BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24601_g2_i1 len=651 path=[3251:0-273 1228:274-650]

Length=651
                                                                      Score     E

ref|XP_009799148.1|  PREDICTED: MATE efflux family protein 6-like       157   1e-41   
ref|XP_009618983.1|  PREDICTED: MATE efflux family protein 6-like       156   4e-41   
ref|XP_009618984.1|  PREDICTED: MATE efflux family protein 6-like       156   4e-41   
gb|AHI48499.1|  multidrug and toxic extrusion transporter               153   5e-40   
emb|CDP02949.1|  unnamed protein product                                156   1e-39   
ref|XP_006367023.1|  PREDICTED: MATE efflux family protein 9-like       150   4e-39   
ref|XP_002270905.1|  PREDICTED: MATE efflux family protein 5-like...    150   9e-39   Vitis vinifera
emb|CBI17785.3|  unnamed protein product                                150   9e-39   
ref|XP_009799149.1|  PREDICTED: MATE efflux family protein 6-like       149   1e-38   
ref|XP_002276239.2|  PREDICTED: MATE efflux family protein 6-like       149   2e-38   Vitis vinifera
emb|CDP02950.1|  unnamed protein product                                150   2e-38   
ref|XP_009799150.1|  PREDICTED: MATE efflux family protein 6-like...    149   2e-38   
ref|XP_008811783.1|  PREDICTED: MATE efflux family protein 5-like       148   5e-38   
emb|CDP02838.1|  unnamed protein product                                147   7e-38   
ref|XP_006490714.1|  PREDICTED: MATE efflux family protein 5-like...    145   5e-37   
gb|EYU40237.1|  hypothetical protein MIMGU_mgv1a005368mg                145   5e-37   
ref|XP_002276463.1|  PREDICTED: MATE efflux family protein 5            145   6e-37   Vitis vinifera
gb|KDO62840.1|  hypothetical protein CISIN_1g010345mg                   144   7e-37   
ref|XP_002270870.2|  PREDICTED: MATE efflux family protein 5-like...    144   1e-36   Vitis vinifera
gb|KDO62838.1|  hypothetical protein CISIN_1g010345mg                   144   1e-36   
ref|XP_006451686.1|  hypothetical protein CICLE_v10008114mg             144   1e-36   
gb|KDO62839.1|  hypothetical protein CISIN_1g010345mg                   144   2e-36   
ref|XP_010319286.1|  PREDICTED: MATE efflux family protein 6 isof...    143   2e-36   
ref|XP_008223667.1|  PREDICTED: MATE efflux family protein 7-like       144   2e-36   
ref|XP_004236802.1|  PREDICTED: MATE efflux family protein 6 isof...    143   2e-36   
ref|XP_002277527.1|  PREDICTED: MATE efflux family protein 7            142   4e-36   Vitis vinifera
ref|XP_006366204.1|  PREDICTED: MATE efflux family protein 6-like       142   4e-36   
ref|XP_011010481.1|  PREDICTED: MATE efflux family protein 6-like       141   9e-36   
ref|XP_010048672.1|  PREDICTED: MATE efflux family protein 5-like...    140   1e-35   
ref|XP_010910116.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    141   1e-35   
gb|KCW80905.1|  hypothetical protein EUGRSUZ_C022722                    134   1e-35   
ref|XP_006381831.1|  hypothetical protein POPTR_0006s18630g             140   2e-35   
ref|XP_010048671.1|  PREDICTED: MATE efflux family protein 7-like...    140   2e-35   
ref|XP_010048680.1|  PREDICTED: MATE efflux family protein 9-like...    140   2e-35   
ref|XP_007222348.1|  hypothetical protein PRUPE_ppa004837mg             140   2e-35   
gb|KHG07789.1|  MATE efflux family protein DTX1                         140   3e-35   
ref|XP_002280423.1|  PREDICTED: MATE efflux family protein 6 isof...    140   3e-35   Vitis vinifera
ref|XP_002280388.2|  PREDICTED: MATE efflux family protein 6-like       140   4e-35   Vitis vinifera
ref|XP_010252180.1|  PREDICTED: MATE efflux family protein 6-like...    139   4e-35   
ref|XP_010048679.1|  PREDICTED: MATE efflux family protein 8-like...    139   4e-35   
ref|XP_010048674.1|  PREDICTED: MATE efflux family protein 6-like       139   4e-35   
emb|CDO98390.1|  unnamed protein product                                139   5e-35   
ref|XP_010048673.1|  PREDICTED: MATE efflux family protein 7-like       139   5e-35   
ref|XP_011039092.1|  PREDICTED: MATE efflux family protein 5 isof...    139   5e-35   
ref|XP_010036921.1|  PREDICTED: MATE efflux family protein 6            139   6e-35   
ref|XP_010048678.1|  PREDICTED: MATE efflux family protein 5-like...    139   6e-35   
gb|EYU42419.1|  hypothetical protein MIMGU_mgv1a005366mg                139   6e-35   
emb|CBI15521.3|  unnamed protein product                                139   7e-35   
ref|XP_007226589.1|  hypothetical protein PRUPE_ppa023794mg             139   7e-35   
ref|XP_008223668.1|  PREDICTED: MATE efflux family protein 8-like       139   7e-35   
gb|KGN63528.1|  hypothetical protein Csa_1G003460                       134   8e-35   
gb|AES76569.2|  MATE efflux family protein                              138   1e-34   
gb|KDP43814.1|  hypothetical protein JCGZ_23022                         139   1e-34   
ref|XP_011069889.1|  PREDICTED: MATE efflux family protein 6-like       138   1e-34   
gb|KCW81035.1|  hypothetical protein EUGRSUZ_C02411                     138   1e-34   
ref|XP_010048677.1|  PREDICTED: MATE efflux family protein 8-like...    138   1e-34   
ref|XP_006341551.1|  PREDICTED: MATE efflux family protein 5-like       138   1e-34   
ref|XP_010678134.1|  PREDICTED: MATE efflux family protein 5-like       138   2e-34   
ref|XP_011084523.1|  PREDICTED: MATE efflux family protein 5-like...    137   2e-34   
ref|XP_004243012.1|  PREDICTED: MATE efflux family protein 6-like       137   2e-34   
ref|XP_003620351.1|  hypothetical protein MTR_6g081810                  137   2e-34   
ref|XP_008223664.1|  PREDICTED: MATE efflux family protein DTX1-l...    137   2e-34   
ref|XP_008223665.1|  PREDICTED: MATE efflux family protein DTX1-l...    137   2e-34   
ref|XP_002318533.2|  hypothetical protein POPTR_0012s04810g             137   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008452131.1|  PREDICTED: MATE efflux family protein 6-like...    137   3e-34   
emb|CBI15520.3|  unnamed protein product                                140   3e-34   
ref|XP_010087833.1|  MATE efflux family protein 6                       137   3e-34   
ref|XP_006843973.1|  hypothetical protein AMTR_s00006p00126430          137   3e-34   
ref|XP_008385501.1|  PREDICTED: MATE efflux family protein 8-like       137   4e-34   
ref|XP_004167999.1|  PREDICTED: MATE efflux family protein 7-like       137   5e-34   
ref|XP_011084514.1|  PREDICTED: MATE efflux family protein DTX1-l...    136   5e-34   
ref|XP_010279420.1|  PREDICTED: MATE efflux family protein 5-like...    136   5e-34   
ref|XP_010279440.1|  PREDICTED: MATE efflux family protein 6-like       136   6e-34   
ref|XP_010279419.1|  PREDICTED: MATE efflux family protein 5-like...    136   7e-34   
ref|XP_007036669.1|  MATE efflux family protein                         136   1e-33   
ref|XP_010051005.1|  PREDICTED: MATE efflux family protein 6-like       135   1e-33   
gb|KEH26973.1|  MATE efflux family protein                              135   1e-33   
ref|XP_004307901.1|  PREDICTED: MATE efflux family protein 9-like       135   2e-33   
ref|XP_004138084.1|  PREDICTED: MATE efflux family protein DTX1-like    135   2e-33   
gb|KGN63531.1|  hypothetical protein Csa_1G003490                       135   2e-33   
ref|XP_004512780.1|  PREDICTED: MATE efflux family protein 6-like       135   2e-33   
gb|AES76567.2|  MATE efflux family protein                              134   3e-33   
ref|XP_010509762.1|  PREDICTED: MATE efflux family protein 5-like       134   3e-33   
ref|XP_008453462.1|  PREDICTED: MATE efflux family protein 5-like...    134   3e-33   
ref|XP_007152706.1|  hypothetical protein PHAVU_004G152500g             134   3e-33   
ref|XP_006344468.1|  PREDICTED: MATE efflux family protein 5-like       134   4e-33   
ref|XP_008453458.1|  PREDICTED: MATE efflux family protein 5-like...    134   4e-33   
ref|XP_008453461.1|  PREDICTED: MATE efflux family protein 5-like...    134   4e-33   
ref|XP_008453459.1|  PREDICTED: MATE efflux family protein 5-like...    134   4e-33   
ref|XP_003620349.1|  hypothetical protein MTR_6g081780                  134   4e-33   
gb|EPS72994.1|  hypothetical protein M569_01755                         134   6e-33   
ref|XP_007201925.1|  hypothetical protein PRUPE_ppa020722mg             133   7e-33   
ref|XP_007036670.1|  MATE efflux family protein                         133   7e-33   
ref|XP_007226244.1|  hypothetical protein PRUPE_ppa017663mg             133   7e-33   
ref|XP_010319106.1|  PREDICTED: MATE efflux family protein 7-like       133   8e-33   
ref|XP_004170251.1|  PREDICTED: MATE efflux family protein DTX1-like    133   8e-33   
gb|KGN61104.1|  hypothetical protein Csa_2G049930                       133   9e-33   
ref|XP_010916291.1|  PREDICTED: MATE efflux family protein 5-like       133   9e-33   
ref|XP_004160426.1|  PREDICTED: MATE efflux family protein 5-like       133   9e-33   
ref|XP_004149091.1|  PREDICTED: MATE efflux family protein 7-like       132   9e-33   
ref|XP_003534150.1|  PREDICTED: MATE efflux family protein 5-like       133   1e-32   
gb|KGN63858.1|  hypothetical protein Csa_1G024900                       133   1e-32   
ref|XP_004235767.1|  PREDICTED: MATE efflux family protein 5            132   1e-32   
ref|XP_004137550.1|  PREDICTED: MATE efflux family protein 8-like       132   1e-32   
ref|NP_001274783.1|  uncharacterized protein LOC102604804               132   2e-32   
ref|XP_010675023.1|  PREDICTED: MATE efflux family protein 6-like       132   2e-32   
ref|XP_006844571.1|  hypothetical protein AMTR_s00016p00194610          132   2e-32   
ref|XP_009797187.1|  PREDICTED: MATE efflux family protein 5-like       132   2e-32   
dbj|BAJ93883.1|  predicted protein                                      132   2e-32   
ref|XP_004168000.1|  PREDICTED: MATE efflux family protein 9-like       132   2e-32   
ref|XP_004149092.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    132   3e-32   
ref|XP_010516582.1|  PREDICTED: MATE efflux family protein 5-like       132   3e-32   
ref|XP_002511322.1|  TRANSPARENT TESTA 12 protein, putative             131   3e-32   Ricinus communis
ref|XP_008464505.1|  PREDICTED: MATE efflux family protein DTX1-like    131   3e-32   
gb|KGN63856.1|  hypothetical protein Csa_1G024880                       131   5e-32   
ref|XP_004160427.1|  PREDICTED: MATE efflux family protein 7-like       131   5e-32   
ref|XP_004137332.1|  PREDICTED: MATE efflux family protein 7-like       131   5e-32   
ref|XP_008453465.1|  PREDICTED: MATE efflux family protein 5-like       130   7e-32   
ref|XP_009380941.1|  PREDICTED: MATE efflux family protein 5-like...    130   7e-32   
ref|XP_010319016.1|  PREDICTED: MATE efflux family protein 7-like       130   7e-32   
ref|XP_009380942.1|  PREDICTED: MATE efflux family protein 5-like...    130   7e-32   
ref|XP_002879493.1|  mate efflux family protein                         130   7e-32   
ref|XP_009383615.1|  PREDICTED: MATE efflux family protein 5-like       130   8e-32   
gb|EMT24674.1|  Multidrug and toxin extrusion protein 1                 130   8e-32   
ref|XP_002511323.1|  TRANSPARENT TESTA 12 protein, putative             130   8e-32   Ricinus communis
dbj|BAK02636.1|  predicted protein                                      125   1e-31   
ref|XP_010910813.1|  PREDICTED: MATE efflux family protein 5-like       130   1e-31   
ref|XP_010044141.1|  PREDICTED: MATE efflux family protein 5-like...    130   1e-31   
ref|XP_009587005.1|  PREDICTED: MATE efflux family protein 5-like       130   1e-31   
ref|XP_009789171.1|  PREDICTED: MATE efflux family protein 7-like...    129   2e-31   
ref|XP_009789172.1|  PREDICTED: MATE efflux family protein 5-like...    129   2e-31   
gb|AAM93464.1|  hypothetical protein                                    129   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14550.1|  Protein TRANSPARENT TESTA 12                            129   2e-31   
ref|XP_009789170.1|  PREDICTED: MATE efflux family protein 7-like...    129   2e-31   
gb|ABG65963.1|  MATE efflux family protein, expressed                   129   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009799154.1|  PREDICTED: MATE efflux family protein 5-like       129   2e-31   
gb|EEC66670.1|  hypothetical protein OsI_32958                          129   3e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010674917.1|  PREDICTED: MATE efflux family protein 7-like       129   3e-31   
ref|XP_009607555.1|  PREDICTED: MATE efflux family protein 5-like       129   3e-31   
gb|KCW81033.1|  hypothetical protein EUGRSUZ_C02409                     128   4e-31   
ref|XP_011038705.1|  PREDICTED: MATE efflux family protein 5-like...    128   4e-31   
ref|XP_010044147.1|  PREDICTED: MATE efflux family protein 5-like       128   6e-31   
ref|XP_003573834.1|  PREDICTED: MATE efflux family protein 5-like       127   6e-31   
ref|NP_180983.4|  MATE efflux family protein                            127   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532532.1|  PREDICTED: MATE efflux family protein DTX1-like    127   8e-31   
ref|XP_004242678.1|  PREDICTED: MATE efflux family protein 6-like...    127   8e-31   
gb|AAC27412.1|  hypothetical protein                                    127   8e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68867.1|  BnaC07g51050D                                          127   9e-31   
ref|XP_002315903.1|  hypothetical protein POPTR_0010s12690g             127   9e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008776058.1|  PREDICTED: MATE efflux family protein DTX1-like    127   9e-31   
ref|XP_010323237.1|  PREDICTED: MATE efflux family protein 6-like...    127   9e-31   
ref|XP_010087832.1|  MATE efflux family protein 6                       127   1e-30   
ref|XP_009132984.1|  PREDICTED: MATE efflux family protein 5-like       127   1e-30   
ref|XP_004299560.1|  PREDICTED: MATE efflux family protein 6-like       127   1e-30   
emb|CDX72467.1|  BnaC07g44890D                                          127   1e-30   
ref|XP_010674914.1|  PREDICTED: MATE efflux family protein 5-like...    127   1e-30   
emb|CBI14951.3|  unnamed protein product                                126   2e-30   
gb|KEH26665.1|  MATE efflux family protein                              126   2e-30   
ref|XP_007211241.1|  hypothetical protein PRUPE_ppa004805mg             126   2e-30   
dbj|BAJ97214.1|  predicted protein                                      125   4e-30   
ref|XP_007160497.1|  hypothetical protein PHAVU_002G326700g             125   4e-30   
ref|XP_006661673.1|  PREDICTED: MATE efflux family protein 6-like       125   5e-30   
ref|XP_010680606.1|  PREDICTED: MATE efflux family protein LAL5-l...    125   5e-30   
ref|XP_004300941.1|  PREDICTED: MATE efflux family protein DTX1-like    125   5e-30   
ref|XP_010680607.1|  PREDICTED: MATE efflux family protein LAL5-l...    125   5e-30   
ref|XP_003579576.1|  PREDICTED: MATE efflux family protein 5-like...    125   5e-30   
emb|CDP00713.1|  unnamed protein product                                125   5e-30   
ref|XP_002526348.1|  conserved hypothetical protein                     122   5e-30   Ricinus communis
ref|XP_004253419.1|  PREDICTED: MATE efflux family protein LAL5-like    122   6e-30   
ref|XP_008223666.1|  PREDICTED: MATE efflux family protein 5-like       125   6e-30   
ref|XP_003567915.1|  PREDICTED: MATE efflux family protein 5-like       125   7e-30   
ref|XP_010319397.1|  PREDICTED: MATE efflux family protein 5-like...    125   7e-30   
ref|XP_010531854.1|  PREDICTED: MATE efflux family protein 6-like       125   7e-30   
ref|XP_002865913.1|  hypothetical protein ARALYDRAFT_918292             125   8e-30   
ref|XP_010251826.1|  PREDICTED: MATE efflux family protein 5-like       124   1e-29   
ref|XP_010675020.1|  PREDICTED: MATE efflux family protein 5-like       127   1e-29   
gb|AFW77707.1|  putative MATE efflux family protein                     122   1e-29   
ref|XP_010482607.1|  PREDICTED: MATE efflux family protein 5-like       124   1e-29   
ref|XP_009138276.1|  PREDICTED: MATE efflux family protein 5-like...    124   1e-29   
emb|CDX79559.1|  BnaC03g18950D                                          124   2e-29   
ref|XP_007036385.1|  MATE efflux family protein, putative               124   2e-29   
ref|XP_009138275.1|  PREDICTED: MATE efflux family protein 5-like...    124   2e-29   
emb|CDX84649.1|  BnaA03g15810D                                          126   2e-29   
ref|XP_002869164.1|  hypothetical protein ARALYDRAFT_328320             123   2e-29   
emb|CDY49289.1|  BnaA03g51020D                                          124   2e-29   
ref|NP_200058.1|  MATE efflux family protein                            123   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010087829.1|  MATE efflux family protein 6                       123   2e-29   
ref|XP_004975347.1|  PREDICTED: MATE efflux family protein 5-like       123   3e-29   
ref|XP_002532228.1|  TRANSPARENT TESTA 12 protein, putative             122   4e-29   Ricinus communis
ref|XP_003560768.1|  PREDICTED: MATE efflux family protein 8            122   4e-29   
dbj|BAK03656.1|  predicted protein                                      122   4e-29   
ref|XP_006280376.1|  hypothetical protein CARUB_v10026303mg             122   5e-29   
ref|XP_010444869.1|  PREDICTED: MATE efflux family protein 5-like...    122   6e-29   
ref|XP_006410581.1|  hypothetical protein EUTSA_v10016570mg             122   6e-29   
ref|XP_010540012.1|  PREDICTED: MATE efflux family protein 5-like...    122   7e-29   
ref|XP_008374800.1|  PREDICTED: MATE efflux family protein 6-like       122   8e-29   
ref|XP_002440937.1|  hypothetical protein SORBIDRAFT_09g017220          121   8e-29   Sorghum bicolor [broomcorn]
ref|XP_008240199.1|  PREDICTED: MATE efflux family protein 6-like       122   8e-29   
ref|XP_006360464.1|  PREDICTED: MATE efflux family protein 5-like       122   9e-29   
gb|KDP34992.1|  hypothetical protein JCGZ_09280                         122   9e-29   
ref|XP_010540011.1|  PREDICTED: MATE efflux family protein 5-like...    122   9e-29   
ref|NP_001266817.1|  uncharacterized protein LOC101027220               121   9e-29   
gb|AFW77706.1|  putative MATE efflux family protein                     121   9e-29   
ref|XP_008452139.1|  PREDICTED: MATE efflux family protein 6-like...    121   9e-29   
ref|NP_001147687.1|  transparent testa 12 protein                       121   1e-28   Zea mays [maize]
ref|XP_006843980.1|  hypothetical protein AMTR_s00006p00135140          121   1e-28   
ref|XP_004983270.1|  PREDICTED: MATE efflux family protein 5-like       121   1e-28   
ref|XP_002280229.1|  PREDICTED: MATE efflux family protein 5 isof...    121   1e-28   Vitis vinifera
ref|XP_006302211.1|  hypothetical protein CARUB_v10020223mg             121   1e-28   
ref|XP_010661327.1|  PREDICTED: MATE efflux family protein 5 isof...    122   1e-28   
ref|XP_010661271.1|  PREDICTED: MATE efflux family protein 5 isof...    122   1e-28   
ref|XP_004983271.1|  PREDICTED: MATE efflux family protein 5-like       120   2e-28   
emb|CDX91652.1|  BnaC02g15080D                                          120   2e-28   
emb|CDY27066.1|  BnaA02g10860D                                          120   2e-28   
emb|CDY00530.1|  BnaA10g07430D                                          120   2e-28   
gb|EMT22454.1|  Protein TRANSPARENT TESTA 12                            120   2e-28   
gb|KFK26855.1|  hypothetical protein AALP_AA8G302100                    120   2e-28   
ref|XP_009127238.1|  PREDICTED: MATE efflux family protein 5            120   2e-28   
ref|XP_006843977.1|  hypothetical protein AMTR_s00006p00131670          120   3e-28   
ref|XP_003592586.1|  Protein TRANSPARENT TESTA                          120   3e-28   
ref|XP_006297558.1|  hypothetical protein CARUB_v10013581mg             120   3e-28   
gb|EMT05193.1|  Protein TRANSPARENT TESTA 12                            120   4e-28   
ref|XP_006401821.1|  hypothetical protein EUTSA_v10013374mg             119   4e-28   
ref|XP_008645476.1|  PREDICTED: MATE efflux family protein 5-like...    119   4e-28   
ref|XP_006583449.1|  PREDICTED: MATE efflux family protein DTX1-l...    119   4e-28   
ref|XP_006583448.1|  PREDICTED: MATE efflux family protein DTX1-l...    119   4e-28   
ref|XP_003528965.1|  PREDICTED: MATE efflux family protein DTX1-l...    119   5e-28   
ref|XP_006401822.1|  hypothetical protein EUTSA_v10013374mg             119   5e-28   
ref|XP_004952272.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    119   5e-28   
ref|XP_008645475.1|  PREDICTED: MATE efflux family protein 9-like...    119   5e-28   
ref|XP_010044148.1|  PREDICTED: MATE efflux family protein 5-like...    120   5e-28   
gb|KHN44604.1|  MATE efflux family protein DTX1                         119   6e-28   
ref|XP_009106027.1|  PREDICTED: MATE efflux family protein 5            119   7e-28   
emb|CAN78228.1|  hypothetical protein VITISV_022105                     119   7e-28   Vitis vinifera
gb|KHG10126.1|  MATE efflux family protein 9                            119   8e-28   
ref|XP_002532229.1|  TRANSPARENT TESTA 12 protein, putative             119   9e-28   Ricinus communis
gb|EMS50494.1|  MATE efflux family protein DTX1                         120   1e-27   
ref|XP_010103000.1|  MATE efflux family protein 9                       119   1e-27   
gb|KGN63859.1|  hypothetical protein Csa_1G024910                       118   1e-27   
ref|XP_002888942.1|  mate efflux family protein                         118   1e-27   
ref|XP_004137334.1|  PREDICTED: MATE efflux family protein 7-like       118   1e-27   
ref|XP_010044149.1|  PREDICTED: MATE efflux family protein 5-like...    118   1e-27   
ref|XP_004160423.1|  PREDICTED: MATE efflux family protein 7-like       118   2e-27   
ref|XP_004952275.1|  PREDICTED: MATE efflux family protein 5-like...    117   2e-27   
ref|XP_004137333.1|  PREDICTED: MATE efflux family protein 9-like       118   2e-27   
ref|XP_004160425.1|  PREDICTED: MATE efflux family protein 9-like       118   2e-27   
emb|CDX84324.1|  BnaC04g10860D                                          118   2e-27   
ref|XP_010468567.1|  PREDICTED: MATE efflux family protein 5-like       117   2e-27   
ref|XP_003579577.1|  PREDICTED: MATE efflux family protein 5-like       118   2e-27   
ref|XP_004952274.1|  PREDICTED: MATE efflux family protein 5-like...    117   2e-27   
ref|XP_006383382.1|  hypothetical protein POPTR_0005s15050g             117   2e-27   
gb|KGN63857.1|  hypothetical protein Csa_1G024890                       117   3e-27   
ref|XP_009143781.1|  PREDICTED: MATE efflux family protein 5            117   3e-27   
ref|XP_004512714.1|  PREDICTED: MATE efflux family protein 5-like       117   3e-27   
gb|EMT22452.1|  Protein TRANSPARENT TESTA 12                            118   3e-27   
ref|XP_011070680.1|  PREDICTED: MATE efflux family protein 6-like       117   3e-27   
emb|CDY17238.1|  BnaA05g09500D                                          117   3e-27   
ref|XP_002453721.1|  hypothetical protein SORBIDRAFT_04g011240          117   4e-27   Sorghum bicolor [broomcorn]
ref|XP_004965369.1|  PREDICTED: MATE efflux family protein 5-like...    116   4e-27   
ref|XP_002453722.1|  hypothetical protein SORBIDRAFT_04g011250          117   5e-27   Sorghum bicolor [broomcorn]
ref|XP_010428306.1|  PREDICTED: MATE efflux family protein 5-like       117   5e-27   
ref|XP_006300152.1|  hypothetical protein CARUB_v10016383mg             116   5e-27   
ref|XP_004965370.1|  PREDICTED: MATE efflux family protein 5-like...    116   5e-27   
ref|NP_177511.1|  MATE efflux family protein                            117   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965368.1|  PREDICTED: MATE efflux family protein 5-like...    116   5e-27   
emb|CDY54775.1|  BnaAnng13490D                                          116   6e-27   
ref|XP_009335493.1|  PREDICTED: MATE efflux family protein 5-like       116   6e-27   
ref|XP_006843971.1|  hypothetical protein AMTR_s00006p00119970          116   7e-27   
ref|XP_006343696.1|  PREDICTED: MATE efflux family protein 9-like       116   7e-27   
ref|XP_006439918.1|  hypothetical protein CICLE_v10020096mg             116   8e-27   
ref|XP_006344515.1|  PREDICTED: MATE efflux family protein 5-like       117   9e-27   
gb|EEC80663.1|  hypothetical protein OsI_23068                          116   9e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001052573.2|  Os04g0373400                                       114   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AFW75831.1|  putative MATE efflux family protein                     115   1e-26   
gb|EEE65758.1|  hypothetical protein OsJ_21427                          115   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004299022.1|  PREDICTED: MATE efflux family protein 9-like       115   1e-26   
ref|XP_006359543.1|  PREDICTED: MATE efflux family protein 6-like       115   1e-26   
ref|XP_006656469.1|  PREDICTED: MATE efflux family protein 5-like...    115   1e-26   
ref|XP_010528510.1|  PREDICTED: MATE efflux family protein 5-like...    115   2e-26   
gb|AAM61608.1|  putative integral membrane protein                      115   2e-26   
gb|EMT22358.1|  Protein TRANSPARENT TESTA 12                            117   2e-26   
ref|NP_001168616.1|  putative MATE efflux family protein                115   2e-26   
gb|EAZ02302.1|  hypothetical protein OsI_24403                          115   2e-26   
ref|NP_001058524.2|  Os06g0707100                                       115   2e-26   
ref|XP_007152703.1|  hypothetical protein PHAVU_004G152200g             112   2e-26   
ref|XP_007152705.1|  hypothetical protein PHAVU_004G152400g             114   2e-26   
ref|XP_011038708.1|  PREDICTED: MATE efflux family protein 9-like...    114   3e-26   
ref|NP_001057687.1|  Os06g0494400                                       114   3e-26   
ref|XP_008459602.1|  PREDICTED: MATE efflux family protein 5-like...    114   3e-26   
gb|EAY78110.1|  hypothetical protein OsI_33157                          114   3e-26   
gb|ACN30994.1|  unknown                                                 112   3e-26   
ref|NP_001064394.1|  Os10g0345100                                       114   3e-26   
ref|XP_010279441.1|  PREDICTED: MATE efflux family protein 6-like       115   3e-26   
gb|AAK92642.1|AC079634_3  Putative transmembrane protein                114   3e-26   
gb|EEC66772.1|  hypothetical protein OsI_33158                          114   4e-26   
ref|XP_006476883.1|  PREDICTED: MATE efflux family protein 5-like       114   4e-26   
ref|XP_009595541.1|  PREDICTED: MATE efflux family protein 5-like       114   4e-26   
ref|XP_004983268.1|  PREDICTED: MATE efflux family protein 5-like       114   4e-26   
ref|NP_001064393.1|  Os10g0344900                                       114   4e-26   
gb|EAZ30429.1|  hypothetical protein OsJ_14480                          114   5e-26   
ref|XP_004965371.1|  PREDICTED: MATE efflux family protein 5-like       114   5e-26   
dbj|BAH01693.1|  unnamed protein product                                114   6e-26   
ref|XP_008453464.1|  PREDICTED: MATE efflux family protein 5-like       114   6e-26   
emb|CAD40572.2|  OSJNBa0069D17.7                                        114   6e-26   
ref|XP_011038712.1|  PREDICTED: MATE efflux family protein 9-like       114   6e-26   
ref|XP_010528509.1|  PREDICTED: MATE efflux family protein 5-like...    114   7e-26   
gb|KDO69489.1|  hypothetical protein CISIN_1g012113mg                   113   7e-26   
ref|XP_002439626.1|  hypothetical protein SORBIDRAFT_09g017210          113   7e-26   
gb|KDP43815.1|  hypothetical protein JCGZ_23023                         113   1e-25   
ref|XP_002314825.2|  MATE efflux family protein                         113   1e-25   
ref|XP_008667050.1|  PREDICTED: putative MATE efflux family prote...    112   1e-25   
gb|AFW77709.1|  putative MATE efflux family protein                     112   1e-25   
ref|NP_001130588.1|  putative MATE efflux family protein                112   2e-25   
gb|EMS66209.1|  MATE efflux family protein 5                            112   2e-25   
ref|XP_010540007.1|  PREDICTED: MATE efflux family protein 5-like...    112   2e-25   
ref|XP_011021312.1|  PREDICTED: MATE efflux family protein 6-like...    112   2e-25   
ref|XP_008229282.1|  PREDICTED: MATE efflux family protein 5            112   2e-25   
ref|XP_010228783.1|  PREDICTED: MATE efflux family protein 5-like...    112   2e-25   
ref|XP_002438367.1|  hypothetical protein SORBIDRAFT_10g014190          112   2e-25   
ref|XP_006388325.1|  hypothetical protein POPTR_0229s00260g             111   2e-25   
ref|XP_003558208.1|  PREDICTED: MATE efflux family protein 5-like...    112   3e-25   
ref|XP_006656105.1|  PREDICTED: MATE efflux family protein 5-like       112   3e-25   
ref|XP_006478384.1|  PREDICTED: MATE efflux family protein 5-like...    111   3e-25   
ref|XP_001761413.1|  predicted protein                                  111   3e-25   
ref|XP_006478383.1|  PREDICTED: MATE efflux family protein 5-like...    111   3e-25   
gb|EMT22359.1|  Protein TRANSPARENT TESTA 12                            111   3e-25   
ref|XP_002979590.1|  hypothetical protein SELMODRAFT_271390             112   3e-25   
ref|XP_011021309.1|  PREDICTED: MATE efflux family protein 5-like...    111   4e-25   
ref|XP_011021310.1|  PREDICTED: MATE efflux family protein 9-like...    111   4e-25   
ref|XP_004975221.1|  PREDICTED: MATE efflux family protein 5-like       111   5e-25   
ref|XP_007019868.1|  MATE efflux family protein, putative               111   5e-25   
ref|XP_004234578.1|  PREDICTED: MATE efflux family protein 9-like       111   5e-25   
ref|XP_002446251.1|  hypothetical protein SORBIDRAFT_06g010096          110   6e-25   
ref|NP_001140720.1|  uncharacterized protein LOC100272795               110   6e-25   
ref|XP_011075977.1|  PREDICTED: MATE efflux family protein 5-like       110   6e-25   
ref|XP_002458328.1|  hypothetical protein SORBIDRAFT_03g031420          111   6e-25   
ref|XP_006589653.1|  PREDICTED: MATE efflux family protein 5-like       110   7e-25   
dbj|BAK07287.1|  predicted protein                                      110   7e-25   
ref|XP_004503307.1|  PREDICTED: MATE efflux family protein 7-like       110   7e-25   
ref|XP_008647509.1|  PREDICTED: uncharacterized protein LOC100272...    111   7e-25   
gb|KEH24742.1|  MATE efflux family protein                              109   7e-25   
ref|XP_004497005.1|  PREDICTED: MATE efflux family protein 5-like...    110   8e-25   
gb|KDP43817.1|  hypothetical protein JCGZ_23025                         110   8e-25   
ref|XP_007142994.1|  hypothetical protein PHAVU_007G034700g             110   8e-25   
gb|KDP34997.1|  hypothetical protein JCGZ_09285                         109   8e-25   
gb|EMS53951.1|  MATE efflux family protein 5                            110   9e-25   
ref|XP_006383383.1|  hypothetical protein POPTR_0005s15060g             110   9e-25   
gb|KEH26965.1|  MATE efflux family protein                              110   9e-25   
ref|XP_010533239.1|  PREDICTED: MATE efflux family protein 5            110   1e-24   
gb|AFK43870.1|  unknown                                                 110   1e-24   
gb|AFW77710.1|  putative MATE efflux family protein                     111   1e-24   
ref|XP_009615046.1|  PREDICTED: MATE efflux family protein 5-like...    109   1e-24   
ref|XP_008219099.1|  PREDICTED: MATE efflux family protein 7-like       110   1e-24   
ref|XP_010471121.1|  PREDICTED: MATE efflux family protein 5-like...    110   1e-24   
ref|XP_003592589.1|  Protein TRANSPARENT TESTA                          110   1e-24   
ref|XP_011035132.1|  PREDICTED: MATE efflux family protein 5-like       110   1e-24   
ref|XP_008226552.1|  PREDICTED: MATE efflux family protein LAL5-like    107   1e-24   
ref|XP_010524348.1|  PREDICTED: MATE efflux family protein 6-like       110   1e-24   
ref|XP_007152702.1|  hypothetical protein PHAVU_004G152100g             110   1e-24   
gb|KEH24741.1|  MATE efflux family protein                              109   1e-24   
ref|XP_010471119.1|  PREDICTED: MATE efflux family protein 5-like...    110   1e-24   
gb|EPS72049.1|  hypothetical protein M569_02707                         110   1e-24   
emb|CDY50254.1|  BnaC07g47890D                                          110   2e-24   
ref|XP_011039093.1|  PREDICTED: MATE efflux family protein 5 isof...    109   2e-24   
ref|XP_009587574.1|  PREDICTED: MATE efflux family protein 9-like       109   2e-24   
ref|XP_011021313.1|  PREDICTED: MATE efflux family protein 5-like...    109   2e-24   
gb|KDO64766.1|  hypothetical protein CISIN_1g011296mg                   108   2e-24   
ref|XP_006396140.1|  hypothetical protein EUTSA_v10003032mg             109   2e-24   
emb|CDP00709.1|  unnamed protein product                                109   2e-24   
ref|XP_006388640.1|  aberrant lateral root formation 1 family pro...    109   2e-24   
gb|KDO64765.1|  hypothetical protein CISIN_1g011296mg                   108   2e-24   
ref|XP_011029503.1|  PREDICTED: MATE efflux family protein ALF5-like    109   2e-24   
ref|XP_003533349.1|  PREDICTED: MATE efflux family protein 5-like       109   2e-24   
ref|XP_006388323.1|  hypothetical protein POPTR_0229s00240g             109   2e-24   
ref|XP_009615041.1|  PREDICTED: MATE efflux family protein 5-like...    109   2e-24   
gb|ACU21263.1|  unknown                                                 107   2e-24   
ref|XP_006469099.1|  PREDICTED: MATE efflux family protein 7-like       104   2e-24   
ref|XP_002526209.1|  TRANSPARENT TESTA 12 protein, putative             109   2e-24   
gb|KEH24740.1|  MATE efflux family protein                              109   3e-24   
ref|NP_177270.1|  MATE efflux family protein                            109   3e-24   
ref|XP_008245933.1|  PREDICTED: MATE efflux family protein LAL5-like    106   3e-24   
ref|XP_006494150.1|  PREDICTED: MATE efflux family protein 8-like       109   3e-24   
ref|XP_011021311.1|  PREDICTED: MATE efflux family protein 6-like...    108   3e-24   
emb|CDY50255.1|  BnaC07g47900D                                          106   3e-24   
ref|XP_006656985.1|  PREDICTED: MATE efflux family protein 9-like       108   3e-24   
gb|KEH26961.1|  MATE efflux family protein                              108   3e-24   
ref|XP_006302179.1|  hypothetical protein CARUB_v10020189mg             108   3e-24   
ref|XP_006579797.1|  PREDICTED: MATE efflux family protein 8-like       108   4e-24   
ref|XP_002986946.1|  hypothetical protein SELMODRAFT_269189             108   4e-24   
ref|XP_002977920.1|  hypothetical protein SELMODRAFT_268118             108   4e-24   
ref|XP_004141549.1|  PREDICTED: MATE efflux family protein DTX1-like    108   4e-24   
ref|XP_006448327.1|  hypothetical protein CICLE_v10015035mg             108   5e-24   
gb|AFW70883.1|  putative MATE efflux family protein                     108   5e-24   
ref|XP_004236983.1|  PREDICTED: MATE efflux family protein 5            108   5e-24   
ref|XP_006468795.1|  PREDICTED: MATE efflux family protein 5-like...    108   5e-24   
gb|KDO64764.1|  hypothetical protein CISIN_1g011296mg                   108   5e-24   
ref|XP_007142996.1|  hypothetical protein PHAVU_007G034900g             108   5e-24   
emb|CBI17778.3|  unnamed protein product                                107   5e-24   
ref|XP_006468794.1|  PREDICTED: MATE efflux family protein 5-like...    108   6e-24   
ref|XP_003567622.1|  PREDICTED: MATE efflux family protein 5-like...    108   6e-24   
ref|XP_009102405.1|  PREDICTED: MATE efflux family protein 9            108   6e-24   
gb|KDO64763.1|  hypothetical protein CISIN_1g011296mg                   108   6e-24   
ref|XP_010528507.1|  PREDICTED: MATE efflux family protein 5-like       108   6e-24   
gb|KFK41541.1|  hypothetical protein AALP_AA2G142500                    106   6e-24   
ref|XP_004232019.2|  PREDICTED: MATE efflux family protein DTX1-like    108   7e-24   
ref|XP_006448326.1|  hypothetical protein CICLE_v10015035mg             108   7e-24   
ref|XP_007213079.1|  hypothetical protein PRUPE_ppa021200mg             106   7e-24   
ref|XP_006575816.1|  PREDICTED: MATE efflux family protein 8-like       105   8e-24   
ref|XP_009606969.1|  PREDICTED: MATE efflux family protein 5-like       107   8e-24   
ref|XP_009764428.1|  PREDICTED: MATE efflux family protein 5-like...    107   8e-24   
ref|XP_006377765.1|  hypothetical protein POPTR_0011s11810g             107   8e-24   
ref|XP_004952273.1|  PREDICTED: MATE efflux family protein 6-like       108   9e-24   
gb|ACF85580.1|  unknown                                                 107   9e-24   
ref|XP_003631059.1|  Protein TRANSPARENT TESTA                          107   9e-24   
ref|XP_004156207.1|  PREDICTED: MATE efflux family protein 9-like       107   1e-23   
ref|XP_006360428.1|  PREDICTED: MATE efflux family protein 5-like       107   1e-23   
ref|XP_009606973.1|  PREDICTED: MATE efflux family protein 7-like       107   1e-23   
ref|XP_010415213.1|  PREDICTED: MATE efflux family protein 5-like...    107   1e-23   
gb|EMS57354.1|  MATE efflux family protein 5                            107   1e-23   
ref|XP_009776773.1|  PREDICTED: MATE efflux family protein 7-like       107   1e-23   
ref|XP_006377766.1|  hypothetical protein POPTR_0011s11810g             107   1e-23   
gb|AAK97692.1|  At1g66760/F4N21_11                                      105   1e-23   
gb|KEH24739.1|  MATE efflux family protein                              107   1e-23   
ref|XP_006280378.1|  hypothetical protein CARUB_v10026306mg             107   1e-23   
ref|XP_010427944.1|  PREDICTED: MATE efflux family protein 5-like       107   2e-23   
ref|NP_001057690.1|  Os06g0495500                                       107   2e-23   
gb|AAV64225.1|  putative integral membrane protein                      107   2e-23   
ref|XP_010470550.1|  PREDICTED: MATE efflux family protein 9-like       107   2e-23   
ref|NP_001151657.1|  transparent testa 12 protein                       107   2e-23   
ref|NP_001151913.1|  LOC100285550                                       107   2e-23   
ref|XP_010415810.1|  PREDICTED: MATE efflux family protein 5-like...    107   2e-23   
ref|XP_010252262.1|  PREDICTED: MATE efflux family protein 6-like...    106   2e-23   
ref|XP_004966381.1|  PREDICTED: MATE efflux family protein 5-like...    106   2e-23   
ref|XP_009606971.1|  PREDICTED: MATE efflux family protein 5-like...    106   2e-23   
ref|XP_007152704.1|  hypothetical protein PHAVU_004G152300g             108   2e-23   
ref|XP_009776776.1|  PREDICTED: MATE efflux family protein 5-like       106   2e-23   
ref|XP_010427940.1|  PREDICTED: MATE efflux family protein 5-like...    106   2e-23   
ref|XP_002445206.1|  hypothetical protein SORBIDRAFT_07g005910          106   2e-23   
ref|XP_007150880.1|  hypothetical protein PHAVU_004G001900g             106   2e-23   
ref|XP_004966380.1|  PREDICTED: MATE efflux family protein 5-like...    106   2e-23   
ref|XP_003533346.2|  PREDICTED: MATE efflux family protein 9-like       106   3e-23   
ref|XP_004966379.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|XP_010496346.1|  PREDICTED: MATE efflux family protein 9-like       106   3e-23   
ref|XP_006420481.1|  hypothetical protein CICLE_v10006804mg             105   3e-23   
ref|XP_004966378.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|XP_010427939.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|XP_009776775.1|  PREDICTED: MATE efflux family protein 5-like...    105   3e-23   
ref|XP_006383381.1|  hypothetical protein POPTR_0005s15040g             106   3e-23   
emb|CAQ51477.1|  putative MATE transporter                              106   3e-23   
ref|XP_006357808.1|  PREDICTED: MATE efflux family protein 9-like       106   3e-23   
ref|NP_001170114.1|  uncharacterized protein LOC100384035               106   3e-23   
ref|XP_009606970.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|NP_001043893.1|  Os01g0684900                                       106   3e-23   
ref|XP_002887351.1|  predicted protein                                  106   3e-23   
ref|XP_009356186.1|  PREDICTED: MATE efflux family protein 9-like       106   3e-23   
ref|XP_009776774.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|XP_010415211.1|  PREDICTED: MATE efflux family protein 5-like...    106   3e-23   
ref|XP_006661705.1|  PREDICTED: MATE efflux family protein 5-like       105   3e-23   
gb|EYU40798.1|  hypothetical protein MIMGU_mgv1a018157mg                105   4e-23   
ref|XP_002280189.2|  PREDICTED: MATE efflux family protein 5            106   4e-23   
ref|XP_003555117.1|  PREDICTED: MATE efflux family protein 5            106   4e-23   
gb|KCW64644.1|  hypothetical protein EUGRSUZ_G02226                     105   4e-23   
ref|XP_002975966.1|  hypothetical protein SELMODRAFT_416160             105   4e-23   
ref|XP_002305842.2|  hypothetical protein POPTR_0004s09390g             105   4e-23   
ref|XP_009796825.1|  PREDICTED: MATE efflux family protein 9-like       105   4e-23   
gb|EYU44956.1|  hypothetical protein MIMGU_mgv1a021048mg                105   4e-23   
ref|XP_011097156.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    105   4e-23   
ref|XP_004232020.1|  PREDICTED: MATE efflux family protein 5-like       105   5e-23   
ref|XP_010471123.1|  PREDICTED: MATE efflux family protein 5-like       105   5e-23   
gb|AAK91328.2|AC090441_10  Putative integral membrane protein           104   5e-23   
ref|XP_007213547.1|  hypothetical protein PRUPE_ppa018119mg             105   5e-23   
ref|XP_002976158.1|  hypothetical protein SELMODRAFT_175403             105   5e-23   
gb|AAV64187.1|  putative integral membrane protein                      108   5e-23   
ref|XP_009102409.1|  PREDICTED: MATE efflux family protein DTX1         105   5e-23   
gb|EAY78108.1|  hypothetical protein OsI_33154                          105   5e-23   
ref|XP_008389239.1|  PREDICTED: MATE efflux family protein 5-like...    105   5e-23   
ref|XP_006357807.1|  PREDICTED: MATE efflux family protein 5-like       105   6e-23   
ref|XP_002968221.1|  hypothetical protein SELMODRAFT_270709             105   6e-23   
emb|CDP00711.1|  unnamed protein product                                105   6e-23   
ref|XP_004489193.1|  PREDICTED: MATE efflux family protein 9-like       105   6e-23   
gb|EAZ15736.1|  hypothetical protein OsJ_31155                          105   6e-23   
gb|KFK41799.1|  hypothetical protein AALP_AA2G173600                    104   6e-23   
ref|NP_564883.2|  MATE efflux family protein                            105   7e-23   
ref|XP_008389238.1|  PREDICTED: MATE efflux family protein 5-like...    105   7e-23   
gb|EYU41307.1|  hypothetical protein MIMGU_mgv1a021573mg                105   7e-23   
dbj|BAB71817.1|  hypothetical membrane protein-1                        105   8e-23   
gb|KFK41800.1|  hypothetical protein AALP_AA2G173600                    104   8e-23   
gb|KHG14317.1|  MATE efflux family protein LAL5                         105   9e-23   
gb|AAK25964.1|AF360254_1  putative MATE efflux family protein           105   9e-23   
ref|XP_007033147.1|  MATE efflux family protein, putative               105   9e-23   
ref|XP_006299203.1|  hypothetical protein CARUB_v10015349mg             105   9e-23   
gb|KHN00184.1|  MATE efflux family protein DTX1                         104   9e-23   
emb|CDM83923.1|  unnamed protein product                                105   9e-23   
ref|NP_849854.1|  MATE efflux family protein                            105   1e-22   
ref|XP_006589654.1|  PREDICTED: MATE efflux family protein 5-like...    104   1e-22   
gb|KHN06722.1|  MATE efflux family protein 5                            104   1e-22   
ref|NP_178492.1|  MATE efflux family protein                            104   1e-22   
gb|EEE50792.1|  hypothetical protein OsJ_31157                          105   1e-22   
gb|EMT22451.1|  Protein TRANSPARENT TESTA 12                            106   1e-22   
ref|XP_010684784.1|  PREDICTED: MATE efflux family protein LAL5-like    105   1e-22   



