +QK+ +   GD I       
Sbjct  99    AKGRGLMGKVIPGCAETFQDSSEFQPRFEGQGQSQRFRDMHQKVEHIRSGDTIATTPGVA  158

Query  780   HWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              WFYN  ++P ++V V   A        NP  F+LAG                  L    
Sbjct  159   QWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW----------LQGRE  208

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------------QLP  1076
                  NI  GF  +++  AL  D +TA+++   +   RG+IV VQ            Q P
Sbjct  209   QQPQKNIFNGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRPPLRGQRP  267

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                E+      +     N LEET+C+A  T N+D+  RAD+Y  + G ++TLNS+ LP L
Sbjct  268   QEEEEEEGRHGR---HGNGLEETICSARCTDNLDDPSRADVYKPQLGYISTLNSYDLPIL  324

Query  1257  SYVRLSAAR  1283
              ++RLSA R
Sbjct  325   RFIRLSALR  333


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R+II+  GL+LPS+ +   
Sbjct  35   ECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYIIESKGLYLPSFFNTAK  94

Query  355  VAYVLQG  375
            +++V +G
Sbjct  95   LSFVAKG  101



>ref|NP_851128.1| 12S seed storage protein CRA1 [Arabidopsis thaliana]
 gb|ABL66748.1| At5g44120 [Arabidopsis thaliana]
 gb|AED95064.1| 12S seed storage protein CRU1 [Arabidopsis thaliana]
Length=368

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 109/242 (45%), Gaps = 45/242 (19%)
 Frame = +3

Query  651   GIIVPGCAETYQQSE----------KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G ++PGCAET+Q S           +     D +QK+ +   GD I        WFYN  
Sbjct  2     GKVIPGCAETFQDSSEFQPRFEGQGQSQRFRDMHQKVEHIRSGDTIATTPGVAQWFYNDG  61

Query  801   REPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
             +EP ++V V   A        NP  F+LAG                  L         NI
Sbjct  62    QEPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW----------LQGREQQPQKNI  111

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------------QLPSrpekrr  1097
               GF  +++  AL  D +TA+++   +   RG+IV VQ            Q P   E+  
Sbjct  112   FNGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRPPLRGQRPQEEEEEE  170

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
                 +     N LEET+C+A  T N+D+  RAD+Y  + G ++TLNS+ LP L ++RLSA
Sbjct  171   GRHGR---HGNGLEETICSARCTDNLDDPSRADVYKPQLGYISTLNSYDLPILRFIRLSA  227

Query  1278  AR  1283
              R
Sbjct  228   LR  229



>gb|ABZ89194.1| protein [Coffea canephora]
Length=396

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 112/222 (50%), Gaps = 33/222 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL------DKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G+G  G ++ GC ET+Q  ++  +        D++QK+  + +GD++ +PA   HW YN+
Sbjct  62    GNGVLGTLLSGCPETFQSFQQSQQRSQSQRFRDEHQKVHQFYRGDVLALPAEVAHWAYNK  121

Query  798   NREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQI  977
                 T+ ++       SFFL+G P    +       +Q +      GY   I  GF+VQI
Sbjct  122   ----TMRILF------SFFLSGNPKQQEEEGGIWQGKQSQQQQHYQGYI--IFQGFEVQI  169

Query  978   VKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggSSNALEETLCTA  1157
             +  A    +ETA K+   N   RG +V V+                  ++N LE T+CT 
Sbjct  170   LAQAFGISQETARKLQNEND-WRGDVVRVKN--------------ELHAANGLEGTICTM  214

Query  1158  TFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                +N+ N ERAD+Y +R G +++LNS  LP L Y++LSA R
Sbjct  215   RVRENLANPERADVYTARGGSISSLNSMNLPILKYLQLSAGR  256



>emb|CAA54152.1| 12s globulin [Avena sativa]
Length=472

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 112/234 (48%), Gaps = 40/234 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+ +PGC   +QQ          +  S + D++Q++  +++GD+I +PA  VHW 
Sbjct  110   GRGFTGLTLPGCPAAFQQQFQPFDRAQGQSQSHLKDEHQRVHRFKQGDVIALPAGIVHWG  169

Query  789   YNQNREPTILV----VLQRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + +    V   AN +      F LAG                     E   +
Sbjct  170   YNDGDAPVVAIYVFDVNNNANQLEPRQKEFLLAGN------------------NKEDQQF  211

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqggg  1121
               NI +GF++Q++ +AL   ++ A++I       RG I+ V Q   R +  +    Q   
Sbjct  212   GQNIFSGFNIQLLSEALGISQQAAQRI-QSQKEQRGEIIRVTQ---RLQFLKPTMSQQDR  267

Query  1122  SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             S N LEE  C+    QNI+N +RAD Y+ RAGR+T L+    P L+ V++SA R
Sbjct  268   SFNGLEENFCSLEAKQNIENPKRADTYNPRAGRITRLHGQNFPILNLVQMSATR  321


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C+  ++ A  P   + ++ G TE++D  +EQ +C G    R +I+P GL LP Y +AP +
Sbjct  45   CKFDRLQAFEPLRQVRSQAGVTEYFDEQNEQLRCTGVSVIRRVIEPQGLLLPQYHNAPGL  104

Query  358  AYVLQG  375
             Y+LQG
Sbjct  105  VYLLQG  110



>emb|CDY38381.1| BnaC01g09900D [Brassica napus]
Length=475

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 124/269 (46%), Gaps = 61/269 (23%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSEK-------------GSEILDKY  722
             G +LP  FS+        G G  G +VPGCAET+  S+                   D +
Sbjct  84    GLYLPTFFSSPKISYVVQGMGISGRVVPGCAETFMDSQPMQGQQQGQQGQQGQQGFRDMH  143

Query  723   QKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGK--P  869
             QK+ +   GD+I I A + HW YN   +P +++ L            NP +F LAG    
Sbjct  144   QKVEHVRHGDVIAITAGSSHWIYNTGDQPLVIICLLDIANYQNQLDRNPRTFRLAGNNPQ  203

Query  870   GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
             G S Q Q++Q                N+L+GFD Q++  AL  D   A+++       RG
Sbjct  204   GGSQQQQQQQQ---------------NMLSGFDPQVLAQALKIDVRLAQEL-QNQQDSRG  247

Query  1050  HIVIVQ-----------QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERAD  1196
             +IV V+           Q     + R   G       N LEET+C+    +NID+  RAD
Sbjct  248   NIVRVKGPFQVVRPPLRQPYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARAD  307

Query  1197  IYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +Y    GR+T++NS+TLP L Y+RLSA R
Sbjct  308   VYKPNLGRVTSVNSYTLPILQYIRLSATR  336


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R QS          C L  +  ++PT  I +E G  E+WD N+ Q +C G    
Sbjct  18   LNGCLAR-QSLGVPPQIGNACNLDNLDVLQPTETIKSEAGRVEYWDHNNPQIRCAGVSVS  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R II+  GL+LP++ S+P ++YV+QG
Sbjct  77   RLIIEQGGLYLPTFFSSPKISYVVQG  102



>gb|ABK80751.1| 11S globulin precursor isoform 1A [Ficus pumila var. awkeotsang]
Length=510

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 128/270 (47%), Gaps = 54/270 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG----SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G G  G + PGCAET+++S++G    +   D++QK+R++ +GDII IPA    W YN   
Sbjct  106   GRGILGTVFPGCAETFEESQRGQGRSARPEDRHQKLRHFREGDIIAIPAGVACWTYNNGD  165

Query  804   EPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLM-----TERLGY  941
             +  + V L            NP  F+LAGKP      Q++Q +Q QE         R   
Sbjct  166   QQLVSVTLLDTSNVENQLDQNPRRFYLAGKPEDEFDPQQQQHQQYQEQQGRDPSRRRWSS  225

Query  942   DG--NILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIVIVQQLPSrpekrr  1097
             +   NI  G + + ++ A N D ETA +I G N       + +G + +V  L    ++R+
Sbjct  226   ENKYNIFGGLNTRFIEKAFNVDSETARRIQGQNDNRNNIIKVKGRLDLVSPLTRSSQERK  285

Query  1098  qpgrqgggS----------------------------SNALEETLCTATFTQNIDNRERA  1193
             + GR                                  N L+ET C+    +NI +  RA
Sbjct  286   REGRWEEEREREERWEEEREREQRERERDWRRRRGDYDNGLKETFCSMRLKENIGDPSRA  345

Query  1194  DIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             DI+  +AGR++ +NSF LP L ++RLSA R
Sbjct  346   DIFTPQAGRISNVNSFNLPILRHLRLSAER  375


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            QNE CQ   + A+ P   I AE G  E WDP+HEQFQC G    R  I+PNGL LPSYT+
Sbjct  38   QNE-CQFDNLQALEPDTRIQAEAGLIESWDPDHEQFQCAGVAVVRRTIEPNGLHLPSYTN  96

Query  346  APLVAYVLQG  375
             P + Y+++G
Sbjct  97   TPQLIYIVRG  106



>ref|XP_010671026.1| PREDICTED: 13S globulin seed storage protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 108/238 (45%), Gaps = 26/238 (11%)
 Frame = +3

Query  615   YFLPFSTGSGEYGIIVPGCAETYQQSEKGSEI-----LDKYQKIRYYEKGDIIVIPASAV  779
             Y    + G G  G+IVPGC E+++    GSE       D +QK+    +GD+I  PA  V
Sbjct  101   YVTYVTQGRGLQGVIVPGCPESFESPRVGSETSQEEERDDHQKVFRVREGDVIGSPAGVV  160

Query  780   HWFYNQNREPTILV-VLQRANP--------VSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              W YN    P + V +L  +NP         SF+LAG P      +R            R
Sbjct  161   QWTYNDGDTPIVSVTLLDLSNPHNQLDLNFRSFYLAGNPQGQKGQERGP----------R  210

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-LPSrpekrrqpgr  1109
                  NI  GF+ +++ D  N D E    I   N   RG I+ V++ L     +  Q   
Sbjct  211   EVAGKNIFNGFNDELLADVFNVDTEIIRNIKAEND-DRGSIIRVERDLELLNPEWDQMEE  269

Query  1110  qgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +     N LEET C+ +F  NID    AD++    GR+ TLN   LP L Y++LS  R
Sbjct  270   ERMRRFNGLEETFCSLSFKHNIDQPLHADVFTKYGGRINTLNGHKLPLLQYIQLSVER  327


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C + Q+ A  PT  + AE G  E W+ N EQF+C G  A R++I+P GL LPSYT+AP 
Sbjct  42   ECDIQQLRAAEPTRRLRAEAGLIEVWETNDEQFRCAGVAAVRYVIEPKGLLLPSYTNAPY  101

Query  355  VAYVLQG  375
            V YV QG
Sbjct  102  VTYVTQG  108



>emb|CDY65916.1| BnaC07g48660D [Brassica napus]
Length=456

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 119/253 (47%), Gaps = 41/253 (16%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSE----------KGSEILDKYQKI  731
             G +LP  FST        G G  G +VPGCAET+Q S           +G    D +QK+
Sbjct  77    GLYLPSFFSTAKLSFVAKGEGLMGRVVPGCAETFQDSSVFQPGGGQQSQGQGFRDMHQKV  136

Query  732   RYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHq  884
              +   GD I        WFYN   +P ++V VL  A        NP  F+LAG       
Sbjct  137   EHIRTGDTIATHPGVAQWFYNDGNQPLVIVSVLDLASHQNQLDRNPRPFYLAGNNPQGQV  196

Query  885   gqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV  1064
                 + +Q Q+          NIL GF  +++  A   D  TA+++       RG+I+ V
Sbjct  197   WIEGREQQPQK----------NILNGFTPEVLAKAFKIDVRTAQQL-QNQQDNRGNIIRV  245

Query  1065  QQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
             Q  P    +     ++     N LEET+C+A  T N+D+   AD+Y  + G ++TLNS+ 
Sbjct  246   QG-PFSVIRPPLRSQRPQEEVNGLEETICSARCTDNLDDPSNADVYKPQLGYISTLNSYD  304

Query  1245  LPALSYVRLSAAR  1283
             LP L ++RLSA R
Sbjct  305   LPILRFLRLSALR  317


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + AE G  E WD +  Q +C G    R+II+  G
Sbjct  18   LHGSTAQQFPNECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSGVSFVRYIIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ S   +++V +G
Sbjct  78   LYLPSFFSTAKLSFVAKG  95



>gb|EYU17920.1| hypothetical protein MIMGU_mgv1a006934mg [Erythranthe guttata]
Length=425

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 92/166 (55%), Gaps = 22/166 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEKGSE---------ILDKYQKIRYYEKGDIIVIPASAV  779
             G G +G+++ GC ET+   QQ+++ SE          LD++QKI  + +GDI+ IPA A 
Sbjct  102   GEGIFGVMISGCPETFESSQQTQRQSEEEGSGRRQRFLDRHQKIGQFRQGDILAIPAGAA  161

Query  780   HWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
             HW YN   +  ++VVLQ           NP SFFLAG PG+  Q Q +    ++    +R
Sbjct  162   HWAYNTGDQEFVVVVLQDTTNNANQLDQNPRSFFLAGNPGNPGQEQEQSHGSRRGGGEQR  221

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ  1070
                 GN+  GFDVQ + +    D ETA K+ G N   RGH++IV++
Sbjct  222   QHELGNVFRGFDVQTLAEVFGVDEETARKLQGENDE-RGHLIIVER  266


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C +++I+A  P+  + AEGG +EFW+ N ++FQC G    RH ++   L LP+Y +APL+
Sbjct  37   CHITRINAQDPSYRLRAEGGVSEFWNHNSDEFQCAGVAFHRHTLRSKALMLPAYHNAPLL  96

Query  358  AYVLQG  375
            AY+L+G
Sbjct  97   AYILKG  102



>ref|XP_002524604.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37812.1| legumin A precursor, putative [Ricinus communis]
Length=475

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 129/263 (49%), Gaps = 40/263 (15%)
 Frame = +3

Query  609   DGYFLP----------FSTGSGEYGIIVPGCAETYQQSEKGSEILDK---YQKIRYYEKG  749
             DG  LP             G G  G + PGCAET+Q+S++ S    +   +QKIR++ +G
Sbjct  79    DGLLLPAYSNAPQLVYIVQGQGMLGAMFPGCAETFQESQESSRSSRQQEQHQKIRHFRRG  138

Query  750   DIIVIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKP------GSSHq  884
             D+I +PA   HW YN   EP I V VL           NP +F+LAG P       S   
Sbjct  139   DVIALPAGIAHWCYNDGNEPLIAVSVLDTGNNANQLDRNPRNFYLAGNPEDEFQQQSRRP  198

Query  885   gqreqgrqqqeLMTERLGYD-GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVI  1061
             G+R  G       +ER      N+  G D + + +A N D + A +I G +   RG+IV 
Sbjct  199   GERGHGEYSLGGSSERRQRSCNNVFCGMDSRFIAEAFNIDEQLARRIQGQDD-ARGNIVR  257

Query  1062  VQ------QLPSrpekrrqpgrqgggSS----NALEETLCTATFTQNIDNRERADIYDSR  1211
             V+      + P   ++R +   +         N +EET CT    +NI +  RADI+   
Sbjct  258   VEGRIQVTRPPRTQQEREEQLEREYEQGRRHYNGIEETFCTMRMRENIADPSRADIFVPE  317

Query  1212  AGRLTTLNSFTLPALSYVRLSAA  1280
              GR++T+NS +LP L +++LSA+
Sbjct  318   VGRMSTVNSHSLPILRWLKLSAS  340


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +C++ +I+A  P   I +E GT E WDPNH+QF+C G    RH IQP+GL LP+Y++
Sbjct  29   QQNECRIDRINAREPDSRIQSEAGTIESWDPNHDQFRCAGVAVTRHTIQPDGLLLPAYSN  88

Query  346  APLVAYVLQG  375
            AP + Y++QG
Sbjct  89   APQLVYIVQG  98



>ref|NP_001291327.1| legumin B-like precursor [Sesamum indicum]
 gb|ABB60054.1| 11S globulin precursor isoform 3 [Sesamum indicum]
Length=491

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 128/263 (49%), Gaps = 40/263 (15%)
 Frame = +3

Query  612   GYFLPFST----------GSGEYGIIVPGCAETYQQS--------EKGSEILDKYQKIRY  737
             G  LP+ T          GSG  G ++PGCAETY+          E+G +  D++QK+R 
Sbjct  97    GLLLPYYTNAPQLVYIVRGSGIQGTVIPGCAETYESESGVGSTGEEEGRQRTDRHQKLRR  156

Query  738   YEKGDIIVIPASAVHWFYNQNREPTILV----VLQRANPV-----SFFLAGKPGSSHqgq  890
             + +GD++ +     HW YN    P I V    V   AN +      FFLAG P ++    
Sbjct  157   FRRGDVLALREGVTHWAYNDGDTPIISVSIRDVANEANQLDLKFRKFFLAGNPQTAQFQG  216

Query  891   reqgrqqqeLMTERLGYDG----NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV  1058
             +++  QQ      R   +G    NI  GF+ + + ++ NTD +   K+       RG IV
Sbjct  217   QQEREQQPRGEGRRGQEEGQGTSNIFNGFNEEFLAESFNTDPQLIRKL-QSREDNRGIIV  275

Query  1059  IVQQ-----LPSrpekrrqpgrqgggSS---NALEETLCTATFTQNIDNRERADIYDSRA  1214
               ++     LP    + +Q  R+ G      N LEET+C+    +NI++      Y+ R 
Sbjct  276   RAERPLRLVLPEYGREEQQRQREQGRGGGYMNGLEETICSLRIRENIEHTAATHSYNPRG  335

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR++T+NS TLP LS +RLSA +
Sbjct  336   GRISTINSQTLPILSQLRLSAEK  358


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ+ Q+ A +P+  + +E G TEFWD N+E+FQC G    RH IQP GL LP YT+AP 
Sbjct  49   ECQVQQLTARQPSSRLQSEAGVTEFWDANNEEFQCAGIEFVRHTIQPRGLLLPYYTNAPQ  108

Query  355  VAYVLQGT  378
            + Y+++G+
Sbjct  109  LVYIVRGS  116



>gb|ACB55490.1| Pis v 5.0101 allergen 11S globulin precusor [Pistacia vera]
Length=473

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 116/244 (48%), Gaps = 31/244 (13%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK------GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G ++PGC ETYQ  ++       S   DK+QKI+ + KGDII +PA   +W YN+
Sbjct  98    GEGMTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNE  157

Query  798   NREPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
                P + V L   +         P  F LAG P    Q Q++Q  + +    ++     N
Sbjct  158   GNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSC--NN  215

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ-------------QLPSrpek  1091
             I  GFD +I+ +    ++    K +      RG IV V+             +     E+
Sbjct  216   IFCGFDTKILAEVFQVEQSLV-KQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEE  274

Query  1092  rrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +  R   G  N LEET+CT    +NI +  R+DIY    GR+T+LNS  LP L +++L
Sbjct  275   ESEYERGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQL  334

Query  1272  SAAR  1283
             SA R
Sbjct  335   SAER  338


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC   RQ       Q  +CQ+ Q+ A+ P   +  E G  E WDPNHEQF+C G    
Sbjct  17   FHGCLASRQQ----GQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVA  72

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            RH IQPNGL LP Y++AP + Y+++G
Sbjct  73   RHTIQPNGLRLPEYSNAPTLMYIVEG  98



>ref|XP_006647245.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha]
Length=503

 Score =   107 bits (266),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 119/257 (46%), Gaps = 49/257 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE---------------ILDKYQKIRYYEKGDIIVIPA  770
             G G +G+ +PGC ET+Q  +   E               ++D++Q+IR + +GD+I +PA
Sbjct  114   GRGVFGVALPGCPETFQTVQSSFEQQMATASEAQSTTKKLVDEHQQIRQFHQGDVIAVPA  173

Query  771   SAVHWFYNQNREPTILVVL-------QRANP--VSFFLAGKPGSSHqgqreqgrqqqeLM  923
                HW YN    P +   +        + NP    FFLAGKP S  Q             
Sbjct  174   GVAHWLYNNGDSPVVAFTVIGTNNNANQLNPRRREFFLAGKPRSWQQQLYSYKG------  227

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------  1070
              E+   + NI AGF   ++ +AL   ++ A ++   N R RG I+ V+            
Sbjct  228   -EQQSSNQNIFAGFSPDLLSEALGVSKQMALRLQSLNDR-RGAIIRVEHGLQALQPSFQA  285

Query  1071  ------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTL  1232
                   L  + +       + GG  N L++ +C+    +NI+N + +DI++ R+GR+T  
Sbjct  286   EAMQEGLSQQQQPTWLQSGRAGGQRNGLDDIMCSFKLRKNINNPQSSDIFNPRSGRITRA  345

Query  1233  NSFTLPALSYVRLSAAR  1283
             NS   P L+ +++SA R
Sbjct  346   NSQNFPILNIIQMSATR  362



>ref|XP_007201716.1| hypothetical protein PRUPE_ppa003759mg [Prunus persica]
 gb|EMJ02915.1| hypothetical protein PRUPE_ppa003759mg [Prunus persica]
Length=551

 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 110/232 (47%), Gaps = 41/232 (18%)
 Frame = +3

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAG  863
             LD++QK R   +GD++ IPA   +W YN   +  + V L            NP  F+LAG
Sbjct  187   LDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSEHNQLDQNPRKFYLAG  246

Query  864   KP---------------GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNT  998
              P               G   +  + Q    +    E+ G   N+ +GF+ Q++  ALN 
Sbjct  247   NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPGQQEQQGNGNNVFSGFNTQLLAQALNV  306

Query  999   DRETAEKIIGGN------ARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSS  1127
             + ETA  + G N       R RG++  VQ           +      ++ +  + G   +
Sbjct  307   NEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGGQLMA  366

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LEET C+    +NI N ERADI+  RAGR++TLNS+ LP L ++RLSA R
Sbjct  367   NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSYNLPILRFLRLSAER  418


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC   RQS   Q S   +CQL+Q+ A  P   I  E G  E W+ N E FQC G  A 
Sbjct  15   FNGCLAARQS---QLSPQNQCQLNQLQAREPDNRIQGEAGQIETWNFNQEDFQCAGVAAS  71

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQ NGL LPSY++AP + Y++QG
Sbjct  72   RITIQRNGLHLPSYSNAPQLIYIVQG  97



>ref|XP_010481774.1| PREDICTED: 12S seed storage protein CRA1-like [Camelina sativa]
Length=465

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 114/248 (46%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G   +  D +QK+ +   GD I
Sbjct  90    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQKFHDMHQKVEHIRSGDTI  149

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN  ++P ++V V   A        NP  F+LAG                
Sbjct  150   ATTPGVAQWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW--------  201

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L         NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     +  
Sbjct  202   --LHEREQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRP  258

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                 +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L 
Sbjct  259   PLRGQRPQEEEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPILR  318

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  319   FIRLSALR  326


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  GL+LPS+ +   
Sbjct  26   ECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFTRYVIESKGLYLPSFVNTAK  85

Query  355  VAYVLQG  375
            +++V QG
Sbjct  86   LSFVAQG  92



>ref|XP_008447426.1| PREDICTED: legumin A-like [Cucumis melo]
Length=496

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 118/253 (47%), Gaps = 37/253 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK-GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPT  812
             G G  G+++PGC +TYQ+S++ G    D++QKIR+   GD+  +PA + HW YN   E  
Sbjct  111   GRGFKGVVLPGCPQTYQESQQSGGAFRDQHQKIRHVRAGDLFAVPAGSAHWTYNDGNERL  170

Query  813   ILVVL----QRAN-----PVSFFLAGKPGSS----HqgqreqgrqqqeLMTERLGYDGNI  953
             I VVL      AN     P +F+LAG P           + +  +      E      NI
Sbjct  171   IAVVLLDVSNHANQLDFHPRTFYLAGNPEEEFPEWRLQWKREQGRHMSGRKEGSSNKNNI  230

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLP-------------------  1076
                FD +++ + LN + E A K+ G +   R  I +   L                    
Sbjct  231   FYAFDDRVLAEILNINIELARKLRGEDDFRRNIIKVEGGLEVIRPPRSRGGRRGEEQEWE  290

Query  1077  ----SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
                    E++R+  ++     N L+ET+C+    +NI +  RAD+Y   AGRL+T NS  
Sbjct  291   EEQEEEMERQRERHQRSRWDENGLDETICSMKMKENIGDASRADMYTPEAGRLSTTNSHR  350

Query  1245  LPALSYVRLSAAR  1283
              P L +++LSA R
Sbjct  351   FPILRWLQLSAER  363


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 8/94 (9%)
 Frame = +1

Query  118  FNGCFGRRQSF--------HGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQF  273
            FN C     +F           +S+  +C+L ++ A+ P+  I AEGG  E WDP+HE F
Sbjct  18   FNACLATNDNFRYVSRRFGEAGQSRYRECRLDKLEAVEPSRRIEAEGGVIEMWDPSHEMF  77

Query  274  QCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            +C G    R+II PNGL LP YT+AP + Y+ +G
Sbjct  78   RCAGVAIQRYIIDPNGLLLPQYTNAPRLIYIERG  111



>emb|CDY14908.1| BnaA02g22500D [Brassica napus]
Length=462

 Score =   106 bits (264),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 108/242 (45%), Gaps = 35/242 (14%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQS---EKGS------------EILDKYQKIRYYEKGDIIVI  764
             + G G  G +VPGCAET+Q S   + GS               D +QK+ +   GD I  
Sbjct  93    AKGQGLMGRVVPGCAETFQDSSVFQPGSGSPFGEGQGQGQGFRDMHQKVEHIRSGDTIAT  152

Query  765   PASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqe  917
                   WFYN   +P ++V +            NP  F+LAGK            + Q  
Sbjct  153   HPGVAQWFYNNGNQPLVIVAVMDLASHQNQLDRNPRPFYLAGK----------NPQGQSW  202

Query  918   LMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrr  1097
             L         NIL GF  +++  A   D  TA+++       RG+IV VQ          
Sbjct  203   LHGRGQQPQNNILNGFSPEVLAQAFKIDVRTAQQL-QNQQDNRGNIVRVQGPFGVIRPPL  261

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             +  R     +N LEET+C+A  T N+D+   AD+Y  + G ++ LNS+ LP L  +RLSA
Sbjct  262   KSQRPQETEANGLEETICSARCTDNLDDPSNADVYKPQLGYISILNSYDLPILRVLRLSA  321

Query  1278  AR  1283
              R
Sbjct  322   LR  323


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + AE G  E WD +  Q +C G    R+II+  G
Sbjct  18   LHGSTAQQFPNECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSGVSFVRYIIESQG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V +G
Sbjct  78   LYLPSFLNTAKLSFVAKG  95



>gb|AFQ32289.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 116/249 (47%), Gaps = 43/249 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G   +  D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQKFHDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrq  908
                     WFYN  ++P ++V           L R NP  F+LAG             + 
Sbjct  153   ATTPGVAQWFYNDGQQPLVIVSIFDLASHQNQLDR-NPRPFYLAGN----------NPQG  201

Query  909   qqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LP  1076
             Q  L         NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     + 
Sbjct  202   QVWLHGREQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIR  260

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                  +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L
Sbjct  261   PPLRGQRPQEEEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPIL  320

Query  1257  SYVRLSAAR  1283
              ++RLSA R
Sbjct  321   RFIRLSALR  329


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   FHGSTAQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFTRYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>ref|XP_010441951.1| PREDICTED: 12S seed storage protein CRA1 [Camelina sativa]
Length=468

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 115/248 (46%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G      D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQRFHDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN  ++P ++V V   A        NP  F+LAG             + Q
Sbjct  153   ATTPGVAQWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGN----------NPQGQ  202

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L         NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     +  
Sbjct  203   VWLHGREQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRP  261

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                 +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L 
Sbjct  262   PLRGQRPQEEEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPILR  321

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  322   FIRLSALR  329


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   FHGYTAQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFTRYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>gb|AFQ32292.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 115/248 (46%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G      D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQRFHDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN  ++P ++V V   A        NP  F+LAG             + Q
Sbjct  153   ATTPGVAQWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGN----------NPQGQ  202

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L         NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     +  
Sbjct  203   VWLHGREQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRP  261

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                 +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L 
Sbjct  262   PLRGQRPQEEEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPILR  321

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  322   FIRLSALR  329


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   FHGYTAQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFTRYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>ref|NP_001289907.1| uncharacterized protein LOC104725055 precursor [Camelina sativa]
 gb|AFQ32293.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 114/248 (46%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ---------------QSEKGS--EILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q               Q E+G      D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPRQGRQFEGQGEEGQSQRFHDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN   +P ++V V   A        NP  F+LAG             + Q
Sbjct  153   ATTPGVAQWFYNDGHQPLVIVSVFDLASHQNQLDRNPRPFYLAGN----------NPQGQ  202

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L         NI +GF  +++  AL  D +TA+++   +   RG+IV VQ     +  
Sbjct  203   VWLHGREQQPQKNIFSGFGPEVIAQALKIDLQTAQQLQNQDD-NRGNIVRVQGPFGVIRP  261

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                 +R    +     N LEET+C+A    N+D+  RAD+Y  + G ++TLNS+ LP L 
Sbjct  262   PLRGQRPQEGEEERVGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLNSYDLPILR  321

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  322   FIRLSALR  329


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   FHGYTAQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>ref|XP_010262323.1| PREDICTED: glutelin type-B 5-like [Nelumbo nucifera]
Length=473