>ref|XP_009799148.1| PREDICTED: MATE efflux family protein 6-like [Nicotiana sylvestris]
Length=481

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            ER+ ++E PLI +S N+E   +RKC DE   EVKKL+ LAGPL+SVNLLL  LQ IS+MF
Sbjct  5    EREIDLECPLISKSRNEESKSKRKC-DEFFEEVKKLLGLAGPLMSVNLLLYCLQVISVMF  63

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LSGASMAT+FA+VTGFS + G+  ALDT+CGQ+YGAKQY MLGI  QR + 
Sbjct  64   VGHLG-ELALSGASMATSFATVTGFSLLMGMGSALDTICGQAYGAKQYHMLGIHMQRAMI  122

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+LLV +P+  +WA    I+
Sbjct  123  VLLLVSVPLAYIWANARHIL  142



>ref|XP_009618983.1| PREDICTED: MATE efflux family protein 6-like [Nicotiana tomentosiformis]
Length=481

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            ER+ ++E  LI +S N+E   +RKC DE   EVKKL+ LAGPL+SVNLLL  LQ IS+MF
Sbjct  5    EREIDIECALISKSRNEESKNKRKC-DEFFEEVKKLLGLAGPLMSVNLLLYCLQVISVMF  63

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LSGASMAT+FA+VTGFS + G+  ALDT+CGQSYGAKQY MLGI+ QR + 
Sbjct  64   IGHLG-ELALSGASMATSFATVTGFSLLMGMGSALDTICGQSYGAKQYHMLGIYMQRAMI  122

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+LLV IP+  +WA    I+
Sbjct  123  VLLLVSIPLAYIWANAGHIL  142



>ref|XP_009618984.1| PREDICTED: MATE efflux family protein 6-like [Nicotiana tomentosiformis]
Length=477

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = -3

Query  577  EMEIPLILESENDE--RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             +E PLI+E+E +E  +R+  DE+  EVKKL+VLAGPL+SVN  L +LQ IS+MF G+ G
Sbjct  5    NLEWPLIVETEKEECKKRRRSDEIFAEVKKLLVLAGPLMSVNFSLFALQVISVMFVGHLG  64

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL+LSGASMAT+FASVTG S + G+A ALDTLCGQSYGAKQY +LGI  QR + V+LLV
Sbjct  65   -ELALSGASMATSFASVTGLSLLMGMANALDTLCGQSYGAKQYYILGIHMQRAMFVLLLV  123

Query  223  CIPVTGVWAYTDRII  179
             +P+T +WA  + I+
Sbjct  124  SVPLTFIWANAEHIL  138



>gb|AHI48499.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=477

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 6/140 (4%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            MER  E + PLI + E   R    DE+  EVKKL+ LAGP++SVNLLL  LQ IS+MF G
Sbjct  1    MER-GEQKQPLISKGEVTNR----DEILNEVKKLLCLAGPIVSVNLLLCFLQMISVMFVG  55

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GASMAT+FASVTGFS M G+  ALDT CGQSYGAKQY MLGI  QR + V+
Sbjct  56   HLG-ELPLAGASMATSFASVTGFSLMIGMGSALDTFCGQSYGAKQYHMLGIHMQRAMFVL  114

Query  232  LLVCIPVTGVWAYTDRIIGF  173
            LL CIP++ +WA T +I+ F
Sbjct  115  LLCCIPLSCIWANTAQILLF  134



>emb|CDP02949.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 105/148 (71%), Gaps = 6/148 (4%)
 Frame = -3

Query  604  DQKRMER-KAEMEIPLIL---ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQ  437
            D +R ER   ++E PLI    ESE   +RK WD V  EVKK + LAGPL++VNLL+  LQ
Sbjct  533  DMEREERAHQDLECPLIHYSQESEFQSKRK-WDNVKIEVKKQLALAGPLMTVNLLINCLQ  591

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL+LSGA+MAT+FASVTGFS ++G+A ALDT CGQSYGAKQY MLGI 
Sbjct  592  VISVMFVGHLG-ELALSGATMATSFASVTGFSLLQGMASALDTFCGQSYGAKQYHMLGIH  650

Query  256  TQRGIPVILLVCIPVTGVWAYTDRIIGF  173
             QR + V+LL   P+  +WA    I+ F
Sbjct  651  QQRAMLVLLLAACPLACIWANAGHILKF  678


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LSGASMATAF SVTGFS + G+  ALDT CGQSYGAKQY MLGI  
Sbjct  2    ISIMFVGHLG-ELALSGASMATAFTSVTGFSLLTGMGSALDTFCGQSYGAKQYHMLGIHL  60

Query  253  QRGIPVILLVCIPVTGVWAYTDRIIGF  173
            Q  + V+LLV  P+  +W+    I+ F
Sbjct  61   QGAMAVLLLVTFPLAYIWSNAGCILRF  87



>ref|XP_006367023.1| PREDICTED: MATE efflux family protein 9-like [Solanum tuberosum]
Length=477

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = -3

Query  577  EMEIPLILESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNR  407
            ++E PLI +S N+E   +RKC D+   EVKK++ LAGPL+SVN LL  LQ IS+MF G+ 
Sbjct  5    DIECPLISKSRNEESKNKRKC-DDFLEEVKKILALAGPLMSVNFLLYCLQVISVMFVGHL  63

Query  406  GGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILL  227
            G EL+LSGASMAT+FA+VTGFS + G+  ALDT+CGQ+YGAKQY MLGI  QR + V+LL
Sbjct  64   G-ELALSGASMATSFATVTGFSLLMGMGSALDTICGQAYGAKQYHMLGIHMQRAMIVLLL  122

Query  226  VCIPVTGVWAYTDRII  179
            V IP+  +WA    I+
Sbjct  123  VSIPLAFIWANAGHIL  138



>ref|XP_002270905.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Vitis 
vinifera]
Length=489

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 5/144 (3%)
 Frame = -3

Query  595  RMERKAEMEIPLILESEN----DERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            R + K+ +E PLI  S+        R   +E+ GEVKK + LAGPL+SVNLL+ SLQ IS
Sbjct  3    REDHKSCLESPLIQVSQEALPGSRNRAKREEILGEVKKQLKLAGPLMSVNLLICSLQMIS  62

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            LMF G+ G EL+LSGASMAT+FASVTGFS + G+  ALDT CGQS+GAKQY MLGI  QR
Sbjct  63   LMFVGHLG-ELALSGASMATSFASVTGFSLLLGMGSALDTFCGQSFGAKQYHMLGIHKQR  121

Query  247  GIPVILLVCIPVTGVWAYTDRIIG  176
             + V+LLV IPV  +W+ T  I+ 
Sbjct  122  AMVVLLLVSIPVAFIWSNTGYILA  145



>emb|CBI17785.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 100/142 (70%), Gaps = 9/142 (6%)
 Frame = -3

Query  586  RKAEMEIPLILE-----SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            RK  +E PLI +     S N  +R   +E+ GEVKK + LAGPL+SVNLLL SLQ IS+M
Sbjct  9    RKPSLESPLISQEAVSVSRNGAKR---EEILGEVKKQLKLAGPLVSVNLLLYSLQVISVM  65

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G EL+LSGA MAT+FASVTGFS M G+  ALDT CGQS+GAKQY MLG+  QR +
Sbjct  66   FVGHLG-ELALSGACMATSFASVTGFSLMVGMGSALDTFCGQSFGAKQYHMLGVHKQRAM  124

Query  241  PVILLVCIPVTGVWAYTDRIIG  176
             V+LLV IPV  +W  T  I+ 
Sbjct  125  VVLLLVSIPVAFIWNNTGHILA  146



>ref|XP_009799149.1| PREDICTED: MATE efflux family protein 6-like [Nicotiana sylvestris]
Length=477

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  577  EMEIPLILESENDE--RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             +E PLI+E+  +E  +R+  DE+  EVKKL+VLAGPL+SVN  L +LQ IS+MF G+ G
Sbjct  5    NLECPLIVETVKEECKKRRRNDEILVEVKKLLVLAGPLMSVNFSLFALQVISVMFVGHLG  64

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL+LSGASMAT+FASVTG S + G+A ALDTLCGQSYGAKQY MLGI  QR + V+LL 
Sbjct  65   -ELALSGASMATSFASVTGLSLLMGMANALDTLCGQSYGAKQYHMLGIHMQRAMFVLLLA  123

Query  223  CIPVTGVWAYTDRII  179
             +P+  +W+  + I+
Sbjct  124  SVPLACIWSNAEHIL  138



>ref|XP_002276239.2| PREDICTED: MATE efflux family protein 6-like [Vitis vinifera]
 ref|XP_010656816.1| PREDICTED: MATE efflux family protein 6-like [Vitis vinifera]
Length=489

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 101/143 (71%), Gaps = 9/143 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILE-----SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            ++K  +E PLI +     S N  +R   +E+ GEVKK + LAGPL+SVNLLL SLQ IS+
Sbjct  5    DQKPSLESPLISQEAVSVSRNGAKR---EEILGEVKKQLKLAGPLVSVNLLLYSLQVISV  61

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL+LSGA MAT+FASVTGFS M G+  ALDT CGQS+GAKQY MLG+  QR 
Sbjct  62   MFVGHLG-ELALSGACMATSFASVTGFSLMVGMGSALDTFCGQSFGAKQYHMLGVHKQRA  120

Query  244  IPVILLVCIPVTGVWAYTDRIIG  176
            + V+LLV IPV  +W  T  I+ 
Sbjct  121  MVVLLLVSIPVAFIWNNTGHILA  143



>emb|CDP02950.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 109/152 (72%), Gaps = 8/152 (5%)
 Frame = -3

Query  616  RIWQDQKRMERKAEMEIPLILESEND--ERRKCW--DEVSGEVKKLMVLAGPLISVNLLL  449
            ++  D ++M    ++E PLI +S+    E +  +  D++  E KK + LAGPL+ VNLLL
Sbjct  117  KVMDDDQQMP---DLETPLISDSQEKGIELKGLFSKDDILAEAKKQLWLAGPLMFVNLLL  173

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
            T +Q IS+MF G+ G EL+LSGASMAT+FASVTGFS + GL GALDT CGQ+YGAKQY M
Sbjct  174  TLIQTISVMFVGHVG-ELALSGASMATSFASVTGFSLLIGLCGALDTFCGQAYGAKQYHM  232

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            +GI TQR + V+LLVCIP+  +WA T  I+ F
Sbjct  233  VGIHTQRAMFVLLLVCIPLACLWANTGHILAF  264



>ref|XP_009799150.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Nicotiana 
sylvestris]
Length=484

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 6/137 (4%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ER+ ++E PLI ES+N  RR   +E+  EVKKL+VLAGPL+SVN LL  LQ IS+MF G+
Sbjct  5    ERELDLESPLITESKN--RR---NEILVEVKKLLVLAGPLMSVNFLLYCLQVISIMFVGH  59

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL+LSGASMAT+FASVTG S + G+  ALDTLCGQSYGA QY MLGI  QR + V+L
Sbjct  60   LG-ELALSGASMATSFASVTGLSLLMGMGSALDTLCGQSYGAMQYHMLGIHMQRAMLVLL  118

Query  229  LVCIPVTGVWAYTDRII  179
            L  +P+  +WA    I+
Sbjct  119  LASVPLACIWANAGYIL  135



>ref|XP_008811783.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=501

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 7/144 (5%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            ++ ME K  +E PL+L SE     K   EV  EVKK + LAGPLI+ NLL  SLQ IS+M
Sbjct  23   EEEME-KPSVESPLLLSSE-----KGGGEVLAEVKKQLWLAGPLIATNLLQKSLQMISVM  76

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G EL+LSGASMAT+FA VTGFS + G++ ALDTLCGQ++GAK Y+MLGI  QR +
Sbjct  77   FVGHLG-ELALSGASMATSFAGVTGFSLLLGMSSALDTLCGQAFGAKSYRMLGIHMQRAM  135

Query  241  PVILLVCIPVTGVWAYTDRIIGFC  170
             V++LV IP+  VWAYT +I+  C
Sbjct  136  LVLMLVSIPLAAVWAYTGQILMLC  159



>emb|CDP02838.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLILESENDERRKC-WDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            D+K +     +E PL+  S   +       +   EVKKL+ LAGPLI VN L+ +LQ I+
Sbjct  2    DEKNISHG--LECPLVPVSSGVQGSSTKHSDFLAEVKKLLALAGPLILVNFLIFALQVIA  59

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            LMF G+ G EL+LSGAS+AT+FASVTGFS   G++GALDT CGQSYGAK Y+MLGI  QR
Sbjct  60   LMFVGHLG-ELALSGASLATSFASVTGFSLFNGMSGALDTFCGQSYGAKHYRMLGIHMQR  118

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+LL CIP+T +WA T RI+ F
Sbjct  119  AMVVLLLTCIPLTCIWANTGRILAF  143



>ref|XP_006490714.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Citrus 
sinensis]
Length=504

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 110/148 (74%), Gaps = 6/148 (4%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLI-LESE--NDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTS  443
            ++ +R E+K+ +  PLI + SE  N+  + C ++  +  EVK+ + L+GPLISV+LL   
Sbjct  13   KNMEREEQKSTLNSPLIQISSEEINNNHQTCSEKKKIIEEVKRQLWLSGPLISVSLLQFC  72

Query  442  LQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLG  263
            LQ IS+MF G+ G EL LSGASMAT+FA+VTGFSF+ GL+ AL+TLCGQSYGAKQY MLG
Sbjct  73   LQMISVMFVGHLG-ELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLG  131

Query  262  IFTQRGIPVILLVCIPVTGVWAYTDRII  179
            I  QRG+ V+LL+ +P+  +WA T+ ++
Sbjct  132  IHMQRGMFVLLLISVPLALIWANTESLL  159



>gb|EYU40237.1| hypothetical protein MIMGU_mgv1a005368mg [Erythranthe guttata]
Length=487

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 8/144 (6%)
 Frame = -3

Query  592  MERKAEMEI------PLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            MER  E +       PLI E+  D+     + +  E++K + LAGPLI+V+LL   LQ I
Sbjct  1    MERGEEEDASCVSRRPLI-ENITDKNNDSKETILAELRKQLWLAGPLITVSLLQFCLQLI  59

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+MF G+ G ELSLSGASMAT+FASVTGFS M G+A ALDTLCGQSYGAKQY MLGI  Q
Sbjct  60   SVMFVGHLG-ELSLSGASMATSFASVTGFSLMMGMASALDTLCGQSYGAKQYHMLGIHMQ  118

Query  250  RGIPVILLVCIPVTGVWAYTDRII  179
            R + V+LLVCIP+  VWA T  I+
Sbjct  119  RAMLVLLLVCIPLAIVWANTAPIL  142



>ref|XP_002276463.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=489

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 101/143 (71%), Gaps = 9/143 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILE-----SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            ++K  +E PLI +     S N  +R   +E+ GEVKK + LAGPL+SVN+LL SLQ IS+
Sbjct  5    DQKPSLESPLISQEAVSHSRNGAKR---EEILGEVKKQLKLAGPLMSVNVLLYSLQAISV  61

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL+LSGASMAT+FASVTG S + G+  ALDT CGQS+GAKQY MLG+  QR 
Sbjct  62   MFVGHLG-ELALSGASMATSFASVTGLSLIVGMGSALDTFCGQSFGAKQYHMLGVHKQRA  120

Query  244  IPVILLVCIPVTGVWAYTDRIIG  176
            + V+LLV IPV  +W  T  I+ 
Sbjct  121  MVVLLLVSIPVAFIWNNTGHILA  143



>gb|KDO62840.1| hypothetical protein CISIN_1g010345mg [Citrus sinensis]
Length=452

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = -3

Query  598  KRMERKAEMEIPLI-LESE--NDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +R E+K+ +  PLI + SE  N+  + C ++  +  EVK+ + L+GPLISV+LL   LQ 
Sbjct  2    EREEQKSTLNSPLIQISSEEINNNHQTCSEKKKIIEEVKRQLWLSGPLISVSLLQFCLQM  61

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL LSGASMAT+FA+VTGFSF+ GL+ AL+TLCGQSYGAKQY MLGI  
Sbjct  62   ISVMFVGHLG-ELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHM  120

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QRG+ V+LL+ +P+  +WA T+ ++
Sbjct  121  QRGMFVLLLISVPLALIWANTESLL  145



>ref|XP_002270870.2| PREDICTED: MATE efflux family protein 5-like isoform X1 [Vitis 
vinifera]
 ref|XP_010656814.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Vitis 
vinifera]
Length=489

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 101/143 (71%), Gaps = 9/143 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILE-----SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            ++K  +E PLI +     S N  +R   +E+ GEVKK + +AGPL+ VN+LL SLQ IS+
Sbjct  5    DQKPSLESPLISQEAVSHSRNGAKR---EEILGEVKKQLKIAGPLMLVNVLLYSLQVISV  61

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL+LSGASMAT+FASVTGFS + G+  ALDT CGQS+GAKQY MLG+  QR 
Sbjct  62   MFVGHLG-ELALSGASMATSFASVTGFSLIVGMGSALDTFCGQSFGAKQYHMLGVHKQRA  120

Query  244  IPVILLVCIPVTGVWAYTDRIIG  176
            + V+LLV IPV  +W  T  I+ 
Sbjct  121  MVVLLLVSIPVAFIWNNTGHILA  143



>gb|KDO62838.1| hypothetical protein CISIN_1g010345mg [Citrus sinensis]
Length=490

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = -3

Query  598  KRMERKAEMEIPLI-LESE--NDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +R E+K+ +  PLI + SE  N+  + C ++  +  EVK+ + L+GPLISV+LL   LQ 
Sbjct  2    EREEQKSTLNSPLIQISSEEINNNHQTCSEKKKIIEEVKRQLWLSGPLISVSLLQFCLQM  61

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL LSGASMAT+FA+VTGFSF+ GL+ AL+TLCGQSYGAKQY MLGI  
Sbjct  62   ISVMFVGHLG-ELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHM  120

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QRG+ V+LL+ +P+  +WA T+ ++
Sbjct  121  QRGMFVLLLISVPLALIWANTESLL  145



>ref|XP_006451686.1| hypothetical protein CICLE_v10008114mg [Citrus clementina]
 ref|XP_006490715.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Citrus 
sinensis]
 gb|ESR64926.1| hypothetical protein CICLE_v10008114mg [Citrus clementina]
Length=490

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = -3

Query  598  KRMERKAEMEIPLI-LESE--NDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +R E+K+ +  PLI + SE  N+  + C ++  +  EVK+ + L+GPLISV+LL   LQ 
Sbjct  2    EREEQKSTLNSPLIQISSEEINNNHQTCSEKKKIIEEVKRQLWLSGPLISVSLLQFCLQM  61

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL LSGASMAT+FA+VTGFSF+ GL+ AL+TLCGQSYGAKQY MLGI  
Sbjct  62   ISVMFVGHLG-ELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHM  120

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QRG+ V+LL+ +P+  +WA T+ ++
Sbjct  121  QRGMFVLLLISVPLALIWANTESLL  145



>gb|KDO62839.1| hypothetical protein CISIN_1g010345mg [Citrus sinensis]
Length=512

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = -3

Query  598  KRMERKAEMEIPLI-LESE--NDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +R E+K+ +  PLI + SE  N+  + C ++  +  EVK+ + L+GPLISV+LL   LQ 
Sbjct  2    EREEQKSTLNSPLIQISSEEINNNHQTCSEKKKIIEEVKRQLWLSGPLISVSLLQFCLQM  61

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL LSGASMAT+FA+VTGFSF+ GL+ AL+TLCGQSYGAKQY MLGI  
Sbjct  62   ISVMFVGHLG-ELPLSGASMATSFATVTGFSFLVGLSSALETLCGQSYGAKQYHMLGIHM  120

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QRG+ V+LL+ +P+  +WA T+ ++
Sbjct  121  QRGMFVLLLISVPLALIWANTESLL  145



>ref|XP_010319286.1| PREDICTED: MATE efflux family protein 6 isoform X2 [Solanum lycopersicum]
Length=459

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 6/137 (4%)
 Frame = -3

Query  577  EMEIPLIL-ESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ++E PLI+ +S N+E    RKC D+   EVKK++ LAGPL+SVN LL  LQ IS+MF G+
Sbjct  5    DIECPLIIPKSRNEESKNERKC-DDFLEEVKKILALAGPLMSVNFLLYCLQVISVMFVGH  63

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL+LSGASMAT+FA+VTGFS + G+  ALDT+CGQ+YGAK+Y MLGI  QR + V+L
Sbjct  64   LG-ELALSGASMATSFATVTGFSLLMGMGSALDTICGQAYGAKRYHMLGIHMQRAMIVLL  122

Query  229  LVCIPVTGVWAYTDRII  179
             V IP+  +WA    I+
Sbjct  123  FVSIPLAFIWANAGHIL  139



>ref|XP_008223667.1| PREDICTED: MATE efflux family protein 7-like [Prunus mume]
Length=489

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = -3

Query  589  ERKAEMEIPLI-----LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            E+ A +E PL+     LES+  + R   DE+  EVKK + LAGPL+S N LL  +Q IS+
Sbjct  5    EQAAGLESPLLPAPQELESQATKGRLSKDEIIKEVKKQLSLAGPLVSSNFLLFGMQVISV  64

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            M+ G+ G EL+L+GASMAT+FASVTG S + G++ ALDT CGQSYGAKQY MLGI  QR 
Sbjct  65   MYVGHLG-ELALAGASMATSFASVTGLSLIIGMSSALDTFCGQSYGAKQYHMLGIHLQRA  123

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+LLVCIP++ +W     I+ F
Sbjct  124  MLVLLLVCIPLSIIWFNAGHILEF  147



>ref|XP_004236802.1| PREDICTED: MATE efflux family protein 6 isoform X1 [Solanum lycopersicum]
Length=478

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 6/137 (4%)
 Frame = -3

Query  577  EMEIPLIL-ESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ++E PLI+ +S N+E    RKC D+   EVKK++ LAGPL+SVN LL  LQ IS+MF G+
Sbjct  5    DIECPLIIPKSRNEESKNERKC-DDFLEEVKKILALAGPLMSVNFLLYCLQVISVMFVGH  63

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL+LSGASMAT+FA+VTGFS + G+  ALDT+CGQ+YGAK+Y MLGI  QR + V+L
Sbjct  64   LG-ELALSGASMATSFATVTGFSLLMGMGSALDTICGQAYGAKRYHMLGIHMQRAMIVLL  122

Query  229  LVCIPVTGVWAYTDRII  179
             V IP+  +WA    I+
Sbjct  123  FVSIPLAFIWANAGHIL  139



>ref|XP_002277527.1| PREDICTED: MATE efflux family protein 7 [Vitis vinifera]
Length=493

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 9/142 (6%)
 Frame = -3

Query  583  KAEMEIPLILESEND-----ERRKCW---DEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            K+ +E PLI + E       E  K W    EV GE+KK M LAGPL+ VN L  SLQ IS
Sbjct  7    KSFLESPLIPKDEKGLEFGGESPKRWIETSEVIGELKKQMKLAGPLVVVNFLQYSLQMIS  66

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G ELSLS ASMAT+FA VTGFS M G+  ALDT CGQ+YGA+QY MLG+  QR
Sbjct  67   IMFVGHLG-ELSLSSASMATSFAGVTGFSIMLGMGSALDTFCGQAYGAEQYHMLGVHMQR  125

Query  247  GIPVILLVCIPVTGVWAYTDRI  182
             + V++  CIP+  VWAYT +I
Sbjct  126  ALLVLMPTCIPIAFVWAYTGKI  147



>ref|XP_006366204.1| PREDICTED: MATE efflux family protein 6-like [Solanum tuberosum]
Length=473

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ERK ++E P    +   ER+  +DE+  +VKKL+VLAGPL+ VN+LL SLQ IS+MF G+
Sbjct  5    ERKEDLECP----NLGIERK--YDEIFVQVKKLLVLAGPLMLVNILLYSLQVISVMFVGH  58

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
            +G EL+LSGASMAT+FA VTGF  + G+  AL+TLCGQSYGA QY MLGI  QR + V L
Sbjct  59   QG-ELALSGASMATSFAFVTGFGLLMGMGSALETLCGQSYGANQYHMLGIHMQRAMFVNL  117

Query  229  LVCIPVTGVWAYTDRII  179
            LV IP+  +WA   RI+
Sbjct  118  LVSIPLACIWANAGRIL  134



>ref|XP_011010481.1| PREDICTED: MATE efflux family protein 6-like [Populus euphratica]
Length=487

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 10/164 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            E K  +++PLI      + R  +   E+  EVKK +VLAGPL++VN  +  LQ IS+MF 
Sbjct  5    EEKPSIDLPLISPETAIKSRNGFSKVEIVEEVKKQLVLAGPLVTVNFFIFLLQVISVMFV  64

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G EL+LSGASMAT+FASVTG S ++GLA ALDT CGQSYGAKQY MLGI  QR + V
Sbjct  65   GHLG-ELALSGASMATSFASVTGLSLLKGLASALDTYCGQSYGAKQYHMLGIHLQRAMIV  123

Query  235  ILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
            +LL  +P+  VWA    I+   VF++      P  S E G  AR
Sbjct  124  LLLASVPLAVVWANAGAIL---VFFKQD----PEISAEAGRYAR  160



>ref|XP_010048672.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Eucalyptus 
grandis]
Length=443

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 100/139 (72%), Gaps = 8/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ ++LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  33   DEIFSEMKQQLLLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  91

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  92   MLIGMASALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  148

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  149  KQD----PQISAEAGSYAR  163



>ref|XP_010910116.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 5-like 
[Elaeis guineensis]
Length=476

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNR  407
             K  +E PL+  SE     K   EV  EVKK + LAGPLI+ NLL T LQ IS+MF G+ 
Sbjct  2    EKPSVESPLLPSSE-----KRGGEVLAEVKKQLWLAGPLIATNLLQTILQVISVMFVGHL  56

Query  406  GGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILL  227
            G EL+LSGASMAT+FA VTGFS + G++ ALDTLCGQ++GAK Y MLGI  QR + V++L
Sbjct  57   G-ELALSGASMATSFAGVTGFSLLLGMSSALDTLCGQAFGAKTYHMLGIHMQRAMLVLML  115

Query  226  VCIPVTGVWAYTDRIIGFC  170
              IP+  VWAYT +I+  C
Sbjct  116  ASIPLAAVWAYTGQILVLC  134



>gb|KCW80905.1| hypothetical protein EUGRSUZ_C022722, partial [Eucalyptus grandis]
 gb|KCW80906.1| hypothetical protein EUGRSUZ_C022722, partial [Eucalyptus grandis]
Length=173

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 8/133 (6%)
 Frame = -3

Query  502  VKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLA  323
            +K+ ++LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS + G+A
Sbjct  1    MKQQLLLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFSMLIGMA  59

Query  322  GALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFYRAIILC  143
             ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F++     
Sbjct  60   SALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFFKQD---  113

Query  142  FPSPSLEVGGGAR  104
             P  S E G  AR
Sbjct  114  -PQISAEAGSYAR  125



>ref|XP_006381831.1| hypothetical protein POPTR_0006s18630g [Populus trichocarpa]
 gb|ERP59628.1| hypothetical protein POPTR_0006s18630g [Populus trichocarpa]
Length=487

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 97/141 (69%), Gaps = 3/141 (2%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            E K  +++PLI      + R  +   E+  EVKK +VLAGPL++VN  +  LQ IS+MF 
Sbjct  5    EEKPSIDLPLISPETAIKSRHGFSKVEIVEEVKKQLVLAGPLVTVNFFMFLLQVISVMFV  64

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G EL+LSGASMAT+FASVTG S ++GLA ALDT CGQSYGAKQY MLGI  QR + V
Sbjct  65   GHLG-ELALSGASMATSFASVTGLSLLKGLASALDTYCGQSYGAKQYHMLGIHLQRAMIV  123

Query  235  ILLVCIPVTGVWAYTDRIIGF  173
            +LL  +P+  VWA    I+ F
Sbjct  124  LLLASVPLAVVWANAGAILVF  144



>ref|XP_010048671.1| PREDICTED: MATE efflux family protein 7-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW81022.1| hypothetical protein EUGRSUZ_C02396 [Eucalyptus grandis]
Length=491

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 100/139 (72%), Gaps = 8/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ ++LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  33   DEIFSEMKQQLLLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  91

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  92   MLIGMASALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  148

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  149  KQD----PQISAEAGSYAR  163



>ref|XP_010048680.1| PREDICTED: MATE efflux family protein 9-like isoform X2 [Eucalyptus 
grandis]
Length=443

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 109/168 (65%), Gaps = 8/168 (5%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ++QK+  +   + +P    +         DE+  E+K+ + LAGPL+SVNL++  LQ IS
Sbjct  4    EEQKQHLKSLLLAVPQEKAASTLGNGFKKDEIFSEMKQQLSLAGPLVSVNLMIYCLQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL+LSGASMAT+FASVTGFS + G+A ALDT CGQSYGAKQY MLGI  QR
Sbjct  64   VMFVGHLG-ELALSGASMATSFASVTGFSMLIGMASALDTFCGQSYGAKQYHMLGIHKQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
             + V+LL  IP+  +WA T +I+   +F++      P  S E G  AR
Sbjct  123  AMIVLLLASIPLAIIWANTGQIL---LFFKQD----PQISAEAGSYAR  163



>ref|XP_007222348.1| hypothetical protein PRUPE_ppa004837mg [Prunus persica]
 gb|EMJ23547.1| hypothetical protein PRUPE_ppa004837mg [Prunus persica]
Length=489

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 6/144 (4%)
 Frame = -3

Query  589  ERKAEMEIPLI-----LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            E+ A +E PL+      ES+  + R   D++  EVKK + LAGPL+S N LL  +Q IS+
Sbjct  5    EQAAGLESPLLPALQEHESQATKGRLSKDDIIKEVKKQLSLAGPLVSSNFLLFGMQVISV  64

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            M+ G+ G EL+L+GASMAT+FASVTG S + G++ ALDT CGQSYGAKQY MLGI  QR 
Sbjct  65   MYVGHLG-ELALAGASMATSFASVTGLSLIIGMSSALDTFCGQSYGAKQYHMLGIHLQRA  123

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+LLVCIP++ +W     I+ F
Sbjct  124  MLVLLLVCIPLSIIWFNAGHILEF  147



>gb|KHG07789.1| MATE efflux family protein DTX1 [Gossypium arboreum]
Length=481

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 99/139 (71%), Gaps = 4/139 (3%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            E++  +E PLI +S+    +   DE+ GEVKK ++LAGPL+SVN L+ +LQ IS+MF G+
Sbjct  6    EQRDCLESPLIPQSQQGFAK---DEILGEVKKQLLLAGPLVSVNFLVFALQLISVMFVGH  62

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G +L LSGASMAT+FASVTGFS +RG+A ALDT CGQS+GAKQY MLGI  Q  + V+L
Sbjct  63   LG-KLPLSGASMATSFASVTGFSLLRGMASALDTFCGQSFGAKQYHMLGIHLQGSLLVLL  121

Query  229  LVCIPVTGVWAYTDRIIGF  173
               IP+  +W     I+ F
Sbjct  122  TASIPLAFIWTNAASILLF  140



>ref|XP_002280423.1| PREDICTED: MATE efflux family protein 6 isoform X1 [Vitis vinifera]
Length=493

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  595  RMERKAEMEIPLILESEND--ERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            R + K  +  PLI     D  ER K      D+V  EVKK + LAGPLISV+LL   LQ 
Sbjct  3    RGDEKPTLRSPLIQSCGEDGGERSKGKVFQRDKVVEEVKKQLWLAGPLISVSLLQYCLQL  62

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LSGASMAT+FASVTG S + G+A ALDTLCGQSYGAKQY ML I  
Sbjct  63   ISVMFVGHLG-ELALSGASMATSFASVTGSSLLMGMASALDTLCGQSYGAKQYHMLSIHM  121

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + ++L+V IP+  +WAYT  I+
Sbjct  122  QRAMLILLIVSIPLATIWAYTGTIL  146



>ref|XP_002280388.2| PREDICTED: MATE efflux family protein 6-like [Vitis vinifera]
Length=491