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/240 (33%), Positives = 112/240 (47%), Gaps = 36/240 (15%)
 Frame = +3

Query  627   FSTGSGEYGIIVPGCAETYQ--QSEKGS----EILDKYQKIRYYEKGDIIVIPASAVHWF  788
             F  G G  G++ PGC ETYQ  Q  KG        D +QKIR + +GD+I  P    HW+
Sbjct  110   FVQGRGFTGVVFPGCPETYQSFQQSKGKGGSRRYEDFHQKIRNFHQGDVIAYPTGVAHWW  169

Query  789   YNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + V +      AN +      F LAG   +  +             T +   
Sbjct  170   YNDGDTPVVAVTVIDTSNNANQLDQNLRKFQLAGNQENQQEN------------TSQQKS  217

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------QLPSrpekrrqp  1103
               NI +GFD + + +A     +TA K+ G +   RG IV+V       + P   E+R + 
Sbjct  218   TNNIFSGFDTETLAEAFGVSTKTARKLQGHDD-DRGEIVLVNDGLQVIRPPRSQEQREEE  276

Query  1104  grqgggSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
               +    S  N LEE  C     +NI++  RAD+Y  + GRL+ LNS  LP L +++LSA
Sbjct  277   EEKQQQQSRDNGLEEAFCNMRLRENIEDPYRADVYSFKGGRLSRLNSQNLPILHHLQLSA  336


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +1

Query  148  FHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLF  327
            F GQ     +CQL    A+ P+  I +EGG TE+W+ N++Q  C G    RH+I+P GL 
Sbjct  42   FRGQR----ECQLQDFSALEPSTRIESEGGVTEYWEENNQQLNCAGVAVIRHVIEPKGLL  97

Query  328  LPSYTSAPLVAYVLQG  375
            LPSYT+AP + Y +QG
Sbjct  98   LPSYTNAPKLTYFVQG  113



>gb|AAC61881.1| 11S storage globulin [Coffea arabica]
Length=487

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 125/261 (48%), Gaps = 55/261 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-----------QSEKGSE------------ILDKYQKIRYYEK  746
             G+G  G ++PGCAET++           Q  KG E              D++QK+R ++K
Sbjct  102   GTGVQGTVIPGCAETFESQGESFSGGQEQPGKGQEGSKGGQEGQRQRFPDRHQKLRRFQK  161

Query  747   GDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreq  899
             GD++++      W YN    P + V L      AN +      FFLAG P      +   
Sbjct  162   GDVLILLPGFTQWTYNDGDVPLVTVALLDVANEANQLDLQSRKFFLAGNPQQGGGKEG--  219

Query  900   grqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQL--  1073
                       +     NI +GFD Q++ +A N D +  +K+ G   + RG  V  ++L  
Sbjct  220   -------HQGQQQQHRNIFSGFDDQLLAEAFNVDLKIIQKLKGPKDK-RGSTVRAEKLQL  271

Query  1074  --PSrpekrrqpgrqgggS---------SNALEETLCTATFTQNIDNRERADIYDSRAGR  1220
               P   E+ +QP +Q G           SN LEETLCT   ++NI   + AD+++ RAGR
Sbjct  272   FLPEYSEQEQQPQQQQGQQQQGVGRGWRSNGLEETLCTVKLSENIGLPQEADVFNPRAGR  331

Query  1221  LTTLNSFTLPALSYVRLSAAR  1283
             +TT+NS  +P LS ++LSA R
Sbjct  332   ITTVNSQKIPILSSLQLSAER  352


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = +1

Query  118  FNGCF---GRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGA  288
            F GC    GR +   G ++Q   C + +++A  P+   P+E G TEFWD N+ +F C G 
Sbjct  17   FLGCLAQLGRPEPRLGGKTQ---CNIQKLNAQEPSFRFPSEAGLTEFWDSNNPEFGCAGV  73

Query  289  YAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
               R+ +QP GL LP Y++ P   YV++GT
Sbjct  74   EFERNTVQPKGLRLPHYSNVPKFVYVVEGT  103



>ref|XP_002863608.1| hypothetical protein ARALYDRAFT_494580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39867.1| hypothetical protein ARALYDRAFT_494580 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 111/249 (45%), Gaps = 45/249 (18%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSEK----------GSEILDKYQKIRYYEKGDIIVIPASAV  779
             + G G  G ++PGCAET+Q S +               D +QK+ +   GD I       
Sbjct  99    AKGRGLMGKVIPGCAETFQDSSEFQPRFEGQGERQRFRDMHQKVEHIRSGDTIATTPGVA  158

Query  780   HWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              WFYN  ++P ++V V   A        NP  F+LAG                  L    
Sbjct  159   QWFYNDGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW----------LQGRE  208

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ------------QLP  1076
                  NI  GF  +++  AL  D +TA+++       RG+IV V+            Q P
Sbjct  209   QQPQKNIFNGFGPEVIAQALKIDLKTAQQL-QNQEDNRGNIVRVEGPFGVIRPPLRGQRP  267

Query  1077  SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                EK      +     N LEET+C+A  T N+D+  RAD+Y  + G ++TLNS+ LP L
Sbjct  268   QEEEKEEGRHGR---HGNGLEETICSARSTDNLDDPSRADVYKPQLGYISTLNSYDLPIL  324

Query  1257  SYVRLSAAR  1283
              ++RLSA R
Sbjct  325   RFIRLSALR  333


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R+II+  GL+LPS+ +   
Sbjct  35   ECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYIIESKGLYLPSFFNTAK  94

Query  355  VAYVLQG  375
            +++V +G
Sbjct  95   LSFVAKG  101



>emb|CDY22309.1| BnaA06g36310D [Brassica napus]
Length=462

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 119/259 (46%), Gaps = 47/259 (18%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSE----------------KGSEIL  713
             G +LP  FST        G G  G +VPGCAET+Q S                 +G    
Sbjct  77    GLYLPSFFSTAKLSFVAKGQGLMGRVVPGCAETFQDSSVFQPGGQGQQGQGQQGQGQGFR  136

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGK  866
             D +QK+ +   GD I        WFYN   +P ++V VL  A        NP  F+LAG 
Sbjct  137   DMHQKVEHIRTGDTIATHPGVAQWFYNDGNQPLVIVSVLDLASHQNQLDRNPRPFYLAGN  196

Query  867   PGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGR  1046
                       + +Q Q+          NIL GF  +++  A   D  TA+++       R
Sbjct  197   NPQGQVWIEGREQQPQK----------NILNGFTPEVLAKAFKIDVRTAQQL-QNQEDNR  245

Query  1047  GHIVIVQQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLT  1226
             G+I+ VQ  P    +     ++     N LEET+C+A  T N+D+   AD+Y  + G ++
Sbjct  246   GNIIRVQG-PFSVIRPPLRSQRPQEEVNGLEETICSARCTDNLDDPSNADVYKPQLGYIS  304

Query  1227  TLNSFTLPALSYVRLSAAR  1283
             TLNS+ LP L ++RLSA R
Sbjct  305   TLNSYDLPILRFLRLSALR  323


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + AE G  E WD +  Q +C G    R+II+  G
Sbjct  18   LHGSTAQQFPNECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSGVSFVRYIIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ S   +++V +G
Sbjct  78   LYLPSFFSTAKLSFVAKG  95



>emb|CAA57847.1| globulin precursor [Magnolia salicifolia]
Length=476

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 120/237 (51%), Gaps = 28/237 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---QSEKGSEILDKYQ-------KIRYYEKGDIIVIPASAVHW  785
             GSG  G I+PGC E++Q   QSE+      + Q       KI+++ +GD+I IPA   HW
Sbjct  110   GSGITGAIIPGCPESFQSFQQSEQREGGQGQRQRQRDQHQKIQHFRQGDVIAIPAGVAHW  169

Query  786   FYNQNREPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN    P +LV VL  +N  +        F LAG        Q++  +  Q+  T   G
Sbjct  170   TYNDRETPVVLVSVLDTSNYANQLDQNHRRFRLAGG------QQQQSRQSYQQQQTREQG  223

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgg  1118
                NI  GF+V+ + +A    RETA K+   +   RG IV V+         R+   +  
Sbjct  224   PSDNIFNGFNVETLAEAFGVSRETARKLQSQDD-NRGSIVRVENGLQVVRPPRREEDEEQ  282

Query  1119  gSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N LEET C+A  T NI +  RAD+Y+ +AGR+T+LNS   P L+ ++LSA R
Sbjct  283   EQFRLNGLEETQCSAKLTYNIADPTRADVYNPQAGRITSLNSQKFPILNVLQLSAER  339


 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C++  + A+ P     +E G TE WD N+EQ +C G  A RH I P GL LPS+ +AP 
Sbjct  44   ECRVESLSALEPNRRYESEAGVTEQWDQNNEQLECAGVAATRHTIAPRGLLLPSFDNAPR  103

Query  355  VAYVLQGT  378
            + YV+QG+
Sbjct  104  LIYVVQGS  111



>gb|AAC61983.1| 11S storage globulin [Coffea arabica]
Length=490

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 131/271 (48%), Gaps = 59/271 (22%)
 Frame = +3

Query  618   FLPFSTGSGEYGIIVPGCAETYQ-----------QSEKGSE----------------ILD  716
             F+    G+G  G ++PGCAET++           Q  KG E                  D
Sbjct  95    FVYVVEGTGVQGTVIPGCAETFESQGESFWGGQEQPGKGQEGQEQGSKGGQEGRRQRFPD  154

Query  717   KYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKP  869
             ++QK+R ++KGD++++      W YN    P + V L      AN +      FFLAG P
Sbjct  155   RHQKLRRFQKGDVLILLPGFTQWTYNDGDVPLVTVALLDVANEANQLDLQSRKFFLAGNP  214

Query  870   GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
                   +  QG+QQQ           NI +GFD Q++ DA N D +  +K+ G   + RG
Sbjct  215   QQGGGKEGHQGQQQQHR---------NIFSGFDDQLLADAFNVDLKIIQKLKGPKDQ-RG  264

Query  1050  HIVIVQQL----PSrpekrrqpgrqgggS---------SNALEETLCTATFTQNIDNRER  1190
               V  ++L    P   E+ +QP +Q             SN LEETLCT   ++NI   + 
Sbjct  265   STVRAEKLQLFLPEYSEQEQQPQQQQEQQQHGVGRGWRSNGLEETLCTVKLSENIGLPQE  324

Query  1191  ADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             AD+++ RAGR+TT+NS  +P LS ++LSA R
Sbjct  325   ADVFNPRAGRITTVNSQKIPILSSLQLSAER  355


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C + +++A  P+   P+E G TEFWD N+ +F C G    R+ +QP GL LP Y++ P 
Sbjct  35   QCDIQKLNAQEPSFRFPSEAGLTEFWDSNNPEFGCAGVEFERNTVQPKGLRLPHYSNVPK  94

Query  355  VAYVLQGT  378
              YV++GT
Sbjct  95   FVYVVEGT  102



>emb|CAA76573.1| 11S storage protein [Coffea arabica]
Length=492

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 126/271 (46%), Gaps = 59/271 (22%)
 Frame = +3

Query  618   FLPFSTGSGEYGIIVPGCAETYQ-----------QSEKGSE----------------ILD  716
             F+    G+G  G ++PGCAET++           Q  KG E                  D
Sbjct  95    FVYVVEGTGVQGTVIPGCAETFESQGESFWGGQEQPGKGQEGQEQGSKGGQEGRRQRFPD  154

Query  717   KYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL----QRANPV-----SFFLAGKP  869
             ++QK+R ++KGD++++      W YN    P + V L      AN +      FFLAG P
Sbjct  155   RHQKLRRFQKGDVLILLPGFTQWTYNDGDVPLVTVALLDVANEANQLDLQSRKFFLAGNP  214

Query  870   GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG  1049
                   +             +     NI +GFD Q++ DA N D +  +K+ G   + RG
Sbjct  215   QQGGGKEG---------HQGQQQQHRNIFSGFDDQLLADAFNVDLKIIQKLKGPKDQ-RG  264

Query  1050  HIVIVQQL----PSrpekrrqpgrqgggS---------SNALEETLCTATFTQNIDNRER  1190
               V  ++L    P   E+ +QP +Q             SN LEETLCT   ++NI   + 
Sbjct  265   STVRAEKLQLFLPEYSEQVQQPQQQQEQQQHGVGRGWRSNGLEETLCTVKLSENIGLPQE  324

Query  1191  ADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             AD+++ RAGR+TT+NS  +P LS ++LSA R
Sbjct  325   ADVFNPRAGRITTVNSQKIPILSSLQLSAER  355


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C + +++A  P+   P+E G TEFWD N+ +F C G    R+ +QP GL LP Y++ P 
Sbjct  35   QCDIQKLNAQEPSFRFPSEAGLTEFWDSNNPEFGCAGVEFERNTVQPKGLRLPHYSNVPK  94

Query  355  VAYVLQGT  378
              YV++GT
Sbjct  95   FVYVVEGT  102



>gb|EEC73106.1| hypothetical protein OsI_07091 [Oryza sativa Indica Group]
Length=489

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 120/263 (46%), Gaps = 54/263 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE---------------ILDKYQKIRYYEKGDIIVIPA  770
             G G +G+ +PGC ET+Q      E               + D++Q++  + +GD+I +PA
Sbjct  93    GRGVFGMALPGCPETFQSVRSPFEQEVATAGEAQSSMQKMRDEHQQLHQFHQGDVIAVPA  152

Query  771   SAVHWFYNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLM  923
                HW YN    P +   V+  +N  +        FFLAGKP SS        +Q     
Sbjct  153   GVAHWLYNNGDSPVVAFTVIDTSNNANQLDPKRREFFLAGKPRSS------WQQQSYSYQ  206

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------  1070
             TE+L  + NI AGF+  ++ +AL+  ++T  + + G +  RG I+ V+            
Sbjct  207   TEQLSRNQNIFAGFNPDLLSEALSVSKQTVLR-LQGLSDPRGAIIRVENGLQALQPSLQV  265

Query  1071  -----------LPSrpekrrqpgr-qgggSSNALEETLCTATFTQNIDNRERADIYDSRA  1214
                        LP++  +          G  N L+E +C     +NIDN + +DI++   
Sbjct  266   EPVKEEQTQAYLPTKQLQPTWSRSGGACGQQNGLDEIMCAFKLRKNIDNPQSSDIFNPHG  325

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR+T  NS   P L+ +++SA R
Sbjct  326   GRITRANSQNFPILNIIQMSATR  348



>gb|KDO60493.1| hypothetical protein CISIN_1g046186mg [Citrus sinensis]
Length=436

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 109/244 (45%), Gaps = 37/244 (15%)
 Frame = +3

Query  642   GEYGIIVPGCAETYQQSEKGS-------EILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G +G   PG  ETYQ  ++G           D +QKIR + +GDI  +PA   HW YN+ 
Sbjct  102   GSHGDPFPGYPETYQSPQQGGFGESAGRSQQDSHQKIRRFRQGDIFALPAGVAHWCYNEG  161

Query  801   REPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
               P + VVL            NP  F LAG P    Q QR+Q R              N+
Sbjct  162   STPVVAVVLLDVANNDNQLDRNPRKFHLAGNPHQEFQQQRQQERFGGHQQCN------NV  215

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV--------------QQLPSrpek  1091
               GFD +I+ +A N D     ++       RG IV V              Q+       
Sbjct  216   FCGFDTRILAEAFNVDERLVRRLR-SEKDYRGAIVTVRGQLQVARPPRTQSQREYEEDSS  274

Query  1092  rrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +  R   G  N +EET+CT    +NI +  +ADIY   AG +TTLNSF LP L +++L
Sbjct  275   EYERSRGRYGGDNGVEETMCTMKLRENIGDPSKADIYTQGAGHITTLNSFNLPVLRWIQL  334

Query  1272  SAAR  1283
             SA R
Sbjct  335   SAER  338


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 3/85 (4%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F GC    Q    Q  Q   CQ++ + A+ P   +  E G  E WDP HEQFQC G    
Sbjct  14   FRGCLAANQQ---QWQQPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAGVAVV  70

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQ  372
            RH I+  GL LP ++++P + Y+LQ
Sbjct  71   RHTIRQKGLLLPQFSNSPQLVYILQ  95



>gb|EYU46457.1| hypothetical protein MIMGU_mgv1a005966mg [Erythranthe guttata]
Length=347

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 110/247 (45%), Gaps = 46/247 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---------------QQSEKGSEILDKYQKIRYYEKGDIIVIPA  770
             G G  GI  PGCAETY               +Q +KGS + D +QK+    +GDII IPA
Sbjct  101   GQGFIGISFPGCAETYHAYKSQYTRESTEAWEQKQKGS-VRDLHQKVHRVRRGDIIAIPA  159

Query  771   SAVHWFYNQNREPTILVVLQRANPVS---------FFLAGK-PGSSHqgqreqgrqqqeL  920
              A HWFYN   E  + + +   N  S         F+LAG  P S    Q  +  Q    
Sbjct  160   GAAHWFYNDGSEEVVAISINDLNHQSNQLDQKFRAFYLAGGVPKSGQHEQSRETFQ----  215

Query  921   MTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPS------r  1082
                      NI   FD  ++ +A N   E   K+     + RG  VIV++  S       
Sbjct  216   ---------NIFQAFDSNLMAEAFNVPEEIVRKM-QTEQQERGLSVIVRERMSFIRPEEE  265

Query  1083  pekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              E+ R+   +     N LEE+ C    + N +NR  ADIY   AG++  ++S  LP L Y
Sbjct  266   QEQEREREGRRSEDDNGLEESFCAMKISTNTENRREADIYSREAGKVHLIDSHKLPILKY  325

Query  1263  VRLSAAR  1283
             + +SA R
Sbjct  326   MDMSAER  332


 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            S  ++C+  ++ A +PT  I +EGGTTE WD NH QFQC G  A R++++ N L LP+Y 
Sbjct  31   SDQQQCRFQRLTAAQPTQRIESEGGTTELWDENHHQFQCAGVVAMRNVLKANALSLPNYH  90

Query  343  SAPLVAYVLQG  375
             AP + ++  G
Sbjct  91   PAPRLVFIENG  101



>pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|B Chain B, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|C Chain C, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|D Chain D, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|E Chain E, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|F Chain F, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3FZ3|A Chain A, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|B Chain B, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|C Chain C, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|D Chain D, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|E Chain E, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|F Chain F, Crystal Structure Of Almond Pru1 Protein
Length=531

 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 108/232 (47%), Gaps = 41/232 (18%)
 Frame = +3

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAG  863
             LD++QK R   +GD++ IPA   +W YN   +  + V L            NP  F+LAG
Sbjct  167   LDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG  226

Query  864   KP---------------GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNT  998
              P               G   +  + Q    +    E+ G   N+ +GF+ Q++  ALN 
Sbjct  227   NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNV  286

Query  999   DRETAEKIIGGN------ARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSS  1127
             + ETA  + G N       + RG++  VQ           +      ++ +  +     +
Sbjct  287   NEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMA  346

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LEET C+    +NI N ERADI+  RAGR++TLNS  LP L ++RLSA R
Sbjct  347   NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAER  398


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  199  AIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            A  P   I AE G  E W+ N   FQC G  A R  IQ NGL LPSY++AP + Y++QG
Sbjct  19   AREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQG  77



>gb|ADN39440.1| prunin 1 precursor [Prunus dulcis]
Length=551

 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 108/232 (47%), Gaps = 41/232 (18%)
 Frame = +3

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAG  863
              D++QK R   +GD++ IPA   +W YN   +  + V L            NP  F+LAG
Sbjct  187   FDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG  246

Query  864   KP---------------GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNT  998
              P               G   +  + Q    +    E+ G   N+ +GF+ Q++  ALN 
Sbjct  247   NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNV  306

Query  999   DRETAEKIIGGN------ARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSS  1127
             + ETA  + G N       R RG++  VQ           +      ++ +  + G   +
Sbjct  307   NEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGGQLMA  366

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LEET C+    +NI N ERADI+  RAGR++TLNS  LP L ++RLSA R
Sbjct  367   NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAER  418


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC   RQS   Q S   +CQL+Q+ A  P   I AE G  E W+ N E FQC G  A 
Sbjct  15   FNGCLAARQS---QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAAS  71

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQ NGL LPSY++AP + Y++QG
Sbjct  72   RITIQRNGLHLPSYSNAPQLIYIVQG  97



>ref|NP_001291336.1| 11S globulin seed storage protein 2 precursor [Sesamum indicum]
 sp|Q9XHP0.1|11S2_SESIN RecName: Full=11S globulin seed storage protein 2; AltName: Full=11S 
globulin seed storage protein II; AltName: Full=Alpha-globulin; 
Contains: RecName: Full=11S globulin seed storage 
protein 2 acidic chain; AltName: Full=11S globulin seed storage 
protein II acidic chain; Contains: RecName: Full=11S globulin 
seed storage protein 2 basic chain; AltName: Full=11S 
globulin seed storage protein II basic chain; Flags: Precursor 
[Sesamum indicum]
 gb|AAD42944.1|AF091842_1 11S globulin precursor [Sesamum indicum]
Length=459

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 114/244 (47%), Gaps = 42/244 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---------------QSEKGSEILDKYQKIRYYEKGDIIVIPA  770
             G G   I+VPGCAETYQ               Q ++GS + D +QK+    +GDI+ IP+
Sbjct  99    GQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGS-VRDLHQKVHRLRQGDIVAIPS  157

Query  771   SAVHWFYNQNREPTILVVLQRANPVS---------FFLAGK-PGSSHqgqreqgrqqqeL  920
              A HW YN   E  + V +   N +S         F+LAG  P S  Q Q+ +       
Sbjct  158   GAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFH---  214

Query  921   MTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrq  1100
                      NI   FD +++ +A N  +ET  ++       RG IV+ ++  +      +
Sbjct  215   ---------NIFRAFDAELLSEAFNVPQETIRRM-QSEEEERGLIVMARERMTFVRPDEE  264

Query  1101  pgrqgggS---SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
              G Q        N LEET CT  F  N+++R  ADI+  +AGR+  ++   LP L Y+ L
Sbjct  265   EGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDL  324

Query  1272  SAAR  1283
             SA +
Sbjct  325   SAEK  328


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            +Q ++C+  +I   +P+  I +EGGTTE WD   EQFQC G  A R  I+PNGL LP+Y 
Sbjct  29   TQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYH  88

Query  343  SAPLVAYVLQG  375
             +P + Y+ +G
Sbjct  89   PSPRLVYIERG  99



>gb|EEE56924.1| hypothetical protein OsJ_06602 [Oryza sativa Japonica Group]
Length=489

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 119/263 (45%), Gaps = 54/263 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE---------------ILDKYQKIRYYEKGDIIVIPA  770
             G G +G+ +PGC ET+Q      E               + D++Q++  + +GD+I +PA
Sbjct  93    GRGVFGMALPGCPETFQSVRSPFEQEVATAGEAQSSIQKMRDEHQQLHQFHQGDVIAVPA  152

Query  771   SAVHWFYNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLM  923
                HW YN    P +   V+  +N  +        FFLAGKP SS        +Q     
Sbjct  153   GVAHWLYNNGDSPVVAFTVIDTSNNANQLDPKRREFFLAGKPRSS------WQQQSYSYQ  206

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------  1070
             TE+L  + NI AGF   ++ +AL+  ++T  + + G +  RG I+ V+            
Sbjct  207   TEQLSRNQNIFAGFSPDLLSEALSVSKQTVLR-LQGLSDPRGAIIRVENGLQALQPSLQV  265

Query  1071  -----------LPSrpekrrqpgr-qgggSSNALEETLCTATFTQNIDNRERADIYDSRA  1214
                        LP++  +          G  N L+E +C     +NIDN + +DI++   
Sbjct  266   EPVKEEQTQAYLPTKQLQPTWLRSGGACGQQNVLDEIMCAFKLRKNIDNPQSSDIFNPHG  325

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR+T  NS   P L+ +++SA R
Sbjct  326   GRITRANSQNFPILNIIQMSATR  348



>ref|NP_001046769.1| Os02g0453600 [Oryza sativa Japonica Group]
 dbj|BAA36695.1| glutelin [Oryza sativa]
 dbj|BAD19503.1| glutelin [Oryza sativa Japonica Group]
 dbj|BAF08683.1| Os02g0453600 [Oryza sativa Japonica Group]
 gb|ABL74550.1| glutelin [Oryza sativa Japonica Group]
Length=510

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 119/263 (45%), Gaps = 54/263 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE---------------ILDKYQKIRYYEKGDIIVIPA  770
             G G +G+ +PGC ET+Q      E               + D++Q++  + +GD+I +PA
Sbjct  114   GRGVFGMALPGCPETFQSVRSPFEQEVATAGEAQSSIQKMRDEHQQLHQFHQGDVIAVPA  173

Query  771   SAVHWFYNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLM  923
                HW YN    P +   V+  +N  +        FFLAGKP SS        +Q     
Sbjct  174   GVAHWLYNNGDSPVVAFTVIDTSNNANQLDPKRREFFLAGKPRSS------WQQQSYSYQ  227

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------  1070
             TE+L  + NI AGF   ++ +AL+  ++T  + + G +  RG I+ V+            
Sbjct  228   TEQLSRNQNIFAGFSPDLLSEALSVSKQTVLR-LQGLSDPRGAIIRVENGLQALQPSLQV  286

Query  1071  -----------LPSrpekrrqpgr-qgggSSNALEETLCTATFTQNIDNRERADIYDSRA  1214
                        LP++  +          G  N L+E +C     +NIDN + +DI++   
Sbjct  287   EPVKEEQTQAYLPTKQLQPTWLRSGGACGQQNVLDEIMCAFKLRKNIDNPQSSDIFNPHG  346

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR+T  NS   P L+ +++SA R
Sbjct  347   GRITRANSQNFPILNIIQMSATR  369



>emb|CAA86824.1| legumin A precursor [Vicia narbonensis]
Length=482

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 118/255 (46%), Gaps = 45/255 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G+G +G++ PGC ET+++ ++  +       D +QK+  + +GDII +P   V W YN  
Sbjct  96    GNGYFGVVFPGCPETFEEPQESEQRERRRYRDSHQKVNRFREGDIIAVPTGNVLWMYNDQ  155

Query  801   REPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
               P I + L             P  F+LAG    + + +  + +++Q    E+     NI
Sbjct  156   DTPVIAISLTDTGSSNNQLDQIPRRFYLAG----NQEQEFLRYQREQGGKQEQENDGNNI  211

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNA-RGRGHIVIVQ---------------------  1067
              +GF    ++DALN +R   +++ G N    +G IV V+                     
Sbjct  212   FSGFKRDFLEDALNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIITPPERQRGSRQEEDE  271

Query  1068  -----QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTL  1232
                  + PSR     Q G       N LEET+CTA    NI +    DIY+ +AGR+ T+
Sbjct  272   DEKEERQPSRRRDESQKGESRRHGDNGLEETVCTAKLRVNIGSSPSPDIYNPQAGRINTV  331

Query  1233  NSFTLPALSYVRLSA  1277
              S  LP L +++LSA
Sbjct  332   TSLDLPVLRWLKLSA  346


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  157  QESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPS  336
            ++SQ  +CQL ++ A+ P   I +EGG  E W+PN+ QF+C G    R  +Q N L  P 
Sbjct  24   EQSQQNECQLERLDALEPDNRIESEGGLIETWNPNNRQFRCAGVALSRVTLQRNALRRPY  83

Query  337  YTSAPLVAYVLQGT  378
            Y++AP   Y+ QG 
Sbjct  84   YSNAPQEIYIQQGN  97



>ref|XP_008235678.1| PREDICTED: legumin type B-like [Prunus mume]
Length=520

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 108/224 (48%), Gaps = 33/224 (15%)
 Frame = +3

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAG  863
             LD++QK R   +GD++ IPA   +W YN   +  + V L            NP  F+LAG
Sbjct  164   LDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG  223

Query  864   KPGSSHqgqreqgrqqqeL-------MTERLGYDGNILAGFDVQIVKDALNTDRETAEKI  1022
              P +    Q +   +QQ           E+ G   N+ +GF+ Q++  ALN + ETA  +
Sbjct  224   NPENEFNQQGQSQPRQQGQQPFGRPGQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNL  283

Query  1023  IGGN------ARGRGHIVIVQQLPSrpekrrqpgrqgggSS-----------NALEETLC  1151
              G N       R RG++  VQ    R E+  +  +Q                N LEET C
Sbjct  284   QGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGGQPMVNGLEETFC  343

Query  1152  TATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +    +NI N ERADI+  RAGR++TLNS  LP L  +RLSA R
Sbjct  344   SLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRSLRLSAER  387


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC   RQS   Q S   +CQL+Q+ A  P   I AE G  E W+ N E FQC G  A 
Sbjct  15   FNGCLAARQS---QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAAS  71

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQ NGL LPSY++AP + Y++QG
Sbjct  72   RITIQRNGLHLPSYSNAPQLIYIVQG  97



>emb|CAA55009.1| prunin [Prunus dulcis]
Length=551

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 108/232 (47%), Gaps = 41/232 (18%)
 Frame = +3

Query  711   LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAG  863
             LD++QK R   +GD++ IPA   +W YN   +  + V L            NP  F+LAG
Sbjct  187   LDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG  246

Query  864   KP---------------GSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNT  998
              P               G   +  + Q    +    E+ G   N+ +GF+ Q++  ALN 
Sbjct  247   NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNV  306