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  595  RMERKAEMEIPLILESEND------ERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            R + K  +  PLI +   D      E+    ++V  EVKK + LAGPLISV+LL   L+ 
Sbjct  3    REDEKPTLRSPLIQKCGQDGGGISMEKVLLREKVVVEVKKQLWLAGPLISVSLLQQCLEV  62

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            ISLMF G+ G +LSLS ASMAT+FASVTGFS + G+A ALDTLCGQSYGAKQY ML I  
Sbjct  63   ISLMFVGHLG-DLSLSAASMATSFASVTGFSLLMGMASALDTLCGQSYGAKQYHMLSIHM  121

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + ++L+V IP+  +WAYT  I+
Sbjct  122  QRAMLILLIVSIPLATIWAYTGTIL  146



>ref|XP_010252180.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Nelumbo 
nucifera]
Length=484

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 4/142 (3%)
 Frame = -3

Query  595  RMERKAEMEI-PLILESENDERRKCW--DEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            R+E+  E  + P   E+  DE R+     EV  E KK   LAGPLISVNLLL  LQ IS+
Sbjct  3    RIEQGLEASLLPTSEENAIDENRRKLMGTEVIAEAKKQAWLAGPLISVNLLLFCLQMISV  62

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL+L+ ASMAT+FASVTGFS + G+A ALDT CGQSYGAKQ+ MLGI  QR 
Sbjct  63   MFVGHLG-ELALAAASMATSFASVTGFSLLMGMASALDTFCGQSYGAKQHHMLGIHLQRA  121

Query  244  IPVILLVCIPVTGVWAYTDRII  179
            I V+LLV IP++ +WA +  I+
Sbjct  122  IFVLLLVSIPLSLIWANSGHIL  143



>ref|XP_010048679.1| PREDICTED: MATE efflux family protein 8-like isoform X1 [Eucalyptus 
grandis]
Length=487

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 99/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ + LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  33   DEIFSEMKQQLSLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  91

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  92   MLIGMASALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  148

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  149  KQD----PQISAEAGSYAR  163



>ref|XP_010048674.1| PREDICTED: MATE efflux family protein 6-like [Eucalyptus grandis]
Length=486

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 99/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ + LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  33   DEIFSEMKQQLSLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  91

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  92   MLIGMASALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  148

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  149  KQD----PQISAEAGSYAR  163



>emb|CDO98390.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 99/152 (65%), Gaps = 10/152 (7%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESE---------NDERRKCWDEVSGEVKKLMVLAGPLISVNLLL  449
            Q+  E +A +  PL+  SE         + E      E+  EVKK + LAGPLI V+LL 
Sbjct  2    QREHEEQAILNAPLVNTSEKVGWKGGLCDQENSFNKKEIVEEVKKQIWLAGPLICVSLLQ  61

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
             SLQ IS+MF G+ G EL+LS ASMAT+FASVTGFS + G++ ALDT CGQSYGAKQ+ M
Sbjct  62   FSLQIISVMFVGHLG-ELALSAASMATSFASVTGFSLLMGMSSALDTFCGQSYGAKQHHM  120

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            LGI  QR + V+LLV IP+  VW  T  I+ F
Sbjct  121  LGIHMQRAMIVVLLVSIPLAVVWGNTGHILKF  152



>ref|XP_010048673.1| PREDICTED: MATE efflux family protein 7-like [Eucalyptus grandis]
Length=522

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ + LAGPL+SVNL +  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  64   DEIFSEIKQQLSLAGPLVSVNLKIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  122

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  123  MLTGMASALDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  179

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  180  KQD----PQISAEAGSYAR  194



>ref|XP_011039092.1| PREDICTED: MATE efflux family protein 5 isoform X1 [Populus euphratica]
Length=492

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -3

Query  595  RMERKAEMEIPL-------ILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQ  437
            R ++   +  PL       + E  N ER     E+  EVKK + LAGPLISV+LL   +Q
Sbjct  3    REQQSLSLNTPLCEGNGVGLYEERNQERGISKKEILEEVKKQLWLAGPLISVSLLQYCIQ  62

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G ELSLSGASMAT+FASVTGFS + G+A ALDT CGQSYGA+Q+ ML I 
Sbjct  63   MISVMFVGHLG-ELSLSGASMATSFASVTGFSLLLGMASALDTFCGQSYGARQFHMLSIH  121

Query  256  TQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
             QR + V+LLV IP+  VWA T  I+  C
Sbjct  122  MQRAMVVLLLVSIPLAIVWANTRPILIAC  150



>ref|XP_010036921.1| PREDICTED: MATE efflux family protein 6 [Eucalyptus grandis]
 gb|KCW48577.1| hypothetical protein EUGRSUZ_K02246 [Eucalyptus grandis]
Length=499

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            E E D+      EV  E+KK + LAGPLISV+LLL SLQ ISLMF G+ G EL LSGASM
Sbjct  31   EGEKDKGAGSRREVLAEIKKQLWLAGPLISVSLLLFSLQMISLMFVGHLG-ELPLSGASM  89

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FA+VTGFS + G+A ALDT CGQSYGA+Q+ MLGI  QR + ++LLV IP+  +WA 
Sbjct  90   ATSFATVTGFSLLMGMASALDTFCGQSYGARQFHMLGIHMQRAMFILLLVSIPLACIWAN  149

Query  193  TDRII  179
            T  I+
Sbjct  150  TRVIL  154



>ref|XP_010048678.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Eucalyptus 
grandis]
Length=443

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 8/168 (5%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ++QK+      + +P    +         DE+  E+K+ + LAGPL+SVNL++  LQ IS
Sbjct  4    EEQKQHLESLLLTVPQEKAASTSGNGFKKDEIFSEMKQQLSLAGPLVSVNLMIYCLQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL+LSGASMAT+FASVTG S + G+A ALDT CGQSYGAKQY MLGI  QR
Sbjct  64   VMFVGHLG-ELALSGASMATSFASVTGLSMLTGMASALDTFCGQSYGAKQYHMLGIHKQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
             + V+LL  IP+  +WA T +I+   +F++      P  S E G  AR
Sbjct  123  AMIVLLLASIPLAIIWANTGQIL---LFFKQD----PQISAEAGSYAR  163



>gb|EYU42419.1| hypothetical protein MIMGU_mgv1a005366mg [Erythranthe guttata]
Length=487

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 5/140 (4%)
 Frame = -3

Query  586  RKAEMEIPLI-LESENDERRKC---WDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMF  419
             KA++E PLI +  E D   K     DE+  E K  + LAGP++ VNLLL+ +Q IS+MF
Sbjct  6    EKADLETPLISISHEYDPNTKSKFNRDEIVAEAKLQLFLAGPMMFVNLLLSLVQTISVMF  65

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LSGASMAT+FASVTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + 
Sbjct  66   VGHEG-ELALSGASMATSFASVTGFSLLVGMACALDTYCGQSYGAKQYHMLGIHMQRAML  124

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+LLV IP+   WA    I+
Sbjct  125  VLLLVSIPLACTWATAGDIL  144



>emb|CBI15521.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  595  RMERKAEMEIPLILESEND--ERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            R + K  +  PLI     D  ER K      D+V  EVKK + LAGPLISV+LL   LQ 
Sbjct  73   RGDEKPTLRSPLIQSCGEDGGERSKGKVFQRDKVVEEVKKQLWLAGPLISVSLLQYCLQL  132

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LSGASMAT+FASVTG S + G+A ALDTLCGQSYGAKQY ML I  
Sbjct  133  ISVMFVGHLG-ELALSGASMATSFASVTGSSLLMGMASALDTLCGQSYGAKQYHMLSIHM  191

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + ++L+V IP+  +WAYT  I+
Sbjct  192  QRAMLILLIVSIPLATIWAYTGTIL  216



>ref|XP_007226589.1| hypothetical protein PRUPE_ppa023794mg [Prunus persica]
 gb|EMJ27788.1| hypothetical protein PRUPE_ppa023794mg [Prunus persica]
Length=471

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 16/149 (11%)
 Frame = -3

Query  619  VRIWQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            +++ Q+Q  + RK   ++P+             DE+  EVKK ++LAGPL++ N LL  +
Sbjct  15   IQVPQEQSLLSRK---QVPVK------------DEIVEEVKKQLLLAGPLVASNFLLFGM  59

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+M+ G+ G EL+L+GASMAT+FASVTG S  RG+  ALDT CGQSYGAKQY MLGI
Sbjct  60   QLISVMYVGHVG-ELALAGASMATSFASVTGLSLTRGMGSALDTFCGQSYGAKQYHMLGI  118

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
              QR + V+LLV IP+  VWA T  I+ F
Sbjct  119  HMQRAMLVLLLVNIPLAFVWANTGHILEF  147



>ref|XP_008223668.1| PREDICTED: MATE efflux family protein 8-like [Prunus mume]
Length=489

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 6/144 (4%)
 Frame = -3

Query  589  ERKAEMEIPLI-----LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            E+ A +E PL+      ES+  + +   DE+  EVKK + LAGPL+S N LL  +Q IS+
Sbjct  5    EQAAGLESPLLPAPQEHESQTTKGKLTKDEIIKEVKKQLSLAGPLVSSNFLLFGMQVISV  64

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            M+ G+ G EL+L+GASMAT+FA+VTG S + G++ ALDT CGQSYGAKQY MLGI  QR 
Sbjct  65   MYVGHLG-ELALAGASMATSFATVTGLSLIIGMSFALDTFCGQSYGAKQYHMLGIHLQRA  123

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+LLVCIP++ +W     I+ F
Sbjct  124  MLVLLLVCIPLSIIWFNAGHILEF  147



>gb|KGN63528.1| hypothetical protein Csa_1G003460 [Cucumis sativus]
Length=238

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLILES-----ENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            D+    +  ++E  L+ ES       D++   W+EV  E+KK M LAGPL+ V+ L  SL
Sbjct  2    DENGGRKLDDLESYLVSESLKMRLNGDQK---WEEVIREIKKQMGLAGPLVLVSFLQYSL  58

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G EL LSGASMA +FA VTGFS + G+  AL+TLCGQSYG KQY+MLGI
Sbjct  59   QLISIMFIGHLG-ELQLSGASMALSFAGVTGFSLLLGMGSALETLCGQSYGGKQYEMLGI  117

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
              QR + V+ L+CIP+  +WA  ++I+ F
Sbjct  118  HMQRAMVVLSLICIPIAVLWASIEQILTF  146



>gb|AES76569.2| MATE efflux family protein [Medicago truncatula]
Length=454

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 109/163 (67%), Gaps = 16/163 (10%)
 Frame = -3

Query  577  EMEIPLILE--SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             ++ PLI+E   +N+++ +   E+  EVKK + L+GPLISV LL   +  IS+MF G+ G
Sbjct  2    SLDSPLIVEETKQNNKKEEDRRELVEEVKKQLWLSGPLISVTLLNFGINLISVMFVGHLG  61

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL LSGASMAT+FASVTGFS ++G+A ALDT CGQSYGAKQY+MLG+  QR + ++++V
Sbjct  62   -ELPLSGASMATSFASVTGFSLLQGMASALDTFCGQSYGAKQYRMLGVHMQRAMFILMVV  120

Query  223  CIPVTGVWAYTDRIIGFCVFYRAIILCF---PSPSLEVGGGAR  104
             IP+  +WA T          R+I+L     P  S+E G  A+
Sbjct  121  AIPLAVIWANT----------RSILLVLGQDPEISIEAGSYAK  153



>gb|KDP43814.1| hypothetical protein JCGZ_23022 [Jatropha curcas]
Length=488

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 105/164 (64%), Gaps = 10/164 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCW--DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            E+K  +E PLI +    E R  +  D +  E+KK ++LAGPLISVN L   LQ IS+MF 
Sbjct  5    EQKLSLESPLISQPRISESRNGFTKDVIIQELKKQLILAGPLISVNFLTYLLQVISVMFV  64

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G EL+LS ASMAT+FASVTGFS ++G+  AL+T CGQSYGAKQ+ MLGI  QR + V
Sbjct  65   GHLG-ELALSSASMATSFASVTGFSLLKGMGSALETFCGQSYGAKQHHMLGIHLQRAVIV  123

Query  235  ILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
            +LL  IP+  +WA      G  +F++      P  S E G  AR
Sbjct  124  LLLASIPLAVIWANAG---GILLFFKQD----PEISAEAGRYAR  160



>ref|XP_011069889.1| PREDICTED: MATE efflux family protein 6-like [Sesamum indicum]
Length=487

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = -3

Query  589  ERKAEMEIPLI-LESENDERRKCW---DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
              KAE++ PLI +  + D   K     DE+  E K  + LAGP++ VNLLL+ +Q IS+M
Sbjct  5    SEKAELQTPLISISQDKDAESKATFTRDEILAETKLQLFLAGPMMFVNLLLSLIQTISVM  64

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G EL+LSGASMAT+FASVTGFS + G+A ALDT CGQ+YGAKQY MLGI  QR +
Sbjct  65   FVGHVG-ELALSGASMATSFASVTGFSLLVGMACALDTYCGQAYGAKQYHMLGIHMQRAM  123

Query  241  PVILLVCIPVTGVWAYTDRII  179
             V+LLV IP+  +WA    I+
Sbjct  124  LVLLLVSIPLACIWATAGDIL  144



>gb|KCW81035.1| hypothetical protein EUGRSUZ_C02411 [Eucalyptus grandis]
Length=491

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 8/168 (5%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ++QK+      + +P    +         DE+  E+K+ + LAGPL+SVNL++  LQ IS
Sbjct  4    EEQKQHLESLLLTVPQEKAASTSGNGFKKDEIFSEMKQQLSLAGPLVSVNLMIYCLQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL+LSGASMAT+FASVTG S + G+A ALDT CGQSYGAKQY MLGI  QR
Sbjct  64   VMFVGHLG-ELALSGASMATSFASVTGLSMLTGMASALDTFCGQSYGAKQYHMLGIHKQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
             + V+LL  IP+  +WA T +I+   +F++      P  S E G  AR
Sbjct  123  AMIVLLLASIPLAIIWANTGQIL---LFFKQD----PQISAEAGSYAR  163



>ref|XP_010048677.1| PREDICTED: MATE efflux family protein 8-like isoform X1 [Eucalyptus 
grandis]
Length=491

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 8/168 (5%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ++QK+      + +P    +         DE+  E+K+ + LAGPL+SVNL++  LQ IS
Sbjct  4    EEQKQHLESLLLTVPQEKAASTSGNGFKKDEIFSEMKQQLSLAGPLVSVNLMIYCLQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL+LSGASMAT+FASVTG S + G+A ALDT CGQSYGAKQY MLGI  QR
Sbjct  64   VMFVGHLG-ELALSGASMATSFASVTGLSMLTGMASALDTFCGQSYGAKQYHMLGIHKQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
             + V+LL  IP+  +WA T +I+   +F++      P  S E G  AR
Sbjct  123  AMIVLLLASIPLAIIWANTGQIL---LFFKQD----PQISAEAGSYAR  163



>ref|XP_006341551.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=493

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME +     PLI++     +    +E+  EVKK + LAGPL+SVNLL  SLQ IS+MF G
Sbjct  1    MEAEHGNSSPLIVKQNGFSK----EEIVEEVKKQIWLAGPLVSVNLLQFSLQLISIMFVG  56

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL LSGASMA +F SVTG S + G++ ALDT CGQSYGAKQY MLGI  QR + ++
Sbjct  57   HLG-ELPLSGASMANSFTSVTGISLLMGMSSALDTFCGQSYGAKQYHMLGIHMQRAMIIL  115

Query  232  LLVCIPVTGVWAYTDRIIGF  173
             LVCIP+  +WA T  I+ F
Sbjct  116  SLVCIPLAVIWANTGPILKF  135



>ref|XP_010678134.1| PREDICTED: MATE efflux family protein 5-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 100/145 (69%), Gaps = 6/145 (4%)
 Frame = -3

Query  589  ERKAEMEIPL--ILESE--NDERRKCWDE-VSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            +    ME PL  I+E E  +D   K W + +  E+KK   LAGPL+SVNLLL SLQ IS+
Sbjct  5    QNDRSMETPLMNIIEREQLDDIESKNWRKSLIEEMKKQAWLAGPLVSVNLLLFSLQLISI  64

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL LSGASMAT+FA+VTGFS + G++ ALDT CGQSYGA+QY MLGI  QR 
Sbjct  65   MFVGHLG-ELPLSGASMATSFATVTGFSLLMGMSSALDTFCGQSYGARQYHMLGIHLQRA  123

Query  244  IPVILLVCIPVTGVWAYTDRIIGFC  170
            + ++ +V IP+  +WA +  I+  C
Sbjct  124  MIILTIVSIPLALIWANSRSILIAC  148



>ref|XP_011084523.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Sesamum 
indicum]
Length=422

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 99/144 (69%), Gaps = 9/144 (6%)
 Frame = -3

Query  592  MERKAE----MEIPLILESEN--DERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            MER  E    +  PLI   E   DE  K  + +  E++K + LAGPLI V+LL   LQ I
Sbjct  1    MERAEENVTVLNSPLIPSPEEIPDENGK--EVILEELRKQLWLAGPLIMVSLLQFCLQLI  58

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+MF G+ G EL+L+GASMAT+FASVTGFS + G+A ALDTLCGQSYGAKQY MLGI   
Sbjct  59   SVMFVGHLG-ELALAGASMATSFASVTGFSLLMGMASALDTLCGQSYGAKQYHMLGIHMV  117

Query  250  RGIPVILLVCIPVTGVWAYTDRII  179
            R I V+L+VCIP+  +WA T  I+
Sbjct  118  RAIVVLLIVCIPLAVIWANTTPIL  141



>ref|XP_004243012.1| PREDICTED: MATE efflux family protein 6-like [Solanum lycopersicum]
Length=471

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            +RK E+E P    +   ER+  ++E+  +VKKL+VLA PL+ VN+LL SLQ IS+MF G+
Sbjct  5    KRKEELECP----NLGIERK--YEEIFVQVKKLLVLAWPLMLVNILLYSLQVISVMFVGH  58

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
            +G EL+LSGASMAT+FA VTGF  + G+  AL+TLCGQSYGA QY MLGI  QR + V L
Sbjct  59   QG-ELALSGASMATSFAFVTGFGLLMGMGSALETLCGQSYGANQYHMLGIHMQRAMFVNL  117

Query  229  LVCIPVTGVWAYTDRII  179
            LV IP+  VWA   RI+
Sbjct  118  LVSIPLACVWANAGRIL  134



>ref|XP_003620351.1| hypothetical protein MTR_6g081810 [Medicago truncatula]
Length=496

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 109/163 (67%), Gaps = 16/163 (10%)
 Frame = -3

Query  577  EMEIPLILE--SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             ++ PLI+E   +N+++ +   E+  EVKK + L+GPLISV LL   +  IS+MF G+ G
Sbjct  2    SLDSPLIVEETKQNNKKEEDRRELVEEVKKQLWLSGPLISVTLLNFGINLISVMFVGHLG  61

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL LSGASMAT+FASVTGFS ++G+A ALDT CGQSYGAKQY+MLG+  QR + ++++V
Sbjct  62   -ELPLSGASMATSFASVTGFSLLQGMASALDTFCGQSYGAKQYRMLGVHMQRAMFILMVV  120

Query  223  CIPVTGVWAYTDRIIGFCVFYRAIILCF---PSPSLEVGGGAR  104
             IP+  +WA T          R+I+L     P  S+E G  A+
Sbjct  121  AIPLAVIWANT----------RSILLVLGQDPEISIEAGSYAK  153



>ref|XP_008223664.1| PREDICTED: MATE efflux family protein DTX1-like isoform X1 [Prunus 
mume]
Length=492

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 8/146 (5%)
 Frame = -3

Query  589  ERKAEMEIPLI--LESEND-ERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            E+  ++E PLI   + E+D + RK      DE   EVKK ++L GPL+S N LL  +Q +
Sbjct  5    EQAGDLESPLIPFADQEHDYQARKGQQLTRDEFFVEVKKQLLLVGPLVSSNFLLFCIQVV  64

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+M+ G+ G EL+LSGASMAT+FASVTG S M G+  ALDT CGQSYGAKQY MLGI  Q
Sbjct  65   SVMYVGHLG-ELALSGASMATSFASVTGISLMIGMGSALDTFCGQSYGAKQYHMLGIHMQ  123

Query  250  RGIPVILLVCIPVTGVWAYTDRIIGF  173
            R + V+LLV IP+  VWA T  I+ F
Sbjct  124  RAMIVLLLVSIPLAVVWANTGFILEF  149



>ref|XP_008223665.1| PREDICTED: MATE efflux family protein DTX1-like isoform X2 [Prunus 
mume]
Length=489

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 8/146 (5%)
 Frame = -3

Query  589  ERKAEMEIPLI--LESEND-ERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            E+  ++E PLI   + E+D + RK      DE   EVKK ++L GPL+S N LL  +Q +
Sbjct  5    EQAGDLESPLIPFADQEHDYQARKGQQLTRDEFFVEVKKQLLLVGPLVSSNFLLFCIQVV  64

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+M+ G+ G EL+LSGASMAT+FASVTG S M G+  ALDT CGQSYGAKQY MLGI  Q
Sbjct  65   SVMYVGHLG-ELALSGASMATSFASVTGISLMIGMGSALDTFCGQSYGAKQYHMLGIHMQ  123

Query  250  RGIPVILLVCIPVTGVWAYTDRIIGF  173
            R + V+LLV IP+  VWA T  I+ F
Sbjct  124  RAMIVLLLVSIPLAVVWANTGFILEF  149



>ref|XP_002318533.2| hypothetical protein POPTR_0012s04810g [Populus trichocarpa]
 gb|EEE96753.2| hypothetical protein POPTR_0012s04810g [Populus trichocarpa]
Length=500

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 99/150 (66%), Gaps = 8/150 (5%)
 Frame = -3

Query  598  KRMERKAEMEIPL-------ILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            +R ++   +  PL       + E  N ER     E+  EVK+ + LAGPLISV+LL   +
Sbjct  2    EREQQSLSLNTPLCEGNGVGLYEERNQERGISKKEILEEVKRQLWLAGPLISVSLLQYCI  61

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G ELSLSGASMAT+FASVTGFS + G+A ALDT CGQ+YGA+Q+ ML I
Sbjct  62   QMISVMFVGHLG-ELSLSGASMATSFASVTGFSLLLGMASALDTFCGQAYGARQFHMLSI  120

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
              QR + V+LLV IP+  +WA T  I+  C
Sbjct  121  HMQRAMVVLLLVSIPLAIIWANTRPILMAC  150



>ref|XP_008452131.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Cucumis 
melo]
Length=488

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ++++  ++ +++  P I    +D R    DE+  EVK+ + LAGPL++VN+L++ LQ IS
Sbjct  3    EEEQTKKQISDLNSPFIPPRHHDGRSFTRDEIWEEVKRQLRLAGPLVTVNVLISCLQMIS  62

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G +L L+GASMAT+FASVTGFS + G+  AL+T CGQSYGAKQY MLGI  QR
Sbjct  63   VMFVGHLG-QLPLAGASMATSFASVTGFSLLNGMGSALETFCGQSYGAKQYHMLGIHLQR  121

Query  247  GIPVILLVCIPVTGVW  200
             + V+LLV  P+  VW
Sbjct  122  AMVVLLLVSFPLAVVW  137



>emb|CBI15520.3| unnamed protein product [Vitis vinifera]
Length=1072

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 108/165 (65%), Gaps = 13/165 (8%)
 Frame = -3

Query  637  LYLPCHVRIWQD---QKRMERKAE---MEIPLILESEND------ERRKCWDEVSGEVKK  494
            LY+  H     D   + +M+R+ E   +  PLI +   D      E+    ++V  EVKK
Sbjct  564  LYMKKHYLSMHDLCVKAKMDREDEKPTLRSPLIQKCGQDGGGISMEKVLLREKVVVEVKK  623

Query  493  LMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGAL  314
             + LAGPLISV+LL   L+ ISLMF G+ G +LSLS ASMAT+FASVTGFS + G+A AL
Sbjct  624  QLWLAGPLISVSLLQQCLEVISLMFVGHLG-DLSLSAASMATSFASVTGFSLLMGMASAL  682

Query  313  DTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            DTLCGQSYGAKQY ML I  QR + ++L+V IP+  +WAYT  I+
Sbjct  683  DTLCGQSYGAKQYHMLSIHMQRAMLILLIVSIPLATIWAYTGTIL  727


 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = -3

Query  517  EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSF  338
            E+  EVKK + LAGPL  V +L    Q +SLMF G+ G EL L+ ASMA +FASVTGFS 
Sbjct  26   EIGEEVKKQLALAGPLTIVGVLRYLTQAVSLMFVGHLG-ELPLASASMAASFASVTGFSL  84

Query  337  MRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            + G+  ALDTLCGQ+YGAK Y MLGI  QR + V+LLV +P+  +WA T+ I+
Sbjct  85   LIGMGSALDTLCGQAYGAKHYHMLGIHMQRAMSVLLLVSVPLAFIWAKTEHIL  137



>ref|XP_010087833.1| MATE efflux family protein 6 [Morus notabilis]
 gb|EXB30269.1| MATE efflux family protein 6 [Morus notabilis]
Length=495

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 11/150 (7%)
 Frame = -3

Query  598  KRMERKAEMEIPLILESE----NDERRKCWDE------VSGEVKKLMVLAGPLISVNLLL  449
            +R   K  +  PLI   E    N+ R +  +E      +  EVK+ + LAGPLI+V+LL 
Sbjct  2    ERENYKPSLVTPLIQSCEENGLNNGRDRVGEEGIKRKQILEEVKRQLWLAGPLIAVSLLQ  61

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
              LQ IS+MF G+ G ELSLSGASMAT+FA+VTGFSF+ G+A AL+TL GQSYGAKQY M
Sbjct  62   YCLQMISVMFVGHLG-ELSLSGASMATSFAAVTGFSFLLGMASALETLSGQSYGAKQYHM  120

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            LGI TQR + V+LLV IP+  +WA T+ I+
Sbjct  121  LGIHTQRSMFVLLLVSIPLAVIWANTEPIL  150



>ref|XP_006843973.1| hypothetical protein AMTR_s00006p00126430 [Amborella trichopoda]
 gb|ERN05648.1| hypothetical protein AMTR_s00006p00126430 [Amborella trichopoda]
Length=491

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 16/150 (11%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDE-----------RRKCWDEVSGEVKKLMVLAGPLISVNLLLT  446
            ME K +++ PLI   E              +R  + E   +VK    LAGPLI+V+LL  
Sbjct  1    MEEKTDLKQPLISLGEGGAGIQEFTLFGWPKRDVFKEAEKQVK----LAGPLIAVSLLQY  56