Query  999   DRETAEKIIGGN------ARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSS  1127
             + ETA  + G N       + RG++  VQ           +      ++ +  +     +
Sbjct  307   NEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMA  366

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LEET C+    +NI N ERADI+  RAGR++TLNS  LP L ++RLSA R
Sbjct  367   NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAER  418


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC   RQS   Q S   +CQL+Q+ A  P   I AE G  E W+ N   FQC G  A 
Sbjct  15   FNGCLAARQS---QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAAS  71

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  IQ NGL LPSY++AP + Y++QG
Sbjct  72   RITIQRNGLHLPSYSNAPQLIYIVQG  97



>ref|XP_010248272.1| PREDICTED: legumin type B-like, partial [Nelumbo nucifera]
Length=380

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 80/270 (30%), Positives = 122/270 (45%), Gaps = 55/270 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---QSE--------KGSEILDKYQKIRYYEKGDIIVIPASAVH  782
             G G  G+ +PGC ET+Q   QS+        +     D++QKIR+ ++GD+I +P    H
Sbjct  66    GKGVLGLSIPGCPETFQSFQQSQHSEEEEENRSRRFQDQHQKIRFVKQGDMIAVPDGIPH  125

Query  783   WFYNQNREPTILV-VLQRANPVS--------FFLAGKP-------------GSSHqgqre  896
             W YN    P + V +   AN ++        F+LAG               G S   + +
Sbjct  126   WMYNNGDAPLVAVSIFDIANSINQLDDRKRQFYLAGNSQQQQQEEQQQQQGGESFSRREK  185

Query  897   qgrqqqeLMTERLGYDG----------------NILAGFDVQIVKDALNTDRETAEKIIG  1028
              G+Q       +    G                NI +GFD + +  A     ETA K+ G
Sbjct  186   AGQQSSSQEQRQQQKGGKSSYQHDQKARQENSANIFSGFDTETLAQAFGVSTETASKLKG  245

Query  1029  GNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERA  1193
              N + RG IV V++     +P+  E+  +  ++    +N +EE +C   F QNI+  + A
Sbjct  246   ENDQ-RGGIVNVEKELRMIMPTSSEEDEEYEQEQQMGANGVEEAICNMRFRQNIEKPKHA  304

Query  1194  DIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             D Y    GR+T LNS  LP L  ++LSA R
Sbjct  305   DFYSPYGGRVTILNSQNLPILQTLQLSAER  334


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            CQ+  + A+ P+    AEGG  E WD N+ QFQC G  A R  IQP GL LPSY +A  +
Sbjct  1    CQVDNLDALEPSRRREAEGGFVEEWDENNNQFQCAGVAASRVTIQPKGLSLPSYYNAHRL  60

Query  358  AYVLQG  375
             Y+++G
Sbjct  61   IYIVEG  66



>gb|AEO27677.1| seed storage protein legumin A, partial [Gossypium raimondii]
Length=486

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 120/276 (43%), Gaps = 60/276 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QK+R + +GDII +P   VHW YN  
Sbjct  77    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDG  136

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMT---------  926
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  137   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEE  196

Query  927   --------------------ERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--IG  1028
                                 E  G +     N+L  FD   +  A N D +   KI  + 
Sbjct  197   GEGEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVR  256

Query  1029  GN------ARGRGHIVIVQQLPSrpekrrqpgrqgggS-----SNALEETLCTATFTQNI  1175
             GN       R R  +V   ++     + RQ  ++   +      N LEET C+    +N+
Sbjct  257   GNRGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKENL  316

Query  1176  DNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  317   ADPERADIFNPQAGRISTLNRFNLPILQRLELSAER  352


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            Q+F  Q+SQNE CQ++++ A  P   I +E GTTE+W+PN +Q +C G    R  I+PNG
Sbjct  1    QTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMRQTIEPNG  59

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LPS+T+AP + Y++QG
Sbjct  60   LVLPSFTNAPQLLYIVQG  77



>emb|CBI37121.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 128/238 (54%), Gaps = 28/238 (12%)
 Frame = +3

Query  627   FSTGSGEYGIIVPGCAETYQ---QSEKGSEIL-DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             F  G G  GI++ GC ET+Q   +S++G +   D++QKIR  E+GD+  +P    H+ YN
Sbjct  93    FVQGRGLQGIMITGCPETFQSFQESQQGQQFRGDQHQKIREVEEGDVFAVPVGTGHFIYN  152

Query  795   Q-NREPTILVVLQRAN--------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
               +R+  ++ VL  +N        P  F+LAG P +  Q Q++Q + +QE   +      
Sbjct  153   NGDRQLIVVSVLDTSNDANQLDFQPRRFYLAGNPQNEFQQQQQQQQGRQESSGD------  206

Query  948   NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrq  1112
             NI +GFD Q + +A N D +   K+ G N R RG+IV V+      LP R ++ R   +Q
Sbjct  207   NIFSGFDAQQLAEAFNVDVQLIRKLQGQNDR-RGNIVRVEGGLQAVLPPRGQQERGEQQQ  265

Query  1113  gggSS--NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL-SYVRLSA  1277
                 +  N  EET+C+    QNI +  RAD+Y  R G  +++  + LP L   VRLSA
Sbjct  266   DHFHARGNGYEETICSLRLKQNIGDPWRADVYTPRGGHRSSVTGYDLPILRKVVRLSA  323


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = +1

Query  127  CFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHI  306
            C GR+Q+      Q ++C++S+++A RP+  I +E G TE +D N+EQFQC G    R+ 
Sbjct  18   CMGRQQT----SRQQKECRISRLNAQRPSNRIQSEAGVTEVFDHNNEQFQCAGVAVVRYT  73

Query  307  IQPNGLFLPSYTSAPLVAYVLQG  375
            I+P GL LPSY +AP + Y +QG
Sbjct  74   IEPRGLLLPSYVNAPQLMYFVQG  96



>ref|XP_010097607.1| Legumin A [Morus notabilis]
 gb|EXC43199.1| Legumin A [Morus notabilis]
Length=480

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 115/233 (49%), Gaps = 53/233 (23%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG----SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             G G  G + PGCAET+++S+KG    S+  D++QK+R+  +GDI+ IP    +W YN   
Sbjct  149   GRGIIGTVFPGCAETFEESQKGQGRSSQPEDRHQKLRHVREGDIVAIPVGVAYWSYNNGD  208

Query  804   EPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqq--qeLMTERLGYDG-  947
             +  + V L            NP  F+LAG P    + Q++Q ++Q  +E    R G +  
Sbjct  209   QQLVSVTLLDTSNVENQLDQNPRRFYLAGNPEDEFEQQQQQYQEQQGREPSRRRRGSEDK  268

Query  948   -NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggS  1124
              NI  G + + +++A N D ETA +I G N   R +I+                      
Sbjct  269   HNIFRGLNTRFIEEAFNVDSETARRIQGQND-NRNNII----------------------  305

Query  1125  SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                           +NI +  RADI+  +AGR++T+NSF LP L ++RLSA R
Sbjct  306   -------------KENIGDPSRADIFTPQAGRISTVNSFNLPILRHLRLSAER  345


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +1

Query  127  CFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHI  306
               R +S      QNE CQ  ++ A+ P   I AE G  E W+PNH+QFQC G    R  
Sbjct  68   AISRSRSEEYSRRQNE-CQFDRLQALEPDSRIKAEAGVIESWNPNHDQFQCAGVAVVRRT  126

Query  307  IQPNGLFLPSYTSAPLVAYVLQG  375
            I+PNGL LPSYT+ P + Y+++G
Sbjct  127  IEPNGLHLPSYTNTPQLMYIVRG  149



>gb|EEC72834.1| hypothetical protein OsI_06562 [Oryza sativa Indica Group]
Length=473

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 112/250 (45%), Gaps = 44/250 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  + +D++QKI  + +GDI+ +P    HWF
Sbjct  88    GRGSMGLTFPGCPTTYQQQSQQFLFQGESQSQKFIDEHQKIHQFRQGDIVALPTGVAHWF  147

Query  789   YNQNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + + +   N  +         F LAGK     Q      +Q          +
Sbjct  148   YNDGDTPVVALYVYDINNSANQLEPRHREFLLAGKNNRVQQVYGRSIQQH---------F  198

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV----------------QQL  1073
               NI  GF V+++ +ALN +  T +++   N + RG I+ V                Q+ 
Sbjct  199   GQNIFNGFSVELLSEALNINTVTTKRLQSQNDQ-RGEIIHVKNGLQLLKPTLTQRHEQEQ  257

Query  1074  PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                 E +     Q     N LEE LCT     NI+N  RAD YD RAGR+T+L+S   P 
Sbjct  258   AQYQEVQFSEKPQTSSRWNGLEENLCTIKTRLNIENPTRADSYDPRAGRITSLDSQKFPI  317

Query  1254  LSYVRLSAAR  1283
             L+ +++SA R
Sbjct  318   LNIIQMSATR  327


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P  N+ +E G TE++D  +E FQC G +  R +IQP GL +P Y + P 
Sbjct  22   ECRFERLQAFEPLQNMRSEAGVTEYFDETNELFQCTGTFVIRRVIQPQGLLIPRYANTPG  81

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  82   MVYIIQG  88



>ref|XP_010935905.1| PREDICTED: glutelin type-A 3-like isoform X2 [Elaeis guineensis]
Length=444

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 108/235 (46%), Gaps = 36/235 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-------QSEKGSE---ILDKYQKIRYYEKGDIIVIPASAVHW  785
             G G    I+PGC  T+Q       + E+GS+     D +QKI  +  GD++ IPA   +W
Sbjct  98    GRGISASIMPGCPTTFQSVRRSEQEGEEGSQRQRFRDDHQKIHRFRAGDVLAIPAGIANW  157

Query  786   FYNQNREP--TILVVLQRANP-------VSFFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
              YN    P  T+ V   R+N          F LAG    S                +++ 
Sbjct  158   CYNDGDTPVVTLTVFDTRSNANQLDQNQREFQLAGSQRGS----------------QQVN  201

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgg  1118
                N+L GF    +  AL  DRE A K+   + R RG IV V++         +   +  
Sbjct  202   TGKNVLRGFRADSLAAALGVDRELARKLQLEDDR-RGEIVRVERSLQVLRPPSEEEEKEM  260

Query  1119  gSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              S N LEET C+    +NI+    AD+Y  R GR+TTLNS  LP L ++++SA R
Sbjct  261   SSPNGLEETYCSMRIKENIETPSAADVYTRRGGRITTLNSHKLPILRFIQMSATR  315


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+L +++ ++PT  + +E G TE++D   +Q QC G    R  I+PNGL LPSY+S+P 
Sbjct  32   ECRLDRLNTLQPTRRVESEAGVTEYFDEKDDQLQCAGVSVRRRTIEPNGLLLPSYSSSPR  91

Query  355  VAYVLQG  375
            + Y+LQG
Sbjct  92   LIYILQG  98



>ref|XP_006279075.1| hypothetical protein CARUB_v10012738mg [Capsella rubella]
 gb|EOA11973.1| hypothetical protein CARUB_v10012738mg [Capsella rubella]
Length=466

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 114/256 (45%), Gaps = 59/256 (23%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQS-----------------EKGSEILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q S                 E+ S+  D +QK+ +   GD I
Sbjct  93    AQGQGLMGKVIPGCAETFQDSSVFQPREGRRQFEGQGEEEQSQFRDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN+ ++P ++V V   A        NP  F+LAG                
Sbjct  153   ATTPGVAQWFYNEGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW--------  204

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------  1067
               L     G   NI +GF  +++  A   D +TA+++       RG+IV V+        
Sbjct  205   --LQGREQGPQKNIFSGFGPEVIAQAFKIDLQTAQQLQN-QQDNRGNIVRVKGPFGVIRP  261

Query  1068  ----QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLN  1235
                 Q P   E+            N LEET+C+A    N+D+  RAD+Y  + G L+TLN
Sbjct  262   PLRGQRPQEEER----------EGNGLEETICSARSVDNLDDPSRADVYKPQLGYLSTLN  311

Query  1236  SFTLPALSYVRLSAAR  1283
             S+ LP L ++RLSA R
Sbjct  312   SYDLPILRFIRLSALR  327


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   LHGYTAQQFPNECQLEQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>gb|AEO27676.1| seed storage protein legumin A, partial [Gossypium hirsutum]
Length=487

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 120/277 (43%), Gaps = 61/277 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QK+R + +GDII +P   VHW YN  
Sbjct  77    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDG  136

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMT---------  926
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  137   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEE  196

Query  927   ---------------------ERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--I  1025
                                  E  G +     N+L  FD   +  A N D +   KI  +
Sbjct  197   GEGEEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRV  256

Query  1026  GGN------ARGRGHIVIVQQLPSrpekrrqpgrqgggS-----SNALEETLCTATFTQN  1172
              GN       R R  +V   ++     + RQ  ++   +      N LEET C+    +N
Sbjct  257   RGNRGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKEN  316

Query  1173  IDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             + + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  317   LADPERADIFNPQAGRISTLNRFNLPILQRLELSAER  353


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            Q+F  Q+SQNE CQ++++ A  P   I +E GTTE+W+PN +Q +C G    R  I+PNG
Sbjct  1    QTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMRQTIEPNG  59

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LPS+T+AP + Y++QG
Sbjct  60   LVLPSFTNAPQLLYIVQG  77



>emb|CDP79024.1| edestin 1 [Cannabis sativa]
Length=511

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 124/265 (47%), Gaps = 50/265 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+  PGC ET+++S++G           D++QK+R+  +GDI+ IPA   +W YN
Sbjct  107   GRGILGVTFPGCPETFEESQRGQGQGQSQGSQPDRHQKLRHVREGDIVAIPAGVAYWSYN  166

Query  795   QNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
                +  + V L            NP  F+LAG P      Q  +   +     ER+    
Sbjct  167   NGDQQLVFVSLLDTSNVNNQLDDNPRRFYLAGNP-EDEFEQLRREGGRGARFDERIRERS  225

Query  948   ----------NILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIVIVQQLPS  1079
                       NI  GF+ + +++A N D ET +++ G N       R +G + +V  L S
Sbjct  226   EGRHSSENYRNIFKGFNSRYLEEAFNVDSETVKRLQGQNDDRNSIIRVKGTLDLVSPLRS  285

Query  1080  rpekrrqpgrqggg-----------------SSNALEETLCTATFTQNIDNRERADIYDS  1208
               E +R+   +                     +N LEET C+    +NI +  RAD++  
Sbjct  286   SQEHQREERYEDERQREIEQERRRMSRGGRYEANGLEETFCSMRLRENIGDPSRADVFTP  345

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             +AGR++T+NS+ LP L +++LSA R
Sbjct  346   QAGRISTVNSYNLPILRFLQLSAER  370


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +CQ+ +I A  P   + AE G  E W+PNH QFQC G    R+ IQ NGL LPSYT+
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHNQFQCAGVAVVRYTIQQNGLHLPSYTN  97

Query  346  APLVAYVLQG  375
             P + Y+++G
Sbjct  98   TPQLVYIVKG  107



>emb|CDY35196.1| BnaA01g08350D [Brassica napus]
Length=489

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 124/283 (44%), Gaps = 75/283 (27%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSEK---------------------  698
             G +LP  FS+        G G  G +VPGCAET+  S+                      
Sbjct  84    GLYLPTFFSSPKISYVVQGMGISGRVVPGCAETFMDSQPMQGQQQGQQGQQGQQGQQGQQ  143

Query  699   ------GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA--------  836
                        D +QK+ +   GDII I A + HW YN   +P +++ L           
Sbjct  144   GQQGQQQQGFRDMHQKVEHVRHGDIIAITAGSSHWIYNTGDQPLVIICLLDIANYQNQLD  203

Query  837   -NPVSFFLAGK--PGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRE  1007
              NP +F LAG    G S Q Q++Q                N+L+GFD Q++  AL  D  
Sbjct  204   RNPRTFRLAGNNPQGGSQQQQQQQQ---------------NMLSGFDPQVLAQALKIDVR  248

Query  1008  TAEKIIGGNARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSSNALEETLCT  1154
              A+++       RG+IV V+           Q     + R   G       N LEET+C+
Sbjct  249   LAQEL-QNQQDSRGNIVRVKGPFQVVRPPLRQPYESEQWRHPRGPPQSPQDNGLEETICS  307

Query  1155  ATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                 +NID+  RAD+Y    GR+T++NS+TLP L Y+RLSA R
Sbjct  308   MRTHENIDDPARADVYKPNLGRVTSVNSYTLPILQYIRLSATR  350


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R QS          C L  +  ++PT  I +E G  E+WD N+ Q +C G    
Sbjct  18   LNGCLAR-QSLGVPPQLGNACNLDNLDVLQPTETIKSEAGRVEYWDHNNPQIRCAGVSVS  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R II+  GL+LP++ S+P ++YV+QG
Sbjct  77   RVIIEQGGLYLPTFFSSPKISYVVQG  102



>emb|CDP79023.1| edestin 1 [Cannabis sativa]
 emb|CDP79025.1| edestin 1 [Cannabis sativa]
Length=511

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 124/265 (47%), Gaps = 50/265 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+  PGC ET+++S++G           D++QK+R+  +GDI+ IPA   +W YN
Sbjct  107   GRGILGVTFPGCPETFEESQRGQGQGQSQGSQPDRHQKLRHVREGDIVAIPAGVAYWSYN  166

Query  795   QNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
                +  + V L            NP  F+LAG P      Q  +   +     ER+    
Sbjct  167   NGDQQLVFVSLLDTSNVNNQLDDNPRRFYLAGNP-EDEFEQLRREGGRGARFDERIRERS  225

Query  948   ----------NILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIVIVQQLPS  1079
                       NI  GF+ + +++A N D ET +++ G N       R +G + +V  L S
Sbjct  226   EGRHSSENYRNIFKGFNSRYLEEAFNVDSETVKRLQGQNDDRNSIIRVKGTLDLVSPLRS  285

Query  1080  rpekrrqpgrqggg-----------------SSNALEETLCTATFTQNIDNRERADIYDS  1208
               E +R+   +                     +N LEET C+    +NI +  RAD++  
Sbjct  286   SQEHQREERYEDERQREIEQERRRMSRGGRYEANGLEETFCSMRLRENIGDPSRADVFTP  345

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             +AGR++T+NS+ LP L +++LSA R
Sbjct  346   QAGRISTVNSYNLPILRFLQLSAER  370


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +CQ+ +I A  P   + AE G  E W+PNH QFQC G    R+ IQ NGL LPSYT+
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHNQFQCAGVAVVRYTIQQNGLHLPSYTN  97

Query  346  APLVAYVLQG  375
             P + Y+++G
Sbjct  98   TPQLVYIVKG  107



>gb|EYU46456.1| hypothetical protein MIMGU_mgv1a005966mg [Erythranthe guttata]
Length=463

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 110/247 (45%), Gaps = 46/247 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---------------QQSEKGSEILDKYQKIRYYEKGDIIVIPA  770
             G G  GI  PGCAETY               +Q +KGS + D +QK+    +GDII IPA
Sbjct  101   GQGFIGISFPGCAETYHAYKSQYTRESTEAWEQKQKGS-VRDLHQKVHRVRRGDIIAIPA  159

Query  771   SAVHWFYNQNREPTILVVLQRANPVS---------FFLAGK-PGSSHqgqreqgrqqqeL  920
              A HWFYN   E  + + +   N  S         F+LAG  P S    Q  +  Q    
Sbjct  160   GAAHWFYNDGSEEVVAISINDLNHQSNQLDQKFRAFYLAGGVPKSGQHEQSRETFQ----  215

Query  921   MTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPS------r  1082
                      NI   FD  ++ +A N   E   K+     + RG  VIV++  S       
Sbjct  216   ---------NIFQAFDSNLMAEAFNVPEEIVRKM-QTEQQERGLSVIVRERMSFIRPEEE  265

Query  1083  pekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              E+ R+   +     N LEE+ C    + N +NR  ADIY   AG++  ++S  LP L Y
Sbjct  266   QEQEREREGRRSEDDNGLEESFCAMKISTNTENRREADIYSREAGKVHLIDSHKLPILKY  325

Query  1263  VRLSAAR  1283
             + +SA R
Sbjct  326   MDMSAER  332


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            S  ++C+  ++ A +PT  I +EGGTTE WD NH QFQC G  A R++++ N L LP+Y 
Sbjct  31   SDQQQCRFQRLTAAQPTQRIESEGGTTELWDENHHQFQCAGVVAMRNVLKANALSLPNYH  90

Query  343  SAPLVAYVLQG  375
             AP + ++  G
Sbjct  91   PAPRLVFIENG  101



>gb|AAA33072.1| legumin precursor, partial [Gossypium hirsutum]
Length=507

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 120/277 (43%), Gaps = 61/277 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QK+R + +GDII +P   VHW YN  
Sbjct  97    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDG  156

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMT---------  926
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  157   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEE  216

Query  927   ---------------------ERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--I  1025
                                  E  G +     N+L  FD   +  A N D +   KI  +
Sbjct  217   GEGEEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRV  276

Query  1026  GGN------ARGRGHIVIVQQLPSrpekrrqpgrqgggS-----SNALEETLCTATFTQN  1172
              GN       R R  +V   ++     + RQ  ++   +      N LEET C+    +N
Sbjct  277   RGNRGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKEN  336

Query  1173  IDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             + + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  337   LADPERADIFNPQAGRISTLNRFNLPILQRLELSAER  373


 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +1

Query  121  NGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFR  300
            NGC  R Q+F  Q+SQNE CQ++++ A  P   I +E GTTE+W+PN +Q +C G    R
Sbjct  15   NGCLAR-QTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMR  72

Query  301  HIIQPNGLFLPSYTSAPLVAYVLQG  375
              I+PNGL LPS+T+AP + Y++QG
Sbjct  73   QTIEPNGLVLPSFTNAPQLLYIVQG  97



>sp|P09802.2|LEGA_GOSHI RecName: Full=Legumin A; AltName: Full=Beta-globulin; AltName: 
Full=LEGA-C94; Contains: RecName: Full=Legumin A acidic chain; 
Contains: RecName: Full=Legumin A basic chain; Flags: Precursor 
[Gossypium hirsutum]
 gb|AAA33053.1| legumin A [Gossypium hirsutum]
 prf||1906369A legumin A:ISOTYPE=D alloallele
Length=509

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 120/277 (43%), Gaps = 61/277 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QK+R + +GDII +P   VHW YN  
Sbjct  99    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDG  158

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMT---------  926
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  159   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEE  218

Query  927   ---------------------ERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--I  1025
                                  E  G +     N+L  FD   +  A N D +   KI  +
Sbjct  219   GEGEEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRV  278

Query  1026  GGN------ARGRGHIVIVQQLPSrpekrrqpgrqgggS-----SNALEETLCTATFTQN  1172
              GN       R R  +V   ++     + RQ  ++   +      N LEET C+    +N
Sbjct  279   RGNRGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKEN  338

Query  1173  IDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             + + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  339   LADPERADIFNPQAGRISTLNRFNLPILQRLELSAER  375


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +1

Query  121  NGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFR  300
            NGC  R Q+F  Q+SQNE CQ++++ A  P   I +E GTTE+W+PN +Q +C G    R
Sbjct  17   NGCLAR-QTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMR  74

Query  301  HIIQPNGLFLPSYTSAPLVAYVLQG  375
              I+PNGL LPS+T+AP + Y++QG
Sbjct  75   QTIEPNGLVLPSFTNAPQLLYIVQG  99



>ref|XP_004289943.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=496

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/280 (31%), Positives = 125/280 (45%), Gaps = 57/280 (20%)
 Frame = +3

Query  609   DGYFLPFSTGSGE-------YGIIV---PGCAETY---------QQSEKGSEILDKYQKI  731
             +G  LP  T S +       +G+++   PGC ET+         Q+  +G + L+++QK+
Sbjct  85    NGLHLPSYTHSPQLMYIVKGWGVMMTALPGCPETFELSQGSEQVQEERQGFDDLERHQKV  144

Query  732   RYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA---------NPVSFFLAGKPGSSHq  884
             R+  +GDII IP   VHW +N      + V L            NP  F+LAG P     
Sbjct  145   RFIGEGDIIAIPPGIVHWVHNNGNSSLVAVSLLDICNDLNQLDRNPRRFYLAGNPEDEFN  204

Query  885   gqreqgrqqqeLMTER---------------LGYDGNILAGFDVQIVKDALNTDRETAEK  1019
              Q E   Q+ E   +                  Y+ NI AGFD  ++ DALN D ETA K
Sbjct  205   RQGEDISQEDEFNQQEGEGISYEQRRHSGQGSNYNNNIFAGFDTSLLADALNVDIETAMK  264

Query  1020  IIGGNARGRGHIVIVQ------QLP--------SrpekrrqpgrqgggSSNALEETLCTA  1157
             + G   + R  IV V+        P        ++ E++ +     G   N L E+LC  
Sbjct  265   VHGQIDQQRSQIVRVEGKFGFLHPPIKSSHWQRTQQEQKDEQQGLQGRHDNGLGESLCNI  324

Query  1158  TFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
                Q + +  RADIY  +AGR+  LNS  +P L  + LSA
Sbjct  325   ALKQYLGDPRRADIYTPQAGRINILNSNDMPILKQMSLSA  364


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +1

Query  124  GCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRH  303
            GC      F  +  +  +CQ+ Q+ A  P   I  E G  E WD     FQC G  A R 
Sbjct  23   GCLAADPQF--EPIKQNQCQIDQLQAREPDIQIECEAGRIESWDHYQNDFQCAGVAAQRI  80

Query  304  IIQPNGLFLPSYTSAPLVAYVLQG  375
             I+PNGL LPSYT +P + Y+++G
Sbjct  81   TIEPNGLHLPSYTHSPQLMYIVKG  104



>ref|XP_006648611.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha]
Length=504

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 118/261 (45%), Gaps = 53/261 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL------------DKYQKIRYYEKGDIIVIPASAV  779
             G G +G+ +PGC ET+Q      E+             D++QKI  + +GD+I +P    
Sbjct  114   GRGVFGMALPGCPETFQSVRSAFEMATGDAESSTRKLRDEHQKIHQFRQGDVIAVPPGVA  173

Query  780   HWFYNQNREPTI-LVVLQRAN--------PVSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
             HW YN    P +   V+   N        P  FFLAGKP           + Q    +E+
Sbjct  174   HWLYNNGDSPVVAFSVIDFGNNANQLDPKPREFFLAGKPWGWQ-------QVQYSYQSEQ  226

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ--------------  1070
                  NI AGF+  ++ +AL+  R+TA ++   N + RG I+ V+Q              
Sbjct  227   QSKHQNIFAGFNPDLLAEALSVSRQTAMRLQELNDQ-RGAIIRVEQGLQLALDPSFQAEQ  285

Query  1071  ---------LPSrpekrrqpgrq-gggSSNALEETLCTATFTQNIDNRERADIYDSRAGR  1220
                      L S+ ++     R      +N L+E +C    ++NI++ +  DI++ R GR
Sbjct  286   EQEEQPQEYLSSQQQQPTWSQRSGACVQNNGLDEIMCAFKVSKNINSAQSTDIFNPRGGR  345

Query  1221  LTTLNSFTLPALSYVRLSAAR  1283
             +T  NS   P L+ +++SA R
Sbjct  346   ITRANSQNFPVLNIIQMSATR  366



>ref|XP_010935904.1| PREDICTED: glutelin type-B 5-like isoform X1 [Elaeis guineensis]
Length=451

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 108/237 (46%), Gaps = 38/237 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ-------QSEKGSE---ILDKYQKIRYYEKGDIIVIPASAVHW  785
             G G    I+PGC  T+Q       + E+GS+     D +QKI  +  GD++ IPA   +W
Sbjct  98    GRGISASIMPGCPTTFQSVRRSEQEGEEGSQRQRFRDDHQKIHRFRAGDVLAIPAGIANW  157

Query  786   FYNQNREP--TILVVLQRANP---------VSFFLAGKPGSSHqgqreqgrqqqeLMTER  932
              YN    P  T+ V   R+N            F LAG    S                ++
Sbjct  158   CYNDGDTPVVTLTVFDTRSNANQLDQNQRVKEFQLAGSQRGS----------------QQ  201

Query  933   LGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
             +    N+L GF    +  AL  DRE A K+   + R RG IV V++         +   +
Sbjct  202   VNTGKNVLRGFRADSLAAALGVDRELARKLQLEDDR-RGEIVRVERSLQVLRPPSEEEEK  260

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                S N LEET C+    +NI+    AD+Y  R GR+TTLNS  LP L ++++SA R
Sbjct  261   EMSSPNGLEETYCSMRIKENIETPSAADVYTRRGGRITTLNSHKLPILRFIQMSATR  317


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+L +++ ++PT  + +E G TE++D   +Q QC G    R  I+PNGL LPSY+S+P 
Sbjct  32   ECRLDRLNTLQPTRRVESEAGVTEYFDEKDDQLQCAGVSVRRRTIEPNGLLLPSYSSSPR  91

Query  355  VAYVLQG  375
            + Y+LQG
Sbjct  92   LIYILQG  98



>prf||1306412B storage protein C94
Length=505

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 120/277 (43%), Gaps = 61/277 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QK+R + +GDII +P   VHW YN  
Sbjct  97    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDG  156

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqqeLMT---------  926
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  157   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEE  216