Query  445  SLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKML  266
             LQ IS+M+ G+ G ELSLS ASMAT+FA VTGFS + G+  ALDTLCGQSYGAKQY ML
Sbjct  57   CLQVISVMYVGHLG-ELSLSSASMATSFAGVTGFSLLLGMGSALDTLCGQSYGAKQYHML  115

Query  265  GIFTQRGIPVILLVCIPVTGVWAYTDRIIG  176
            GI TQR + V+LLV IP+  +WAYT  I+G
Sbjct  116  GIHTQRSMFVLLLVSIPLAFIWAYTGEILG  145



>ref|XP_008385501.1| PREDICTED: MATE efflux family protein 8-like [Malus domestica]
Length=490

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 7/144 (5%)
 Frame = -3

Query  586  RKAEMEIPLI--LESENDERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            + A +E PLI  L  E + +RK      DEV  EVKK ++LAGPL+S N LL  +Q IS+
Sbjct  6    QTAGLESPLIPVLPQELEVQRKQGPLSKDEVIKEVKKQLLLAGPLVSSNFLLFGMQVISV  65

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            M+ G+ G EL+L+GASMAT+FASVTG S + G+  ALDT CGQSYGAKQY MLGI  QR 
Sbjct  66   MYVGHLG-ELALAGASMATSFASVTGLSLIIGMGSALDTFCGQSYGAKQYHMLGIHLQRA  124

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+ LVCIP+  VW     I+ F
Sbjct  125  MLVLGLVCIPLATVWFNAGHILKF  148



>ref|XP_004167999.1| PREDICTED: MATE efflux family protein 7-like, partial [Cucumis 
sativus]
Length=486

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -3

Query  610  WQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            ++  +R ++K  +  P I    +  R    DE+  EVK+ ++LAGPL++VN+L++ LQ I
Sbjct  1    YRHGRRADKKQSLNSPFI-PPRHHGRSFTRDEIWDEVKRQVLLAGPLVTVNVLISCLQMI  59

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+MF G+ G +L L+GASMAT+FASVTGFS + G+  AL+T CGQSYGAKQY MLGI  Q
Sbjct  60   SVMFVGHLG-QLPLAGASMATSFASVTGFSLLNGMGSALETFCGQSYGAKQYHMLGIHMQ  118

Query  250  RGIPVILLVCIPVTGVW  200
            R + V+LLV  P+  VW
Sbjct  119  RAMVVLLLVSFPLAVVW  135



>ref|XP_011084514.1| PREDICTED: MATE efflux family protein DTX1-like isoform X1 [Sesamum 
indicum]
Length=486

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 99/144 (69%), Gaps = 9/144 (6%)
 Frame = -3

Query  592  MERKAE----MEIPLILESEN--DERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            MER  E    +  PLI   E   DE  K  + +  E++K + LAGPLI V+LL   LQ I
Sbjct  1    MERAEENVTVLNSPLIPSPEEIPDENGK--EVILEELRKQLWLAGPLIMVSLLQFCLQLI  58

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+MF G+ G EL+L+GASMAT+FASVTGFS + G+A ALDTLCGQSYGAKQY MLGI   
Sbjct  59   SVMFVGHLG-ELALAGASMATSFASVTGFSLLMGMASALDTLCGQSYGAKQYHMLGIHMV  117

Query  250  RGIPVILLVCIPVTGVWAYTDRII  179
            R I V+L+VCIP+  +WA T  I+
Sbjct  118  RAIVVLLIVCIPLAVIWANTTPIL  141



>ref|XP_010279420.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Nelumbo 
nucifera]
Length=470

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -3

Query  571  EIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELS  392
            EI +    E  +     +EV  EVKK + LAGPLI+V+LL   LQ IS+MF G+ G EL+
Sbjct  19   EISIEFSGEMSQASGWTEEVVAEVKKQVGLAGPLIAVSLLQYCLQMISIMFVGHLG-ELA  77

Query  391  LSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPV  212
            LSGASMAT+FASVTGF  + G+  AL+TLCGQ+YGAKQY MLG+ TQR + ++L++ IP+
Sbjct  78   LSGASMATSFASVTGFDLLLGMGSALETLCGQAYGAKQYHMLGVHTQRAMLILLVISIPL  137

Query  211  TGVWAYTDRII  179
              +W+YT  I+
Sbjct  138  AFIWSYTSHIL  148



>ref|XP_010279440.1| PREDICTED: MATE efflux family protein 6-like [Nelumbo nucifera]
Length=549

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 102/155 (66%), Gaps = 18/155 (12%)
 Frame = -3

Query  592  MERKAE--------MEIPLILESENDE---------RRKCWDEVSGEVKKLMVLAGPLIS  464
            MER+A+        + IP    SE DE         RR    +V  E+KK + LAGPLI 
Sbjct  1    MEREADGLAPNSLLLGIPEENGSELDEERTVDQKGIRRSSSSKVVAELKKQLWLAGPLIL  60

Query  463  VNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGA  284
            VNLL  S+Q IS+MF G+ G EL LS AS+A +FA+VTGFS + G+  AL+TLCGQSYGA
Sbjct  61   VNLLEYSVQTISIMFTGHVG-ELELSSASIANSFATVTGFSLLTGMGSALETLCGQSYGA  119

Query  283  KQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +QY MLGI  QR + V+ +VCIPVT +WA+T RI+
Sbjct  120  EQYHMLGIHMQRAMFVLSIVCIPVTFIWAHTGRIL  154



>ref|XP_010279419.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -3

Query  571  EIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELS  392
            EI +    E  +     +EV  EVKK + LAGPLI+V+LL   LQ IS+MF G+ G EL+
Sbjct  19   EISIEFSGEMSQASGWTEEVVAEVKKQVGLAGPLIAVSLLQYCLQMISIMFVGHLG-ELA  77

Query  391  LSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPV  212
            LSGASMAT+FASVTGF  + G+  AL+TLCGQ+YGAKQY MLG+ TQR + ++L++ IP+
Sbjct  78   LSGASMATSFASVTGFDLLLGMGSALETLCGQAYGAKQYHMLGVHTQRAMLILLVISIPL  137

Query  211  TGVWAYTDRII  179
              +W+YT  I+
Sbjct  138  AFIWSYTSHIL  148



>ref|XP_007036669.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY21170.1| MATE efflux family protein [Theobroma cacao]
Length=497

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 13/152 (9%)
 Frame = -3

Query  598  KRMERKAEMEIPLILES-ENDERRKCWDEVSG-----------EVKKLMVLAGPLISVNL  455
            +R ++K  +  PLI +S END+     ++ S            EVKK + LAGPLI+VNL
Sbjct  2    EREDQKLSLTFPLIRKSGENDDLTLSNEQKSSNGSDTRKNIFEEVKKQLWLAGPLIAVNL  61

Query  454  LLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQY  275
            L   +Q IS+MF G+ G EL+LSGASMAT+FA+VTGFS + G+A ALDTLCGQSYGAKQ+
Sbjct  62   LQYCIQMISVMFVGHLG-ELALSGASMATSFATVTGFSLLMGMAAALDTLCGQSYGAKQH  120

Query  274  KMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             MLGI  QR I V+ +V IP+  +W  T  I+
Sbjct  121  SMLGIHMQRAIIVLEIVSIPLAIIWVNTRPIL  152



>ref|XP_010051005.1| PREDICTED: MATE efflux family protein 6-like [Eucalyptus grandis]
 gb|KCW81042.1| hypothetical protein EUGRSUZ_C02419 [Eucalyptus grandis]
Length=491

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 100/146 (68%), Gaps = 10/146 (7%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDER-------RKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            E+K  +E PL+  S+           +K  DE+  E+K+ + LAGPL+++NLL+  LQ I
Sbjct  5    EQKPHLESPLLAVSQEKAAPEPGNGFKK--DEIFSEIKRQLSLAGPLVALNLLMYCLQVI  62

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+MF G+ G E++L+GASMAT+FA VTGFS   G++ AL+T CGQSYGAKQY MLGI  Q
Sbjct  63   SVMFVGHLG-EVALAGASMATSFAYVTGFSLFIGMSTALETFCGQSYGAKQYHMLGIHKQ  121

Query  250  RGIPVILLVCIPVTGVWAYTDRIIGF  173
            R + V+L+   PV  +WAYT +I+ F
Sbjct  122  RAMIVLLITSFPVAIIWAYTGQILLF  147



>gb|KEH26973.1| MATE efflux family protein [Medicago truncatula]
Length=480

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            +++ +ERRK  +EV    K  + L+GPLISV LL   +  ISLMF G+ G ELSLSGASM
Sbjct  14   QNKEEERRKLVEEV----KTQLWLSGPLISVTLLNYGINIISLMFVGHLG-ELSLSGASM  68

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FASVTGFS + G+A ALDTLCGQSYGAKQY+MLGI  QR + ++++V IP+  +WA 
Sbjct  69   ATSFASVTGFSLLIGMASALDTLCGQSYGAKQYRMLGIHMQRAMFILMIVAIPLAIIWAN  128

Query  193  TDRII  179
            T  I+
Sbjct  129  TRSIL  133



>ref|XP_004307901.1| PREDICTED: MATE efflux family protein 9-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 10/146 (7%)
 Frame = -3

Query  589  ERKAEMEIPLI-------LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFI  431
            +++  +E PLI       L+S      K  DE+  EVKK ++LAGPL+S N LL   Q I
Sbjct  6    KQRGGLESPLIPAPHEHALQSRKGLLNK--DEIVEEVKKQLLLAGPLVSSNFLLFGTQVI  63

Query  430  SLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQ  251
            S+M+ G+ G ELSL+GASMAT+FASVTG S + G+  ALDT CGQSYGAKQY+MLGI  Q
Sbjct  64   SVMYVGHLG-ELSLAGASMATSFASVTGLSLILGMCSALDTFCGQSYGAKQYRMLGIHMQ  122

Query  250  RGIPVILLVCIPVTGVWAYTDRIIGF  173
            R + V+LLV IP+  +W    RI+ F
Sbjct  123  RAMLVLLLVSIPLATIWFNAGRILQF  148



>ref|XP_004138084.1| PREDICTED: MATE efflux family protein DTX1-like [Cucumis sativus]
Length=495

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            N +++  W+EV  E+KK M LAGPL+ V+ L  SLQ IS+MF G+ G EL LSGASMA +
Sbjct  26   NGDQK--WEEVIREIKKQMGLAGPLVLVSFLQYSLQLISIMFIGHLG-ELQLSGASMALS  82

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFS + G+  AL+TLCGQSYG KQY+MLGI  QR I V+ L+CIP+  +WA  ++
Sbjct  83   FAGVTGFSLLMGMGSALETLCGQSYGGKQYEMLGIHMQRAIVVLSLICIPIAVLWASIEQ  142

Query  184  IIGF  173
            I+ F
Sbjct  143  ILTF  146



>gb|KGN63531.1| hypothetical protein Csa_1G003490 [Cucumis sativus]
Length=495

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            N +++  W+EV  E+KK M LAGPL+ V+ L  SLQ IS+MF G+ G EL LSGASMA +
Sbjct  26   NGDQK--WEEVIREIKKQMGLAGPLVLVSFLQYSLQLISIMFIGHLG-ELQLSGASMALS  82

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFS + G+  AL+TLCGQSYG KQY+MLGI  QR I V+ L+CIP+  +WA  ++
Sbjct  83   FAGVTGFSLLMGMGSALETLCGQSYGGKQYEMLGIHMQRAIVVLSLICIPIAVLWASIEQ  142

Query  184  IIGF  173
            I+ F
Sbjct  143  ILTF  146



>ref|XP_004512780.1| PREDICTED: MATE efflux family protein 6-like [Cicer arietinum]
Length=503

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 97/146 (66%), Gaps = 13/146 (9%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            + +R  CW       +K++ LAGPLI VNLL+  LQ IS+MF G+ G EL LS AS+AT+
Sbjct  46   DKDRPNCWRS-----EKVLKLAGPLIFVNLLIYGLQVISIMFVGHLG-ELPLSAASVATS  99

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            F + TGF+ M G+A ALDTLCGQSYGAKQY MLGI  QR I ++++VCIP++ +WA T+ 
Sbjct  100  FVTATGFNVMSGMACALDTLCGQSYGAKQYHMLGILMQRAIFILMIVCIPISIIWANTNS  159

Query  184  IIGFCVFYRAIILCFPSPSLEVGGGA  107
            I  F  F++      P  S E G  A
Sbjct  160  I--FISFHQD-----PEISAEAGKYA  178



>gb|AES76567.2| MATE efflux family protein [Medicago truncatula]
Length=480

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            +++ +ERRK  +EV    K  + L+GPLISV LL   +  ISLMF G+   ELSLSGASM
Sbjct  14   QNKEEERRKLVEEV----KTQLWLSGPLISVTLLNFGISLISLMFVGHLS-ELSLSGASM  68

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FASVTGFS + G+A ALDTLCGQSYGAKQY+MLGI  QR + ++++V IP+  +WA 
Sbjct  69   ATSFASVTGFSLLVGMASALDTLCGQSYGAKQYRMLGIHMQRAMFILMIVAIPLAIIWAN  128

Query  193  TDRIIGF  173
            T  I+ F
Sbjct  129  TRSILIF  135



>ref|XP_010509762.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=489

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 9/145 (6%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            R ER+  +  PLI E E   R      V  EVKK ++L+GPLI+V+LL  SLQ IS+MF 
Sbjct  3    REEREDTLSWPLIGEKEKRSRL-----VKEEVKKQLLLSGPLIAVSLLQYSLQIISVMFV  57

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  LSLS AS+AT+FASVTGF+F+ G A ALDT+CGQSYGAK Y MLG   QR + V
Sbjct  58   GHLG-SLSLSAASIATSFASVTGFTFLMGTASALDTVCGQSYGAKMYGMLGKQMQRAMLV  116

Query  235  ILLVCIPVTGVWAYTDRIIGFCVFY  161
            + L+ +P++ VWA T+R   F VF+
Sbjct  117  LTLLSVPLSIVWANTER---FLVFF  138



>ref|XP_008453462.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Cucumis 
melo]
Length=461

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = -3

Query  559  ILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGA  380
            ++ + +  RR+   +V+ E+K+ + LAGPLI V LL  SLQ IS+MF G+ G ELSLSGA
Sbjct  28   VIRANDRNRRR--QQVAEELKRQLWLAGPLILVGLLQYSLQMISVMFVGHLG-ELSLSGA  84

Query  379  SMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVW  200
            SMAT+FA+VTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + V+ LV IP+  +W
Sbjct  85   SMATSFATVTGFSLLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMFVLSLVSIPLAVIW  144

Query  199  AYTDRII  179
            A T  I+
Sbjct  145  ANTGGIL  151



>ref|XP_007152706.1| hypothetical protein PHAVU_004G152500g [Phaseolus vulgaris]
 gb|ESW24700.1| hypothetical protein PHAVU_004G152500g [Phaseolus vulgaris]
Length=501

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLILESEN---------DERRKCW-----DEVSGEVKKLMVLAGPLI  467
            +++   + A ++ PLI  S +         +E++  W      +V  EVKK + L+GPLI
Sbjct  2    EREDQNQSAYLQSPLIQHSYSSGLKDGSVVNEKQSSWRRIERKDVVEEVKKQLWLSGPLI  61

Query  466  SVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYG  287
            +V LL   L  IS+MF G+ G EL+LSGASMAT+FASVTGFS + G+A ALDT CGQSYG
Sbjct  62   TVTLLNFCLNVISVMFVGHLG-ELALSGASMATSFASVTGFSLLVGMASALDTFCGQSYG  120

Query  286  AKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            AKQY MLGI  QR + +++ V IP+  +WA T  I+ F
Sbjct  121  AKQYHMLGIHMQRAMFILMTVSIPLAVIWANTSSILIF  158



>ref|XP_006344468.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=474

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 95/148 (64%), Gaps = 11/148 (7%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWD-------EVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            M  +   E PL+    N+  +  W+       EV  E KK + LAGPL+ V+ L   LQ 
Sbjct  1    MMSERNSEFPLL---SNNIEKGSWNPEDCDIGEVIEETKKQLELAGPLVLVSFLQYFLQM  57

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G R GELSLS A++AT+FA VTGFSFM G   AL+TLCGQ+YGAKQY MLGI  
Sbjct  58   ISIMFVG-RLGELSLSSATLATSFAGVTGFSFMLGTGSALETLCGQAYGAKQYHMLGIHM  116

Query  253  QRGIPVILLVCIPVTGVWAYTDRIIGFC  170
            QRG+ V+L + IP++ +WA+   I  FC
Sbjct  117  QRGMLVLLAISIPISIIWAFAGHIFAFC  144



>ref|XP_008453458.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Cucumis 
melo]
Length=496

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 98/146 (67%), Gaps = 11/146 (8%)
 Frame = -3

Query  586  RKAEMEIPLILESEN-----DERRKCWDEV-----SGEVKKLMVLAGPLISVNLLLTSLQ  437
            R + +  PLI +SE+     DE +  ++ +     + EVKK + LAGPLISV+LL   LQ
Sbjct  7    RNSSLNSPLIHKSEDGVNSKDESQINYENIRRKLIAEEVKKQLWLAGPLISVSLLQYCLQ  66

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL LSGASMA +F SVTGF+ + G+A ALDT CGQSYGAKQY MLGI 
Sbjct  67   MISIMFVGHLG-ELPLSGASMAVSFTSVTGFTVLLGMASALDTFCGQSYGAKQYHMLGIH  125

Query  256  TQRGIPVILLVCIPVTGVWAYTDRII  179
             QR + ++ LV IP+  +WA T  I+
Sbjct  126  VQRAMFILSLVSIPLAVIWANTGEIL  151



>ref|XP_008453461.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Cucumis 
melo]
Length=496

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = -3

Query  559  ILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGA  380
            ++ + +  RR+   +V+ E+K+ + LAGPLI V LL  SLQ IS+MF G+ G ELSLSGA
Sbjct  28   VIRANDRNRRR--QQVAEELKRQLWLAGPLILVGLLQYSLQMISVMFVGHLG-ELSLSGA  84

Query  379  SMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVW  200
            SMAT+FA+VTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + V+ LV IP+  +W
Sbjct  85   SMATSFATVTGFSLLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMFVLSLVSIPLAVIW  144

Query  199  AYTDRII  179
            A T  I+
Sbjct  145  ANTGGIL  151



>ref|XP_008453459.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Cucumis 
melo]
Length=477

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 98/146 (67%), Gaps = 11/146 (8%)
 Frame = -3

Query  586  RKAEMEIPLILESEN-----DERRKCWDEV-----SGEVKKLMVLAGPLISVNLLLTSLQ  437
            R + +  PLI +SE+     DE +  ++ +     + EVKK + LAGPLISV+LL   LQ
Sbjct  7    RNSSLNSPLIHKSEDGVNSKDESQINYENIRRKLIAEEVKKQLWLAGPLISVSLLQYCLQ  66

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL LSGASMA +F SVTGF+ + G+A ALDT CGQSYGAKQY MLGI 
Sbjct  67   MISIMFVGHLG-ELPLSGASMAVSFTSVTGFTVLLGMASALDTFCGQSYGAKQYHMLGIH  125

Query  256  TQRGIPVILLVCIPVTGVWAYTDRII  179
             QR + ++ LV IP+  +WA T  I+
Sbjct  126  VQRAMFILSLVSIPLAVIWANTGEIL  151



>ref|XP_003620349.1| hypothetical protein MTR_6g081780 [Medicago truncatula]
Length=517

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            +++ +ERRK  +EV    K  + L+GPLISV LL   +  ISLMF G+   ELSLSGASM
Sbjct  14   QNKEEERRKLVEEV----KTQLWLSGPLISVTLLNFGISLISLMFVGHLS-ELSLSGASM  68

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FASVTGFS + G+A ALDTLCGQSYGAKQY+MLGI  QR + ++++V IP+  +WA 
Sbjct  69   ATSFASVTGFSLLVGMASALDTLCGQSYGAKQYRMLGIHMQRAMFILMIVAIPLAIIWAN  128

Query  193  TDRIIGF  173
            T  I+ F
Sbjct  129  TRSILIF  135



>gb|EPS72994.1| hypothetical protein M569_01755 [Genlisea aurea]
Length=484

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
             +K ++E PL++ + +++  +  +E+  E K  + LA P++ VNLLL+ +Q IS+MF G+
Sbjct  5    NQKTDLEKPLLISTSDEKFTR--EEIVEETKTQLFLAFPMMFVNLLLSLIQNISVMFVGH  62

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL+LSGASMAT+FASVTGFS + G+A ALDT CGQS+GAKQY +LGI  QR + V+L
Sbjct  63   VG-ELALSGASMATSFASVTGFSLLVGMACALDTYCGQSHGAKQYHLLGIHMQRAMLVLL  121

Query  229  LVCIPVTGVWAYTDRII  179
            +V IP+ G+WA    I+
Sbjct  122  VVSIPLAGIWAAAGDIL  138



>ref|XP_007201925.1| hypothetical protein PRUPE_ppa020722mg [Prunus persica]
 gb|EMJ03124.1| hypothetical protein PRUPE_ppa020722mg [Prunus persica]
Length=490

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 92/137 (67%), Gaps = 5/137 (4%)
 Frame = -3

Query  571  EIPLILESENDERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             +P   +  + + RK      DE   EVKK ++L GPL+S N LL  +Q +S+M+ G+ G
Sbjct  12   SLPFADQEHDYQERKGQQLTRDEFFVEVKKQLLLVGPLVSSNFLLFCIQVVSVMYVGHLG  71

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL+LSGASMAT+FASVTG S M G+  ALDT CGQSYGAKQY MLGI  QR + V+LLV
Sbjct  72   -ELALSGASMATSFASVTGISLMIGMGSALDTFCGQSYGAKQYHMLGIHMQRAMIVLLLV  130

Query  223  CIPVTGVWAYTDRIIGF  173
             IP+  VWA T  I+ F
Sbjct  131  SIPLAVVWANTGFILEF  147



>ref|XP_007036670.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY21171.1| MATE efflux family protein [Theobroma cacao]
Length=497

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
             +EN+ R+K ++E     KK + LAGPL++V LL  S+Q ISLMF G+ G EL+LSGASM
Sbjct  33   SNENNRRKKIFEES----KKQLWLAGPLVAVTLLQYSIQMISLMFVGHLG-ELALSGASM  87

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FA+VTGFS + G+A ALDTLCGQSYGAKQY MLGI  QR + ++++V IP+  +W  
Sbjct  88   ATSFAAVTGFSLLLGMATALDTLCGQSYGAKQYPMLGIHMQRAMFILVIVSIPLAIIWVN  147

Query  193  TDRII  179
            T  I+
Sbjct  148  TRPIL  152



>ref|XP_007226244.1| hypothetical protein PRUPE_ppa017663mg [Prunus persica]
 gb|EMJ27443.1| hypothetical protein PRUPE_ppa017663mg [Prunus persica]
Length=492

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 92/137 (67%), Gaps = 5/137 (4%)
 Frame = -3

Query  571  EIPLILESENDERRK----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             +P   +  + + RK      DE   EVKK ++L GPL+S N LL  +Q +S+M+ G+ G
Sbjct  12   SLPFADQEHDYQERKGQQLTRDEFFVEVKKQLLLVGPLVSSNFLLFCIQVVSVMYVGHLG  71

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL+LSGASMAT+FASVTG S M G+  ALDT CGQSYGAKQY MLGI  QR + V+LLV
Sbjct  72   -ELALSGASMATSFASVTGISLMIGMGSALDTFCGQSYGAKQYHMLGIHMQRAMIVLLLV  130

Query  223  CIPVTGVWAYTDRIIGF  173
             IP+  VWA T  I+ F
Sbjct  131  SIPLAVVWANTGFILEF  147



>ref|XP_010319106.1| PREDICTED: MATE efflux family protein 7-like [Solanum lycopersicum]
Length=478

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = -3

Query  550  SENDERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGAS  377
            +  D  R C D  EV  E KK + LAGPL+ ++ L   LQ IS+MF G R GELSLS A+
Sbjct  21   NPEDRDRGCCDIGEVIEETKKQLELAGPLVLISFLQYFLQMISIMFVG-RLGELSLSSAT  79

Query  376  MATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWA  197
            +AT+F  VTGFSFM G+  AL+TLCGQ+YGAKQY MLGI  QRG+ V+L + IP++ +WA
Sbjct  80   LATSFTGVTGFSFMLGMGSALETLCGQAYGAKQYHMLGIHMQRGMLVLLAISIPISIIWA  139

Query  196  YTDRIIGFC  170
            +   I  FC
Sbjct  140  FAGHIFAFC  148



>ref|XP_004170251.1| PREDICTED: MATE efflux family protein DTX1-like [Cucumis sativus]
Length=494

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            N +++  W+EV  E+KK M LAGPL+ V+ L  SLQ IS+MF G+ G EL LSGASMA +
Sbjct  26   NGDQK--WEEVIREIKKQMGLAGPLVLVSFLQYSLQLISIMFIGHLG-ELQLSGASMALS  82

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFS + G+  AL+TLCGQSYG KQY+MLGI  QR + V+ L+CIP+  +WA  ++
Sbjct  83   FAGVTGFSLLLGMGSALETLCGQSYGGKQYEMLGIHMQRAMVVLSLICIPIAVLWASIEQ  142

Query  184  IIGF  173
            I+ F
Sbjct  143  ILTF  146



>gb|KGN61104.1| hypothetical protein Csa_2G049930 [Cucumis sativus]
Length=484

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            ++   +K  +  P I    +  R    DE+  EVK+ ++LAGPL++VN+L++ LQ IS+M
Sbjct  2    EEEQTKKQSLNSPFI-PPRHHGRSFTRDEIWDEVKRQVLLAGPLVTVNVLISCLQMISVM  60

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G +L L+GASMAT+FASVTGFS + G+  AL+T CGQSYGAKQY MLGI  QR +
Sbjct  61   FVGHLG-QLPLAGASMATSFASVTGFSLLNGMGSALETFCGQSYGAKQYHMLGIHMQRAM  119

Query  241  PVILLVCIPVTGVW  200
             V+LLV  P+  VW
Sbjct  120  VVLLLVSFPLAVVW  133



>ref|XP_010916291.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=510

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -3

Query  514  VSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFM  335
            +  EV++ + LAGPLI+V+LL  S+Q I++MF G+ G EL LSGASMAT+FA+VTGFS +
Sbjct  56   IVAEVRRQLWLAGPLIAVSLLHYSIQVIAVMFVGHLG-ELPLSGASMATSFANVTGFSVL  114

Query  334  RGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             G+A ALDTLCGQSYGAKQY MLGI  QR + V+LL  IP+  +WAYT +I+
Sbjct  115  LGMASALDTLCGQSYGAKQYHMLGIHMQRAMLVLLLASIPLAFIWAYTSQIL  166



>ref|XP_004160426.1| PREDICTED: MATE efflux family protein 5-like [Cucumis sativus]
Length=497

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = -3

Query  556  LESENDER-RKCWD------EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGE  398
            L S N ER R+  D      +V  E+KK + LAGPLI V+LL   LQ IS+MF G+ G E
Sbjct  21   LTSSNGERERRVNDINHRRQQVREEIKKQLWLAGPLILVSLLQYCLQMISVMFVGHLG-E  79

Query  397  LSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCI  218
            LSLSGASMAT+FA+VTGFS + G+A ALDT CGQSYGAKQ+ MLGI  QR + V+ +V I
Sbjct  80   LSLSGASMATSFATVTGFSLLMGMASALDTFCGQSYGAKQFHMLGIHMQRAMFVLSIVSI  139

Query  217  PVTGVWAYTDRIIGF  173
            P+  +WA T  I+ F
Sbjct  140  PLAVIWANTGEILKF  154



>ref|XP_004149091.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
Length=449

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            ++   +K  +  P I    +  R    DE+  EVK+ ++LAGPL++VN+L++ LQ IS+M
Sbjct  2    EEEQTKKQSLNSPFI-PPRHHGRSFTRDEIWDEVKRQVLLAGPLVTVNVLISCLQMISVM  60

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G +L L+GASMAT+FASVTGFS + G+  AL+T CGQSYGAKQY MLGI  QR +
Sbjct  61   FVGHLG-QLPLAGASMATSFASVTGFSLLNGMGSALETFCGQSYGAKQYHMLGIHMQRAM  119

Query  241  PVILLVCIPVTGVW  200
             V+LLV  P+  VW
Sbjct  120  VVLLLVSFPLAVVW  133



>ref|XP_003534150.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=489

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLI------LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTS  443
            ++    + A ++ PLI            ERR    EV  EVKK + LAGPLISV LL   
Sbjct  2    ERGDQNQSASLQSPLIKHSHSSSSGRGIERR----EVIEEVKKQLWLAGPLISVTLLNFC  57

Query  442  LQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLG  263
            L  IS+MF G+ G ELSLSGASMAT+FASVTGFS + G+A +LDT CGQSYGAKQY MLG
Sbjct  58   LSIISVMFVGHLG-ELSLSGASMATSFASVTGFSLLVGMASSLDTFCGQSYGAKQYHMLG  116

Query  262  IFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            I  QR +  +++V IP+  +WA T  I+ F
Sbjct  117  IHLQRAMFTLMIVSIPLAIIWANTRSILTF  146



>gb|KGN63858.1| hypothetical protein Csa_1G024900 [Cucumis sativus]
Length=497

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = -3

Query  556  LESENDER-RKCWD------EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGE  398
            L S N ER R+  D      +V  E+KK + LAGPLI V+LL   LQ IS+MF G+ G E
Sbjct  21   LTSSNGERERRVNDINHRRQQVGEEIKKQLWLAGPLILVSLLQYCLQMISVMFVGHLG-E  79

Query  397  LSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCI  218
            LSLSGASMAT+FA+VTGFS + G+A ALDT CGQSYGAKQ+ MLGI  QR + V+ +V I
Sbjct  80   LSLSGASMATSFATVTGFSLLMGMASALDTFCGQSYGAKQFHMLGIHMQRAMFVLSIVSI  139

Query  217  PVTGVWAYTDRIIGF  173
            P+  +WA T  I+ F
Sbjct  140  PLAVIWANTGEILKF  154



>ref|XP_004235767.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=495

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 97/147 (66%), Gaps = 10/147 (7%)
 Frame = -3

Query  586  RKAEMEIPLILESEN----DERRK-----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            + + ++ PLI + E     D  RK       +E+  EVK+ + LAGPL+SVNLL  SLQ 
Sbjct  7    KSSSVKTPLIDDREKQSILDGERKNGGGFSKEEIVEEVKRQVWLAGPLVSVNLLQFSLQL  66

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            I++MF G+ G EL LSGASMA +F SVTG S + G++ ALDT CGQSYGAKQY MLGI  
Sbjct  67   IAIMFVGHLG-ELPLSGASMANSFTSVTGISLLMGMSSALDTFCGQSYGAKQYHMLGIHM  125

Query  253  QRGIPVILLVCIPVTGVWAYTDRIIGF  173
            QR + ++ LV IP+  +WA T  I+ F
Sbjct  126  QRAMIILSLVSIPLAVIWANTGHILKF  152



>ref|XP_004137550.1| PREDICTED: MATE efflux family protein 8-like [Cucumis sativus]
Length=389

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = -3

Query  556  LESENDER-RKCWD------EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGE  398
            L S N ER R+  D      +V  E+KK + LAGPLI V+LL   LQ IS+MF G+ G E
Sbjct  21   LTSSNGERERRVNDINHRRQQVGEEIKKQLWLAGPLILVSLLQYCLQMISVMFVGHLG-E  79

Query  397  LSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCI  218
            LSLSGASMAT+FA+VTGFS + G+A ALDT CGQSYGAKQ+ MLGI  QR + V+ +V I
Sbjct  80   LSLSGASMATSFATVTGFSLLMGMASALDTFCGQSYGAKQFHMLGIHMQRAMFVLSIVSI  139

Query  217  PVTGVWAYTDRIIGF  173
            P+  +WA T  I+ F
Sbjct  140  PLAVIWANTGGILKF  154



>ref|NP_001274783.1| uncharacterized protein LOC102604804 [Solanum tuberosum]
 gb|AFX67006.1| hypothetical protein [Solanum tuberosum]
Length=495

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 10/145 (7%)
 Frame = -3

Query  586  RKAEMEIPLILESEN----DERRK-----CWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            + + ++ PLI + E     DE RK       +E+  EVK+ + LAGPL+SVNLL  SLQ 
Sbjct  7    KSSSVKTPLIDDREKQSILDETRKNGGGFSKEEIVDEVKRQVWLAGPLVSVNLLQFSLQL  66

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G +L LSGASMA +F SVTG S + G++ ALDT CGQSYGAKQY MLGI  
Sbjct  67   ISIMFVGHLG-KLPLSGASMANSFTSVTGISLLMGMSSALDTFCGQSYGAKQYHMLGIHM  125

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + V+ LV +P+  +WA T  I+
Sbjct  126  QRAMIVLSLVSVPLAVIWANTGPIL  150



>ref|XP_010675023.1| PREDICTED: MATE efflux family protein 6-like [Beta vulgaris subsp. 
vulgaris]
Length=491

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = -3

Query  550  SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMA  371
            S N  R     ++  E KK M LAGPL++VN LL SLQ IS+MF G+ G EL L+ AS+A
Sbjct  29   SSNKGRLLNKKDIVEEAKKQMKLAGPLMAVNFLLFSLQVISVMFVGHLG-ELPLAAASVA  87

Query  370  TAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYT  191
            T+FASVTG S ++G+  ALDT CGQSYGAKQY MLGI  QR + V+L + IP+  +WA T
Sbjct  88   TSFASVTGLSLLKGMGNALDTFCGQSYGAKQYHMLGIHKQRAMVVLLCISIPLAFIWANT  147

Query  190  DRIIGF  173
             +I+ F
Sbjct  148  GQILAF  153



>ref|XP_006844571.1| hypothetical protein AMTR_s00016p00194610 [Amborella trichopoda]
 gb|ERN06246.1| hypothetical protein AMTR_s00016p00194610 [Amborella trichopoda]
Length=493

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 99/145 (68%), Gaps = 10/145 (7%)
 Frame = -3

Query  592  MERKAEMEIPLILESEN-DERRKCWDEVSGEVKKL------MVLAGPLISVNLLLTSLQF  434
            ME +  +++ LI   EN D R +  D  SGE KK+      + LAGPLI+VNL   SL  
Sbjct  1    MEEENGLKLALISVQENGDPRNR--DCGSGERKKIDEIKTQIALAGPLIAVNLFQQSLCV  58

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            ISLMF G+ G ELSLSGAS+AT+FA+ TGFS + G+   L+TLCGQ+YGAKQY MLGI+ 
Sbjct  59   ISLMFVGHLG-ELSLSGASLATSFANATGFSLLSGMGSTLETLCGQAYGAKQYHMLGIYM  117

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + V+ L C+P+T +WA T  ++
Sbjct  118  QRALLVLSLFCVPLTFIWASTTTVL  142



>ref|XP_009797187.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=496

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 99/149 (66%), Gaps = 15/149 (10%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSG------------EVKKLMVLAGPLISVNLLLT  446
            E+ A ++ PLI++  + E++  +DE+              EVKK + LAGPL+SV LL  
Sbjct  6    EKSASVKTPLIVD--DREKQSLFDEIRNINGSFSKEQIVEEVKKQVWLAGPLVSVTLLQF  63

Query  445  SLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKML  266
            SLQ I++MF G+ G +L LSGASMAT+F SVTG S + G++ ALDT CGQSYGAKQY ML
Sbjct  64   SLQLIAIMFVGHLG-KLPLSGASMATSFTSVTGISLLMGMSSALDTFCGQSYGAKQYHML  122

Query  265  GIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            GI  QR + ++ LV IP+  +WA T  I+
Sbjct  123  GIHMQRAMIILSLVSIPLAVIWANTGPIL  151



>dbj|BAJ93883.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=472

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 96/138 (70%), Gaps = 8/138 (6%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME     E PL++E   DE    W     EVK+L+ LAGPL++  +L  +LQ +S+MF G
Sbjct  1    MENPRVDEQPLLVE--RDENAAAW-----EVKRLLRLAGPLVASGVLRCALQLVSVMFVG  53

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+AT+ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  54   HLG-ELHLAGASLATSLANVTGFSLLVGMASALDTLCGQAFGARQYHLLGVYKQRAMLVL  112

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA T RI+
Sbjct  113  ALACVPIALVWANTARIL  130



>ref|XP_004168000.1| PREDICTED: MATE efflux family protein 9-like [Cucumis sativus]
Length=486

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDE-----RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQ  437
            ++   +K  +E PLIL    D+     R + W+EV    K+ + LAGPL+++N+L+  LQ
Sbjct  2    EEEQTKKQSLESPLILPPREDDGGCFTRYETWEEV----KRQLRLAGPLMTMNVLINCLQ  57

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G +L L+ ASMAT+FA+VTGFS + G+  AL+T CGQSYGAKQY +LGI 
Sbjct  58   MISVMFVGHLG-QLPLASASMATSFAAVTGFSLLNGMCSALETFCGQSYGAKQYHILGIH  116

Query  256  TQRGIPVILLVCIPVTGVWAYTDRIIGF  173
             QR + V+LL+  P+ GVW     I+ F
Sbjct  117  LQRAMVVLLLISFPLAGVWFNAGVILQF  144



>ref|XP_004149092.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 9-like 
[Cucumis sativus]
Length=491

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDE-----RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQ  437
            ++   +K  +E PLIL    D+     R + W+EV    K+ + LAGPL+++N+L+  LQ
Sbjct  2    EEEQTKKQSLESPLILPPREDDGGCFTRYETWEEV----KRQLRLAGPLMTMNVLINCLQ  57

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G +L L+ ASMAT+FA+VTGFS + G+  AL+T CGQSYGAKQY +LGI 
Sbjct  58   MISVMFVGHLG-QLPLASASMATSFAAVTGFSLLNGMCSALETFCGQSYGAKQYHILGIH  116

Query  256  TQRGIPVILLVCIPVTGVWAYTDRIIGF  173
             QR + V+LL+  P+ GVW     I+ F
Sbjct  117  LQRAMVVLLLISFPLAGVWFNAGVILQF  144



>ref|XP_010516582.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=488

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 99/145 (68%), Gaps = 9/145 (6%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            R ER+  +  PLI E E   R      V  EVKK ++L+GPLI+V+LL  SLQ IS+MF 
Sbjct  3    REEREDTLSWPLIGEKEKRSRL-----VKEEVKKQLLLSGPLIAVSLLQFSLQIISVMFV  57

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  LSLS AS+AT+FASVTGF+F+ G A ALDT+CGQSYG+K Y +LGI  QR + V
Sbjct  58   GHLG-SLSLSAASIATSFASVTGFTFLMGTASALDTVCGQSYGSKMYGLLGIQMQRAMLV  116

Query  235  ILLVCIPVTGVWAYTDRIIGFCVFY  161
            + L  +P++ +WA T+    F VF+
Sbjct  117  LTLFSVPLSIIWANTEH---FLVFF  138



>ref|XP_002511322.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF51924.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=471

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLILESEN-DERRKCWDE-------VSGEVKKLMVLAGPLISVNLLL  449
            D+++   K  +   LI  S N D     W+E       +  E+KK M LAGPL+ V+ L 
Sbjct  2    DRQQCTSKTCLHASLIQNSNNVDHDVNSWNEKYYGKAEIITELKKQMRLAGPLVIVSFLQ  61

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
             SLQ IS+MF G R G LSLS ASMAT+FA VTGF FM G+  AL+TLCGQ+YGAKQY M
Sbjct  62   YSLQMISVMFVG-RLGVLSLSSASMATSFAGVTGFGFMLGMGAALETLCGQAYGAKQYHM  120

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            LG+  QR + V+ LV IP++ +W+ T+ I  F
Sbjct  121  LGVHMQRAMLVLALVNIPISLLWSCTEPIFRF  152



>ref|XP_008464505.1| PREDICTED: MATE efflux family protein DTX1-like [Cucumis melo]
Length=473

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -3

Query  547  ENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMAT  368
            + D++   W+EV  E+KK M LAGPL+ V+ L  SLQ IS+MF G+ G EL LSGASMA 
Sbjct  4    DGDQK---WEEVIREIKKQMGLAGPLVLVSFLQYSLQLISIMFIGHLG-ELQLSGASMAL  59

Query  367  AFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTD  188
            +FA VTGFS + G+  AL+TLCGQS+G KQY+MLGI  QR + V+ L+CIP+  +WA  +
Sbjct  60   SFAGVTGFSLLLGMGSALETLCGQSFGGKQYEMLGIHMQRAMVVLSLICIPIALLWASIE  119

Query  187  RIIGF  173
            +I+ F
Sbjct  120  QILTF  124



>gb|KGN63856.1| hypothetical protein Csa_1G024880 [Cucumis sativus]
Length=496

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 97/146 (66%), Gaps = 11/146 (8%)
 Frame = -3

Query  586  RKAEMEIPLILESEN-----DERRKCWDEV-----SGEVKKLMVLAGPLISVNLLLTSLQ  437
            + +    PLI +SE+     DER+  ++ +     + EVKK + LAGPLI V+LL   LQ
Sbjct  7    QNSSFNSPLIHKSEDEVNSKDERQIDYENIRRKLIAEEVKKQLWLAGPLILVSLLQYCLQ  66

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL LSGASMA +F SVTGF+ + G+A ALDT CGQSYGAKQY MLGI 
Sbjct  67   MISIMFVGHLG-ELPLSGASMAVSFTSVTGFTVLLGMASALDTFCGQSYGAKQYHMLGIH  125

Query  256  TQRGIPVILLVCIPVTGVWAYTDRII  179
             QR + V+ LV IP+  +WA T  I+
Sbjct  126  LQRAMFVLSLVSIPLAVIWANTGEIL  151



>ref|XP_004160427.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
Length=496

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 97/146 (66%), Gaps = 11/146 (8%)
 Frame = -3

Query  586  RKAEMEIPLILESEN-----DERRKCWDEV-----SGEVKKLMVLAGPLISVNLLLTSLQ  437
            + +    PLI +SE+     DER+  ++ +     + EVKK + LAGPLI V+LL   LQ
Sbjct  7    QNSSFNSPLIHKSEDEVNSKDERQIDYENIRRKLIAEEVKKQLWLAGPLILVSLLQYCLQ  66

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL LSGASMA +F SVTGF+ + G+A ALDT CGQSYGAKQY MLGI 
Sbjct  67   MISIMFVGHLG-ELPLSGASMAVSFTSVTGFTVLLGMASALDTFCGQSYGAKQYHMLGIH  125

Query  256  TQRGIPVILLVCIPVTGVWAYTDRII  179
             QR + V+ LV IP+  +WA T  I+
Sbjct  126  LQRAMFVLSLVSIPLAVIWANTGEIL  151



>ref|XP_004137332.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
Length=496

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 97/146 (66%), Gaps = 11/146 (8%)
 Frame = -3

Query  586  RKAEMEIPLILESEN-----DERRKCWDEV-----SGEVKKLMVLAGPLISVNLLLTSLQ  437
            + +    PLI +SE+     DER+  ++ +     + EVKK + LAGPLI V+LL   LQ
Sbjct  7    QNSSFNSPLIHKSEDEVNSKDERQIDYENIRRKLIAEEVKKQLWLAGPLILVSLLQYCLQ  66

Query  436  FISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIF  257
             IS+MF G+ G EL LSGASMA +F SVTGF+ + G+A ALDT CGQSYGAKQY MLGI 
Sbjct  67   MISIMFVGHLG-ELPLSGASMAVSFTSVTGFTVLLGMASALDTFCGQSYGAKQYHMLGIH  125

Query  256  TQRGIPVILLVCIPVTGVWAYTDRII  179
             QR + V+ LV IP+  +WA T  I+
Sbjct  126  LQRAMFVLSLVSIPLAVIWANTGEIL  151



>ref|XP_008453465.1| PREDICTED: MATE efflux family protein 5-like [Cucumis melo]
Length=492

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 98/149 (66%), Gaps = 13/149 (9%)
 Frame = -3

Query  619  VRIWQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            + I +D    ER+          ++ + RRK   +V  E+KK + LAGPLI V+LL   L
Sbjct  14   LHISEDGSNGERRV---------NDVNHRRK---QVGEEIKKQLWLAGPLILVSLLQYCL  61

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G EL+LSGASMAT+FA+VTGFS + G+A ALDT CGQS GAKQY MLGI
Sbjct  62   QMISVMFVGHLG-ELALSGASMATSFATVTGFSLLMGMASALDTFCGQSNGAKQYHMLGI  120

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
              QR + V+ LV IP+  +WA T  I+ F
Sbjct  121  HMQRAMFVLSLVSIPLAVIWANTGGILKF  149



>ref|XP_009380941.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=510

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  517  EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSF  338
            +V  E ++L+ LAGPLI+ +LL  SLQ IS+MF G+ G EL+LSGASMAT+FA+V+GFS 
Sbjct  37   DVVAEARRLLSLAGPLIAASLLQYSLQLISIMFVGHLG-ELNLSGASMATSFANVSGFSV  95

Query  337  MRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            + G+A ALDT CGQ+YGAK+Y MLGI  QR + ++LLV +P+  VW YT +I+
Sbjct  96   LLGMASALDTSCGQAYGAKEYHMLGIHMQRAMFILLLVSVPLALVWTYTSQIL  148



>ref|XP_010319016.1| PREDICTED: MATE efflux family protein 7-like [Solanum lycopersicum]
Length=481

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = -3

Query  574  MEIPLILESENDERRKCWD---EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
            ++ PL+ E + +   K W    E   E+KK + LAGPL+ V  +   L  IS+MF G+ G
Sbjct  11   LDFPLLNEKDPENGIKRWYDMYETIEELKKQLELAGPLVVVGFMQYFLLLISVMFVGHLG  70

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             ELSLS A++AT+FA VTGF FM G+A AL+TLCGQ+YGAKQY MLGI  QRG+ V++ +
Sbjct  71   -ELSLSSATLATSFAGVTGFRFMLGMASALETLCGQAYGAKQYHMLGIHMQRGMLVVVAI  129

Query  223  CIPVTGVWAYTDRIIGFC  170
             IP++ VWA+   I  FC
Sbjct  130  SIPISIVWAFAGHIFAFC  147



>ref|XP_009380942.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  517  EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSF  338
            +V  E ++L+ LAGPLI+ +LL  SLQ IS+MF G+ G EL+LSGASMAT+FA+V+GFS 
Sbjct  37   DVVAEARRLLSLAGPLIAASLLQYSLQLISIMFVGHLG-ELNLSGASMATSFANVSGFSV  95

Query  337  MRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            + G+A ALDT CGQ+YGAK+Y MLGI  QR + ++LLV +P+  VW YT +I+
Sbjct  96   LLGMASALDTSCGQAYGAKEYHMLGIHMQRAMFILLLVSVPLALVWTYTSQIL  148



>ref|XP_002879493.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55752.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ER+A +  PLI   E  ER +   E   EVKK ++L+GPLI+V+LL   LQ IS+MF G+
Sbjct  4    EREAMLSWPLI--GEKKERSRLVKE---EVKKQLLLSGPLIAVSLLQFCLQIISVMFVGH  58

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G  L LS AS+AT+FASVTGF+F+ G A ALDT+CGQSYGAK Y MLGI  QR + V+ 
Sbjct  59   LG-SLPLSAASIATSFASVTGFTFLMGTASALDTVCGQSYGAKMYGMLGIQMQRAMLVLT  117

Query  229  LVCIPVTGVWAYTDRIIGF  173
            L  IP++ VWA T+  + F
Sbjct  118  LFSIPLSIVWANTEHFLVF  136



>ref|XP_009383615.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            N+   K   E   E+K+ + LAGPLI+ +LL   LQ IS+MF G+ G EL+LSGASMAT+
Sbjct  26   NEAGLKSDGEFFAEIKRQLCLAGPLIASSLLQNILQVISVMFVGHLG-ELALSGASMATS  84

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFSF+ G++ ALDT+CGQ++GAKQY MLGI  QR +  + LV +PV  +W+YT  
Sbjct  85   FAGVTGFSFLLGMSTALDTMCGQAFGAKQYHMLGIHMQRAMLALTLVSLPVAVIWSYTGS  144

Query  184  IIGFC  170
            I+  C
Sbjct  145  ILKLC  149



>gb|EMT24674.1| Multidrug and toxin extrusion protein 1 [Aegilops tauschii]
Length=481

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 99/147 (67%), Gaps = 8/147 (5%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLIL--ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +  K M+  +  E PL++    E DE     +  + E K+L+ LAGPL++  LL  +LQ 
Sbjct  51   KADKNMQNPSVDEQPLLVAGSVERDE-----NVAASEAKRLLRLAGPLVASGLLQCALQL  105

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            +S+MF G+ G EL L+GAS+AT+ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ 
Sbjct  106  VSVMFVGHLG-ELHLAGASLATSLANVTGFSLLAGMASALDTLCGQAFGARQYHLLGVYK  164

Query  253  QRGIPVILLVCIPVTGVWAYTDRIIGF  173
            QR + V+ L C+P+  VW  T RI+ F
Sbjct  165  QRAMLVLALACVPIALVWTNTTRILLF  191



>ref|XP_002511323.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF51925.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=503

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = -3

Query  574  MEIPLILESEN------DERRKCWDEVSG--EVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            M+ PLI   EN      ++ RKC+ E     E+K+ M LAGPLI+V+    SLQ IS+MF
Sbjct  11   MQSPLIATHENIVEYDANQGRKCYLEAETITELKRQMSLAGPLIAVSFFQYSLQMISVMF  70

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G ELSL+ ASMAT+FA VTGFSF++G+  AL+T  GQ+YGA+QY MLG+ TQR + 
Sbjct  71   VGHLG-ELSLASASMATSFAGVTGFSFLQGMGSALETFSGQAYGARQYHMLGVHTQRAML  129

Query  238  VILLVCIPVTGVWAYTDRIIGFCVF  164
            V+ L+ IP++  W Y+  I  F +F
Sbjct  130  VLALMSIPISFFWLYSGHI--FLIF  152



>dbj|BAK02636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 6/145 (4%)
 Frame = -3

Query  598  KRMERKA---EMEIPLILESENDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
             R  R A    ME  L++       +K  DE  V  EVKK + LAGPL+   LL   +Q 
Sbjct  6    HRHSRPAAWSSMEDQLLVPGSPGIEKKGEDESLVLSEVKKQLRLAGPLVVGCLLQNVVQM  65

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LS ASMAT+FA+VTGFS + G+A +LDTLCGQ+YGA Q++MLG++ 
Sbjct  66   ISVMFVGHLG-ELALSSASMATSFANVTGFSLLAGMACSLDTLCGQAYGASQHRMLGVYK  124

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + V+ L  +PV  +WA+T RI+
Sbjct  125  QRAMLVLSLTSVPVAALWAHTGRIL  149



>ref|XP_010910813.1| PREDICTED: MATE efflux family protein 5-like, partial [Elaeis 
guineensis]
Length=456

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 92/139 (66%), Gaps = 7/139 (5%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNR  407
             K  +E PL+      ER     EV  EVK+ + L+GPLI+ NLL   +Q IS+MF G+ 
Sbjct  2    EKPSLEAPLV--PSTKER----GEVLAEVKRQLWLSGPLITANLLQYIIQVISVMFVGHL  55

Query  406  GGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILL  227
            G EL+L+GASMA +FA VTGFS + G    LDTLCGQS+GAKQY MLGI  QR + V+ L
Sbjct  56   G-ELALAGASMAISFAGVTGFSVLMGFGSTLDTLCGQSFGAKQYNMLGIHMQRAMLVVTL  114

Query  226  VCIPVTGVWAYTDRIIGFC  170
            + +P+  +WAYT +I+  C
Sbjct  115  LSVPIAIIWAYTTQILMAC  133



>ref|XP_010044141.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Eucalyptus 
grandis]
Length=464

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 98/162 (60%), Gaps = 22/162 (14%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERR-----------------KCWDE----VSGEVKKLMV  485
             + +   A +E PLI   ++D  R                 +  DE    +  EVKK   
Sbjct  7    DREIHEAALLESPLIQNRDHDHERDDGGDGGGGEKSSLGLARIGDESRAIIFEEVKKQAW  66

Query  484  LAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTL  305
            L+GPLI V+LL   +Q IS+MF G+ G EL LSGASMAT+FASVTGFS + G+  AL+TL
Sbjct  67   LSGPLIGVSLLQYCIQVISVMFVGHLG-ELHLSGASMATSFASVTGFSVLLGMGSALETL  125

Query  304  CGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            CGQ+YGAKQY MLG++TQR +  +L V IP+  VW YT  I+
Sbjct  126  CGQAYGAKQYHMLGVYTQRAMLTLLCVSIPLAVVWLYTSDIL  167