Query  927   ---------------------ERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--I  1025
                                  E  G +     N+L  FD   +  A N D +   KI  +
Sbjct  217   GEGEEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRV  276

Query  1026  GGN------ARGRGHIVIVQQLPSrpekrrqpgrqgggS-----SNALEETLCTATFTQN  1172
              GN       R R  +V   ++     + RQ  ++   +      N LEET C+    +N
Sbjct  277   RGNRGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKEN  336

Query  1173  IDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             + + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  337   LADPERADIFNPQAGRISTLNRFNLPILQRLELSAER  373


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +1

Query  121  NGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFR  300
            NGC  R Q+F  Q+SQNE CQ++++ A  P   I +E GTTE+W+PN +Q +C G    R
Sbjct  15   NGCLAR-QTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGVSVMR  72

Query  301  HIIQPNGLFLPSYTSAPLVAYVLQG  375
              I+PNGL LPS+T+AP + Y++QG
Sbjct  73   QTIEPNGLVLPSFTNAPQLLYIVQG  97



>gb|ABI32184.1| allergenic protein [Fagopyrum tataricum]
Length=515

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 125/266 (47%), Gaps = 46/266 (17%)
 Frame = +3

Query  615   YFLPFSTGSGEYGIIVPGCAETYQ------QSEKGSEIL----------DKYQKIRYYEK  746
             Y      G G  G+++PGC ET+Q      QS++G              D++QKI    +
Sbjct  105   YITFVEQGRGVQGVVIPGCPETFQSDSEYPQSQRGQHSRESESQESSRGDQHQKIFRVRE  164

Query  747   GDIIVIPASAVHWFYNQNREPTILVVLQRANPV---------SFFLAGKP--GSSHqgqr  893
             GD+I  PA  V W +N   +  I V L  AN           SFFLAG+   G   +  +
Sbjct  165   GDVIPSPAGVVQWTHNDGDQDLISVTLLDANSFHNQLDENVRSFFLAGQSQQGREERRSQ  224

Query  894   eqgrqqqeLMTERLGYD------GNILAGFDVQIVKDAL-NTDRETAEKIIGGNARGRGH  1052
             +Q R++      R   D       NIL+GF  +I+ +   + DRET  K+ G N + RG 
Sbjct  225   QQTREEGGDRQSRESDDVEALIGANILSGFQDEILHELFRDVDRETISKLRGENDQ-RGF  283

Query  1053  IVIVQQLP-----------SrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADI  1199
             IV  Q L             R    R+   +G G SN LE+  C   F QN++    AD+
Sbjct  284   IVQAQDLKLRVPEDSEEGYERQRGDRKRDERGSGRSNGLEQAFCNLKFRQNVNRPSHADV  343

Query  1200  YDSRAGRLTTLNSFTLPALSYVRLSA  1277
             ++ RAGR+ T+NS  LP L +++LSA
Sbjct  344   FNPRAGRINTVNSNNLPILEFLQLSA  369


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C + ++ A  P+  + +E G TE WD N  +F+C G  A R++IQP GL LPSY++AP +
Sbjct  47   CDIQRLTASEPSRRVRSEAGVTEIWDHNTPEFRCTGFVAVRYVIQPGGLLLPSYSNAPYI  106

Query  358  AYVLQG  375
             +V QG
Sbjct  107  TFVEQG  112



>gb|AEO27675.1| seed storage protein legumin A, partial [Gossypium arboreum]
Length=486

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 124/279 (44%), Gaps = 66/279 (24%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QKIR + +GDII +P   VHW YN  
Sbjct  77    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKIRRFRQGDIIALPQGVVHWSYNDG  136

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqq-------------  914
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  137   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESQEEE  196

Query  915   ----------------eLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--IG  1028
                                 E  G +     N+L  FD   +  A N D++   KI  + 
Sbjct  197   GEGEEEEEDNPSRHSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDQDVIRKIQRVR  256

Query  1029  GNARGRGHIVIVQ--------------QLPSrpekrrqpgrqgggSSNALEETLCTATFT  1166
             GN   RG I+ V+              +   R +++R    +GG   N LEET C+    
Sbjct  257   GN---RGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRRTRGGSQDNGLEETFCSMRIK  313

Query  1167  QNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +N+ + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  314   ENLADPERADIFNPQAGRISTLNRFNLPILQQLELSAER  352


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            Q+F  Q+ QNE CQ++++HA  P   I +E GTTE+W+PN +Q +C G    R  I+PNG
Sbjct  1    QTFSSQQFQNE-CQINRLHAFAPQTRIRSEAGTTEWWNPNSQQLRCAGVSVMRQTIEPNG  59

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LPS+T+AP + Y++QG
Sbjct  60   LVLPSFTNAPQLLYIVQG  77



>sp|P05190.1|LEGB4_VICFA RecName: Full=Legumin type B; Contains: RecName: Full=Legumin 
type B alpha chain; AltName: Full=Legumin type B acidic chain; 
Contains: RecName: Full=Legumin type B beta chain; AltName: 
Full=Legumin type B basic chain; Flags: Precursor [Vicia 
faba]
 emb|CAA27313.1| legumin B [Vicia faba]
Length=484

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/256 (32%), Positives = 123/256 (48%), Gaps = 43/256 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+ +PGC +TYQ+               D +QKIR + KGDII IP+   +W YN
Sbjct  98    GKGVIGLTLPGCPQTYQEPRSSQSRQGSRQQQPDSHQKIRRFRKGDIIAIPSGIPYWTYN  157

Query  795   QNREPTILV-VLQRAN--------PVSFFLAGKP----GSSHqgqreqgrqqqeLMTERL  935
                EP + + +L  +N        P  F+L G P      + + Q+E+ +Q+  L   R 
Sbjct  158   NGDEPLVAISLLDTSNIANQLDSTPRVFYLVGNPEVEFPETQEEQQERHQQKHSLPVGRR  217

Query  936   G------------YDGN-ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---  1067
             G             DGN +L+GF  + +    NT+ +TA+++     + R  IV V+   
Sbjct  218   GGQHQQEEESEEQKDGNSVLSGFSSEFLAHTFNTEEDTAKRLRSPRDK-RNQIVRVEGGL  276

Query  1068  ------QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTT  1229
                         E+  +  ++     N LEET+C+    +NI    RAD+Y+ RAG ++T
Sbjct  277   RIINPEGQQEEEEEEEEEKQRSEQGRNGLEETICSLKIRENIAQPARADLYNPRAGSIST  336

Query  1230  LNSFTLPALSYVRLSA  1277
              NS TLP L Y+RLSA
Sbjct  337   ANSLTLPILRYLRLSA  352


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+L  I+A+ P   + +E G TE W+PNH + +C G    R  I PNGL LPSY+ +P 
Sbjct  32   QCRLDNINALEPDHRVESEAGLTETWNPNHPELRCAGVSLIRRTIDPNGLHLPSYSPSPQ  91

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  92   LIYIIQG  98



>gb|AEO27674.1| seed storage protein legumin A, partial [Gossypium herbaceum]
Length=486

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 124/279 (44%), Gaps = 66/279 (24%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QKIR + +GDII +P   VHW YN  
Sbjct  77    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKIRRFRQGDIIALPQGVVHWSYNDG  136

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqq-------------  914
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  137   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESQEEE  196

Query  915   ----------------eLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--IG  1028
                                 E  G +     N+L  FD   +  A N D++   KI  + 
Sbjct  197   GEGEEEEEDNPSSHSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDQDVIRKIQRVR  256

Query  1029  GNARGRGHIVIVQ--------------QLPSrpekrrqpgrqgggSSNALEETLCTATFT  1166
             GN   RG I+ V+              +   R +++R    +GG   N LEET C+    
Sbjct  257   GN---RGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRRTRGGSQDNGLEETFCSMRIK  313

Query  1167  QNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +N+ + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  314   ENLADPERADIFNPQAGRISTLNRFNLPILQQLELSAER  352


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            Q+F  Q+ QNE CQ++++HA  P   I +E GTTE+W+PN +Q +C G    R  I+PNG
Sbjct  1    QTFSSQQFQNE-CQINRLHAFAPQTRIRSEAGTTEWWNPNSQQLRCAGVSVMRQTIEPNG  59

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LPS+T+AP + Y++QG
Sbjct  60   LVLPSFTNAPQLLYIVQG  77



>gb|AAK07609.1|AF319771_1 cruciferin subunit [Brassica napus]
Length=489

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 124/283 (44%), Gaps = 75/283 (27%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSEK---------------------  698
             G +LP  FS+        G G  G +VPGCAET+  S+                      
Sbjct  84    GLYLPTFFSSPKISYVVQGMGISGRVVPGCAETFMDSQPMQGQQQGQQGQQGQQGQQGQQ  143

Query  699   ------GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRA--------  836
                        D +QK+ +   GD+I I A + HW YN   +P +++ L           
Sbjct  144   GQQGLQQQGFRDMHQKVEHVRHGDVIAITAGSSHWIYNTGDQPLVIICLLDIANYQNQLD  203

Query  837   -NPVSFFLAGK--PGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRE  1007
              NP +F LAG    G S Q Q++Q                N+L+GFD Q++  AL  D  
Sbjct  204   RNPRTFRLAGNNPQGGSQQQQQQQQ---------------NMLSGFDPQVLAQALKIDVR  248

Query  1008  TAEKIIGGNARGRGHIVIVQ-----------QLPSrpekrrqpgrqgggSSNALEETLCT  1154
              A+++       RG+IV V+           Q     + R   G       N LEET+C+
Sbjct  249   LAQEL-QNQQDSRGNIVRVKGPFQVVRPPLRQPYESEQWRHPRGPPQSPQDNGLEETICS  307

Query  1155  ATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                 +NID+  RAD+Y    GR+T++NS+TLP L Y+RLSA R
Sbjct  308   MRTHENIDDPARADVYKPNLGRVTSVNSYTLPILQYIRLSATR  350


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R QS          C L  +  ++PT  I +E G  E+WD N+ Q +C G    
Sbjct  18   LNGCLAR-QSLGVPPQIGNACNLDNLDVLQPTETIKSEAGRVEYWDHNNPQIRCAGVSVS  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R II+  GL+LP++ S+P ++YV+QG
Sbjct  77   RLIIEQGGLYLPTFFSSPKISYVVQG  102



>gb|ABG73109.1| Pis v 2.0101 allergen11S globulin precusor [Pistacia vera]
Length=496

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 118/241 (49%), Gaps = 26/241 (11%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             GSG +G + PGC ET+Q+  +            +++QK+R  ++GD+I +PA   HW YN
Sbjct  108   GSGIHGAVFPGCPETFQEESQSRSRSERSQQSGEQHQKVRPIQEGDVIALPAGVAHWIYN  167

Query  795   QNREPTILVVL----QRANPV-----SFFLAGKPGSS---HqgqreqgrqqqeLMTERLG  938
               +   +LV L       N +      F L G P          R + + Q     ++  
Sbjct  168   NGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQ  227

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ------LPSrpekrrq  1100
                NIL+ FD +I+  + N D + A ++     R RG IV VQ+         + +++  
Sbjct  228   QSNNILSAFDEEILAQSFNIDTQLARRL-QKEKRQRGIIVRVQEDLEVLSPHRQEQEQEY  286

Query  1101  pgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAA  1280
                +     N LEET CT T   NI++  RAD+Y+ R GR++++N+  LP L +++LSA 
Sbjct  287   EEERERRQRNGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAK  346

Query  1281  R  1283
             +
Sbjct  347   K  347


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  184  LSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAY  363
            +  ++A+ P   I +E G TEFWD N EQ QC     FRH IQ  GL +PSY +AP + Y
Sbjct  45   IQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVY  104

Query  364  VLQGT  378
            V+QG+
Sbjct  105  VVQGS  109



>ref|XP_006647177.1| PREDICTED: glutelin type-B 2-like [Oryza brachyantha]
Length=495

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 109/250 (44%), Gaps = 44/250 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+V+PA   HWF
Sbjct  110   GRGYIGLTFPGCPPTYQQQFQYFLPQEQSQSQKFRDEHQKIHQFRQGDIVVLPAGVAHWF  169

Query  789   YNQNREPTILV----VLQRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + V    V   AN +      F L G    + Q       Q           
Sbjct  170   YNDGDVPVVAVYVYDVKNSANQLEPRQREFLLGGNNMRAQQVYGSSVEQHSR--------  221

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----------------L  1073
               NI +GF V+I+ +AL    ET +++   N + RG I+ V+                  
Sbjct  222   -QNIFSGFGVEILSEALGISTETTKRLQSQNDQ-RGEIIHVKNGLQFLKPTLTQQQEQAQ  279

Query  1074  PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                 E +    +Q     N L+E  CT     NI+N  RAD Y+ RAGR T+LNS   P 
Sbjct  280   AQYQEVQYSEQQQTSSRWNGLDENFCTIKARMNIENPSRADTYNPRAGRTTSLNSQKFPI  339

Query  1254  LSYVRLSAAR  1283
             L+ V++SA R
Sbjct  340   LNLVQMSATR  349


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  157  QESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPS  336
            ++  + +C+  ++ A  P   + +E G TE++D  +E FQC G +  R +IQP GL +P 
Sbjct  38   RQGSSRQCRFDRLQAFEPLRKVRSEAGVTEYFDEKNELFQCTGTFVIRRVIQPQGLLVPR  97

Query  337  YTSAPLVAYVLQG  375
            YT+AP + Y++QG
Sbjct  98   YTNAPGLVYIIQG  110



>ref|XP_009417018.1| PREDICTED: glutelin type-A 1-like [Musa acuminata subsp. malaccensis]
Length=490

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 123/263 (47%), Gaps = 70/263 (27%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---QSEKGSEIL--------DKYQKIRYYEKGDIIVIPASAVH  782
             G G  G + PGC ET+Q   Q+E+  E +        D++Q+I Y+ +GDII +PA   +
Sbjct  114   GRGIIGTVFPGCPETFQSFQQTEQQWEQVAGGCQRFRDEHQRIHYFREGDIIALPAGVSY  173

Query  783   WFYNQNREPTILVV-----LQRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTER  932
             W YN N E  ++ +     +  AN +      F LAG+                    ER
Sbjct  174   WGYN-NGEVAVVAITTFDTISSANQLDRQHREFLLAGR--------------------ER  212

Query  933   LGYDG-------------NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV---  1064
             L   G             N+L+GF++  + +AL  DRE   KI   + R RG IV+V   
Sbjct  213   LVEQGSQIEVRLQQIKGNNLLSGFELDPLAEALGVDRELVRKIQNPDDR-RGEIVLVTSG  271

Query  1065  ----------QQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRA  1214
                       +QL    E R++     G  SN L E  CT    QNI +  RAD ++ RA
Sbjct  272   LQVLQASRQSEQLVREREVRQECQEGRGCQSNVL-EAFCTMKVRQNIGDPLRADYFNPRA  330

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR+TTLNS  LP L +V++SA R
Sbjct  331   GRITTLNSQKLPILRFVQMSAVR  353


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            S+  +C++ ++  +  T  +P+E G TE++D  +EQ QC G  A RH IQP GL LPS++
Sbjct  44   SRVSQCKIEKLSTLELTRRVPSEAGYTEYFDQYNEQLQCVGVSACRHTIQPRGLLLPSFS  103

Query  343  SAPLVAYVLQG  375
            SAP + Y++QG
Sbjct  104  SAPRLVYIVQG  114



>ref|XP_006480087.1| PREDICTED: LOW QUALITY PROTEIN: legumin A-like [Citrus sinensis]
Length=436

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 108/246 (44%), Gaps = 37/246 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS-------EILDKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G   PG  ETYQ  ++G           D +QKIR + +GDI  +PA   HW YN
Sbjct  100   GEGLTGXPFPGYPETYQSPQQGGFGESAGRSQQDSHQKIRRFRQGDIFALPAGVAHWCYN  159

Query  795   QNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
             +   P + VVL            NP  F LAG P    Q QR+Q R              
Sbjct  160   EGSTPVVAVVLLDVANNDNQLDRNPRKFHLAGNPHQEFQQQRQQERFGGHQQCN------  213

Query  948   NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV--------------QQLPSrp  1085
             N+  GFD +I+ +A N D     ++       RG IV V              Q+     
Sbjct  214   NVFCGFDTRILAEAFNVDERLVRRLR-SEKDYRGAIVTVRGQLQVARPPRTQSQREYEED  272

Query  1086  ekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
                 +  R   G  N +EET+CT    +NI +  +ADIY   AG +TTLNS  LP L ++
Sbjct  273   SSEYERSRGRYGGDNGVEETMCTMKLRENIGDPSKADIYTQGAGHITTLNSLNLPVLRWI  332

Query  1266  RLSAAR  1283
             +LSA R
Sbjct  333   QLSAER  338


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F GC    Q    Q  Q   CQ++ + A+ P   +  E G  E WDP HEQFQC G    
Sbjct  18   FRGCLAANQQ---QWQQPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAGVAVV  74

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            RH I+  GL LP ++++P + Y+LQG
Sbjct  75   RHTIRQKGLLLPQFSNSPQLVYILQG  100



>gb|KHG13642.1| Legumin A [Gossypium arboreum]
Length=508

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 123/279 (44%), Gaps = 66/279 (24%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE-----ILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G  GI++PGCAET+Q S++          D++QKIR + +GDII +P   VHW YN  
Sbjct  99    GRGIQGIVMPGCAETFQDSQQWQHQSRGRFQDQHQKIRRFRQGDIIALPQGVVHWSYNDG  158

Query  801   REPTILVVL----QRAN-----PVSFFLAGKPGSSHqgqreqgrqqq-------------  914
              E  + + L      AN     P  F LAG P    +  R   +Q Q             
Sbjct  159   NERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESQEEE  218

Query  915   ----------------eLMTERLGYD----GNILAGFDVQIVKDALNTDRETAEKI--IG  1028
                                 E  G +     N+L  FD   +  A N D++   KI  + 
Sbjct  219   GEGEEEEEDNPSRHSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDQDVIRKIQRVR  278

Query  1029  GNARGRGHIVIVQQ--------------LPSrpekrrqpgrqgggSSNALEETLCTATFT  1166
             GN   RG I+ V+                  R +++R    +GG   N LEET C+    
Sbjct  279   GN---RGTIIRVRDRLQVVTPPRMEEEEREERQQEQRYRRTRGGSQDNGLEETFCSMRIK  335

Query  1167  QNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +N+ + ERADI++ +AGR++TLN F LP L  + LSA R
Sbjct  336   ENLADPERADIFNPQAGRISTLNRFNLPILQQLELSAER  374


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +1

Query  121  NGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFR  300
            NGC  R Q+F  Q+ QNE CQ++++HA  P   I +E GTTE+W+PN +Q +C G    R
Sbjct  17   NGCLAR-QTFSSQQFQNE-CQINRLHAFAPQTRIRSEAGTTEWWNPNSQQLRCAGVSVMR  74

Query  301  HIIQPNGLFLPSYTSAPLVAYVLQG  375
              I+PNGL LPS+T+AP + Y++QG
Sbjct  75   QTIEPNGLVLPSFTNAPQLLYIVQG  99



>ref|XP_006443837.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
 gb|ESR57077.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
Length=434

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 108/244 (44%), Gaps = 37/244 (15%)
 Frame = +3

Query  642   GEYGIIVPGCAETYQQSEKGS-------EILDKYQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G +G   PG  ETYQ  ++G           D +QKIR + +GDI  +PA   HW YN+ 
Sbjct  100   GSHGDPFPGYPETYQSPQQGGFGESAGRSQQDSHQKIRRFRQGDIFALPAGVAHWCYNEG  159

Query  801   REPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
               P + VVL            NP  F LAG P    Q QR+Q R              N+
Sbjct  160   STPVVAVVLLDVANNDNQLDRNPRKFHLAGNPHQEFQQQRQQERFGGHQQCN------NV  213

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV--------------QQLPSrpek  1091
               GFD +I+ +A N D     ++       RG IV V              Q+       
Sbjct  214   FCGFDTRILAEAFNVDERLVRRLR-SEKDYRGAIVTVRGQLQVARPPRTQSQREYEEDSS  272

Query  1092  rrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +  R   G  N +EET+CT    +NI +  +ADIY   AG +TTLNS  LP L +++L
Sbjct  273   EYERSRGRYGGDNGVEETMCTMKLRENIGDPSKADIYTQGAGHITTLNSLNLPVLRWIQL  332

Query  1272  SAAR  1283
             SA R
Sbjct  333   SAER  336


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F GC    Q    Q  Q   CQ++ + A+ P   +  E G  E WDP HEQFQC G    
Sbjct  18   FRGCLAANQQ---QWQQPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAGVAVV  74

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQGTY  381
            RH I+  GL LP ++++P + Y+LQG++
Sbjct  75   RHTIRQKGLLLPQFSNSPQLVYILQGSH  102



>emb|CAA53177.1| ginnacin [Ginkgo biloba]
Length=460

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 105/230 (46%), Gaps = 27/230 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE----KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ-N  800
             G G  G++ PGC ET+Q S     +G +  ++ QKIR   +GD++ IPA   +W YN  N
Sbjct  108   GEGRLGVVFPGCPETFQSSTSRGGEGQQSQERSQKIRRVRRGDVVAIPAGVAYWLYNDGN  167

Query  801   REPTILVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNIL  956
             R   I+ +   +N  +        F+LAG   S  Q                     NIL
Sbjct  168   RRLQIVAIADTSNDQNQLDQTYRPFYLAGSAPSGAQKAAGAT-----------SIGDNIL  216

Query  957   AGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-LPSrpekrrqpgrqgggSSNA  1133
              GFD   + +A+   ++TA +I     + +G IV V++ L           R+     N 
Sbjct  217   QGFDTDTLAEAMGISQDTARRI--QQNQKKGLIVKVERGLRMPGPPSDDYEREREREGNN  274

Query  1134  LEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +EE  C+     N D+ E AD+Y    GRL T+N   LPAL  +RL A R
Sbjct  275   VEELYCSMRLRHNADDSEDADVYVRNGGRLNTVNRLKLPALRSLRLGAER  324


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  136  RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWD-PNHEQFQCGGAYAFRHIIQ  312
            RRQ    Q+S    C+  +++A  PT  I +EGG+ E  +  + EQFQC G    R  + 
Sbjct  32   RRQREQLQQS----CRFDRLNAQEPTQRITSEGGSVELLNVEDSEQFQCAGVAPLRETLN  87

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
            PN L LP YT+ P +AYV++G
Sbjct  88   PNALSLPRYTNTPTMAYVVEG  108



>gb|AFZ41189.1| glutelin, partial [Oryza sativa Indica Group]
Length=472

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 122/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  95    GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  154

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P I+V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  155   YNGGDTPAIVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  212

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E A+++   N + RG I+ V+   QL  P+  +++ +P +      
Sbjct  213   FNTEVLSEALGINTEAAKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEPRQYQQVQY  271

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + AAR
Sbjct  272   REGQYNGLDENFCTIKARVNIENPNRADYYNPRAGRITLLNNQKFPILNLIGMGAAR  328


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P     +E G TE++D  +EQF+C G +  R +I+P GL
Sbjct  19   AWESRQGASRECRFDRLQAFEPLRKARSEAGVTEYFDERNEQFRCAGVFVIRRVIEPQGL  78

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  79   VVPRYSNTPALAYIIQG  95



>ref|XP_006281468.1| hypothetical protein CARUB_v10027551mg [Capsella rubella]
 gb|EOA14366.1| hypothetical protein CARUB_v10027551mg [Capsella rubella]
Length=466

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 114/256 (45%), Gaps = 59/256 (23%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQS-----------------EKGSEILDKYQKIRYYEKGDII  758
             + G G  G ++PGCAET+Q S                 E+ S+  D +QK+ +   GD I
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPREGRRQFEGQGEEEQSQFRDMHQKVEHIRSGDTI  152

Query  759   VIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqq  911
                     WFYN+ ++P ++V V   A        NP  F+LAG                
Sbjct  153   ATTPGVAQWFYNEGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVW--------  204

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------  1067
               L     G   NI +GF  +++  A   D +TA+++       RG+IV V+        
Sbjct  205   --LQGREQGPQKNIFSGFGPEVIAQAFKIDLQTAQQLQN-QQDNRGNIVRVKGPFGVIRP  261

Query  1068  ----QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLN  1235
                 Q P   E+            N LEET+C+A    N+D+  RAD+Y  + G ++TLN
Sbjct  262   PLRGQRPQEEER----------EGNGLEETICSARSVDNLDDPSRADVYKPQLGYISTLN  311

Query  1236  SFTLPALSYVRLSAAR  1283
             S+ LP L ++RLSA R
Sbjct  312   SYDLPILRFIRLSALR  327


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   LHGYTAQQFPNECQLEQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFVRYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>gb|EAY85201.1| hypothetical protein OsI_06564 [Oryza sativa Indica Group]
Length=484

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 122/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  103   GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  162

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P I+V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  163   YNGGDTPAIVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  220

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E A+++   N + RG I+ V+   QL  P+  +++ +P +      
Sbjct  221   FNTEVLSEALGINTEAAKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEPRQYQQVQY  279

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + AAR
Sbjct  280   REGQYNGLDENFCTIKARVNIENPNRADYYNPRAGRITLLNNQKFPILNLIGMGAAR  336


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P     +E G TE++D  +EQF+C G +  R +I+P GL
Sbjct  27   AWESRQGASRECRFDRLQAFEPLRKARSEAGVTEYFDERNEQFRCAGVFVIRRVIEPQGL  86

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  87   VVPRYSNTPALAYIIQG  103



>emb|CDX89858.1| BnaA10g02240D [Brassica napus]
Length=470

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 110/238 (46%), Gaps = 34/238 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE---------KGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G + PGCAET+  S          +G    D +QK+ +   GD I  P     WF
Sbjct  107   GHGLMGKVTPGCAETFMDSPVFGQGQSQEQGQGFRDMHQKVEHLRCGDTIATPPGVAQWF  166

Query  789   YNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
             YN   EP ILV           L R N   F +AG             + QQ L   +  
Sbjct  167   YNNGNEPLILVAAADIANNLNQLDR-NLRPFLIAGN----------NPQGQQWLQGRQQQ  215

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrpekrrqpgr  1109
                NI  GF  QI+  A     ETA+K+       RG+IV VQ    +   P ++ Q G+
Sbjct  216   KQNNIFNGFAPQILAQAFKISVETAQKLQNQQVN-RGNIVKVQGQFGVIRPPLRQGQGGQ  274

Query  1110  qgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP L ++RLSA R
Sbjct  275   QPQEEGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILRFLRLSALR  332


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  I +EGG  E WD +  Q +C G    R +I+P G
Sbjct  30   FHGFTAQQWPNECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSGFAFERFVIEPQG  89

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LP++ +A  + +V+ G
Sbjct  90   LYLPTFLNAGKLTFVVHG  107



>emb|CAA90641.1| legumin; 11S-globulin [Ginkgo biloba]
Length=460

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 105/230 (46%), Gaps = 27/230 (12%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE----KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ-N  800
             G G  G++ PGC ET+Q S     +G +  ++ QKIR   +GD++ IPA   +W YN  N
Sbjct  108   GEGRLGVVFPGCPETFQSSTSRGGEGQQSQERSQKIRRVRRGDVVAIPAGVAYWLYNDGN  167

Query  801   REPTILVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNIL  956
             R   I+ +   +N  +        F+LAG   S  Q                     NIL
Sbjct  168   RRLQIVAIADTSNHQNQLDQTYRPFYLAGSAPSGAQKAAGATS-----------IGDNIL  216

Query  957   AGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-LPSrpekrrqpgrqgggSSNA  1133
              GFD   + +A+   ++TA +I     + +G IV V++ L           R+     N 
Sbjct  217   QGFDTDTLAEAMGISQDTARRI--QQNQKKGLIVKVERGLRMPGPPSDDYEREREREGNN  274

Query  1134  LEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +EE  C+     N D+ E AD+Y    GRL T+N   LPAL  +RL A R
Sbjct  275   VEEFYCSMRLRHNADDSEDADVYVRNGGRLNTVNRLKLPALRSLRLGAER  324


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  136  RRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWD-PNHEQFQCGGAYAFRHIIQ  312
            RRQ    Q+S    C+  +++A  PT  I +EGG+ E  +  + EQFQC G    R  + 
Sbjct  32   RRQREQLQQS----CRFDRLNAQEPTQRITSEGGSVELLNVEDSEQFQCAGVAPLRETLN  87

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
            PN L LP YT+ P +AYV++G
Sbjct  88   PNALSLPRYTNTPTMAYVVEG  108



>emb|CDP79026.1| edestin 1 [Cannabis sativa]
Length=511

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 123/265 (46%), Gaps = 50/265 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+  PGC ET+++S++G           D++QK+R+  +GDI+ IPA   +W YN
Sbjct  107   GRGILGVTFPGCPETFEESQRGQGQGQSQGSQPDRHQKLRHVREGDIVAIPAGVAYWSYN  166

Query  795   QNREPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDG  947
                +  + V L            NP  F+LAG P      Q  +   +     ER+    
Sbjct  167   NGDQQLVFVSLLDTSNVNNQLDDNPRRFYLAGNP-EDEFEQLRREGGRGARFDERIRERS  225

Query  948   ----------NILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIVIVQQLPS  1079
                       NI  GF+ +  ++A N D ET +++ G N       R +G + +V  L S
Sbjct  226   EGRHSSENYRNIFKGFNSRYPEEAFNVDSETVKRLQGQNDDRNSIIRVKGTLDLVSPLRS  285

Query  1080  rpekrrqpgrqggg-----------------SSNALEETLCTATFTQNIDNRERADIYDS  1208
               E +R+   +                     +N LEET C+    +NI +  RAD++  
Sbjct  286   SQEHQREERYEDERQREIEQERRRMSRGGRYEANGLEETFCSMRLRENIGDPSRADVFTP  345

Query  1209  RAGRLTTLNSFTLPALSYVRLSAAR  1283
             +AGR++T+NS+ LP L +++LSA R
Sbjct  346   QAGRISTVNSYNLPILRFLQLSAER  370


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q  +CQ+ +I A  P   + AE G  E W+PNH QFQC G    R+ IQ NGL LPSYT+
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHSQFQCAGVAVVRYTIQQNGLHLPSYTN  97

Query  346  APLVAYVLQG  375
             P + Y+++G
Sbjct  98   TPQLVYIVKG  107



>ref|XP_004289944.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 127/288 (44%), Gaps = 66/288 (23%)
 Frame = +3

Query  609   DGYFLPFST----------GSGEYGIIVPGCAETYQQSEKGSE-----------------  707
             +G  LPF T          G G+ G+++PGC ET++++E+  E                 
Sbjct  79    NGLHLPFYTNSPRLLYVVQGRGQLGMVIPGCPETFEETEQSYEEQLQGSQQQGQGQQGRQ  138

Query  708   ----------------ILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRAN  839
                              LD++QK+R  ++GD+I +PA    W YN   +  + V LQ  +
Sbjct  139   QIGRRQGQQGQQESFEQLDRHQKVRPVKEGDVIAVPAGVTTWSYNDGDQSLVFVCLQDTS  198

Query  840   ---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE-RLGYDGN----ILAGFDVQI  977
                      P  F+LAG P      Q +          + R    GN    + AGFD ++
Sbjct  199   NLHNQLDQIPRRFYLAGNPQDEFTQQGQSRHSIARQQGKIRHQQQGNNNNNVFAGFDTRL  258

Query  978   VKDALNTDRETAEKIIGGNARGRGHIVIVQ------QLPSrpekrrqpgrqgggSSNALE  1139
             + DALN D++TA+++ G N   R  IV VQ      Q P    + RQ   +     N  E
Sbjct  259   LADALNIDQQTAQQLQGQND-NRPQIVRVQGRLDFVQPPESMREERQQQGRQ--GQNGFE  315

Query  1140  ETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             E  C     QNI     AD++  +AGR++ LN  ++P L ++RLSA R
Sbjct  316   EVFCHMKMKQNIGKPSMADVFSPQAGRISVLNGLSMPVLRHLRLSAER  363


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F+GC   RQ      SQ  +C L+QI A  P   I  E G  E WD N + FQC G    
Sbjct  15   FHGCSAYRQ--QSPSSQQNECMLNQIQAREPDNRIETEAGRIESWDYNQDDFQCAGVAVQ  72

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  ++ NGL LP YT++P + YV+QG
Sbjct  73   RITVERNGLHLPFYTNSPRLLYVVQG  98



>emb|CAR78996.1| legumin storage protein 5 [Lotus japonicus]
Length=476

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 118/248 (48%), Gaps = 40/248 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAET----YQQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNR  803
             GSG +G+I PGC ET    ++  ++G    D++QK+  + +GD+I +P   V W YN+  
Sbjct  98    GSGIFGMIFPGCPETVEEPFESDQQGRR--DRHQKVNRFREGDVIAVPPGVVFWMYNEEE  155

Query  804   EPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNIL  956
              P I V L             P  F+L+G    + + +  Q ++Q+    E     GNI 
Sbjct  156   TPVIAVSLIDTGSYLNQLDQMPRRFYLSG----NQEQEFLQYQRQEVRGREEENQGGNIF  211

Query  957   AGFDVQIVKDALNTDRETAEKIIGGN-ARGRGHIVIVQ--------------------QL  1073
             +GF  + ++DALN DR    K+ G +  + +G IV V+                    + 
Sbjct  212   SGFGGEFLEDALNIDRNIVHKLQGRDEEQDKGAIVRVKGGLSVITPPERQSHRRGSEEEE  271

Query  1074  PSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                 ++  +   +GG   N LEET+CT     NI      DI++ +AGR+ T   F  PA
Sbjct  272   DEEEDRPSRHQSRGGSRRNGLEETICTVRLRMNIGKSSSPDIFNPQAGRIKTATGFDFPA  331

Query  1254  LSYVRLSA  1277
             L +++LSA
Sbjct  332   LRFLKLSA  339


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F GCF  RQ       Q  +CQL +++A++P   I +E G  E W+P + QF+C G    
Sbjct  17   FGGCFAIRQQ----SQQQNECQLERLNALKPDNRIESEAGYIETWNPTNNQFRCAGVALS  72

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQGT  378
            R  ++ NGL  PSY++AP   ++ QG+
Sbjct  73   RCTLRRNGLKRPSYSNAPQEIFIQQGS  99



>emb|CAA64762.1| legumin-like protein [Asarum europaeum]
Length=462

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 113/244 (46%), Gaps = 42/244 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY--------QQSEKGSEIL-----DKYQKIRYYEKGDIIVIPASA  776
             G G  GI  PGCAE+Y        QQS +  +       D++QK+    +GDI+ +PA A
Sbjct  100   GRGLLGISYPGCAESYHSRRQSTSQQSPRERQTEQQRGEDQHQKVHRIRRGDIVALPAGA  159

Query  777   VHWFYNQNREPTILVVLQRAN---------PVSFFLAG-KPGSSHqgqreqgrqqqeLMT  926
              HW YN   E  I + +   N         P SF+LAG +P  S                
Sbjct  160   AHWCYNDGNEELIALSITDVNSETNQLDQTPRSFYLAGGEPKRS------------STQQ  207

Query  927   ERLGYDGN-ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPSrpek  1091
             ++  Y+ N IL  FD +++ DA +   E   K+   + RG   IV V+Q    +    E+
Sbjct  208   QKQQYNANNILRAFDERMMADAFDVPMEVVRKMQREDERG--FIVKVEQGEMSMIRPDEE  265

Query  1092  rrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRL  1271
               +   +    SN +EE  C       +DN + AD+Y  +AGRL ++N   LP L Y+++
Sbjct  266   EDEESEERRRGSNGMEEAYCNMRINMYLDNPKEADVYSRQAGRLNSVNMNKLPILRYMQM  325

Query  1272  SAAR  1283
             SA +
Sbjct  326   SAEK  329


 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  172  EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAP  351
            ++C++ Q+ A RP+  I +EGG TE WD N EQFQC G  A R+IIQ N L LP+++ +P
Sbjct  33   QQCRIQQLSASRPSRRIESEGGVTELWDENEEQFQCAGVAATRNIIQQNSLSLPNFSPSP  92

Query  352  LVAYVLQG  375
             + Y+ QG
Sbjct  93   RLVYIQQG  100



>emb|CDY18193.1| BnaC05g02160D [Brassica napus]
Length=457

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 109/238 (46%), Gaps = 34/238 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE---------KGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G    G + PGCAET+  S          +G    D +QK+ +   GD I  P     WF
Sbjct  94    GHALMGKVTPGCAETFMDSPVFGQGQGQEQGQGFRDMHQKVEHLRCGDTIATPPGVAQWF  153

Query  789   YNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
             YN   EP ILV           L R N   F LAG             + QQ L   +  
Sbjct  154   YNNGNEPLILVAAADIANNLNQLDR-NLRPFLLAGN----------NPQGQQWLQGRQQQ  202

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrpekrrqpgr  1109
                NI  GF  QI+  A     ETA+K+       RG+IV VQ    +   P ++ Q G+
Sbjct  203   KQNNIFNGFAPQILAQAFKISVETAQKLQNQQVN-RGNIVKVQGQFGVIRPPLRQGQGGQ  261

Query  1110  qgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP L ++RLSA R
Sbjct  262   QPQEEGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILRFLRLSALR  319


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  FHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLF  327
            F  Q+  NE CQL Q++A+ P+  I +EGG  E WD +  Q +C G    R +I+P GL+
Sbjct  20   FTAQQWPNE-CQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSGFAFERFVIEPQGLY  78

Query  328  LPSYTSAPLVAYVLQG  375
            LP++ +A  + +V+ G
Sbjct  79   LPTFLNAGKLTFVVHG  94



>gb|EPS70989.1| hypothetical protein M569_03772 [Genlisea aurea]
Length=572

 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 130/314 (41%), Gaps = 99/314 (32%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ----------------------------SEKGSEIL------  713
             G+G  G+++PGCAET++                             SE+G          
Sbjct  118   GNGVQGVVIPGCAETFESGESSEGRREGGPRWESERGRGEGGRRWESERGQSEGGRRWEG  177

Query  714   -------DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRANPVS-------  848
                    D++QK+R   +GD++ +P     W YN      + V +L  AN  +       
Sbjct  178   GEGGSQRDRHQKLRRIRQGDVLALPQGVTRWTYNDGDSELVTVSILDVANDNNQLDLNFR  237

Query  849   -FFLAGKPGSSHqgqreqgrqqqeLMT--------ERLGYDGNILAGFDVQIVKDALNTD  1001
              FFLAG P SS + +  +  +Q+            ER     NI +GFD +++ DA N D
Sbjct  238   KFFLAGNPSSSGRQEGRREGRQEGRHEGRRFGGREERSDEWRNIFSGFDEELLADAFNVD  297

Query  1002  RETAEKIIGGNARGRGHIVIVQQ----LPS------------------------------  1079
              +   ++   +   RG IV  ++    LP                               
Sbjct  298   NQLIRRLQSQDD-NRGFIVKAERLNLVLPEYSREEREEEFRHGGGRREQEWRHGGTRREQ  356

Query  1080  ------rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSF  1241
                      ++      G  SSN LEET CT    Q+IDN ERADI++ RAGR++T+NS 
Sbjct  357   ERRHGGTRREQEWRHGGGRDSSNGLEETFCTLKLHQSIDNPERADIFNPRAGRISTVNSQ  416

Query  1242  TLPALSYVRLSAAR  1283
             TLP LSY+RL+A R
Sbjct  417   TLPVLSYLRLNAER  430


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
             C++ +I A  P      EGG  E+WD N+E+ +C G    RH+IQP GL LP Y +AP 
Sbjct  52   DCRVQRIDAREPEQRYEFEGGYVEYWDGNNEESECAGIRFVRHVIQPGGLLLPHYANAPQ  111

Query  355  VAYVLQGT  378
            + YV+QG 
Sbjct  112  LVYVVQGN  119



>gb|KHN02503.1| Glycinin G3 [Glycine soja]
Length=481

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 113/250 (45%), Gaps = 36/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             GSG +G+I PGC  T+   QQ  + S   D++QKI ++ +GD+I +P    +W YN    
Sbjct  96    GSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDT  155

Query  807   PTILVVLQRAN---------PVSFFLAGKPGSS------HqgqreqgrqqqeLMTERLGY  941
             P + V L   N         P  F+LAG            + Q     Q+ +   E    
Sbjct  156   PVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENE  215

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARG-RGHIVIVQ-----------------  1067
              G+IL+GF  + ++ A   DR+   K+ G N    +G IV V+                 
Sbjct  216   GGSILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRP  275

Query  1068  QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
             +   +P+   +       S N ++ET+CT     NI      DI++ +AG +TT  S   
Sbjct  276   EEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDF  335

Query  1248  PALSYVRLSA  1277
             PALS+++LSA
Sbjct  336   PALSWLKLSA  345


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = +1

Query  118  FNGC---FGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGA  288
            F+GC   F  R+    Q  QNE CQ+ +++A++P   I +EGG  E W+PN++ FQC G 
Sbjct  13   FSGCCFAFSSRE----QPQQNE-CQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGV  67

Query  289  YAFRHIIQPNGLFLPSYTSAPLVAYVLQGT  378
               R  +  N L  PSYT+ P   Y+ QG+
Sbjct  68   ALSRCTLNRNALRRPSYTNGPQEIYIQQGS  97



>sp|P11828.1|GLYG3_SOYBN RecName: Full=Glycinin G3; Contains: RecName: Full=Glycinin A 
subunit; Contains: RecName: Full=Glycinin B subunit; Flags: 
Precursor [Glycine max]
 emb|CAA33217.1| glycinin subunit G3 [Glycine max]
Length=481

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 113/250 (45%), Gaps = 36/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             GSG +G+I PGC  T+   QQ  + S   D++QKI ++ +GD+I +P    +W YN    
Sbjct  96    GSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDT  155

Query  807   PTILVVLQRAN---------PVSFFLAGKPGSS------HqgqreqgrqqqeLMTERLGY  941
             P + V L   N         P  F+LAG            + Q     Q+ +   E    
Sbjct  156   PVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENE  215

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARG-RGHIVIVQ-----------------  1067
              G+IL+GF  + ++ A   DR+   K+ G N    +G IV V+                 
Sbjct  216   GGSILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRP  275

Query  1068  QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
             +   +P+   +       S N ++ET+CT     NI      DI++ +AG +TT  S   
Sbjct  276   EEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDF  335

Query  1248  PALSYVRLSA  1277
             PALS+++LSA
Sbjct  336   PALSWLKLSA  345


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            SF  Q  QNE CQ+ +++A++P   I +EGG  E W+PN++ FQC G    R  +  N L
Sbjct  21   SFREQPQQNE-CQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNAL  79

Query  325  FLPSYTSAPLVAYVLQGT  378
              PSYT+AP   Y+ QG+
Sbjct  80   RRPSYTNAPQEIYIQQGS  97



>ref|XP_006418192.1| hypothetical protein EUTSA_v10009863mg [Eutrema salsugineum]
 gb|ESQ36545.1| hypothetical protein EUTSA_v10009863mg [Eutrema salsugineum]
Length=441

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 113/233 (48%), Gaps = 35/233 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ---  797
             G G  G I  GC ETY++    + G    D +QK+  + +GD+  + A    W+YN+   
Sbjct  97    GEGVMGTIASGCPETYEEIGGGDSGRRFEDMHQKLENFRRGDVFALVAGVSQWWYNRGNS  156

Query  798   -----------NREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYD  944
                        NRE  +  V     P  F +AG           + +++++ +T   G  
Sbjct  157   DVVIVIVLDVTNRENQLDQV-----PRMFQIAGS----------RTQEEEQPLTWPTG--  199

Query  945   GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggS  1124
              N  +GFD  I+ +A   D ETA K +      RG+IV  +          +  +Q  G+
Sbjct  200   NNAFSGFDPNIIAEAFKIDIETA-KELQNQKDNRGNIVRAKGPLHFVISPPRQRQQDHGN  258

Query  1125  SNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              N +EET CTA   +NID+ ER+D + +RAGR++TLNS  LP L  VRL+A R
Sbjct  259   VNGIEETYCTARIHENIDDPERSDFFSTRAGRISTLNSHNLPVLRSVRLNAVR  311


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 6/82 (7%)
 Frame = +1

Query  148  FHGQESQN------EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            FHG E++         C  SQI+++ P   I  E G  E WD    + +C G    R  +
Sbjct  16   FHGGEARQLEVPLPNACHFSQINSLGPAHAIKFEAGQMEVWDHTSPELRCAGVTVARITL  75

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            Q N +FLPS+ S+P +AYV+QG
Sbjct  76   QANSIFLPSFFSSPALAYVVQG  97



>pir||S11003 glycinin G3 precursor - soybean
 gb|AAB23211.1| glycinin G3 subunit [soybeans, Peptide, 484 aa]
Length=484

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 113/250 (45%), Gaps = 36/250 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEKGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNRE  806
             GSG +G+I PGC  T+   QQ  + S   D++QKI ++ +GD+I +P    +W YN    
Sbjct  96    GSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDT  155

Query  807   PTILVVLQRAN---------PVSFFLAGKPGSS------HqgqreqgrqqqeLMTERLGY  941
             P + V L   N         P  F+LAG            + Q     Q+ +   E    
Sbjct  156   PVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENE  215

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARG-RGHIVIVQ-----------------  1067
              G+IL+GF  + ++ A   DR+   K+ G N    +G IV V+                 
Sbjct  216   GGSILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRP  275

Query  1068  QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
             +   +P+   +       S N ++ET+CT     NI      DI++ +AG +TT  S   
Sbjct  276   EEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDF  335

Query  1248  PALSYVRLSA  1277
             PALS+++LSA
Sbjct  336   PALSWLKLSA  345


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            SF  Q  QNE CQ+ +++A++P   I +EGG  E W+PN++ FQC G    R  +  N L
Sbjct  21   SFREQPQQNE-CQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNAL  79

Query  325  FLPSYTSAPLVAYVLQGT  378
              PSYT+AP   Y+ QG+
Sbjct  80   RRPSYTNAPQEIYIQQGS  97



>gb|AGU36396.1| 11S globulin precursor, partial [Helianthus argophyllus]
Length=336

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 111/220 (50%), Gaps = 33/220 (15%)
 Frame = +3

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQR----ANPVSF-----FLAGK  866
             D +QK+  + +GDII IPA AV+W YN   +  + +++      AN + F     FLAG 
Sbjct  1     DSHQKVHRFREGDIIAIPAGAVYWTYNDRNQEVVAIIVDDVNNFANQLDFQAKTSFLAGG  60

Query  867   PGSSHqgqreqgrqqqeLMT----------------ERLGYDGNILAGFDVQIVKDALNT  998
               S H   ++Q + QQ                    E L  D N+ AGFD +++ +A N 
Sbjct  61    ISSEHIKGQQQFQGQQGQQQFQGRQQGRRRSPFGGQEELTRD-NVYAGFDTELLAEAFNC  119

Query  999   DRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSSNALEETLCTATF  1163
             D +    +    +R RG IV VQQ      P   +++    R  GG SN +EET+C+A  
Sbjct  120   DPQIMRAL--QESRNRGVIVQVQQQMEFVTPEEEQQQMHQRRSRGGPSNGVEETICSAKL  177

Query  1164  TQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               N+DN+  AD+++ +AG+L  +N   LP LS + LSA +
Sbjct  178   VFNLDNQREADVFNRQAGKLNMVNEHKLPILSLMDLSAEK  217



>gb|ABK80750.1| 11S globulin precursor isoform 2A [Ficus pumila var. awkeotsang]
Length=505

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 123/274 (45%), Gaps = 50/274 (18%)
 Frame = +3

Query  612   GYFLPFST----------GSGEYGIIVPGCAETYQQS--EKGSEILDKYQKIRYYEKGDI  755
             G  LPF +          G G +G ++PGC ET+++S  ++     +++QK+R   +GDI
Sbjct  98    GLLLPFFSNAPVIFYVIQGRGFHGAVIPGCPETFEESGFQQSQRSQEQHQKVREICEGDI  157

Query  756   IVIPASAVHWFYNQNREPTILV----VLQRANPVS-----FFLAGKPGSSHqgqreqgrq  908
             +  PA    W YN    P +LV    V  +AN +      F + G P    + ++E  +Q
Sbjct  158   VAAPAGVAQWVYNNGDSPLVLVSFTDVGNQANQLDLNTRRFHIGGNPLKDQRSEQEMRQQ  217

Query  909   qqeLMTERLGY--------DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRG-----  1049
              Q     R           +GNI +GFDV ++ ++   D + A ++   N R        
Sbjct  218   SQSQSRRRRSESASERRNPNGNIFSGFDVGLLAESFKIDNKLASRLQNQNDRRERIVRVR  277

Query  1050  ---HIVIVQQLPSrpekrrqpgrqgggS-------------SNALEETLCTATFTQNIDN  1181
                HIV   ++     +                        +N LEET CT     NID 
Sbjct  278   EDLHIVSPGRIQEEERRHEYRRGSYDEEEYRRRSNGGEYMMTNGLEETFCTLRMRHNIDR  337

Query  1182  RERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               +ADI++ R GR+TT+N+F LP L ++RL+A R
Sbjct  338   PSQADIFNPRGGRVTTVNNFNLPILRFLRLTAER  371


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWD-PNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAP  351
             C+L +++A++P+  + +E G +E+WD  +  Q QC G  A RH IQ  GL LP +++AP
Sbjct  49   DCRLDRLNALQPSRRVQSEAGVSEYWDLESDNQLQCAGVSAVRHTIQNRGLLLPFFSNAP  108

Query  352  LVAYVLQG  375
            ++ YV+QG
Sbjct  109  VIFYVIQG  116



>gb|ABK80753.1| 11S globulin precursor isoform 2B [Ficus pumila var. awkeotsang]
Length=493

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 125/275 (45%), Gaps = 52/275 (19%)
 Frame = +3

Query  612   GYFLPFST----------GSGEYGIIVPGCAETYQQSEKGSEILDKYQ--KIRYYEKGDI  755
             G  LPF +          G G +G ++PGC ET+++S        + Q  K+R    GDI
Sbjct  92    GLLLPFFSNAPVIFYVIQGRGFHGAVIPGCPETFEESGSQQSQRSQEQHQKVREICAGDI  151

Query  756   IVIPASAVHWFYNQNREPTILVVL----QRANPVS-----FFLAGKPGSSHqgqreqgrq  908
             +  PA    W YN    P +LV       +AN +      F + G P    + ++E  +Q
Sbjct  152   VAAPAGVAQWVYNNGDSPLVLVFFTDIGNQANQLDLNTRRFHIGGNPQKDQRSEQEMRQQ  211

Query  909   qqeLMTERLGY--------DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV  1064
              Q L   R           +GNI +GFDV ++ ++ N D E A ++   N R R  IV V
Sbjct  212   SQSLSRRRRSESASERRNPNGNIFSGFDVGLLAESFNIDNELASRLQNQNDR-RERIVKV  270

Query  1065  QQ-----LPSrpekrrqpgrqgggS-----------------SNALEETLCTATFTQNID  1178
             ++      P R ++  +      GS                 +N LEET CT     NID
Sbjct  271   KEDLHIVSPGRIQEEERRHEYIRGSYDEEEYRRRSNGGEYMMTNGLEETFCTLRMRHNID  330

Query  1179  NRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                +ADI++ R GR TT+N+F LP L ++RL+A R
Sbjct  331   RPSQADIFNPRGGRFTTVNNFNLPILRFLRLTAER  365


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 7/93 (8%)
 Frame = +1

Query  118  FNGCFGR------RQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWD-PNHEQFQ  276
            F+ CF +      R     Q+     C+L  ++A++P+  + +E G +E+WD  +  Q Q
Sbjct  18   FHVCFAQIEQMPLRSGHDQQQRWQTDCRLDHLNALQPSRRVQSEAGVSEYWDLESDNQLQ  77

Query  277  CGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            C G  A RH IQ  GL LP +++AP++ YV+QG
Sbjct  78   CAGVSAVRHTIQNRGLLLPFFSNAPVIFYVIQG  110



>ref|XP_006647144.1| PREDICTED: glutelin type-B 5-like isoform X1 [Oryza brachyantha]
 ref|XP_006647145.1| PREDICTED: glutelin type-B 5-like isoform X2 [Oryza brachyantha]
Length=495

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 113/250 (45%), Gaps = 44/250 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+ +PA   HWF
Sbjct  110   GRGSMGLSFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHWF  169

Query  789   YNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN+   P + L V    N  +        F LAG      Q       +           
Sbjct  170   YNEGDTPVVALYVFDVNNSANQLEPRQKEFLLAGNNNREQQVYSRSIEKHS---------  220

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrr---  1097
               NI +GF+ +++ +AL      A+++ G N + RG I+ V+   QL  P+  ++ +   
Sbjct  221   GQNIFSGFNSELLSEALGISTLAAKRLQGQNDQ-RGEIIRVRNGLQLLKPTFTQQEQEQA  279

Query  1098  --------qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                        +Q     N L+E  CT     NI+N  RAD Y+ RAGR+T LNS   P 
Sbjct  280   QRQYQDQYSEEQQESTRCNGLDENFCTIKARLNIENPSRADTYNPRAGRITRLNSQKFPI  339

Query  1254  LSYVRLSAAR  1283
             L+ V++SA R
Sbjct  340   LNLVQMSATR  349


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
             C+  ++ A  P   + +E G TE++D  +EQFQC G +  R +I+P GL +P YT+AP 
Sbjct  44   DCRFDRLQAFEPLRKVRSEAGVTEYFDERNEQFQCTGTFVVRRVIEPQGLLVPRYTNAPG  103

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  104  MVYIIQG  110



>gb|AFZ41190.1| glutelin, partial [Oryza sativa Japonica Group]
Length=468

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 121/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  93    GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  152

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P ++V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  153   YNGGDTPAVVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  210

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E ++++   N + RG I+ V+   QL  P+  +++ +  +      
Sbjct  211   FNTEVLSEALGINTEASKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEHRQYQQVQY  269

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + AAR
Sbjct  270   REGQYNGLDENFCTIKARVNIENPSRADYYNPRAGRITLLNNQKFPILNLIGMGAAR  326


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P   + +E G TE++D  +EQF+C G +  R +I+P GL
Sbjct  17   AWESRQGASRQCRFDRLQAFEPLRKVRSEAGDTEYFDERNEQFRCAGVFVIRRVIEPQGL  76

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  77   VVPRYSNTPALAYIIQG  93



>gb|AGT59179.1| glutelin, partial [Oryza sativa Indica Group]
Length=468

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 121/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  93    GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  152

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P I+V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  153   YNGGDTPAIVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  210

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E A+++   N + RG I+ V+   QL  P+  +++ +P +      
Sbjct  211   FNTEVLSEALGINTEAAKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEPRQYQQVQY  269

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + A R
Sbjct  270   REGQYNGLDENFCTIKARVNIENPNRADYYNPRAGRITLLNNQKFPILNLIGMGATR  326


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P     +E G TE++D  +EQF+C G +  R +I+P G 
Sbjct  17   AWESRQGASRECRFDRLQAFEPLRKARSEAGVTEYFDERNEQFRCAGVFVIRRVIEPQGP  76

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  77   VVPRYSNTPALAYIIQG  93



>gb|EAZ22416.1| hypothetical protein OsJ_06076 [Oryza sativa Japonica Group]
Length=473

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 116/250 (46%), Gaps = 44/250 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  + +D++QKI  + +GDI+V+P    HWF
Sbjct  88    GRGSMGLTFPGCPATYQQQSQQFLFQGESQSQKFIDEHQKIHQFRQGDIVVLPTGVAHWF  147

Query  789   YNQNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + + +   N  +         F LAGK     Q            + +  G 
Sbjct  148   YNDGDTPVVALYVYDINNSANQLEPRHREFLLAGKNNRVQQVYGRS-------IQQHSG-  199

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrr---  1097
               NI  GF V+ + +ALN +  T +++   N + RG I+ V+   QL  P+  +++    
Sbjct  200   -QNIFNGFSVEPLSEALNINTVTTKRLQSQNDQ-RGEIIHVKNGLQLLKPTLTQRQEQEQ  257

Query  1098  --------qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                         Q     N LEE LCT     NI+N  RAD YD RAGR+T+L+S   P 
Sbjct  258   AQYQEVQYSEKPQTSSRWNGLEENLCTIKTRLNIENPSRADSYDPRAGRITSLDSQKFPI  317

Query  1254  LSYVRLSAAR  1283
             L+ +++SA R
Sbjct  318   LNIIQMSATR  327


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P  N+ +E G TE++D  +E FQC G +  R +IQP GL +P Y + P 
Sbjct  22   ECRFERLQAFEPLQNVRSEAGVTEYFDETNELFQCTGTFVIRRVIQPQGLLIPRYANTPG  81

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  82   MVYIIQG  88



>ref|XP_006282820.1| hypothetical protein CARUB_v10006612mg [Capsella rubella]
 gb|EOA15718.1| hypothetical protein CARUB_v10006612mg [Capsella rubella]
Length=492

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 110/253 (43%), Gaps = 39/253 (15%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK-------------------------------GSEILDKY  722
             G G  G +VPGCAET+  S+                                     D +
Sbjct  102   GKGISGRVVPGCAETFMDSQPMQEQQQEQRQGQQGRQPWGGQGQQGQQGQQQQQGFRDMH  161

Query  723   QKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqg  902
             QK+ +  +GDI  I   + HW YN   +P +++ L         L   P   H     Q 
Sbjct  162   QKVEHVRQGDICAITPGSAHWIYNTGEQPLVIIALLDIANYQNQLDRNPRVFHLAGNNQQ  221

Query  903   rqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKII------GGNARGRGHIVIV  1064
                     ++     N+ +GFD Q++  AL  D + A+++       G   R +G   +V
Sbjct  222   GGFGGPQQQQ--EQKNMWSGFDAQVIAQALKIDVQLAQELQNQQDNRGNIVRVKGPFQVV  279

Query  1065  QQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
             +    +P +  +  R  G   N LEET+C+    +NID+  RAD+Y    GR+TT+NS+T
Sbjct  280   RPPLRQPYESEERRRPRGPQDNGLEETICSMRSHENIDDPARADVYKPNLGRMTTVNSYT  339

Query  1245  LPALSYVRLSAAR  1283
             LP L ++RLSA R
Sbjct  340   LPILQFIRLSATR  352


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R+      + QNE C L  +  ++ T  I +E G  E+WD NH Q +C G    
Sbjct  18   LNGCLARQSLGVPPQLQNE-CNLDNLDVLQATETIKSEAGQIEYWDHNHPQLRCAGVSVA  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R++I+  GL+LP++ ++P ++YV+QG
Sbjct  77   RYVIEQGGLYLPTFFTSPKISYVVQG  102