>ref|XP_009587005.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=492

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -3

Query  589  ERKAE--MEIPLILESEN------DERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTSL  440
            ER +E  +E PL+   E       D  + C D  E   E+KK + LAGPL+ V+ L   L
Sbjct  4    ERNSEFLLEFPLLSNIEKGSRNPEDHDKWCCDIAEAIEELKKQLELAGPLVLVSFLQYFL  63

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+   EL LS A++AT+FA VTGFSFM GL  A++TLCGQ+YGAKQY MLGI
Sbjct  64   QMISIMFVGHLE-ELPLSSATLATSFAGVTGFSFMLGLGSAMETLCGQAYGAKQYHMLGI  122

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
              QRG+ V++ + IP++ +WA+   I  FC
Sbjct  123  HMQRGMLVLVAIGIPISIIWAFAGHIFAFC  152



>ref|XP_009789171.1| PREDICTED: MATE efflux family protein 7-like isoform X2 [Nicotiana 
sylvestris]
Length=482

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -3

Query  589  ERKAE--MEIPLILE----SENDERRKCW----DEVSGEVKKLMVLAGPLISVNLLLTSL  440
            ER +E  ++ PL+      S N E    W     E   E+KK + LAGPL+ V+ L   L
Sbjct  4    ERNSEFLIDYPLLSNIEKGSRNPEEHDKWFCDIAEAIEELKKQLELAGPLVLVSFLQYFL  63

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G +L LS A++AT+FA VTGFSFM GL  AL+TLCGQ+YGAKQY MLGI
Sbjct  64   QMISIMFVGHLG-QLPLSSATLATSFAGVTGFSFMLGLGSALETLCGQAYGAKQYHMLGI  122

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
              QRG+ V++ + +P++ +WA+   I  FC
Sbjct  123  HMQRGMLVLVTIGLPISIIWAFAGHIFAFC  152



>ref|XP_009789172.1| PREDICTED: MATE efflux family protein 5-like isoform X3 [Nicotiana 
sylvestris]
Length=478

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -3

Query  589  ERKAE--MEIPLILE----SENDERRKCW----DEVSGEVKKLMVLAGPLISVNLLLTSL  440
            ER +E  ++ PL+      S N E    W     E   E+KK + LAGPL+ V+ L   L
Sbjct  4    ERNSEFLIDYPLLSNIEKGSRNPEEHDKWFCDIAEAIEELKKQLELAGPLVLVSFLQYFL  63

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G +L LS A++AT+FA VTGFSFM GL  AL+TLCGQ+YGAKQY MLGI
Sbjct  64   QMISIMFVGHLG-QLPLSSATLATSFAGVTGFSFMLGLGSALETLCGQAYGAKQYHMLGI  122

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
              QRG+ V++ + +P++ +WA+   I  FC
Sbjct  123  HMQRGMLVLVTIGLPISIIWAFAGHIFAFC  152



>gb|AAM93464.1| hypothetical protein [Oryza sativa Japonica Group]
Length=479

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSG----EVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            + A ME PLI  S      K   E  G    E+KK + LAGPL+   LL   +Q IS+MF
Sbjct  2    KAAAMEEPLIAGSSGGAAEKNGGEEEGLVVTEIKKQLYLAGPLVVGMLLQNVVQMISVMF  61

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LS ASMAT+FA VTGFS + G+A +LDTLCGQ++GAKQ+ MLG++ QR + 
Sbjct  62   VGHLG-ELALSSASMATSFAGVTGFSLLAGMASSLDTLCGQAFGAKQHHMLGVYKQRAML  120

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+ LV +P+  VWA+T  I+
Sbjct  121  VLALVSVPIAAVWAFTGEIL  140



>gb|EMT14550.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=466

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME+ +  E PL++E   DE     +  + E K+L+ LAGPL++  +L  +LQ +S+MF G
Sbjct  1    MEKPSVDEQPLLVE--RDE-----NAAAPEAKRLLRLAGPLVASGILQCALQLVSVMFVG  53

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+AT+ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  54   HLG-ELPLAGASLATSLANVTGFSLLVGMASALDTLCGQAFGARQYHLLGVYKQRAMLVL  112

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA T RI+
Sbjct  113  TLACVPIALVWANTARIL  130



>ref|XP_009789170.1| PREDICTED: MATE efflux family protein 7-like isoform X1 [Nicotiana 
sylvestris]
Length=490

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -3

Query  589  ERKAE--MEIPLILE----SENDERRKCW----DEVSGEVKKLMVLAGPLISVNLLLTSL  440
            ER +E  ++ PL+      S N E    W     E   E+KK + LAGPL+ V+ L   L
Sbjct  4    ERNSEFLIDYPLLSNIEKGSRNPEEHDKWFCDIAEAIEELKKQLELAGPLVLVSFLQYFL  63

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+MF G+ G +L LS A++AT+FA VTGFSFM GL  AL+TLCGQ+YGAKQY MLGI
Sbjct  64   QMISIMFVGHLG-QLPLSSATLATSFAGVTGFSFMLGLGSALETLCGQAYGAKQYHMLGI  122

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
              QRG+ V++ + +P++ +WA+   I  FC
Sbjct  123  HMQRGMLVLVTIGLPISIIWAFAGHIFAFC  152



>gb|ABG65963.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=485

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSG----EVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            + A ME PLI  S      K   E  G    E+KK + LAGPL+   LL   +Q IS+MF
Sbjct  2    KAAAMEEPLIAGSSGGAAEKNGGEEEGLVVTEIKKQLYLAGPLVVGMLLQNVVQMISVMF  61

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LS ASMAT+FA VTGFS + G+A +LDTLCGQ++GAKQ+ MLG++ QR + 
Sbjct  62   VGHLG-ELALSSASMATSFAGVTGFSLLAGMASSLDTLCGQAFGAKQHHMLGVYKQRAML  120

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+ LV +P+  VWA+T  I+
Sbjct  121  VLALVSVPIAAVWAFTGEIL  140



>ref|XP_009799154.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=530

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 98/151 (65%), Gaps = 6/151 (4%)
 Frame = -3

Query  625  CHVRIWQDQKRMERKAEME-IPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLL  449
            C  +        ERK ++E  P +  S N+ +    DE   EVKKL+ LAGPL+ VNLLL
Sbjct  42   CETKFVGKTDIQERKQDLEECPQVPNSRNERKS---DEFFEEVKKLLALAGPLMLVNLLL  98

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
              LQ ISLMF G+ G EL+LSGAS+AT+FA VTG+S + G+  AL+TLCGQSYGA  + M
Sbjct  99   YFLQVISLMFVGHLG-ELALSGASLATSFAFVTGYSLLVGMGSALETLCGQSYGALHHYM  157

Query  268  LGIFTQRGIPV-ILLVCIPVTGVWAYTDRII  179
            LGI  QR + V +L++ IP+  +WA    I+
Sbjct  158  LGIHMQRAMFVSLLIISIPIVCIWANAGHIL  188



>gb|EEC66670.1| hypothetical protein OsI_32958 [Oryza sativa Indica Group]
 gb|EEE50690.1| hypothetical protein OsJ_30950 [Oryza sativa Japonica Group]
Length=500

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSG----EVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            + A ME PLI  S      K   E  G    E+KK + LAGPL+   LL   +Q IS+MF
Sbjct  2    KAAAMEEPLIAGSSGGAAEKNGGEEEGLVVTEIKKQLYLAGPLVVGMLLQNVVQMISVMF  61

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LS ASMAT+FA VTGFS + G+A +LDTLCGQ++GAKQ+ MLG++ QR + 
Sbjct  62   VGHLG-ELALSSASMATSFAGVTGFSLLAGMASSLDTLCGQAFGAKQHHMLGVYKQRAML  120

Query  238  VILLVCIPVTGVWAYTDRII  179
            V+ LV +P+  VWA+T  I+
Sbjct  121  VLALVSVPIAAVWAFTGEIL  140



>ref|XP_010674917.1| PREDICTED: MATE efflux family protein 7-like [Beta vulgaris subsp. 
vulgaris]
Length=491

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 10/144 (7%)
 Frame = -3

Query  577  EMEIPLILE---------SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            ++E PL  E         S N+ R     E+  E KK + LAG L++VN LL SLQ IS+
Sbjct  11   DLETPLTNENNYIVNDGVSSNEGRLLNKKEIVKEAKKQIKLAGSLMAVNFLLFSLQVISV  70

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL L+ AS+AT+FASVTG S ++G+  ALDT CGQSYGAKQY MLGI  QR 
Sbjct  71   MFVGHLG-ELPLAAASIATSFASVTGLSLLKGMENALDTFCGQSYGAKQYHMLGIHKQRA  129

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+L + IP+  +W  T +I+ F
Sbjct  130  MVVLLCISIPLAFIWENTGQILAF  153



>ref|XP_009607555.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=496

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = -3

Query  589  ERKAEMEIPLIL----------ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            E+ A ++ PLI+          E+ N+      +++  EVKK + LAGPL+SV LL  SL
Sbjct  6    EKSASVKTPLIVDDREKQSLFNETRNNNGGFSKEQIVEEVKKQVWLAGPLVSVTLLQFSL  65

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q I++MF G+ G +L LSGASMAT+F SVTG S + G++ ALDT CGQSYGAKQY MLGI
Sbjct  66   QLIAIMFVGHLG-KLPLSGASMATSFTSVTGISLLMGMSSALDTFCGQSYGAKQYHMLGI  124

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRII  179
              QR + ++ LV IP+  +W  T  I+
Sbjct  125  HMQRAMIILSLVSIPLAVIWGNTGPIL  151



>gb|KCW81033.1| hypothetical protein EUGRSUZ_C02409 [Eucalyptus grandis]
Length=409

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 9/139 (6%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            DE+  E+K+ + LAGPL+SVNL++  LQ IS+MF G+ G EL+LSGASMAT+FASVTGFS
Sbjct  33   DEIFSEIKQQLSLAGPLVSVNLMIYCLQVISVMFVGHLG-ELALSGASMATSFASVTGFS  91

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             +       DT CGQSYGAKQY MLGI  QR + V+LL  IP+  +WA T +I+   +F+
Sbjct  92   MLEWQVH-WDTFCGQSYGAKQYHMLGIHKQRAMIVLLLASIPLAIIWANTGQIL---LFF  147

Query  160  RAIILCFPSPSLEVGGGAR  104
            +      P  S E G  AR
Sbjct  148  KQD----PQISAEAGSYAR  162



>ref|XP_011038705.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Populus 
euphratica]
Length=497

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 10/145 (7%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRK---------CWDEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
             K+ +E  LIL  E               C ++  GE KK + LAGPLI+V+LL   LQ 
Sbjct  10   EKSSLESHLILNQERSHGVDGEVSQQGCFCGEDFIGEAKKQLWLAGPLIAVSLLQYCLQV  69

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LS ASMA +FASVTGFS + G+  AL+TLCGQ+YGAKQY MLGI T
Sbjct  70   ISIMFVGHLG-ELALSSASMACSFASVTGFSVLLGMGSALETLCGQAYGAKQYHMLGIHT  128

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR +  +L V IP+  +W YT  ++
Sbjct  129  QRAMLTLLTVSIPLAIIWFYTGTLL  153



>ref|XP_010044147.1| PREDICTED: MATE efflux family protein 5-like [Eucalyptus grandis]
 gb|KCW86186.1| hypothetical protein EUGRSUZ_B02875 [Eucalyptus grandis]
Length=505

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 98/159 (62%), Gaps = 19/159 (12%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERR-------KC-------WDE----VSGEVKKLMVLAG  476
             + +   A +E PLI   +++  R       KC        DE    +  EVKK   L+G
Sbjct  7    DREIHEAALLESPLIQNRDHEHERNDGGGGEKCSLGSARRGDESRAIIFEEVKKQAWLSG  66

Query  475  PLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQ  296
            PLI V LL   +Q IS+MF G+ G EL LSGASMAT+FASVTGFS + G+  AL+TLCGQ
Sbjct  67   PLIGVCLLQYCIQVISVMFVGHLG-ELPLSGASMATSFASVTGFSVLLGMGSALETLCGQ  125

Query  295  SYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +YGAKQY MLG++TQR +  +L V IP+  VW YT  I+
Sbjct  126  AYGAKQYHMLGVYTQRAMLTLLCVSIPLAVVWLYTSDIL  164



>ref|XP_003573834.1| PREDICTED: MATE efflux family protein 5-like [Brachypodium distachyon]
Length=472

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 98/136 (72%), Gaps = 7/136 (5%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNR  407
            +K  +E PL+     +      + V+GE K+L+ LAGPL++ ++L  +LQ +S+MF G+ 
Sbjct  2    QKPGVEEPLLAAGSEE------NAVAGEAKQLLRLAGPLVASSILQCALQLVSVMFVGHL  55

Query  406  GGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILL  227
            G EL+L+GAS+AT+ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+ L
Sbjct  56   G-ELALAGASLATSLANVTGFSLLVGMASALDTLCGQAFGARQYDLLGVYKQRAMLVLAL  114

Query  226  VCIPVTGVWAYTDRII  179
             C+P+  +WA T RI+
Sbjct  115  ACVPIVLLWANTGRIL  130



>ref|NP_180983.4| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEC08964.1| MATE efflux family protein [Arabidopsis thaliana]
Length=480

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 9/145 (6%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            R ER+  +  PLI E E   R      V  EV+K ++L+GPLI+V+LL   LQ IS+MF 
Sbjct  2    REEREDMLSWPLIGEKEKRSRF-----VKEEVEKQLLLSGPLIAVSLLQFCLQIISVMFV  56

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  L LS AS+AT+FASVTGF+F+ G A A+DT+CGQSYGAK Y MLGI  QR + V
Sbjct  57   GHLG-SLPLSAASIATSFASVTGFTFLMGTASAMDTVCGQSYGAKMYGMLGIQMQRAMLV  115

Query  235  ILLVCIPVTGVWAYTDRIIGFCVFY  161
            + L+ +P++ VWA T+    F VF+
Sbjct  116  LTLLSVPLSIVWANTEH---FLVFF  137



>ref|XP_003532532.1| PREDICTED: MATE efflux family protein DTX1-like [Glycine max]
Length=498

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 14/152 (9%)
 Frame = -3

Query  595  RMERKAEMEIPLI-------LESENDERRKCWD------EVSGEVKKLMVLAGPLISVNL  455
            R ++KA +   LI       L+ +N +R K         E+  EV+K + LAGPLISV++
Sbjct  3    REDQKASLLSQLIHITVEDRLKVDNIQRNKDKQQAIERAELYEEVRKQLWLAGPLISVSM  62

Query  454  LLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQY  275
            L  S Q IS+MF G+ G +L LSGASMAT+FASVTGFS + G+A ALDTLCGQSYGAKQ+
Sbjct  63   LNYSQQIISVMFVGHLG-QLPLSGASMATSFASVTGFSLLVGMASALDTLCGQSYGAKQH  121

Query  274  KMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             MLGI  QR + V+++V I +  +WA T  I+
Sbjct  122  HMLGIHMQRAMLVLMIVSINLAFIWANTRSIL  153



>ref|XP_004242678.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Solanum 
lycopersicum]
Length=489

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -3

Query  577  EMEIPLILESENDERRKCW-DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGG  401
            ++E  LI E+ N+E  K   +E+  E+K+L+VLAGPL++VN LL  LQ IS+MF G+ G 
Sbjct  5    DIECSLIRETVNEEESKNKKNEIFEEMKRLLVLAGPLMTVNFLLYCLQVISIMFVGHLG-  63

Query  400  ELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVC  221
            EL LSGASMAT+FASVTG S M G+  AL+TLCGQSYGAKQY MLGI  QR + V+LLV 
Sbjct  64   ELPLSGASMATSFASVTGLSLMMGMGSALETLCGQSYGAKQYHMLGIHMQRAMLVLLLVS  123

Query  220  IPVTGVWA  197
            +PV  VWA
Sbjct  124  VPVAFVWA  131



>gb|AAC27412.1| hypothetical protein [Arabidopsis thaliana]
Length=466

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 96/141 (68%), Gaps = 6/141 (4%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            R ER+  +  PLI E E   R      V  EV+K ++L+GPLI+V+LL   LQ IS+MF 
Sbjct  2    REEREDMLSWPLIGEKEKRSRF-----VKEEVEKQLLLSGPLIAVSLLQFCLQIISVMFV  56

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  L LS AS+AT+FASVTGF+F+ G A A+DT+CGQSYGAK Y MLGI  QR + V
Sbjct  57   GHLG-SLPLSAASIATSFASVTGFTFLMGTASAMDTVCGQSYGAKMYGMLGIQMQRAMLV  115

Query  235  ILLVCIPVTGVWAYTDRIIGF  173
            + L+ +P++ VWA T+  + F
Sbjct  116  LTLLSVPLSIVWANTEHFLVF  136



>emb|CDY68867.1| BnaC07g51050D, partial [Brassica napus]
Length=468

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 4/145 (3%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            Q  ++ +R      P        +  K   E   EVKK   L+ PLI V+LL  SLQ IS
Sbjct  3    QQTEKADRDTATVSPAATNGNKSDTGKVIKE---EVKKQFWLSAPLIGVSLLQYSLQVIS  59

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGF+F+ G A AL+TLCGQSYGAK Y  LGI+ QR
Sbjct  60   VMFVGHLG-SLPLSAASIATSFASVTGFTFLMGTASALETLCGQSYGAKMYGKLGIYMQR  118

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+L++ IP++ VWAYT+ I+ F
Sbjct  119  AMFVLLILSIPLSVVWAYTENILVF  143



>ref|XP_002315903.1| hypothetical protein POPTR_0010s12690g [Populus trichocarpa]
 gb|EEF02074.1| hypothetical protein POPTR_0010s12690g [Populus trichocarpa]
Length=481

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 13/150 (9%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRK------------CWDEVSGEVKKLMVLAGPLISVNLLL  449
            ME  AE      L   N ER              C ++  GE KK + LAGPLI+V+LL 
Sbjct  1    METGAEKSSLESLLIRNQERSHGVDGEVSQQGCFCREDFIGEAKKQLWLAGPLIAVSLLQ  60

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
              LQ IS+MF G+ G EL+LS ASMA +FASVTGFS + G+  AL+TLCGQ+YGAKQY M
Sbjct  61   YCLQVISIMFVGHLG-ELALSSASMACSFASVTGFSVLLGMGSALETLCGQAYGAKQYHM  119

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            LGI TQR +  +L+V IP+  +W YT  ++
Sbjct  120  LGIHTQRAMLTLLIVSIPLAIIWFYTGTLL  149



>ref|XP_008776058.1| PREDICTED: MATE efflux family protein DTX1-like [Phoenix dactylifera]
Length=510

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  GEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRG  329
             EV++ + LAGPLI+V+LL  S+Q IS+MF G+ G EL LSGASMAT+FA+VTGFS + G
Sbjct  58   AEVRRQLWLAGPLIAVSLLHYSIQVISVMFVGHLG-ELPLSGASMATSFANVTGFSVLLG  116

Query  328  LAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +A ALDTLCGQ YGAKQY MLGI  QR + V+LL  IP+  + AYT +I+
Sbjct  117  MASALDTLCGQGYGAKQYHMLGIHMQRAMLVLLLASIPLAFILAYTSQIL  166



>ref|XP_010323237.1| PREDICTED: MATE efflux family protein 6-like isoform X2 [Solanum 
lycopersicum]
Length=482

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -3

Query  577  EMEIPLILESENDERRKCW-DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGG  401
            ++E  LI E+ N+E  K   +E+  E+K+L+VLAGPL++VN LL  LQ IS+MF G+ G 
Sbjct  5    DIECSLIRETVNEEESKNKKNEIFEEMKRLLVLAGPLMTVNFLLYCLQVISIMFVGHLG-  63

Query  400  ELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVC  221
            EL LSGASMAT+FASVTG S M G+  AL+TLCGQSYGAKQY MLGI  QR + V+LLV 
Sbjct  64   ELPLSGASMATSFASVTGLSLMMGMGSALETLCGQSYGAKQYHMLGIHMQRAMLVLLLVS  123

Query  220  IPVTGVWA  197
            +PV  VWA
Sbjct  124  VPVAFVWA  131



>ref|XP_010087832.1| MATE efflux family protein 6 [Morus notabilis]
 gb|EXB30268.1| MATE efflux family protein 6 [Morus notabilis]
Length=466

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 100/154 (65%), Gaps = 17/154 (11%)
 Frame = -3

Query  598  KRMERKAEMEIPLILESENDE-------------RRKCWDEVSGEVKKLMVLAGPLISVN  458
            +R + K  +  PLI   E +              +RK   E+  EVKK + LAGP+ISV 
Sbjct  2    ERDDHKPTLTAPLIQICEENGLNNGSGGVHDKGFKRK---EILEEVKKQLWLAGPMISVG  58

Query  457  LLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQ  278
            LL   LQ IS+MF G+ G E+ LSGASMAT+FA+VTGFS + G+AGAL+TL GQ+YGAKQ
Sbjct  59   LLQYFLQMISIMFVGHLG-EIPLSGASMATSFATVTGFSLLLGMAGALETLSGQAYGAKQ  117

Query  277  YKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIG  176
            Y ++ ++ QR + V+LLV IP+  +WA T+ I+ 
Sbjct  118  YHLMSVYMQRSMIVLLLVSIPLAVIWANTEPILA  151



>ref|XP_009132984.1| PREDICTED: MATE efflux family protein 5-like [Brassica rapa]
Length=485

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 94/143 (66%), Gaps = 8/143 (6%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ER   +  PLI E+E          +  EVKK + LAGPLI+V+LL   LQ IS+MF G+
Sbjct  4    ERDEMLSWPLIGENEKSSS----SGIKVEVKKQLWLAGPLIAVSLLQFCLQVISVMFVGH  59

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G  L LS AS+AT+FASVTGFSF+ G A ALDT+CGQSYGAK Y MLGI  QR + V+ 
Sbjct  60   LG-SLPLSAASVATSFASVTGFSFLMGTASALDTVCGQSYGAKMYGMLGIQMQRAMFVLT  118

Query  229  LVCIPVTGVWAYTDRIIGFCVFY  161
            L  IP++ VWA T+    F VF+
Sbjct  119  LYSIPLSIVWANTEH---FLVFF  138



>ref|XP_004299560.1| PREDICTED: MATE efflux family protein 6-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 7/145 (5%)
 Frame = -3

Query  598  KRMERKAEMEIPLILESENDERRKC--W---DEVSGEVKKLMVLAGPLISVNLLLTSLQF  434
            +R +  + +  PLI   E DE R    W   +EV  EVK+ + LAGPLI V++L  S+Q 
Sbjct  2    EREDNSSSLSSPLIPVCEEDEERSHEKWFKREEVVEEVKRQLWLAGPLICVSILQYSIQI  61

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            I++MF G+ G ELSLSGA+MA +F SVTGFS + G++ ALDT  GQ YGAKQY M+GI  
Sbjct  62   IAVMFVGHLG-ELSLSGATMALSFTSVTGFSLLMGMSSALDTFSGQCYGAKQYHMMGIHM  120

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + V+LLVCIP+  + A T RII
Sbjct  121  QRAMFVLLLVCIPLAIISANT-RII  144



>emb|CDX72467.1| BnaC07g44890D [Brassica napus]
Length=490

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 4/145 (3%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            Q  ++ +R      P        +  K   E   EVKK   L+ PLI V+LL  SLQ IS
Sbjct  3    QQTEKADRDTATVSPAATNGNKSDTGKVIKE---EVKKQFWLSAPLIGVSLLQYSLQVIS  59

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGF+F+ G A AL+TLCGQSYGAK Y  LGI+ QR
Sbjct  60   VMFVGHLG-SLPLSAASIATSFASVTGFTFLMGTASALETLCGQSYGAKMYGKLGIYMQR  118

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+L++ IP++ VWAYT+ I+ F
Sbjct  119  AMFVLLILSIPLSVVWAYTENILVF  143



>ref|XP_010674914.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=485

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 5/139 (4%)
 Frame = -3

Query  577  EMEIPLIL----ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ++E PL+L    ++ N+      +E+  E  K + LAGPL++VN LL SLQ IS+MF G+
Sbjct  10   DLENPLLLSAPQKNANNGSLVRKNEIVMEAMKQIKLAGPLMAVNFLLFSLQVISVMFVGH  69

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL L+ AS+AT+FASVTG S ++G+  ALDT CG SYGAKQY MLGI TQR + V++
Sbjct  70   LG-ELPLAAASVATSFASVTGLSLLKGMGNALDTFCGLSYGAKQYHMLGIHTQRAMVVLI  128

Query  229  LVCIPVTGVWAYTDRIIGF  173
             + IP+  +W  T +I+ F
Sbjct  129  CISIPLAFIWKNTGQILAF  147



>emb|CBI14951.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -3

Query  490  MVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALD  311
            M LAGPL+ VN L  SLQ IS+MF G+ G ELSLS ASMAT+FA VTGFS M G+  ALD
Sbjct  1    MKLAGPLVVVNFLQYSLQMISIMFVGHLG-ELSLSSASMATSFAGVTGFSIMLGMGSALD  59

Query  310  TLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRI  182
            T CGQ+YGA+QY MLG+  QR + V++  CIP+  VWAYT +I
Sbjct  60   TFCGQAYGAEQYHMLGVHMQRALLVLMPTCIPIAFVWAYTGKI  102



>gb|KEH26665.1| MATE efflux family protein [Medicago truncatula]
Length=482

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = -3

Query  577  EMEIPLILESENDERRKCWDEVSGEV--KKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
             +  PLI+E    + +K  +        KK + L+GPLISV  L   +  IS+MF G+ G
Sbjct  2    SLHSPLIVEETKQKNKKEEERRELVEEVKKQLWLSGPLISVAFLNFGINLISVMFVGHLG  61

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL LSGASMAT+FA+VTGF+ ++G+A ALDTLCGQSYGAKQY+MLG+  QR + ++++V
Sbjct  62   -ELPLSGASMATSFAAVTGFTLLQGMASALDTLCGQSYGAKQYRMLGVHMQRAMFILMIV  120

Query  223  CIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGAR  104
             IP+  +WA T  I+        ++   P  S+E G  AR
Sbjct  121  AIPLAVIWANTKSIL-------ILLGQDPEISIEAGNYAR  153



>ref|XP_007211241.1| hypothetical protein PRUPE_ppa004805mg [Prunus persica]
 gb|EMJ12440.1| hypothetical protein PRUPE_ppa004805mg [Prunus persica]
Length=491