>ref|NP_001046435.1| Os02g0249000 [Oryza sativa Japonica Group]
 dbj|BAD19796.1| glutelin C precursor [Oryza sativa Japonica Group]
 dbj|BAF08349.1| Os02g0249000 [Oryza sativa Japonica Group]
 gb|ABL74551.1| glutelin [Oryza sativa Japonica Group]
 gb|EAZ22417.1| hypothetical protein OsJ_06077 [Oryza sativa Japonica Group]
Length=484

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 121/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  103   GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  162

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P ++V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  163   YNGGDTPAVVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  220

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E ++++   N + RG I+ V+   QL  P+  +++ +  +      
Sbjct  221   FNTEVLSEALGINTEASKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEHRQYQQVQY  279

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + AAR
Sbjct  280   REGQYNGLDENFCTIKARVNIENPSRADYYNPRAGRITLLNNQKFPILNLIGMGAAR  336


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P   + +E G TE++D  +EQF+C G +  R +I+P GL
Sbjct  27   AWESRQGASRQCRFDRLQAFEPLRKVRSEAGDTEYFDERNEQFRCAGVFVIRRVIEPQGL  86

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  87   VVPRYSNTPALAYIIQG  103



>gb|AAF69015.1|AF261691_1 glutelin [Elaeis guineensis]
Length=471

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 108/232 (47%), Gaps = 20/232 (9%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ---------QSEKGSE--ILDKYQKIRYYEKGDIIVIPASAVH  782
             G G YG ++PGC ET+Q         QSEKG      D++Q+I ++ + D+I I A   H
Sbjct  110   GRGIYGTVIPGCPETFQSFQQSESEKQSEKGQRQRFRDEHQRIHHFNQEDVIAIAAEVAH  169

Query  783   WFYNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAG  962
             W Y     P I   +   +     L    G+S+               +        LA 
Sbjct  170   WCYTDADTPVIAFTVSDISTARISLMKTIGNSYWLGDGVAAGGNLGKNKNRAQRATSLAD  229

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSS  1127
                   + A+  DRE A K+   + + RG IV V++      PS  ++ R+   +    +
Sbjct  230   SIPSYWRPAIGVDREVARKLQCKDDQ-RGEIVRVEKGLEVLRPSSEKQEREERGR---GT  285

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             N LE  +C+    +NID+  RAD+Y  R GR+T LNS  LP LS+++LSA R
Sbjct  286   NGLEVAMCSMRNRENIDSSRRADVYIPRGGRITNLNSQKLPMLSFIQLSAER  337


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 6/81 (7%)
 Frame = +1

Query  139  RQSFH--GQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQ  312
            RQS    G++SQ   C + + +A+ P   + +E G TE++  N+ QF+C G  AFR  I+
Sbjct  34   RQSVRRSGEQSQ---CGVEKHNALEPIREVRSEAGVTEYYQ-NNAQFECAGVAAFRRTIE  89

Query  313  PNGLFLPSYTSAPLVAYVLQG  375
            P GL LPS+++AP + Y++QG
Sbjct  90   PRGLLLPSFSNAPRLVYIIQG  110



>ref|XP_004294115.1| PREDICTED: legumin B-like [Fragaria vesca subsp. vesca]
Length=495

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 120/267 (45%), Gaps = 56/267 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE----------------------------ILDKYQKI  731
             G G  G++ PGC ET+++SE+  E                             LD++Q++
Sbjct  100   GRGHLGLVFPGCPETFEESEQSIEEQQQQQGHRQRHGRRQGKFGEQEQQEFEQLDRHQRV  159

Query  732   RYYEKGDIIVIPASAVHWFYNQNREPTILVVL---------QRANPVSFFLAGKPGSSHq  884
             R  ++GD+I +PA    W +N   +  + V L            NP  F+LAG P     
Sbjct  160   RVIKQGDVIAVPAGVTTWTHNDGDQSLVYVTLLDISNNHNQLDQNPRRFYLAGNPQDEFN  219

Query  885   gqreqgrqqqeLMTERLGYDGN-------------ILAGFDVQIVKDALNTDRETAEKII  1025
               ++QG+        R G  G              I +GF+ +++ DALN D++T +++ 
Sbjct  220   FNQQQGQS----QQRRPGQQGRSMKHQQQGNNNNNIFSGFEARLLADALNIDQQTVQQLQ  275

Query  1026  GGNARGRGHIVIVQ-QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIY  1202
              G +  R  I+ V+ +         +   +     N  EE  C     QNI N   AD++
Sbjct  276   -GQSDNRPQIIRVEGRFDFVEPPESKSEERQLQGHNGFEEVFCHMKIKQNIGNPSMADVF  334

Query  1203  DSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               +AGR++TLNSF+LP L ++RLSA R
Sbjct  335   SPQAGRISTLNSFSLPILRFLRLSAER  361


 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            F GC   RQ    Q SQ   C L+QI A  P   I  E G  E WD N + FQC G    
Sbjct  17   FQGCLAIRQ--QCQSSQQNVCMLNQIQAREPDNRIETEAGRIESWDYNQDDFQCAGVAVQ  74

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+ NGL LPSYT+ P + YV+QG
Sbjct  75   RFTIERNGLHLPSYTNTPRLVYVVQG  100



>gb|AAR06951.1| glutelin C precursor [Oryza sativa Japonica Group]
Length=484

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 121/237 (51%), Gaps = 24/237 (10%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  T+QQ         S++  +  D++QKI  + +GD++ +PAS  HWF
Sbjct  103   GKGYVGLTFPGCPATHQQQFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWF  162

Query  789   YNQNREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL-GYDG-NILAG  962
             YN    P ++V +   +  SF    +P           ++ Q++    +  + G NI +G
Sbjct  163   YNGGDTPAVVVYV--YDIKSFANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSG  220

Query  963   FDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrrqpgrqggg--  1121
             F+ +++ +AL  + E ++++   N + RG I+ V+   QL  P+  +++ +  +      
Sbjct  221   FNTEVLSEALGINTEASKRLQSQNDQ-RGDIIRVKHGLQLLKPTLTQRQEEHRQYQQVQY  279

Query  1122  ---SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
                  N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L+ + + AAR
Sbjct  280   REGQYNGLDENFCTIKARVNIENPSRADYYNPRAGRITLLNNQRFPILNLIGMGAAR  336


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  SFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGL  324
            ++  ++  + +C+  ++ A  P   + +E G TE++D  +EQF+C G +  R +I+P GL
Sbjct  27   AWESRQGASRQCRFDRLQAFEPLRKVRSEAGDTEYFDERNEQFRCAGVFVIRRVIEPQGL  86

Query  325  FLPSYTSAPLVAYVLQG  375
             +P Y++ P +AY++QG
Sbjct  87   VVPRYSNTPALAYIIQG  103



>ref|XP_010272888.1| PREDICTED: legumin B-like [Nelumbo nucifera]
Length=500

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/263 (31%), Positives = 120/263 (46%), Gaps = 50/263 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY------QQSE----------------KGSEILDKYQKIRYYEKG  749
             G G  G++VPGC ET+      +QSE                +G E  D +QK+R  +KG
Sbjct  111   GKGVLGLLVPGCPETFHSFDHSRQSEDQESRRPSSKDQDSRSQGHE--DVHQKLRRVKKG  168

Query  750   DIIVIPASAVHWFYNQNREPTILV-VLQRANPVS--------FFLAGK--------PGSS  878
             DII IP    +WF+N    P + V +    N ++        F+LAG             
Sbjct  169   DIIAIPNGVAYWFFNDGDTPVVAVGIADTGNNLNQLDDRIRKFYLAGNVQEQEQQHHHHQ  228

Query  879   HqgqreqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV  1058
              Q Q+           E   +  NI +GFD +++  A   ++ET  K+ G N   RG I+
Sbjct  229   QQQQQRGSSSSGREKAEEESFGNNIFSGFDAELLAQAFGVEKETVRKLQGKNDE-RGRII  287

Query  1059  IVQQ--------LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRA  1214
              V++             E++++  RQ    +N LEE+ C   F QNI     AD+Y    
Sbjct  288   HVEEGLQVIRSISSEEEEEQQEQQRQNQMKANGLEESFCNMRFRQNIGKATSADVYTPFG  347

Query  1215  GRLTTLNSFTLPALSYVRLSAAR  1283
             GR+T +NS +LP LS++ LSA R
Sbjct  348   GRVTNVNSQSLPILSFLDLSAER  370


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  148  FHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLF  327
            F G++ Q   C++  + A+ PT  I AE G  E+WD N+EQFQC G  A R  +QP GL 
Sbjct  39   FRGEQRQ---CRIDNLDALEPTHQIEAEAGLIEYWDENNEQFQCAGVTACRITVQPKGLS  95

Query  328  LPSYTSAPLVAYVLQG  375
            LP+Y ++P + Y+++G
Sbjct  96   LPAYYNSPKLIYIVKG  111



>ref|XP_010679299.1| PREDICTED: 11S globulin seed storage protein 2-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679300.1| PREDICTED: 11S globulin seed storage protein 2-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=473

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 115/257 (45%), Gaps = 42/257 (16%)
 Frame = +3

Query  618   FLPFST------GSGEYGIIVPGCAETYQQS-----------EKG-SEILDKYQKIRYYE  743
             F PF        G G  G+  PGC ETY  S           E+G S   D +QK+  + 
Sbjct  89    FSPFPVLVYIERGEGILGVTYPGCPETYHSSGGRQEGYRGEEERGFSHSKDLHQKVHRFR  148

Query  744   KGDIIVIPASAVHWFYNQNREPTILV-VLQRANPV--------SFFLAGKPGSSHqgqre  896
             +GDI+ IP  AVHW YN   E  + V V    NP         +F+LAG   +S      
Sbjct  149   RGDILAIPPGAVHWCYNDGNEEVVAVHVADLNNPANQLDQSFRAFYLAGASENS------  202

Query  897   qgrqqqeLMTERLGYD--GNILAGFDVQIVKDALNTDRETAEKIIGGNARG------RGH  1052
              G++    + +R G     NIL+ FD +++ +A +   E   ++     RG      +G 
Sbjct  203   -GQRGIRRLGDRHGQRQFNNILSAFDSELLAEAFDVPEELIRRVQQPENRGLIVRVEKGE  261

Query  1053  IVIVQQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTL  1232
             + I+     +  +  +  +  G   N LEET+CT     ++DNR  AD++    GRL  +
Sbjct  262   MRILAPEGEQEYEYERRRKYMGLDINGLEETICTMRLRHSLDNRREADVFSRHGGRLNIV  321

Query  1233  NSFTLPALSYVRLSAAR  1283
             N   LP L Y+ +S  +
Sbjct  322   NEHKLPILRYLDMSVEK  338


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  QNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTS  345
            Q ++C+LS++ +  P      EGG  E WD N EQ+QC G +A R  +Q N L LP+++ 
Sbjct  32   QAQQCRLSRLSSNEPNQRFEFEGGLIELWDENEEQYQCTGVHAMRVTVQQNSLALPNFSP  91

Query  346  APLVAYVLQG  375
             P++ Y+ +G
Sbjct  92   FPVLVYIERG  101



>sp|P19084.1|11S3_HELAN RecName: Full=11S globulin seed storage protein G3; AltName: 
Full=Helianthinin-G3; Contains: RecName: Full=11S globulin seed 
storage protein G3 acidic chain; Contains: RecName: Full=11S 
globulin seed storage protein G3 basic chain; Flags: Precursor 
[Helianthus annuus]
 gb|AAA33374.1| 11S storage protein [Helianthus annuus]
Length=493

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/296 (30%), Positives = 134/296 (45%), Gaps = 55/296 (19%)
 Frame = +3

Query  558   HFQVV*NFIISSSVN*FDGYFLPFSTG----SGEYGIIVPGCAETYQQSEKGS-------  704
              FQ   + +  +  N      LP ST     S   G+I+PGC  TY+ S++         
Sbjct  62    QFQCAWSILFDTGFNLVAFSCLPTSTPLFWPSSREGVILPGCRRTYEYSQEQQFSGEGGR  121

Query  705   ------EILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRANPVS------  848
                         +K+   ++GD++ IP    HW +N      ++V L   N  +      
Sbjct  122   RGGGEGTFRTVIRKLENLKEGDVVAIPTGTAHWLHNDGNTELVVVFLDTQNHENQLDENQ  181

Query  849   --FFLAGKPGSSHqgqreqgrqqqeLMTERLGYD---------GNILAGFDVQIVKDALN  995
               FFLAG P +  Q Q++Q RQ ++   +R             GNI  GF  +++  + N
Sbjct  182   RRFFLAGNPQAQAQSQQQQQRQPRQQSPQRQRQRQRQGQGQNAGNIFNGFTPELIAQSFN  241

Query  996   TDRETAEKIIGGNARGRGHIVIV--------------------QQLPSrpekrrqpgrqg  1115
              D+ETA+K+ G N + RGHIV V                    +Q  S  +++ Q   + 
Sbjct  242   VDQETAQKLQGQNDQ-RGHIVNVGQDLQIVRPPQDRRSPRQQQEQATSPRQQQEQQQGRR  300

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             GG SN +EET+C+  F  NIDN  +AD  + +AG +  LNSF  P L ++RLS  R
Sbjct  301   GGWSNGVEETICSMKFKVNIDNPSQADFVNPQAGSIANLNSFKFPILEHLRLSVER  356



>ref|NP_001046434.1| Os02g0248800 [Oryza sativa Japonica Group]
 gb|AAR06952.1| glutelin type-B [Oryza sativa Japonica Group]
 dbj|BAD19794.1| glutelin type-B [Oryza sativa Japonica Group]
 dbj|BAF08348.1| Os02g0248800 [Oryza sativa Japonica Group]
 dbj|BAH01171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADB84627.1| glutelin [Oryza sativa Japonica Group]
Length=495

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 116/250 (46%), Gaps = 44/250 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ---------SEKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  + +D++QKI  + +GDI+V+P    HWF
Sbjct  110   GRGSMGLTFPGCPATYQQQSQQFLFQGESQSQKFIDEHQKIHQFRQGDIVVLPTGVAHWF  169

Query  789   YNQNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN    P + + +   N  +         F LAGK     Q            + +  G 
Sbjct  170   YNDGDTPVVALYVYDINNSANQLEPRHREFLLAGKNNRVQQVYGRS-------IQQHSG-  221

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpekrr---  1097
               NI  GF V+ + +ALN +  T +++   N + RG I+ V+   QL  P+  +++    
Sbjct  222   -QNIFNGFSVEPLSEALNINTVTTKRLQSQNDQ-RGEIIHVKNGLQLLKPTLTQRQEQEQ  279

Query  1098  --------qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPA  1253
                         Q     N LEE LCT     NI+N  RAD YD RAGR+T+L+S   P 
Sbjct  280   AQYQEVQYSEKPQTSSRWNGLEENLCTIKTRLNIENPSRADSYDPRAGRITSLDSQKFPI  339

Query  1254  LSYVRLSAAR  1283
             L+ +++SA R
Sbjct  340   LNIIQMSATR  349


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P  N+ +E G TE++D  +E FQC G +  R +IQP GL +P Y + P 
Sbjct  44   ECRFERLQAFEPLQNVRSEAGVTEYFDETNELFQCTGTFVIRRVIQPQGLLIPRYANTPG  103

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  104  MVYIIQG  110



>ref|XP_006654150.1| PREDICTED: glutelin type-A 3-like [Oryza brachyantha]
Length=491

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 111/256 (43%), Gaps = 51/256 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS-----------EILDKYQKIRYYEKGDIIVIPASAVH  782
             G G  G   PGC ETYQQ  + S           +  D++QKI  + +GD++ +PA   H
Sbjct  107   GRGITGPTFPGCPETYQQQFQQSGEAQPFEGQSHKFRDEHQKIHRFRQGDVVALPAGVAH  166

Query  783   WFYNQNREPTILV----VLQRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERL  935
             W YN    P + +    +   AN +      FFLAG               QQ   +E  
Sbjct  167   WCYNDGEVPIVAIYVTDIYNSANQLDPRHRDFFLAGN----------NKVAQQLYRSEAR  216

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---------------  1070
                 NI  GF V+++ +AL   R  A ++   N + RG IV V+                
Sbjct  217   ENSKNIFGGFSVELLSEALGISRGVARQLQCQNDQ-RGEIVRVEHGLALLQPYASVQEQQ  275

Query  1071  -----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLN  1235
                       + + Q  +  G  SN L+ET CT    QNIDN   AD Y+ +AGR+T LN
Sbjct  276   QEQVQSRDYEQTQYQQKQPQGSCSNGLDETFCTMRLRQNIDNPNLADTYNPKAGRITYLN  335

Query  1236  SFTLPALSYVRLSAAR  1283
                 P L+ V++SA +
Sbjct  336   GQKFPILNLVQMSAVK  351


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  Q+ A  P   + ++ G TEF+D ++E FQC G    R +I+P GL LP Y++   
Sbjct  41   QCRFDQLQAFEPIRTVRSQAGVTEFYDVSNELFQCTGVSVVRRVIEPRGLLLPHYSNGAT  100

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  101  LVYIIQG  107



>ref|XP_009129556.1| PREDICTED: cruciferin CRU1 [Brassica rapa]
Length=500

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/294 (30%), Positives = 124/294 (42%), Gaps = 86/294 (29%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSEK---------------------  698
             G +LP  FS+        G G  G +VPGCAET+  S+                      
Sbjct  84    GLYLPTFFSSPKISYVVQGMGISGRVVPGCAETFMDSQPMQGQQQGQPWQGQQGQQGQQG  143

Query  699   -----------------GSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL  827
                                   D +QK+ +   GDII I A + HW YN   +P +++ L
Sbjct  144   QQGQQGQQGQQGQQGQQQQGFRDMHQKVEHVRHGDIIAITAGSSHWIYNTGDQPLVIICL  203

Query  828   QRA---------NPVSFFLAGK--PGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQ  974
                         NP +F LAG    G S Q Q++Q                N+L+GFD Q
Sbjct  204   LDIANYQNQLDRNPRTFRLAGNNPQGGSQQQQQQQQ---------------NMLSGFDPQ  248

Query  975   IVKDALNTDRETAEKIIGGNARGRGHIVIVQ-----------QLPSrpekrrqpgrqggg  1121
             ++  AL  D   A+++       RG+IV V+           Q     + R   G     
Sbjct  249   VLAQALKIDVRLAQEL-QNQQDSRGNIVRVKGPFQVVRPPLRQPYESEQWRHPRGPPQSP  307

Query  1122  SSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               N LEET+C+    +NID+  RAD+Y    GR+T++NS+TLP L Y+RLSA R
Sbjct  308   QDNGLEETICSMRTHENIDDPARADVYKPNLGRVTSVNSYTLPILQYIRLSATR  361


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
             NGC  R QS          C L  +  ++PT  I +E G  E+WD N+ Q +C G    
Sbjct  18   LNGCLAR-QSLGVPPQLGNACNLDNLDVLQPTETIKSEAGRVEYWDHNNPQIRCAGVSVS  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R II+  GL+LP++ S+P ++YV+QG
Sbjct  77   RVIIEQGGLYLPTFFSSPKISYVVQG  102



>emb|CAA40980.1| cruciferin cru4 subunit [Brassica napus]
Length=413

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 109/246 (44%), Gaps = 42/246 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE-----------------KGSEILDKYQKIRYYEKGDIIVI  764
             G    G + PGCAET+  S                  +G    D +QK+ +   GD I  
Sbjct  42    GHALMGKVTPGCAETFMDSPVFGQGQGQEQGQGQGQGQGQGFRDMHQKVEHLRSGDTIAT  101

Query  765   PASAVHWFYNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqq  914
             P     WFYN   EP ILV           L R N   F LAG             + QQ
Sbjct  102   PPGVAQWFYNNGNEPLILVAAADIANNLNQLDR-NLRPFLLAGN----------NPQGQQ  150

Query  915   eLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrp  1085
              L   +     NI  GF  QI+  A     ETA+K+       RG+IV VQ    +   P
Sbjct  151   WLQGRQQQKQNNIFNGFAPQILAQAFKISVETAQKLQNQQV-NRGNIVKVQGQFGVIRPP  209

Query  1086  ekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
              ++ Q G+Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP L ++
Sbjct  210   LRQGQGGQQPQEEGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILRFL  269

Query  1266  RLSAAR  1283
             RLSA R
Sbjct  270   RLSALR  275



>gb|AGU36395.1| 11S globulin precursor, partial [Helianthus petiolaris]
Length=330

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 111/214 (52%), Gaps = 27/214 (13%)
 Frame = +3

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQR----ANPVSF-----FLAGK  866
             D +QK+  + +GDII IPA AV+W YN   +  + +++      AN + F     FLAG 
Sbjct  1     DSHQKVHRFRQGDIIAIPAGAVYWTYNDRNQEVVAIIVDDVNNFANQLDFQAKTSFLAGG  60

Query  867   PGSSHqgqreqgrqqqeLMT----------ERLGYDGNILAGFDVQIVKDALNTDRETAE  1016
                 H   ++Q RQQ+              + +  D N+ AGFD +++ +A N D +   
Sbjct  61    ISREHIQGQQQRRQQRRQQXGRQRSPFGGQQEMTRD-NVYAGFDTELLAEAFNCDPQIMR  119

Query  1017  KIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDN  1181
              +    +R RG IV VQQ      P   +++    R  GG SN +EET+C+A    N+DN
Sbjct  120   AL--QESRNRGVIVQVQQRMEFVTPEEEQQQMHQRRSTGGPSNGVEETICSAKLVFNLDN  177

Query  1182  RERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +  AD+++ +AG+L  +N   LP LS + LSA +
Sbjct  178   QREADVFNRQAGKLNMVNEHKLPILSLMDLSAEK  211



>ref|XP_010231907.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon]
Length=492

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/252 (30%), Positives = 111/252 (44%), Gaps = 56/252 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ--------------QSEKGSEIL-DKYQKIRYYEKGDIIVIPA  770
             G+G  G+  PGC ET++              QS+  S+ L D +Q++  + +GD++ +P 
Sbjct  109   GNGFVGLTFPGCPETFREQFQQFRQTQSTLGQSQCQSQKLGDVHQRVHQFTQGDVVALPT  168

Query  771   SAVHWFYNQNREPTILV----VLQRANPVS-----FFLAGKPGSSHqgqreqgrqqqeLM  923
                HW YN    P ++V    V   AN +      F L G                    
Sbjct  169   GVAHWIYNGGDAPVVIVYVFDVNNNANQLEPRQKEFLLGGN------------------Y  210

Query  924   TERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHI------------VIVQ  1067
                L Y  NI +GF+ Q++  A   + +T+++I   N  GRG I            V+ Q
Sbjct  211   NGVLQYGQNIFSGFNAQLLSQAFGINEQTSQRIQNQND-GRGDIIRVDNGLQFLKPVVTQ  269

Query  1068  QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
             Q P +P    Q       S N LEE  C+    QNI++  RAD Y+ RAG +T LN    
Sbjct  270   QQPEQPFMPIQHQTGQS-SRNGLEENFCSLEPRQNIEDPNRADTYNPRAGSITRLNGQNF  328

Query  1248  PALSYVRLSAAR  1283
             P L+ V++SA R
Sbjct  329   PILNLVQMSATR  340


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
             C   ++ AI P   + ++ G TE++D  +EQF+C G +  R +I+P GL LP Y + P 
Sbjct  43   DCSFDRLQAIEPVTQVRSQAGLTEYFDEQNEQFRCAGVFVIRRVIEPRGLLLPRYHNTPG  102

Query  355  VAYVLQGT  378
            + Y+LQG 
Sbjct  103  LVYILQGN  110



>gb|KEH23930.1| legumin A2 [Medicago truncatula]
Length=525

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 84/290 (29%), Positives = 121/290 (42%), Gaps = 76/290 (26%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY---QQSEK-----------------------------------G  701
             GSG +G++ PGC ET+   Q+SE+                                   G
Sbjct  100   GSGYFGMVFPGCPETFEEPQESEQRESRRFRESEQRESRRIRESEQGESRRFRESEQGEG  159

Query  702   SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVLQRAN---------PVSFF  854
                 D +QK+  + +GD+I +P   V W YN    P I V L             P  F+
Sbjct  160   RRFRDSHQKVNRFREGDLIAVPTGTVFWMYNDQDTPVIAVSLIDTGSFQNQLDEMPRRFY  219

Query  855   LAGKPGSSHqgqr----eqgrqqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKI  1022
             LAG         +        +Q+    ++    GNI +GF    ++DALN  R   EK+
Sbjct  220   LAGNQEQEFLQYQQQQVRGRGEQRRGREQQENEGGNIFSGFKRDFLEDALNVKRHIVEKL  279

Query  1023  IGGNA-RGRGHIVIV-------------QQLPSrpek-----------rrqpgrqgggSS  1127
              G N  + +G IV V             Q+ PSR ++             Q  R+     
Sbjct  280   QGRNEDQEKGAIVKVEGGLSIMSPPERQQRHPSRQDEEDEDEEDEWRPHHQKSRRERERH  339

Query  1128  NALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             N L ET+CTA   QN+ +    DIY+ +AGR+ T+ SF LPAL ++RLSA
Sbjct  340   NGLAETICTARLHQNMVSSSSPDIYNPQAGRIKTITSFDLPALRWLRLSA  389


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ P   I +EGG  E W+PN+ QF+C G    R  +Q N L  PSY++AP 
Sbjct  34   ECQLEQLNALEPDNRIESEGGIIETWNPNNRQFRCAGVALSRCTLQRNSLRRPSYSNAPQ  93

Query  355  VAYVLQGT  378
              ++ QG+
Sbjct  94   EIFIQQGS  101



>ref|XP_009119353.1| PREDICTED: cruciferin CRU4 [Brassica rapa]
Length=464

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 110/245 (45%), Gaps = 41/245 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE----------------KGSEILDKYQKIRYYEKGDIIVIP  767
             G G  G + PGCAET+  S                 +G    D +QK+ +   GD I  P
Sbjct  94    GHGLMGKVTPGCAETFMDSPVFGQGQSQEQGQEGQGQGQGFRDMHQKVEHLRCGDTIATP  153

Query  768   ASAVHWFYNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqe  917
                  WFYN   EP ILV           L R N   F +AG             + QQ 
Sbjct  154   PGVAQWFYNNGNEPLILVAAADIANNLNQLDR-NLRPFLIAGN----------NPQGQQW  202

Query  918   LMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrpe  1088
             L   +     NI  GF  QI+  A     ETA+K+       RG+IV VQ    +   P 
Sbjct  203   LQGRQQQKQNNIFNGFAPQILAQAFKISVETAQKLQNQQVN-RGNIVKVQGQFGVIRPPL  261

Query  1089  krrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVR  1268
             ++ Q G+Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP L ++R
Sbjct  262   RQGQGGQQPQEEGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILRFLR  321

Query  1269  LSAAR  1283
             LSA R
Sbjct  322   LSALR  326


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+ P+  I +EGG  E WD +  Q +C G    R +I+P G
Sbjct  17   FHGFTAQQWPNECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSGFAFERFVIEPQG  76

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LP++ +A  + +V+ G
Sbjct  77   LYLPTFLNAGKLTFVVHG  94



>ref|XP_006647142.1| PREDICTED: glutelin type-B 4-like [Oryza brachyantha]
Length=494

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 111/249 (45%), Gaps = 43/249 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+ +PA   HWF
Sbjct  110   GRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHWF  169

Query  789   YNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN+   P + L V    N  +        F LAG      Q       +           
Sbjct  170   YNEGDTPVVALYVFDINNSANQLEPRQKDFLLAGNNNREQQVYGRSIEKHS---------  220

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ---QL--PSrpe------  1088
               NI +GF+ +++ +AL      A+++ G N   RG I+ V+   QL  P+  +      
Sbjct  221   GQNIFSGFNHELLSEALGISTLAAKRLQGQNDH-RGEIIRVRNGLQLLKPTFTQQQEQAQ  279

Query  1089  ----krrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPAL  1256
                  +    +Q     N L+E  CT     NI+N  RAD Y+ RAGR+T LN+   P L
Sbjct  280   SQYQVQYSEKQQESTRCNGLDENFCTINARLNIENPSRADTYNPRAGRITHLNNQKFPIL  339

Query  1257  SYVRLSAAR  1283
             + V++SA R
Sbjct  340   NLVQMSATR  348


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  169  NEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSA  348
            +  C+  ++ A  P   + +E G TE++D  +EQFQC G +  R +I+P GL +P YT+ 
Sbjct  42   SRDCRFDRLQAFEPLRRVRSEAGVTEYFDERNEQFQCTGTFVIRRVIEPQGLLVPRYTNT  101

Query  349  PLVAYVLQG  375
            P V Y++QG
Sbjct  102  PGVVYIMQG  110



>sp|P05692.1|LEGJ_PEA RecName: Full=Legumin J; Contains: RecName: Full=Legumin J alpha 
chain; AltName: Full=Legumin J acidic chain; Contains: RecName: 
Full=Legumin J beta chain; AltName: Full=Legumin J basic 
chain; Flags: Precursor [Pisum sativum]
 emb|CAA30067.1| legumin [Pisum sativum]
Length=503

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 120/274 (44%), Gaps = 60/274 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-------DKYQKIRYYEKGDIIVIPASAVHWFYN  794
             G G  G+  PGC ETY++               D +QK+R + KGDII IP+   +W YN
Sbjct  98    GKGVLGLSFPGCPETYEEPRSSQSRQESRQQQGDSHQKVRRFRKGDIIAIPSGIPYWTYN  157

Query  795   QNREPTILV-VLQRAN--------PVSFFLAGKPGSS-----HqgqreqgrqqqeLMTER  932
                EP + + +L  +N        P  F+L G P +       + Q    ++    +  R
Sbjct  158   HGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPETEFPETQEEQQGRHRQKHSYPVGRR  217

Query  933   LGYD-----------GN-ILAGFDVQIVKDALNTDRETAEKIIGGN------ARGRGHIV  1058
              G+            GN +L+GF  + +    NT+ +TA+++           R  G + 
Sbjct  218   SGHHQQEEESEEQNEGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDERSQIVRVEGGLR  277

Query  1059  IVQQLPSrpekrrqpgrqgggS---------------------SNALEETLCTATFTQNI  1175
             I++      E++ Q                              N LEET+C+A   +NI
Sbjct  278   IIKPKGKEEEEKEQSHSHSHREEKEEEEEEEEDEEEKQRSEERKNGLEETICSAKIRENI  337

Query  1176  DNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
              +  RAD+Y+ RAGR++T NS TLP L Y+RLSA
Sbjct  338   ADAARADLYNPRAGRISTANSLTLPVLRYLRLSA  371


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL  I+A+ P   + +E G TE W+PNH + +C G    R  I PNGL LPS++ +P 
Sbjct  32   QCQLDSINALEPDHRVESEAGLTETWNPNHPELKCAGVSLIRRTIDPNGLHLPSFSPSPQ  91

Query  355  VAYVLQG  375
            + +++QG
Sbjct  92   LIFIIQG  98



>gb|AAA50317.1| glutelin [Oryza sativa Japonica Group]
Length=499

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 113/259 (44%), Gaps = 55/259 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY-------------QQSEKGSEILDKYQKIRYYEKGDIIVIPASA  776
             G G  G   PGC ETY             +   +  +  D++QKI  + +GD+I +PA  
Sbjct  111   GRGITGPTFPGCPETYQQQFQQSGQAQLTESQSQSQKFKDEHQKIHRFRQGDVIALPAGV  170

Query  777   VHWFYNQNREPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
              HW YN    P + + +   N            F LAG   +    +RE        + E
Sbjct  171   AHWCYNDGEVPVVAIYVTDLNNGANQLDPRQRDFLLAGNKRNPQAYRRE--------VEE  222

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV-------IVQQLPSrpe  1088
             R     NI +GF  +++ +AL    + A ++   N + RG IV       ++Q  PS  E
Sbjct  223   R---SQNIFSGFSTELLSEALGVSGQVARQLQCQNDQ-RGEIVRVEHGLSLLQPYPSLQE  278

Query  1089  krrqpgrqggg--------------SSNALEETLCTATFTQNIDNRERADIYDSRAGRLT  1226
             + +   +                   SN L+ET CT    QNIDN  RAD Y+ RAGR+T
Sbjct  279   QEQGQVQSRERYQEQGYQQSQYGSGCSNGLDETFCTMRVRQNIDNPNRADTYNPRAGRVT  338

Query  1227  TLNSFTLPALSYVRLSAAR  1283
              LN+   P L+ V++SA +
Sbjct  339   NLNTQNFPILNLVQMSAVK  357


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P  ++ ++ GTTEF+D ++EQFQC G    R +I+P GL LP YT+   
Sbjct  45   ECRFDRLQAFEPIRSVRSQAGTTEFFDVSNEQFQCTGVSVVRRVIEPRGLLLPHYTNGAS  104

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  105  LVYIIQG  111



>ref|XP_006418193.1| hypothetical protein EUTSA_v10009410mg [Eutrema salsugineum]
 gb|ESQ36546.1| hypothetical protein EUTSA_v10009410mg [Eutrema salsugineum]
Length=467

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 108/248 (44%), Gaps = 43/248 (17%)
 Frame = +3

Query  633   TGSGEYGIIVPGCAETYQQSE-----------------KGSEILDKYQKIRYYEKGDIIV  761
              G G  G +VPGCAET+  SE                 +G    D +QK+ +   GD I 
Sbjct  94    NGRGLMGRVVPGCAETFMDSEVIQPGEQFGEGQEQGQGQGQGFRDMHQKVEHIRCGDTIA  153

Query  762   IPASAVHWFYNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqq  911
              P     W YN   EP ILV           L R N   F LAG      +         
Sbjct  154   TPPGVAQWIYNNGNEPLILVSAADLANNQNQLDR-NLRPFLLAGNNPQGQKW--------  204

Query  912   qeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ----LPS  1079
               L   R     NI  GF  +I+  A   + +TA ++   +   RG+IV V      +  
Sbjct  205   --LQGRRQQKQNNIFNGFAPEILAKAFKINIQTARQLQNQDV-NRGNIVKVNGPFGVIRP  261

Query  1080  rpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                + +Q G+Q     N LEETLCT  FT+N+D+   AD+Y    G ++TLNS+ LP L 
Sbjct  262   PLRRGQQGGQQPQVEGNGLEETLCTMRFTENLDDPSSADVYKPSLGYISTLNSYNLPILR  321

Query  1260  YVRLSAAR  1283
              +RLSA R
Sbjct  322   SLRLSALR  329


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            FHG  +Q    +CQL Q++A+     I +EGG  E ++ +  Q +C G    R +I P G
Sbjct  18   FHGYTAQQWPNECQLDQLNALEADQIIESEGGRIEVFNHHAPQLRCSGFAFERFVIDPQG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LP++ +A  + +V+ G
Sbjct  78   LYLPTFLNAGKLTFVVNG  95



>gb|AAF05770.1|AF193433_1 glutelin [Elaeis guineensis]
Length=368

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 114/238 (48%), Gaps = 34/238 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEI-----------LDKYQKIRYYEKGDIIVIPASAVH  782
             G G  G+++PGC ET+Q  ++                D++QK+  +E+GD++ +P    +
Sbjct  110   GRGIVGLVMPGCPETFQSFQRSERYEREEGGRHRRPRDEHQKVYQFEEGDVLAVPNGFAY  169

Query  783   WFYNQNREPTI-LVVLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERL  935
             W YN    P + + VL  +N  +        F LAG+     Q  R +       M E  
Sbjct  170   WCYNNGENPVVAITVLDTSNDANQLDRSHRQFLLAGRQEEGRQRYRREES-----MKE--  222

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPS--rpekrrqpgr  1109
                 NIL GF  +++  A   + E A K+   +   RG +V  +      RP +  +  R
Sbjct  223   ----NILRGFSTELLAAAFGVNMELARKLQCRDD-TRGEMVRAENGLQVLRPSRMEEEER  277

Query  1110  qgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +     N LEET C+    QNI +  RAD+++ R GR+TTLNS  LP L ++++SA R
Sbjct  278   EESRRKNGLEETYCSMKIKQNIGDPRRADVFNPRGGRITTLNSEKLPILRFIQMSAER  335


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +1

Query  142  QSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
            QS     S   +C++ +++A+ PT  + +E G T+++D ++EQF+C G  A R +I+P G
Sbjct  33   QSSRRSVSTRNECRIERLNALEPTRTVRSEAGMTDYFDEDNEQFRCAGVSAIRRVIEPRG  92

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LPS ++AP + Y++QG
Sbjct  93   LLLPSMSNAPRLVYIVQG  110



>gb|KFK42731.1| hypothetical protein AALP_AA1G032400 [Arabis alpina]
Length=455

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 110/238 (46%), Gaps = 34/238 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSE---------ILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G +VPGCAET+  S    E           D +QK+ +   GD    P    HW 
Sbjct  95    GKGLMGKVVPGCAETFMDSPVFGEGQGQSQSQGFRDIHQKVEHLRCGDTTATPPGVAHWV  154

Query  789   YNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLG  938
             YN   EP ILV           L R N   F LAG             + QQ L      
Sbjct  155   YNNGDEPLILVSAYDIANNLNQLDR-NLRPFLLAGN----------NQQGQQWLQGREQE  203

Query  939   YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrpekrrqpgr  1109
                NI +GF  +++  A     ETA+++       RG+I+ V+    +   P +R Q G+
Sbjct  204   PQNNIFSGFAPEVLAQAFKIKLETAQQLQNQQNN-RGNIIKVKGPFGVIRPPLRRGQGGQ  262

Query  1110  qgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP LSY+RLSA R
Sbjct  263   QPQEVGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILSYLRLSALR  320


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P   I +EGG  E WD    Q +C G    R +I+P G
Sbjct  18   LHGYSAQQWPNECQLDQLNALEPFQVIKSEGGRIEVWDHRAPQLRCSGFAFERFVIEPQG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L LP++ +A  + +V+ G
Sbjct  78   LLLPTFLNAGKLTFVVHG  95



>sp|P33522.1|CRU4_BRANA RecName: Full=Cruciferin CRU4; AltName: Full=11S globulin; AltName: 
Full=12S storage protein; Contains: RecName: Full=Cruciferin 
CRU4 alpha chain; Contains: RecName: Full=Cruciferin 
CRU4 beta chain; Flags: Precursor [Brassica napus]
Length=465

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 109/246 (44%), Gaps = 42/246 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSE-----------------KGSEILDKYQKIRYYEKGDIIVI  764
             G    G + PGCAET+  S                  +G    D +QK+ +   GD I  
Sbjct  94    GHALMGKVTPGCAETFNDSPVFGQGQGQEQGQGQGQGQGQGFRDMHQKVEHLRSGDTIAT  153

Query  765   PASAVHWFYNQNREPTILVV----------LQRANPVSFFLAGKPGSSHqgqreqgrqqq  914
             P     WFYN   EP ILV           L R N   F LAG             + QQ
Sbjct  154   PPGVAQWFYNNGNEPLILVAAADIANNLNQLDR-NLRPFLLAGN----------NPQGQQ  202

Query  915   eLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ---LPSrp  1085
              L   +     NI  GF  QI+  A     ETA+K+       RG+IV VQ    +   P
Sbjct  203   WLQGRQQQKQNNIFNGFAPQILAQAFKISVETAQKLQNQQVN-RGNIVKVQGQFGVIRPP  261

Query  1086  ekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
              ++ Q G+Q     N LEETLCT   T+N+D+   AD+Y    G ++TLNS+ LP L ++
Sbjct  262   LRQGQGGQQPQEEGNGLEETLCTMRCTENLDDPSSADVYKPSLGYISTLNSYNLPILRFL  321

Query  1266  RLSAAR  1283
             RLSA R
Sbjct  322   RLSALR  327


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  FHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLF  327
            F  Q+  NE CQL Q++A+ P+  I +EGG  E WD +  Q +C G    R +I+P GL+
Sbjct  20   FTAQQWPNE-CQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSGFAFERFVIEPQGLY  78

Query  328  LPSYTSAPLVAYVLQG  375
            LP++ +A  + +V+ G
Sbjct  79   LPTFLNAGKLTFVVHG  94



>gb|AAF73008.1|AF262999_1 seed storage protein [Ricinus communis]
Length=353

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 111/221 (50%), Gaps = 29/221 (13%)
 Frame = +3

Query  696   KGSEILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-VLQRANPVS--------  848
             +G    D++QK+R   +GD+I + A    W YN  R P +LV ++  +NP +        
Sbjct  1     QGQSRRDQHQKVRQIREGDVIALHAGVAQWIYNNGRSPLVLVQIIDTSNPANQLDQNHRD  60

Query  849   FFLAGKPGSSHqgqreqgrqqqeLMTERLG--YD--GNILAGFDVQIVKDALNTDRETAE  1016
             FFLAG P    Q QR +  +  E  +   G  +D  GN+ +G D +++ ++ N + + A 
Sbjct  61    FFLAGNPQREVQSQRGERGRTSERRSTSTGSAHDNSGNVFSGMDERVIAESFNINTDLAR  120

Query  1017  KIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSS----------NALEETLC  1151
             K+ G N   RG IV V+       P R ++  +  R+               N LEET C
Sbjct  121   KLRGENDL-RGIIVSVEHDLEMLAPQRSQEEEREEREEEAQRQLERSPRARFNGLEETFC  179

Query  1152  TATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
             T     NI+    ADIY+ RAGR+T++NS  LP L Y++LS
Sbjct  180   TRRLRHNINKPSEADIYNPRAGRVTSVNSHNLPILRYLQLS  220



>emb|CAA67879.1| legumin precursor [Quercus robur]
Length=488

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 118/250 (47%), Gaps = 40/250 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDK-----YQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G +G ++PGC  TYQ+S++  +  +      +QKIR + +GDII +PA   HW YN  
Sbjct  102   GYGIFGAVLPGCPNTYQESQQQQQQREGQQRDQHQKIRNFRQGDIIALPAGVAHWLYNDG  161

Query  801   REPTILVVLQRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNI  953
                 + + L            NP  F+LAG P    Q  + +  +  +  T   G   N+
Sbjct  162   DSEVVALSLLDTNNQANQLDQNPRHFYLAGNPEDEFQQGQGRRERGHQQPT---GQGNNL  218

Query  954   LAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ----------------------  1067
              +GF  + + DA N +  T    + G    R +IV V+                      
Sbjct  219   FSGFRTEDLADAFNVNENTIRN-LQGFQEDRKNIVKVKGTLQVARPPRSREERERLERQE  277

Query  1068  QLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTL  1247
             +   R ++R       GG  N +EETLCT    +NI +  RADIY+ +AGR++TLNS  L
Sbjct  278   REQEREDEREPRESHRGGRDNGIEETLCTLRLRENIHDPSRADIYNPQAGRISTLNSHNL  337

Query  1248  PALSYVRLSA  1277
             P L +++LSA
Sbjct  338   PVLRWLQLSA  347


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAF  297
            FNGC   + S   Q+ Q  +CQL ++ A+ P   I AEGG  E WDPN +QFQC G    
Sbjct  19   FNGCLATQTS--RQQRQFNQCQLDRLDALEPNHRIEAEGGVIESWDPNDKQFQCVGVAVD  76

Query  298  RHIIQPNGLFLPSYTSAPLVAYVLQG  375
            R  I+PNGL LP Y +   + Y+ +G
Sbjct  77   RRTIEPNGLLLPQYANTAQLIYIERG  102



>ref|XP_006420240.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
 gb|ESR33480.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
Length=485

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 112/247 (45%), Gaps = 40/247 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDK-----YQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G +G++ PGCAET+Q S++            +QK+R   +GDII +P  A HW YN  
Sbjct  112   GRGIHGVVFPGCAETFQDSQQQQSFQSSKSQDQHQKVRQLREGDIIALPTGAAHWIYNNG  171

Query  801   REPTILVVL----QRANPV-----SFFLAGKP-----GSSHqgqreqgrqqqeLMTERLG  938
             R+  +LV L       N +      F+L G P     G S          Q        G
Sbjct  172   RDQLVLVALVDVGNSQNQLDQYFRKFYLGGNPQPQLQGFSQSQGGRSQGSQ--------G  223

Query  939   YD----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------QLPSr  1082
              D    GN+  GFD +++ +A N + +   ++     + RG I+ V+        Q    
Sbjct  224   SDDRRAGNLFRGFDERLLAEAFNVNPDLIRRLQRPQIQ-RGIIIRVEEELRVLSPQRDRE  282

Query  1083  pekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              E+            N  EET+CT     NID    AD+Y+ RAGR+TT+N F LP L  
Sbjct  283   QEQEECEETPSYERDNGFEETICTMKLRHNIDKPSHADVYNPRAGRVTTVNRFNLPILRD  342

Query  1263  VRLSAAR  1283
             ++LSA +
Sbjct  343   LQLSAEK  349


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 11/97 (11%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEK-----------CQLSQIHAIRPTGNIPAEGGTTEFWDPNH  264
            FN CF + +   G  S+ ++           C +  ++A+ P   + +E G TEFWD N+
Sbjct  16   FNICFAQIEQVTGITSEGKQQRQRQQRFQTQCNIQNLNALEPRQKVESEAGVTEFWDQNN  75

Query  265  EQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            EQ QC     FRH IQ  GL +P+YT+ P + YV+QG
Sbjct  76   EQLQCANVAVFRHRIQQRGLLVPAYTNTPEIFYVVQG  112



>ref|XP_006420239.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
 gb|ESR33479.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
Length=478

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 112/247 (45%), Gaps = 40/247 (16%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEILDK-----YQKIRYYEKGDIIVIPASAVHWFYNQN  800
             G G +G++ PGCAET+Q S++            +QK+R   +GDII +P  A HW YN  
Sbjct  112   GRGIHGVVFPGCAETFQDSQQQQSFQSSKSQDQHQKVRQLREGDIIALPTGAAHWIYNNG  171

Query  801   REPTILVVL----QRANPV-----SFFLAGKP-----GSSHqgqreqgrqqqeLMTERLG  938
             R+  +LV L       N +      F+L G P     G S          Q        G
Sbjct  172   RDQLVLVALVDVGNSQNQLDQYFRKFYLGGNPQPQLQGFSQSQGGRSQGSQ--------G  223

Query  939   YD----GNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------QLPSr  1082
              D    GN+  GFD +++ +A N + +   ++     + RG I+ V+        Q    
Sbjct  224   SDDRRAGNLFRGFDERLLAEAFNVNPDLIRRLQRPQIQ-RGIIIRVEEELRVLSPQRDRE  282

Query  1083  pekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSY  1262
              E+            N  EET+CT     NID    AD+Y+ RAGR+TT+N F LP L  
Sbjct  283   QEQEECEETPSYERDNGFEETICTMKLRHNIDKPSHADVYNPRAGRVTTVNRFNLPILRD  342

Query  1263  VRLSAAR  1283
             ++LSA +
Sbjct  343   LQLSAEK  349


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 11/97 (11%)
 Frame = +1

Query  118  FNGCFGRRQSFHGQESQNEK-----------CQLSQIHAIRPTGNIPAEGGTTEFWDPNH  264
            FN CF + +   G  S+ ++           C +  ++A+ P   + +E G TEFWD N+
Sbjct  16   FNICFAQIEQVTGITSEGKQQRQRQQRFQTQCNIQNLNALEPRQKVESEAGVTEFWDQNN  75

Query  265  EQFQCGGAYAFRHIIQPNGLFLPSYTSAPLVAYVLQG  375
            EQ QC     FRH IQ  GL +P+YT+ P + YV+QG
Sbjct  76   EQLQCANVAVFRHRIQQRGLLVPAYTNTPEIFYVVQG  112



>ref|XP_009118685.1| PREDICTED: 12S seed storage protein CRD [Brassica rapa]
Length=445

 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 106/236 (45%), Gaps = 39/236 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG------SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G I  GC ETY+++  G          D +QK+  + +GD+    A    W+YN+
Sbjct  101   GEGVMGTIASGCPETYEEAGGGVGGDMHRRFEDMHQKLEDFRRGDVFASLAGVSQWWYNR  160

Query  798   --------------NREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL  935
                           NRE  +  V     P  F +AG      Q            +T   
Sbjct  161   GNSDVVIVIVLDVTNRENQLDQV-----PRMFQIAGSKTQEQQQP----------LTWPS  205

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqg  1115
             G   N  +GFD  I+ +A   D ETA+K+       RG+IV     P           Q 
Sbjct  206   GK--NAFSGFDPNIIAEAFKIDIETAKKL-QNQKDNRGNIVRANG-PLHFISSPSRQWQQ  261

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              G+ N +EET CTA   +NID+ ER+D + +RAGR++TLNS  LP L  VRL+A R
Sbjct  262   DGNGNGIEETYCTARLHENIDDPERSDFFSTRAGRISTLNSLNLPVLRLVRLNAIR  317


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = +1

Query  148  FHGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            FHG E++  +      C  SQI+++ P      E G  E WD    + QC G    R  +
Sbjct  20   FHGSEARQRELPLPNACHFSQINSLSPAHATKFEAGQMEVWDHTSNELQCAGVTVARITL  79

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            Q N +FLPS+ S P +AYV+QG
Sbjct  80   QANSIFLPSFFSPPSLAYVVQG  101



>gb|AGU36406.1| 11S globulin precursor, partial [Helianthus annuus]
Length=342

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 112/226 (50%), Gaps = 39/226 (17%)
 Frame = +3

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYN-QNREPTILVVLQRANPV--------SFFLAGK  866
             D +QK+  + +GDII IPA AV+W YN +N+E   ++V    NP         + FLAG 
Sbjct  1     DSHQKVHRFREGDIIAIPAGAVYWTYNDRNQEVVAIIVDDVNNPANQLDFQAKTSFLAGG  60

Query  867   PGSSHqgqreqgrqqqeLMT----------------------ERLGYDGNILAGFDVQIV  980
               S H   ++Q + QQ                          E L  D N+ AGFD +++
Sbjct  61    ISSEHIQGQQQFQGQQGRQGQQQIHGQQSRQQGRRRSPFGGQEELTRD-NVYAGFDTELL  119

Query  981   KDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSSNALEET  1145
              +A N D +    +    +R RG IV VQQ      P   +++    R  GG SN +EET
Sbjct  120   AEAFNCDPQIMRAL--QESRNRGVIVQVQQQMEFVTPEEEQQQMHQRRSRGGPSNGVEET  177

Query  1146  LCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +C+A    N+DN+  AD+++ +AG+L  +N   LP LS + LSA +
Sbjct  178   ICSAKLVFNLDNQREADVFNRQAGKLNMVNEHKLPILSLMDLSAEK  223



>gb|AGU36403.1| 11S globulin precursor, partial [Helianthus annuus]
Length=342

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 112/226 (50%), Gaps = 39/226 (17%)
 Frame = +3

Query  714   DKYQKIRYYEKGDIIVIPASAVHWFYN-QNREPTILVVLQRANPV--------SFFLAGK  866
             D +QK+  + +GDII IPA AV+W YN +N+E   ++V    NP         + FLAG 
Sbjct  1     DSHQKVHRFREGDIIAIPAGAVYWTYNDRNQEVVAIIVDDVNNPANQLDFQAKTSFLAGG  60

Query  867   PGSSHqgqreqgrqqqeLMT----------------------ERLGYDGNILAGFDVQIV  980
               S H   ++Q + QQ                          E L  D N+ AGFD +++
Sbjct  61    ISSEHIQGQQQFQGQQGRQGQQQIHGQQSRQQGRRRSPFGGQEELTRD-NVYAGFDTELL  119

Query  981   KDALNTDRETAEKIIGGNARGRGHIVIVQQ-----LPSrpekrrqpgrqgggSSNALEET  1145
              +A N D +    +    +R RG IV VQQ      P   +++    R  GG SN +EET
Sbjct  120   AEAFNCDPQIMRAL--QESRNRGVIVQVQQQMEFVTPEEEQQQMHQRRSRGGPSNGVEET  177

Query  1146  LCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +C+A    N+DN+  AD+++ +AG+L  +N   LP LS + LSA +
Sbjct  178   ICSAKLVFNLDNQREADVFNRQAGKLNMVNEHKLPILSLMDLSAEK  223



>ref|XP_010238071.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon]
Length=483

 Score = 98.2 bits (243),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 117/246 (48%), Gaps = 49/246 (20%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGS------EILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             GSG  G   PGC ET+QQ E+        +  D++QK+  +++GD+I +P    HW YN 
Sbjct  110   GSGFAGFAFPGCPETFQQFEQAQGPSQSQQFSDEHQKVHRFQQGDVIALPVGVAHWLYND  169

Query  798   NREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGN  950
                P + + +   N  +         F LAG                  L  +  G   N
Sbjct  170   GDAPIVAIYVFDTNSNANQLEPRRKEFMLAG---------------ANRLAQQYFG--DN  212

Query  951   ILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIV---------------QQLPSrp  1085
             I +GF+VQ++ +AL+ +  TA+++       RG I++V               +QL S P
Sbjct  213   IFSGFNVQLLSEALDINELTAQRL-QSQYEQRGEIILVDHGLQFVKPAVIQQKEQL-SYP  270

Query  1086  ekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYV  1265
             + R Q GR  GGS N LEE  C      NI++  +AD Y+ RAGR+T LNS     L+ V
Sbjct  271   QGRSQIGRSIGGSLNGLEENFCDHKPIINIEDPNQADEYNPRAGRITHLNSQKFSILNTV  330

Query  1266  RLSAAR  1283
             ++SA R
Sbjct  331   QMSATR  336


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P   + ++GG TE++D  +EQF C G    R +I P GL LP Y + P 
Sbjct  44   ECRFDRLQAHEPLRQVRSQGGLTEYFDEQNEQFLCSGVSVIRRVINPRGLLLPRYHNTPG  103

Query  355  VAYVLQGT  378
            + Y+++G+
Sbjct  104  LVYIIRGS  111



>ref|XP_010326169.1| PREDICTED: LOW QUALITY PROTEIN: 11S globulin seed storage protein 
2-like [Solanum lycopersicum]
Length=478

 Score = 98.2 bits (243),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/245 (30%), Positives = 113/245 (46%), Gaps = 35/245 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQ----------QSEKGSEIL-DKYQKIRYYEKGDIIVIPASAVH  782
             G G  GI  PGCAET+Q          + E+G  +  D++QK+    +GD++ IPA A H
Sbjct  109   GQGIVGITYPGCAETFQSQTFQAGREPREERGQGLGGDQHQKVHRIRQGDVVAIPAGAAH  168

Query  783   WFYNQNREPTILVVLQRANPVS---------FFLAGKPGSSHqgqreqgrqqqeLMTERL  935
             W YN   E  + V +   N  S         F+LAG    +   + + G     L  +R 
Sbjct  169   WCYNDGEEELVAVAINDLNHRSNXLDQNSRVFYLAGGVQENESQRAQTG-----LRKQRK  223

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpe---------  1088
                 NI   FD +++ +A+N   ET  K+       RG IV V++  S  +         
Sbjct  224   QKFQNIFRAFDTELLAEAINIPSETVRKMQEEQTE-RGTIVNVREGMSTIKPDEEEAEGR  282

Query  1089  krrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVR  1268
              +R        + N LEE +CT     NI+ + RADI+  +AG++  +    LP L Y+ 
Sbjct  283   SQRGQQWWEKVTRNGLEENICTMKIRTNIETQRRADIFSRQAGKVNHVGRQKLPILEYID  342

Query  1269  LSAAR  1283
             +SA++
Sbjct  343   MSASK  347


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +1

Query  163  SQNEKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYT  342
            +Q ++C+L +I   +P+  I +EGG +E WD N EQFQC G    R +I+ N L LP + 
Sbjct  39   TQAQQCRLQRIAGCQPSDRIESEGGFSELWDENEEQFQCAGVAPLRFVIRRNSLSLPKFH  98

Query  343  SAPLVAYVLQG  375
                + Y+ +G
Sbjct  99   PMRGLVYIQRG  109



>ref|XP_008353191.1| PREDICTED: LOW QUALITY PROTEIN: legumin type B-like, partial 
[Malus domestica]
Length=433

 Score = 97.4 bits (241),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 124/282 (44%), Gaps = 69/282 (24%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEK---------------------------GSEILDKYQKIR  734
             G G  G+  PGC ET++ S+                              E  D++QK+R
Sbjct  96    GRGVLGVAFPGCPETFEDSQDRQFQHQQQFQPFQPSRRHGGQGQQQQQSEENQDRHQKVR  155

Query  735   YYEKGDIIVIPASAVHWFYNQ-NREPTILVVLQRAN--------PVSFFLAGKPGSSHqg  887
             +  +GDII +PA   +W YN  N++   + +L  +N        P  F+LAG P +S   
Sbjct  156   HIREGDIIALPAGVAYWSYNNGNQDLVAISLLDFSNEQNQLDQQPRRFYLAGNPQTSSAS  215

Query  888   qreqgrqqqeLMTERLGYDG--------------------------NILAGFDVQIVKDA  989
              +  G +Q     ++                               N+ AGFD Q++  A
Sbjct  216   NKANGIEQGRQQQQQGRQQQQQGQGGQQERGQQGRRGQQQQGGNGKNLFAGFDTQMLAQA  275

Query  990   LNTDRETAEKIIGGNARGRGHIVIVQ-QLP-----SrpekrrqpgrqgggSSNALEETLC  1151
             LN D E   ++ G N   R  IV VQ QL      S+ E+  +    GGG +N LEET C
Sbjct  276   LNVDEEIVNRLQGRND-DRNEIVQVQGQLDFVSPFSQGEQEGRRQMGGGGRANGLEETFC  334

Query  1152  TATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             +    +NI +   AD Y  +AGR++ +NS TLP LS +RLSA
Sbjct  335   SMRLKENIRDPSNADFYSPQAGRVSVVNSGTLPILSALRLSA  376


 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQ +Q+ +  P   I +E G TE W+PN +QFQC G    R  IQPNGL LPS+ ++P 
Sbjct  30   ECQFNQLQSREPDNQIQSEAGLTESWNPNDQQFQCAGVAMVRRTIQPNGLHLPSFLNSPQ  89

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  90   LIYIVQG  96



>sp|P33523.2|CRU1_BRANA RecName: Full=Cruciferin BnC1; AltName: Full=11S globulin; AltName: 
Full=12S storage protein; Contains: RecName: Full=Cruciferin 
BnC1 subunit alpha; Contains: RecName: Full=Cruciferin 
BnC1 subunit beta; Flags: Precursor [Brassica napus]
 emb|CAA41984.1| cruciferin storage protein [Brassica napus]
Length=490

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 118/286 (41%), Gaps = 73/286 (26%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQ-----QSEKGSE-------------  707
             G +LP  FST        G G  G +VPGCAET+Q     Q   GS              
Sbjct  77    GLYLPSFFSTAKLSFVAKGEGLMGRVVPGCAETFQDSSVFQPSGGSPSGEGQGQGQQGQG  136

Query  708   -------------------------ILDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPT  812
                                        D +QK+ +   GD I        WFYN   +P 
Sbjct  137   QGHQGQGQGQQGQQGQQGQQSQGQGFRDMHQKVEHIRTGDTIATHPGVAQWFYNDGNQPL  196

Query  813   ILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAGF  965
             ++V VL  A        NP  F+LAG           + +Q Q+          NIL GF
Sbjct  197   VIVSVLDLASHQNQLDRNPRPFYLAGNNPQGQVWIEGREQQPQK----------NILNGF  246

Query  966   DVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggSSNALEET  1145
               +++  A   D  TA+++       RG+I+ VQ   S      +  R      N LEET
Sbjct  247   TPEVLAKAFKIDVRTAQQL-QNQQDNRGNIIRVQGPFSVIRPPLRSQRPQETEVNGLEET  305

Query  1146  LCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
             +C+A  T N+D+   AD+Y  + G ++TLNS+ LP L ++RLSA R
Sbjct  306   ICSARCTDNLDDPSNADVYKPQLGYISTLNSYDLPILRFLRLSALR  351


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + AE G  E WD +  Q +C G    R+II+  G
Sbjct  18   LHGSTAQQFPNECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSGVSFVRYIIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ S   +++V +G
Sbjct  78   LYLPSFFSTAKLSFVAKG  95



>gb|AFQ32290.1| 12S seed storage protein [Camelina sativa]
Length=375

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 106/242 (44%), Gaps = 44/242 (18%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL----------DKYQKIRYYEKGDIIVIPASAVHW  785
             G G  G I  GC ETY+  E                D +QK+  + +GD+  + A    W
Sbjct  101   GEGVIGTIASGCPETYEDIEASGRGGGGGDRQRRFEDMHQKLENFRRGDVFALLAGVSQW  160

Query  786   FYNQ--------------NREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLM  923
             +YN               NRE  +  V     P  F LAG      +             
Sbjct  161   WYNSGDSDVVIVIVLDVTNRENQLDQV-----PRMFQLAGSRTQEEE------------Q  203

Query  924   TERLGYDG--NILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrr  1097
              + L +    N  +GFD  I+ +A   D ETA K +      RG+IV           + 
Sbjct  204   QQPLNWPSGNNAFSGFDANIIAEAFKIDIETA-KQLQNQQDNRGNIVRANGPLHFVIPQP  262

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
             +  +Q  G +N +EET CTA   +NID+ ER+D++ +RAGR++TLNS  LP L  VRL+A
Sbjct  263   RQWQQQDGIANGIEETYCTARLHENIDDPERSDLFSTRAGRISTLNSLNLPVLRLVRLNA  322

Query  1278  AR  1283
              R
Sbjct  323   VR  324


 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 6/82 (7%)
 Frame = +1

Query  148  FHGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            FHG E++ ++      C  SQI+++ P      E G  E WD    + QC G    R  +
Sbjct  20   FHGGEARQQETPFPNACHFSQINSLAPAQATKFEAGQMEVWDHMSPELQCAGVTVVRITL  79

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            Q N +FLP++ S P +AYV+QG
Sbjct  80   QSNSIFLPAFFSPPALAYVVQG  101



>dbj|BAO50872.1| 13S globulin [Fagopyrum esculentum]
Length=453

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 113/242 (47%), Gaps = 41/242 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ--------------SEKGSEILDKYQKIRYYEKGDIIVIPAS  773
             G G +G+ +PGC ETYQ                E G  + D +Q  R   KGD++ +P  
Sbjct  96    GEGVFGLSLPGCPETYQSRGMEMRGDEEEEEGFESGRRMTDAHQPTRRVRKGDVVALPQG  155

Query  774   AVHWFYNQNREPTILVVLQRANP---------VSFFLAG--KPGSSHqgqreqgrqqqeL  920
              VHW +N  +E  ++V +   N           +FFLAG  + GS               
Sbjct  156   TVHWCFNDGQEDLVVVAVHNLNTDANQLDQSLKTFFLAGGVQGGSKEGK-----------  204

Query  921   MTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-LPSrpekrr  1097
              +++L ++ NIL+ F+ +++ +AL T+ ET  K+   +   RG IV  ++ +       R
Sbjct  205   -SQKLNFN-NILSAFETKLLAEALGTEEETVRKMQESDE--RGPIVKARKNMRQMVTPPR  260

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
                 Q    +N LEE+ C   F  N+  R  ADI   +AGR+ +++   LP L ++ +SA
Sbjct  261   FGREQDEDETNGLEESFCNMRFRHNLGPRTEADIASRQAGRIHSVDQNKLPILEFIDMSA  320

Query  1278  AR  1283
              +
Sbjct  321   EK  322


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+L Q+ + +P   I +EGGT E WD   +QFQC G  A R  +QP+ L LPSY S+P 
Sbjct  30   QCRLDQLTSSQPNQKIRSEGGTIEVWDEEEDQFQCAGVAAMRVTVQPDSLSLPSYYSSPR  89

Query  355  VAYVLQG  375
            + YV QG
Sbjct  90   LVYVEQG  96



>emb|CDY32518.1| BnaA09g50780D [Brassica napus]
Length=496

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 106/236 (45%), Gaps = 39/236 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKG------SEILDKYQKIRYYEKGDIIVIPASAVHWFYNQ  797
             G G  G I  GC ETY+++  G          D +QK+  + +GD+    A    W+YN+
Sbjct  101   GEGVMGTIASGCPETYEEAGGGVGGDMHRRFEDMHQKLEDFRRGDVFASLAGVSQWWYNR  160

Query  798   --------------NREPTILVVLQRANPVSFFLAGKPGSSHqgqreqgrqqqeLMTERL  935
                           NRE  +  V     P  F +AG      Q            +T   
Sbjct  161   GNSDVVIVIVLDVTNRENQLDQV-----PRMFQIAGSKTQEQQQP----------LTWPS  205

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqg  1115
             G   N  +GFD  I+ +A   D ETA+K+       RG+IV     P           Q 
Sbjct  206   GK--NAFSGFDPNIIAEAFKIDIETAKKL-QNQKDNRGNIVRANG-PLHFISSPSRQWQQ  261

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              G+ N +EET CTA   +NID+ ER+D + +RAGR++TLNS  LP L  VRL+A R
Sbjct  262   DGNGNGIEETYCTARLHENIDDPERSDFFSTRAGRISTLNSLNLPVLRLVRLNAIR  317


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = +1

Query  148  FHGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            FHG E++  +      C  SQI+++ P      E G  E WD    + QC G    R  +
Sbjct  20   FHGSEARQRELPLPNACHFSQINSLSPAHATKFEAGQMEVWDHTSNELQCAGVTVARITL  79

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            Q N +FLPS+ S P +AYV+QG
Sbjct  80   QANSIFLPSFFSPPSLAYVVQG  101



>dbj|BAO50870.1| 13S globulin [Fagopyrum esculentum]
 dbj|BAO50871.1| 13S globulin [Fagopyrum esculentum]
Length=453

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 113/242 (47%), Gaps = 41/242 (17%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQ--------------SEKGSEILDKYQKIRYYEKGDIIVIPAS  773
             G G +G+ +PGC ETYQ                E G  + D +Q  R   KGD++ +P  
Sbjct  96    GEGVFGLSLPGCPETYQSRGMEMRGDEEEEEGFESGRRMTDAHQPTRRVRKGDVVALPQG  155

Query  774   AVHWFYNQNREPTILVVLQRANP---------VSFFLAG--KPGSSHqgqreqgrqqqeL  920
              VHW +N  +E  ++V +   N           +FFLAG  + GS               
Sbjct  156   TVHWCFNDGQEDLVVVAVHNLNTDANQLDQSLKTFFLAGGVQGGSKEGK-----------  204

Query  921   MTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-LPSrpekrr  1097
              +++L ++ NIL+ F+ +++ +AL T+ ET  K+   +   RG IV  ++ +       R
Sbjct  205   -SQKLNFN-NILSAFETKLLAEALGTEEETVRKMQESDE--RGPIVKARKNMRQMVTPPR  260

Query  1098  qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSA  1277
                 Q    +N LEE+ C   F  N+  R  ADI   +AGR+ +++   LP L ++ +SA
Sbjct  261   FGREQDEDETNGLEESFCNMRFRHNLGPRTEADIASRQAGRIHSVDQNKLPILEFIDMSA  320

Query  1278  AR  1283
              +
Sbjct  321   EK  322


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+L Q+ + +P   I +EGGT E WD   +QFQC G  A R  +QP+ L LPSY S+P 
Sbjct  30   QCRLDQLTSSQPNQKIQSEGGTIEVWDEEEDQFQCAGVAAMRVTVQPDSLSLPSYYSSPR  89

Query  355  VAYVLQG  375
            + YV QG
Sbjct  90   LVYVEQG  96



>ref|XP_002889480.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65739.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
Length=452

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 108/236 (46%), Gaps = 34/236 (14%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQSEKGSEIL-----------DKYQKIRYYEKGDIIVIPASAVH  782
             G G  G I  GC ETY+++E  S              D +QK+  + +GD+    A    
Sbjct  101   GEGVMGTIASGCPETYEETEGSSGRGGGGGDRRRRFEDMHQKLENFRRGDVFASLAGVSQ  160

Query  783   WFYNQ-NREPTILVVLQRAN--------PVSFFLAGKPGSSHqgqreqgrqqqeLMTERL  935
             W+YN+ + +  I++VL   N        P  F LAG      Q            +T   
Sbjct  161   WWYNRGDSDAVIVIVLDVTNRENQLDQVPRMFQLAGSRTQEQQQP----------LTWPS  210

Query  936   GYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqg  1115
             G   N  +GFD  I+ +A   + ETA K +      RG+I+     P           Q 
Sbjct  211   G--NNAFSGFDPNIIAEAFKINIETA-KQLQNQKDNRGNIIRANG-PLHFVTPPPREWQQ  266

Query  1116  ggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              G +N +EET CTA   +NID+ ER D + +RAGR++TLNS  LP L  VRL+A R
Sbjct  267   DGIANGIEETYCTAKIHENIDDPERTDHFSTRAGRISTLNSLNLPVLRLVRLNALR  322


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = +1

Query  148  FHGQESQNEK------CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHII  309
            FHG E++  +      C  SQI+++ P      E G  E WD    + +C G    R  +
Sbjct  20   FHGGEARQREVPFQNACHFSQINSLAPAQATKFEAGQMEVWDHMSPELRCAGVTVARITL  79

Query  310  QPNGLFLPSYTSAPLVAYVLQG  375
            Q N +FLP++ S P +AYV+QG
Sbjct  80   QANSIFLPAFFSPPALAYVVQG  101



>ref|NP_001046512.1| Os02g0268100 [Oryza sativa Japonica Group]
 sp|Q6ERU3.1|GLUB5_ORYSJ RecName: Full=Glutelin type-B 5; Contains: RecName: Full=Glutelin 
type-B 5 acidic chain; Contains: RecName: Full=Glutelin 
type-B 5 basic chain; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD28627.1| glutelin precursor [Oryza sativa Japonica Group]
 dbj|BAF08426.1| Os02g0268100 [Oryza sativa Japonica Group]
 dbj|BAG98006.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 113/255 (44%), Gaps = 49/255 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+ +PA   HWF
Sbjct  110   GRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHWF  169

Query  789   YNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN+   P + + +      AN +      F LAG      Q            + +  G 
Sbjct  170   YNEGDAPVVALYVFDLNNNANQLEPRQKEFLLAGNNNREQQMYGRS-------IEQHSGQ  222

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------------  1070
               NI +GF+ +++ +AL  +   A+++ G N + RG I+ V+                  
Sbjct  223   --NIFSGFNNELLSEALGVNALVAKRLQGQNDQ-RGEIIRVKNGLKLLRPAFAQQQEQAQ  279

Query  1071  ----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
                   ++ + +    +Q     N L+E  CT     NI+N   AD Y+ RAGR+T LNS
Sbjct  280   QQEQAQAQYQVQYSEEQQPSTRCNGLDENFCTIKARLNIENPSHADTYNPRAGRITRLNS  339

Query  1239  FTLPALSYVRLSAAR  1283
                P L+ V+LSA R
Sbjct  340   QKFPILNLVQLSATR  354


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P   + +E G TE++D  +EQFQC G +  R +I+P GL +P Y++ P 
Sbjct  44   ECRFDRLQAFEPLRRVRSEAGVTEYFDEKNEQFQCTGTFVIRRVIEPQGLLVPRYSNTPG  103

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  104  MVYIIQG  110



>ref|NP_001046513.1| Os02g0268300 [Oryza sativa Japonica Group]
 sp|P14614.1|GLUB4_ORYSJ RecName: Full=Glutelin type-B 4; Contains: RecName: Full=Glutelin 
type-B 4 acidic chain; Contains: RecName: Full=Glutelin 
type-B 4 basic chain; Flags: Precursor [Oryza sativa Japonica 
Group]
 emb|CAA32566.1| preprolglutelin (AA -24 to 476) [Oryza sativa Japonica Group]
 gb|AAM97692.1| glutelin precursor [Oryza sativa]
 dbj|BAC77348.1| glutelin [Oryza sativa Japonica Group]
 dbj|BAD28628.1| glutelin precursor [Oryza sativa Japonica Group]
 dbj|BAF08427.1| Os02g0268300 [Oryza sativa Japonica Group]
 gb|EAY85309.1| hypothetical protein OsI_06679 [Oryza sativa Indica Group]
 gb|EAZ22524.1| hypothetical protein OsJ_06189 [Oryza sativa Japonica Group]
 gb|ADB84626.1| glutelin [Oryza sativa Japonica Group]
 prf||1604474A glutelin
Length=500

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 113/255 (44%), Gaps = 49/255 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+ +PA   HWF
Sbjct  110   GRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHWF  169

Query  789   YNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN+   P + + +      AN +      F LAG      Q            + +  G 
Sbjct  170   YNEGDAPVVALYVFDLNNNANQLEPRQKEFLLAGNNNREQQMYGRS-------IEQHSGQ  222

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------------  1070
               NI +GF+ +++ +AL  +   A+++ G N + RG I+ V+                  
Sbjct  223   --NIFSGFNNELLSEALGVNALVAKRLQGQNDQ-RGEIIRVKNGLKLLRPAFAQQQEQAQ  279

Query  1071  ----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
                   ++ + +    +Q     N L+E  CT     NI+N   AD Y+ RAGR+T LNS
Sbjct  280   QQEQAQAQYQVQYSEEQQPSTRCNGLDENFCTIKARLNIENPSHADTYNPRAGRITRLNS  339

Query  1239  FTLPALSYVRLSAAR  1283
                P L+ V+LSA R
Sbjct  340   QKFPILNLVQLSATR  354


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P   + +E G TE++D  +EQFQC G +  R +I+P GL +P Y++ P 
Sbjct  44   ECRFDRLQAFEPLRRVRSEAGVTEYFDEKNEQFQCTGTFVIRRVIEPQGLLVPRYSNTPG  103

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  104  MVYIIQG  110



>gb|KFK31664.1| hypothetical protein AALP_AA6G142800 [Arabis alpina]
Length=518

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/281 (27%), Positives = 115/281 (41%), Gaps = 74/281 (26%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQ-----QSEKGSEIL---------------------------  713
             ++G G  G ++PGCAET+Q     Q   GS+                             
Sbjct  110   ASGRGLMGRVIPGCAETFQDSSVFQPRGGSQFGEGQEEQEEQGQQGQGHQGRGQHGQGQQ  169

Query  714   ----------------------DKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILVVL  827
                                   D +QK+ +  KGD I        WFYN+ ++P ++V +
Sbjct  170   GRGQQGQGQQEQEQRQQGQGFRDMHQKVEHIRKGDTIATLPGVAEWFYNEGQQPLVIVAV  229

Query  828   QRA---------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQIV  980
                         NP  F+LAG      +    + +Q             NIL+GF  +++
Sbjct  230   MDLASHQNQLDRNPRPFYLAGNNQEGQKWIEGREQQP----------QNNILSGFAPEVI  279

Query  981   KDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggSSNALEETLCTAT  1160
               A   + +TA+++       RG+IV VQ          +  R     +N LEET+C+  
Sbjct  280   AQAFKINLKTAQQL-QNQQDNRGNIVRVQGQFGVIRPPLRGQRPQEEGTNGLEETVCSQR  338

Query  1161  FTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
              T+N+D+  RAD+Y    G ++TLNSF LP L  +RLSA R
Sbjct  339   VTENLDDPSRADVYKPHLGYISTLNSFDLPILQQIRLSALR  379


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +CQL Q++A+ PT  + +EGG  E WD +  Q +C G    R++I+  GL+LPSY +   
Sbjct  46   ECQLDQLNALEPTHVLKSEGGRIEVWDHHAPQLRCSGVSFVRYVIENKGLYLPSYLNTAK  105

Query  355  VAYVLQG  375
            +++V  G
Sbjct  106  LSFVASG  112



>ref|XP_006282361.1| hypothetical protein CARUB_v10028658mg [Capsella rubella]
 gb|EOA15259.1| hypothetical protein CARUB_v10028658mg [Capsella rubella]
Length=468

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 112/248 (45%), Gaps = 41/248 (17%)
 Frame = +3

Query  630   STGSGEYGIIVPGCAETYQQSE-------------------KGSEILDKYQKIRYYEKGD  752
             + G G  G ++PGCAET+Q S                    +     D +QK+ +   GD
Sbjct  93    AQGRGLMGKVIPGCAETFQDSSVFQPREGRRQYEGQGEEEEQSQRFHDMHQKVEHIRSGD  152

Query  753   IIVIPASAVHWFYNQNREPTILV-VLQRA--------NPVSFFLAGKPGSSHqgqreqgr  905
              I        WFYN+ ++P ++V V   A        NP  F+LAG             +
Sbjct  153   TIATTPGVAQWFYNEGQQPLVIVSVFDLASHQNQLDRNPRPFYLAGN----------NPQ  202

Query  906   qqqeLMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrp  1085
              Q  L     G   NI +GF  +++  A   D +TA+++       RG+IV V+      
Sbjct  203   GQVWLQGREQGPQKNIFSGFGPEVIAQAFKIDLQTAQQLQN-QQDNRGNIVRVKGPFGVI  261

Query  1086  ekrr--qpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALS  1259
                   Q  ++     N LEET+C+A    N+D+  RAD+Y  + G L+TLNS+ LP L 
Sbjct  262   RPPLRGQRPQEEEREGNGLEETICSARSVDNLDDPSRADVYKPQLGYLSTLNSYDLPILR  321

Query  1260  YVRLSAAR  1283
             ++RLSA R
Sbjct  322   FIRLSALR  329


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + +E G  E WD +  Q +C G    R++I+  G
Sbjct  18   LHGYTAQQFPNECQLEQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFVRYVIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ +   +++V QG
Sbjct  78   LYLPSFVNTAKLSFVAQG  95



>ref|XP_002526484.1| nutrient reservoir, putative [Ricinus communis]
 gb|EEF35875.1| nutrient reservoir, putative [Ricinus communis]
Length=360

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/234 (32%), Positives = 107/234 (46%), Gaps = 50/234 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAET------YQQSEKGSEI--LDKYQKIRYYEKGDIIVIPASAVHWFY  791
             G G  G + PGC ET       Q   +G E    D++QK+R   +GD+I +      W Y
Sbjct  52    GRGIQGSVFPGCPETCQSPSESQSESRGQEQSRRDQHQKVRQIREGDVIALHTGVAQWIY  111

Query  792   NQNREPTILV-VLQRANPVS--------FFLAGKPGSSHqgqreqgrqqqeLMTERLG--  938
             N  R P +LV ++  +NP +        FFLAG P    Q QR +  +Q+E     +G  
Sbjct  112   NNGRSPLVLVQIIDTSNPTNQLDQNHRDFFLAGNPQQEVQSQRGERGRQRERRPISMGGA  171

Query  939   --YDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrq  1112
                 GN+ +G D +++ +A N + + A K+ G N   RG I                   
Sbjct  172   RDNSGNVFSGMDERMIAEAFNINTDLARKLRGENDL-RGII-------------------  211

Query  1113  gggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLS  1274
                      ET C A    NID    ADIY+ RAGR++ +NS  LP L +++LS
Sbjct  212   ---------ETFCKARLRHNIDKPSEADIYNPRAGRVSNVNSHNLPILRFLQLS  256



>gb|AGT59175.1| glutelin, partial [Oryza sativa Indica Group]
Length=456

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/259 (29%), Positives = 108/259 (42%), Gaps = 55/259 (21%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY-------------QQSEKGSEILDKYQKIRYYEKGDIIVIPASA  776
             G G  G   PGC ETY             +   +  +  D++QKI  + +GD+I +PA  
Sbjct  68    GRGITGPTFPGCPETYQQQFQQSGQAQLTESQSQSHKFKDEHQKIHRFRQGDVIALPAGV  127

Query  777   VHWFYNQNREPTILVVLQRAN---------PVSFFLAGKPGSSHqgqreqgrqqqeLMTE  929
              HW YN    P + + +   N            F LAG   +                 E
Sbjct  128   AHWCYNDGEVPVVAIYVTDINNGANQLDPRQRDFLLAGNKRNPQ-----------AYRRE  176

Query  930   RLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQ--------------  1067
                +  NI +GF  +++ +A     + A ++   N + RG IV V+              
Sbjct  177   VEEWSQNIFSGFSTELLSEAFGISNQVARQLQCQNDQ-RGEIVRVERGLSLLQPYASLQE  235

Query  1068  ----QLPSrpekrrqpgrqgggSS---NALEETLCTATFTQNIDNRERADIYDSRAGRLT  1226
                 Q+ SR   +    +Q    S   N L+ET CT    QNIDN  RAD Y+ RAGR+T
Sbjct  236   QEQGQMQSREHYQEGGYQQSQYGSGCPNGLDETFCTMRVRQNIDNPNRADTYNPRAGRVT  295

Query  1227  TLNSFTLPALSYVRLSAAR  1283
              LNS   P L+ V++SA +
Sbjct  296   NLNSQNFPILNLVQMSAVK  314


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  178  CQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPLV  357
            C+  ++ A  P  ++ ++ GTTEF+D ++E FQC G    R +I+P GL LP YT+   +
Sbjct  3    CRFDRLQAFEPIRSVRSQAGTTEFFDVSNELFQCTGVSVVRRVIEPRGLLLPHYTNGASL  62

Query  358  AYVLQG  375
             Y++QG
Sbjct  63   VYIIQG  68



>ref|XP_003566659.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon]
 ref|XP_003566660.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon]
Length=493

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 109/253 (43%), Gaps = 56/253 (22%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETY----QQSEKGSEIL-------------DKYQKIRYYEKGDIIVI  764
             GSG  G+  PGC ET+    QQS +    L             D +Q++  + +GD++ +
Sbjct  109   GSGFVGLAFPGCPETFLEQFQQSRQTQSTLGQSQCQSQSQKLGDVHQRVHQFTQGDVVAL  168

Query  765   PASAVHWFYNQNREPTILV----VLQRANPVS-----FFLAGKPGSSHqgqreqgrqqqe  917
             PA   HWFYN    P + V    V   AN +      F LAG                  
Sbjct  169   PAGVAHWFYNGGDAPVVAVYVFDVNNNANQLEPRQKEFLLAGN-------------YNGV  215

Query  918   LMTERLGYDGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIV-----------IV  1064
             L + R     NIL G + Q++  A   + +T+ +II     GRG IV           +V
Sbjct  216   LQSGR-----NILNGLNAQLLSQAFGINEQTS-RIIQNQNDGRGEIVRVEYGLQFLTPVV  269

Query  1065  QQLPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNSFT  1244
              Q   +        ++G  S N LEE  C+    QNI++  RAD Y+ RAG +  LN   
Sbjct  270   TQQQQKQPFLPIEPQEGQSSRNGLEENFCSLEPRQNIEDPNRADTYNPRAGSIARLNGQN  329

Query  1245  LPALSYVRLSAAR  1283
              P L+ V++SA R
Sbjct  330   FPILNLVQMSATR  342


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C   ++  I P   + ++ G TE++D  +EQF+C G    R +I+P GL LP Y + P 
Sbjct  43   ECSFDRLQTIEPLTQVRSQAGLTEYFDEQNEQFRCAGVSVIRRVIEPRGLLLPRYHNTPG  102

Query  355  VAYVLQGT  378
            + Y+L+G+
Sbjct  103  LVYILEGS  110



>ref|XP_009101736.1| PREDICTED: cruciferin BnC1 [Brassica rapa]
Length=485

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 84/282 (30%), Positives = 119/282 (42%), Gaps = 70/282 (25%)
 Frame = +3

Query  612   GYFLP--FST--------GSGEYGIIVPGCAETYQQSE-----KGSEI------------  710
             G +LP  FST        G G  G +VPGCAET+Q S       GS              
Sbjct  77    GLYLPSFFSTAKLSFVAKGQGLMGRVVPGCAETFQDSSVFQPGGGSPFGEGQGQGQQGQG  136

Query  711   ----------------------LDKYQKIRYYEKGDIIVIPASAVHWFYNQNREPTILV-  821
                                    D +QK+ +   GD I        WFYN   +P ++V 
Sbjct  137   QGQQGQGQGQQGQGQQGQGQGFRDMHQKVEHIRTGDTIATHPGVAQWFYNDGNQPLVIVS  196

Query  822   VLQRA--------NPVSFFLAGKPGSSHqgqreqgrqqqeLMTERLGYDGNILAGFDVQI  977
             VL  A        NP  F+LAG           + +Q Q+          NIL GF  ++
Sbjct  197   VLDLASHQNQLDRNPRPFYLAGNNPQGQVWIEGREKQPQK----------NILNGFTPEV  246

Query  978   VKDALNTDRETAEKIIGGNARGRGHIVIVQQLPSrpekrrqpgrqgggSSNALEETLCTA  1157
             +  A   D  TA+++       RG+I+ VQ  P    +     ++     N LEET+C+A
Sbjct  247   LAKAFKIDVRTAQQL-QNQEDNRGNIIRVQG-PFSVIRPPLRSQRPQEEVNGLEETICSA  304

Query  1158  TFTQNIDNRERADIYDSRAGRLTTLNSFTLPALSYVRLSAAR  1283
               T N+D+   AD+Y  + G ++TLNS+ LP L ++RLSA R
Sbjct  305   RCTDNLDDPSNADVYKPQLGYISTLNSYDLPILRFLRLSALR  346


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  FHGQESQN--EKCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNG  321
             HG  +Q    +CQL Q++A+ P+  + AE G  E WD +  Q +C G    R+II+  G
Sbjct  18   LHGSTAQQFPNECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSGVSFVRYIIESKG  77

Query  322  LFLPSYTSAPLVAYVLQG  375
            L+LPS+ S   +++V +G
Sbjct  78   LYLPSFFSTAKLSFVAKG  95



>gb|ADB84625.1| glutelin [Oryza sativa Japonica Group]
Length=500

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 113/255 (44%), Gaps = 49/255 (19%)
 Frame = +3

Query  636   GSGEYGIIVPGCAETYQQS---------EKGSEILDKYQKIRYYEKGDIIVIPASAVHWF  788
             G G  G+  PGC  TYQQ           +  +  D++QKI  + +GDI+ +PA   HWF
Sbjct  110   GRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHWF  169

Query  789   YNQNREPTILVVL----QRANPV-----SFFLAGKPGSSHqgqreqgrqqqeLMTERLGY  941
             YN+   P + + +      AN +      F LAG      Q            + +  G 
Sbjct  170   YNEGDAPVVALYVFDLNNNANQLEPRQKEFLLAGNNNREQQMYGRS-------IEQHSGQ  222

Query  942   DGNILAGFDVQIVKDALNTDRETAEKIIGGNARGRGHIVIVQQ-----------------  1070
               NI +GF+ +++ +AL  +   A+++ G N + RG I+ V+                  
Sbjct  223   --NIFSGFNNELLSEALGVNALVAKRLQGQNDQ-RGEIIRVKNGLKLLRPAFAQQQEQAQ  279

Query  1071  ----LPSrpekrrqpgrqgggSSNALEETLCTATFTQNIDNRERADIYDSRAGRLTTLNS  1238
                   ++ + +    +Q     N L+E  CT     NI+N   AD Y+ RAGR+T LNS
Sbjct  280   QQEQAQAQYQVQYSEEQQPSTRCNGLDENFCTIKARLNIENPSHADTYNLRAGRITRLNS  339

Query  1239  FTLPALSYVRLSAAR  1283
                P L+ V+LSA R
Sbjct  340   QKFPILNLVQLSATR  354


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  175  KCQLSQIHAIRPTGNIPAEGGTTEFWDPNHEQFQCGGAYAFRHIIQPNGLFLPSYTSAPL  354
            +C+  ++ A  P   + +E G TE++D  +EQFQC G +  R +I+P GL +P Y++ P 
Sbjct  44   ECRFDRLQAFEPLRRVRSEAGVTEYFDEKNEQFQCTGTFVIRRVIEPQGLLVPRYSNTPG  103

Query  355  VAYVLQG  375
            + Y++QG
Sbjct  104  MVYIIQG  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3374802091560