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 13/137 (9%)
 Frame = -3

Query  565  PLILESENDE--------RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            PLI   E D+        +RK   E+  EVKK + LAGPLI V+LL  S+Q I++MF G+
Sbjct  14   PLIQVCEEDDAGSHGRGFKRK---EIVEEVKKQLWLAGPLICVSLLQYSVQIIAVMFVGH  70

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G ELSLSGASMA +F+SVTGFS + G++ ALDTLCGQ YGAKQY M+GI  QR + V+ 
Sbjct  71   LG-ELSLSGASMALSFSSVTGFSLLMGMSSALDTLCGQCYGAKQYHMMGIHMQRAMLVLS  129

Query  229  LVCIPVTGVWAYTDRII  179
            +VCIP+  + A T RII
Sbjct  130  IVCIPLAIISANT-RII  145



>dbj|BAJ97214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQF  434
                R    + ME  L++       +K  DE  V  EVKK + LAGPL+   LL   +Q 
Sbjct  6    HRHSRPAAWSSMEDQLLVPGSPGIEKKGEDESLVLSEVKKQLRLAGPLVVGCLLQNVVQM  65

Query  433  ISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFT  254
            IS+MF G+ G EL+LS ASMAT+FA+VTGFS + G+A +LDTLCGQ+YGA Q++MLG++ 
Sbjct  66   ISVMFVGHLG-ELALSSASMATSFANVTGFSLLAGMACSLDTLCGQAYGASQHRMLGVYK  124

Query  253  QRGIPVILLVCIPVTGVWAYTDRII  179
            QR + V+ L  +PV  +WA+T RI+
Sbjct  125  QRAMLVLSLTSVPVAALWAHTGRIL  149



>ref|XP_007160497.1| hypothetical protein PHAVU_002G326700g [Phaseolus vulgaris]
 gb|ESW32491.1| hypothetical protein PHAVU_002G326700g [Phaseolus vulgaris]
Length=500

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 100/148 (68%), Gaps = 12/148 (8%)
 Frame = -3

Query  589  ERKAEMEIPLILESEND---------ERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTS  443
            ++K+ ++ PLI  +  D          + K  +  E+  EV+K + LAGPL+SV++L  S
Sbjct  5    DQKSSIQSPLIHITVEDRLKVDSIQLNKDKAIERAELYEEVRKQLWLAGPLVSVSILNYS  64

Query  442  LQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLG  263
            LQ IS+MF G+ G +L LS AS+AT+FASVTGFS + G+A ALDTLCGQSYGAKQ+ MLG
Sbjct  65   LQIISVMFVGHLG-QLQLSAASLATSFASVTGFSLLVGVASALDTLCGQSYGAKQHHMLG  123

Query  262  IFTQRGIPVILLVCIPVTGVWAYTDRII  179
            I  QR + V+++V I +  +WA T  I+
Sbjct  124  IHMQRAMLVLMIVSIHLAFIWANTSSIL  151



>ref|XP_006661673.1| PREDICTED: MATE efflux family protein 6-like [Oryza brachyantha]
Length=484

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 102/164 (62%), Gaps = 16/164 (10%)
 Frame = -3

Query  583  KAEMEIPLILESENDERRKCWDE-----VSGEVKKLMVLAGPLISVNLLLTSLQFISLMF  419
            KA ME PL+ ++  D  +   DE     V  EVKK + LAGPLI   LL   +Q IS+MF
Sbjct  2    KAAMEEPLLADT-GDAGKNGGDEEEESLVVIEVKKQLCLAGPLIVGMLLQNVVQMISVMF  60

Query  418  AGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIP  239
             G+ G EL+LS ASMAT+FA VTGFS + G+A +LDTLCGQ++GAKQ+ MLG++ QR + 
Sbjct  61   VGHLG-ELALSSASMATSFAGVTGFSLLAGMASSLDTLCGQAFGAKQHHMLGVYKQRAML  119

Query  238  VILLVCIPVTGVWAYTDRIIGFCVFYRAIILCFPSPSLEVGGGA  107
            V+ L  +PV  VWA+T  I         ++L    P +  G G+
Sbjct  120  VLALASVPVAVVWAFTGDI---------LVLVGQDPEIAAGAGS  154



>ref|XP_010680606.1| PREDICTED: MATE efflux family protein LAL5-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=479

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 98/146 (67%), Gaps = 7/146 (5%)
 Frame = -3

Query  589  ERKAEMEIPLILESE---NDERRKCW---DEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            E ++    PLI   E    DE R+ +    EV  E K+ + LAGPLI+V +L   +Q IS
Sbjct  4    ELESSHNTPLIQREEGGMEDEVRETFISKAEVLDEAKRQIYLAGPLIAVTILQYLVQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL LS AS+AT+FASVTGF  + GL+ AL+TLCG SYGA++Y MLG++TQR
Sbjct  64   VMFVGHLG-ELPLSSASLATSFASVTGFYVLLGLSSALETLCGGSYGAQKYSMLGLYTQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFC  170
             + ++L+  IP++ +W YT  I+ FC
Sbjct  123  AMIILLVSSIPLSLIWYYTTDILIFC  148



>ref|XP_004300941.1| PREDICTED: MATE efflux family protein DTX1-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            D+V  E KK + LAGPLI+V+LL  SLQ  S+MF G+ G EL+LSGAS+A++FA+VTGF 
Sbjct  35   DDVIEEAKKQLWLAGPLIAVSLLQCSLQITSVMFVGHLG-ELALSGASLASSFAAVTGFD  93

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G+A AL+TLCGQ+YGAKQY MLG+  QRG+  +++V +P+  +W YT  I+
Sbjct  94   ILLGMASALETLCGQAYGAKQYHMLGVHMQRGMLTLVVVSMPLALIWFYTGTIL  147



>ref|XP_010680607.1| PREDICTED: MATE efflux family protein LAL5-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 98/146 (67%), Gaps = 7/146 (5%)
 Frame = -3

Query  589  ERKAEMEIPLILESE---NDERRKCW---DEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            E ++    PLI   E    DE R+ +    EV  E K+ + LAGPLI+V +L   +Q IS
Sbjct  4    ELESSHNTPLIQREEGGMEDEVRETFISKAEVLDEAKRQIYLAGPLIAVTILQYLVQVIS  63

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G EL LS AS+AT+FASVTGF  + GL+ AL+TLCG SYGA++Y MLG++TQR
Sbjct  64   VMFVGHLG-ELPLSSASLATSFASVTGFYVLLGLSSALETLCGGSYGAQKYSMLGLYTQR  122

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFC  170
             + ++L+  IP++ +W YT  I+ FC
Sbjct  123  AMIILLVSSIPLSLIWYYTTDILIFC  148



>ref|XP_003579576.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Brachypodium 
distachyon]
Length=480

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -3

Query  577  EMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGE  398
             ME PL+  +    +      V  EVKK + LAGPLI+  LL   +Q IS+MF G+ G E
Sbjct  4    SMEEPLVASNTEKTQGPGHSLVVIEVKKQLYLAGPLIAGGLLQNVVQMISVMFVGHLG-E  62

Query  397  LSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCI  218
            L+LS AS+AT+FA VTGFS + G++ +LDTLCGQ++GAKQY +LGI+ QR I V+ LV +
Sbjct  63   LALSSASIATSFAGVTGFSLLAGMSSSLDTLCGQAFGAKQYHLLGIYKQRAIFVLTLVSV  122

Query  217  PVTGVWAYTDRIIGF  173
             V  +WAYT +I+ F
Sbjct  123  VVAVIWAYTGQILLF  137



>emb|CDP00713.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -3

Query  556  LESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGAS  377
            ++ E  E+     E+  EVK+ + LA PLI+V++L   LQ IS+MF G+ G EL LS AS
Sbjct  22   IDREVSEQGCYRGEIIEEVKRQLGLALPLIAVSILQYCLQIISIMFVGHLG-ELPLSSAS  80

Query  376  MATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWA  197
            MAT+FASVTGF+ + G+  AL+TLCGQ+YGAKQY+MLGI+TQRG+ V+L++ I +  +W 
Sbjct  81   MATSFASVTGFNVLLGMGSALETLCGQAYGAKQYRMLGIYTQRGMIVLLVLSIFLALIWF  140

Query  196  YTDRII  179
            YTD I+
Sbjct  141  YTDHIL  146



>ref|XP_002526348.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36019.1| conserved hypothetical protein [Ricinus communis]
Length=259

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 93/147 (63%), Gaps = 21/147 (14%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            N  RR  W E+  EVKK M LAGPL+ V++L   LQ IS+MF G+ G ELSL+GASMAT+
Sbjct  31   NKIRR--WKEIVKEVKKQMGLAGPLVLVSVLQFFLQMISVMFVGHLG-ELSLTGASMATS  87

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA+VTGFS + G+A ALDTLCGQSYGA+QY M+GI             IP+  VWA T  
Sbjct  88   FATVTGFSLLLGMASALDTLCGQSYGARQYYMMGIH-----------IIPLATVWANTLP  136

Query  184  IIGFCVFYRAIILCFPSPSLEVGGGAR  104
            I+  C   +AI       S+E G  AR
Sbjct  137  ILIACGQDKAI-------SMEAGTYAR  156



>ref|XP_004253419.1| PREDICTED: MATE efflux family protein LAL5-like, partial [Solanum 
lycopersicum]
Length=268

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
              V  EVKK   L+ PLI V+LL  SLQ IS+MF G+ G  L LS AS+AT+FASVTGF+
Sbjct  28   QSVKEEVKKQFWLSAPLIGVSLLQYSLQVISVMFVGHLGS-LPLSAASIATSFASVTGFT  86

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            F+ G A AL+TLCGQSYGAK Y  LGIF QR + V+L++ +P++ VW YT+ I+
Sbjct  87   FLMGTASALETLCGQSYGAKMYGKLGIFMQRAMFVLLILSVPLSIVWFYTEDIL  140



>ref|XP_008223666.1| PREDICTED: MATE efflux family protein 5-like [Prunus mume]
Length=490

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 16/149 (11%)
 Frame = -3

Query  619  VRIWQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSL  440
            +++ Q+Q  + RK   ++P+             DE+  EVKK ++LAGPL++ N LL  +
Sbjct  15   IQVPQEQSLLSRK---QVPVK------------DEIVEEVKKQLLLAGPLVASNFLLFGM  59

Query  439  QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGI  260
            Q IS+M+ G+ G EL+L+GASMAT+FASVTG S  RG+  ALDT CGQSYGAKQY MLGI
Sbjct  60   QLISVMYVGHVG-ELALAGASMATSFASVTGLSLTRGMGSALDTFCGQSYGAKQYHMLGI  118

Query  259  FTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
              QR + V+LLV +P+  VWA   RI+ F
Sbjct  119  HMQRAMLVLLLVNLPLAFVWANAGRILEF  147



>ref|XP_003567915.1| PREDICTED: MATE efflux family protein 5-like [Brachypodium distachyon]
Length=475

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 97/144 (67%), Gaps = 3/144 (2%)
 Frame = -3

Query  583  KAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
            K  +E PL+    + E R+  + V+ E K+L+ LAGPL++  +L ++LQ +S+MF G+ G
Sbjct  2    KTSVEEPLLATGYDKEDRE--NAVAAEAKRLLWLAGPLVASGILRSALQMVSVMFVGHLG  59

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL L+GAS+AT+  SVTGF+   G++GALDTLCGQ++GA QY +LG++ Q  +  + L 
Sbjct  60   -ELPLAGASLATSVTSVTGFTLFIGMSGALDTLCGQAFGAGQYHLLGVYKQSAMVALTLT  118

Query  223  CIPVTGVWAYTDRIIGFCVFYRAI  152
            C+P+  VWA   +I+ F    RAI
Sbjct  119  CVPIALVWACVSQILVFLGQDRAI  142



>ref|XP_010319397.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Solanum 
lycopersicum]
Length=490

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            Q QK+ME     ++PL+L  E          +  E+K+ + LA PLI+VN+L   LQ IS
Sbjct  11   QQQKKMEGP---QVPLLLNQETSHDFDNTTTIIEEIKRQLRLAVPLIAVNILQYCLQVIS  67

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G ELSLSGASMAT+FASVTGFS + G+  AL+TLCGQ+YGAKQ+ MLGI+TQR
Sbjct  68   IMFVGHLG-ELSLSGASMATSFASVTGFSVLLGMGSALETLCGQAYGAKQHHMLGIYTQR  126

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFC  170
             + V+L + I +  +W  T  I+  C
Sbjct  127  AMLVLLSLSILLLLIWFNTSTILIAC  152



>ref|XP_010531854.1| PREDICTED: MATE efflux family protein 6-like [Tarenaya hassleriana]
Length=477

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -3

Query  592  MERKAEMEI-PLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            MER +E    PL   +  +ER+K W     EVK+ + L+GPLI V+LL  SLQ IS+MF 
Sbjct  1    MERWSEESARPL---TGGEERKKKWTA-REEVKRQVWLSGPLIGVSLLQYSLQLISVMFV  56

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  L LS AS+AT+FASVTGFS + G A ALDTLCGQSYGAK Y MLG+  QR + V
Sbjct  57   GHLG-SLPLSAASVATSFASVTGFSLLMGTASALDTLCGQSYGAKLYNMLGVQMQRAMLV  115

Query  235  ILLVCIPVTGVWAYTDRII  179
            ++++ +P++ +WA T+ ++
Sbjct  116  LVILSVPLSIIWAKTEHLL  134



>ref|XP_002865913.1| hypothetical protein ARALYDRAFT_918292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42172.1| hypothetical protein ARALYDRAFT_918292 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
             D++R E   E+  PLI E  +         V  EVKK + L+GPLI+V+LL   LQ IS
Sbjct  3    DDRERGED--ELSWPLIGEKSS---------VKEEVKKQLWLSGPLIAVSLLQFCLQVIS  51

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQ+YGAK+Y MLGI  QR
Sbjct  52   VMFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQAYGAKKYGMLGIQMQR  110

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+ L  IP++ +WA T+ ++ F
Sbjct  111  AMFVLTLASIPLSIIWANTEHLLVF  135



>ref|XP_010251826.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=495

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
             E   EVKK + LAGPLI+V  L  SLQ IS+MF G+ G EL+LSGASMAT+FA+VTGFS
Sbjct  38   SEFVAEVKKQLWLAGPLITVGFLQYSLQMISVMFVGHLG-ELTLSGASMATSFATVTGFS  96

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPV  212
             + G+  ALDTLCGQSYGAKQY MLGI  QR + V+L+V +P+
Sbjct  97   LLLGMGSALDTLCGQSYGAKQYHMLGIHMQRAMFVLLVVSVPL  139



>ref|XP_010675020.1| PREDICTED: MATE efflux family protein 5-like [Beta vulgaris subsp. 
vulgaris]
Length=808

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = -3

Query  550  SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMA  371
            + N+ R     E+  E KK + LAG L++VN LL SLQ IS+MF G+ G EL L+ AS+A
Sbjct  20   TSNEGRLLNKKEIVKEAKKQIKLAGSLMAVNFLLFSLQVISVMFVGHLG-ELPLAAASIA  78

Query  370  TAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYT  191
            T+FASVTG S ++G+   LDT CGQSYGAKQY M+GI  QR + V+L V IP+  +WA T
Sbjct  79   TSFASVTGLSLLKGMGNGLDTFCGQSYGAKQYHMVGIHKQRAMVVLLCVSIPIAFIWANT  138

Query  190  DRIIGF  173
             +I+ F
Sbjct  139  GKILAF  144



>gb|AFW77707.1| putative MATE efflux family protein [Zea mays]
Length=290

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME+KA      +L   ++        V+ E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MEKKAATTEEPLLAPRSEH------TVAAEAKRLLSLAGPLVASCILQNVVQLVSVMFVG  54

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  55   HLG-ELPLAGASLASSLANVTGFSLLVGMASALDTLCGQAFGARQYGLLGLYKQRAMLVL  113

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA   RI+
Sbjct  114  ALACVPIAAVWANAGRIL  131



>ref|XP_010482607.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=486

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            +D++R E   E+  PLI E  +         V  EVKK + L+GPLI+V+LL   LQ IS
Sbjct  3    EDRERGED--ELSWPLIGEKSS---------VKEEVKKQLWLSGPLIAVSLLQFCLQVIS  51

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQS+GAK+Y MLGI  QR
Sbjct  52   VMFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQSFGAKKYGMLGIQMQR  110

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+ L  IP++ +WA T+  + F
Sbjct  111  AMFVLTLASIPLSIIWANTEHFLVF  135



>ref|XP_009138276.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Brassica 
rapa]
Length=499

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 6/150 (4%)
 Frame = -3

Query  607  QDQKRMER---KAEMEIPLILESENDERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTS  443
            ++ K+ME+   K + EI  +  +         D   V  EVKK   L+ PLI V+LL  S
Sbjct  4    ENSKQMEQETEKVDKEITTVSPAAQHVVGDNSDMQSVKEEVKKQFWLSAPLIGVSLLQYS  63

Query  442  LQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLG  263
            LQ IS+MF G+ G  L LS AS+AT+FASVTGF+F+ G A AL+TLCGQSYGAK Y  LG
Sbjct  64   LQVISVMFVGHLG-SLPLSAASIATSFASVTGFTFLMGTASALETLCGQSYGAKMYGKLG  122

Query  262  IFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            I+ QR + V+L++ IP++ +W YT+ I+ F
Sbjct  123  IYMQRAMFVLLILSIPLSIIWTYTETILVF  152



>emb|CDX79559.1| BnaC03g18950D [Brassica napus]
Length=487

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 94/147 (64%), Gaps = 8/147 (5%)
 Frame = -3

Query  601  QKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            Q   +    +  PLI E+E        + +  EVKK + LAGPLI+V+LL   LQ IS+M
Sbjct  2    QSERDEVLTLSWPLIGENEKSSS----NGIKVEVKKQLWLAGPLIAVSLLQFCLQVISVM  57

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G  L LS AS+AT+FASVTGFSF+ G A ALDT+CGQSYG K Y MLGI  QR +
Sbjct  58   FVGHLG-SLPLSAASVATSFASVTGFSFLIGTASALDTVCGQSYGGKMYGMLGIQMQRAM  116

Query  241  PVILLVCIPVTGVWAYTDRIIGFCVFY  161
             V+ L  IP++ VWA T+    F VF+
Sbjct  117  FVLTLYSIPLSIVWANTEH---FLVFF  140



>ref|XP_007036385.1| MATE efflux family protein, putative [Theobroma cacao]
 gb|EOY20886.1| MATE efflux family protein, putative [Theobroma cacao]
Length=468

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -3

Query  517  EVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSF  338
            E++ E+KK M LAG L+ V+ L  SL  IS+MF G+ G ELSL+ ASMAT+FA VTGFSF
Sbjct  37   EITSELKKQMRLAGSLVVVSFLQYSLLMISVMFVGHLG-ELSLASASMATSFAGVTGFSF  95

Query  337  MRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRI  182
            M G+  AL+T CGQ+YGA+QY MLG+  QR I V+ LV +P++ +WA+T ++
Sbjct  96   MLGMGSALETFCGQAYGARQYHMLGVHMQRAILVLTLVSVPISLIWAFTGQV  147



>ref|XP_009138275.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Brassica 
rapa]
Length=533

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 6/150 (4%)
 Frame = -3

Query  607  QDQKRMER---KAEMEIPLILESENDERRKCWD--EVSGEVKKLMVLAGPLISVNLLLTS  443
            ++ K+ME+   K + EI  +  +         D   V  EVKK   L+ PLI V+LL  S
Sbjct  38   ENSKQMEQETEKVDKEITTVSPAAQHVVGDNSDMQSVKEEVKKQFWLSAPLIGVSLLQYS  97

Query  442  LQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLG  263
            LQ IS+MF G+ G  L LS AS+AT+FASVTGF+F+ G A AL+TLCGQSYGAK Y  LG
Sbjct  98   LQVISVMFVGHLG-SLPLSAASIATSFASVTGFTFLMGTASALETLCGQSYGAKMYGKLG  156

Query  262  IFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            I+ QR + V+L++ IP++ +W YT+ I+ F
Sbjct  157  IYMQRAMFVLLILSIPLSIIWTYTETILVF  186



>emb|CDX84649.1| BnaA03g15810D [Brassica napus]
Length=970

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 92/139 (66%), Gaps = 5/139 (4%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            ER   +  PLI E+E          +  EVKK + LAGPLI+V+LL   LQ IS+MF G+
Sbjct  4    ERDEMLSWPLIGENEKSSSSG----IKVEVKKQLWLAGPLIAVSLLQFCLQVISVMFVGH  59

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G  L LS AS+AT+FASVTGFSF+ G A ALDT+CGQSYGAK Y MLGI  QR + V+ 
Sbjct  60   LGS-LPLSAASVATSFASVTGFSFLMGTASALDTVCGQSYGAKMYGMLGIQMQRAMFVLT  118

Query  229  LVCIPVTGVWAYTDRIIGF  173
            L  IP++ VWA T+  + F
Sbjct  119  LYSIPLSIVWANTEHFLVF  137



>ref|XP_002869164.1| hypothetical protein ARALYDRAFT_328320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45423.1| hypothetical protein ARALYDRAFT_328320 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            + V  EVKK   L+ PLI V+LL  SLQ IS+MF G+ G  L LS AS+AT+FASVTGF+
Sbjct  4    NSVKEEVKKQFWLSAPLIGVSLLQYSLQVISVMFVGHLG-SLPLSAASIATSFASVTGFT  62

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            F+ G A AL+TLCGQSYGAK Y  LGIF QR + V+L++ IP++ VW YT+ I+ F
Sbjct  63   FLMGTASALETLCGQSYGAKMYGKLGIFMQRAMFVLLILSIPLSMVWFYTEDILVF  118



>emb|CDY49289.1| BnaA03g51020D [Brassica napus]
Length=491

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 3/145 (2%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            Q+ ++++++     P       D        V  EVKK   L+ PLI V+LL  SLQ IS
Sbjct  3    QETEKVDKEITTVSPAAQHVVGDNSDM--QSVKEEVKKQFWLSAPLIGVSLLQYSLQVIS  60

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGF+F+ G A AL+TLCGQSYGAK Y  LGI+ QR
Sbjct  61   VMFVGHLG-SLPLSAASIATSFASVTGFTFLMGTASALETLCGQSYGAKMYGKLGIYMQR  119

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+L++ IP++ +W YT+ I+ F
Sbjct  120  AMFVLLILSIPLSIIWTYTETILVF  144



>ref|NP_200058.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB10542.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK76728.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85047.1| unknown protein [Arabidopsis thaliana]
 gb|AED96215.1| MATE efflux family protein [Arabidopsis thaliana]
Length=486

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
             D++R E   ++  PLI E  +         V  EVKK + L+GPLI+V+LL   LQ IS
Sbjct  3    DDRERGE--GDLSWPLIGEKSS---------VKEEVKKQLWLSGPLIAVSLLQFCLQVIS  51

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQ+YGAK+Y MLGI  QR
Sbjct  52   VMFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQAYGAKKYGMLGIQMQR  110

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+ L  IP++ +WA T+ ++ F
Sbjct  111  AMFVLTLASIPLSIIWANTEHLLVF  135



>ref|XP_010087829.1| MATE efflux family protein 6 [Morus notabilis]
 gb|EXB30265.1| MATE efflux family protein 6 [Morus notabilis]
Length=495

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -3

Query  550  SENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMA  371
             E   +RK   E+  EVKK + LAGP+ISV LL   LQ IS+MF G+ G E+ LSGASMA
Sbjct  31   HEKGFKRK---EILEEVKKQLWLAGPMISVGLLQYFLQMISIMFVGHLG-EIPLSGASMA  86

Query  370  TAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYT  191
            T+FA+VTGFS + G+AGAL+TL GQ+YGAKQY ++ ++ QR + V+ LV IP+  +WA T
Sbjct  87   TSFATVTGFSLLLGMAGALETLSGQAYGAKQYHLMSVYMQRSMIVLSLVSIPLAVIWANT  146

Query  190  DRIIG  176
              I+ 
Sbjct  147  GPILA  151



>ref|XP_004975347.1| PREDICTED: MATE efflux family protein 5-like [Setaria italica]
Length=466

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -3

Query  508  GEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRG  329
            GEV+K + LAGPLI   LL  S++ ISLMF G+ G EL+LS ASMAT+FASVTGFS + G
Sbjct  14   GEVRKQLYLAGPLIVAWLLQNSVRIISLMFVGHLG-ELALSSASMATSFASVTGFSLLLG  72

Query  328  LAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +A +LDTLCGQ++GAKQ+ +LGI+ QR I V+ LV I +  VW YT +I+
Sbjct  73   MASSLDTLCGQAFGAKQHHLLGIYKQRAILVLTLVSIGLAVVWWYTGKIL  122



>ref|XP_002532228.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30159.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=485

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            + E  ++  C  +   E KK   LAGPLI+V++L   LQ IS+MF G+ G EL+LSGASM
Sbjct  21   DEELSQKGCCRRDFLEEAKKQFWLAGPLITVSMLQYCLQVISIMFVGHLG-ELALSGASM  79

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            A++FASVTGF+ + G+  AL+TLCGQ+YGA+QY MLGI +QR +  +L + IP+  +W Y
Sbjct  80   ASSFASVTGFNVLLGMGSALETLCGQAYGAEQYHMLGIHSQRAMLTLLALSIPLAIIWFY  139

Query  193  TDRIIGF  173
            T  I+ F
Sbjct  140  TSTILMF  146



>ref|XP_003560768.1| PREDICTED: MATE efflux family protein 8 [Brachypodium distachyon]
Length=479

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -3

Query  514  VSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFM  335
            V  EVKK + LAGPLI+  LL   +Q IS+M+ G+ G EL+L+GASMA++FASVTGFS +
Sbjct  24   VGEEVKKQLWLAGPLIAGALLQNLIQMISVMYVGHLG-ELALAGASMASSFASVTGFSLL  82

Query  334  RGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             G+A ALDTLCGQ++GA+QY +LGI+ QR + ++ LV IP+  VW YT  I+
Sbjct  83   LGMASALDTLCGQAFGARQYHLLGIYKQRAMVILTLVSIPLAVVWFYTGEIL  134



>dbj|BAK03656.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -3

Query  583  KAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRG  404
            K  ++  L+L S  DE       V  EVKK + LAGPLI   LL   +Q IS+M+ G+ G
Sbjct  3    KGSVDEALLLASRGDEGLGL--GVREEVKKQLWLAGPLIGGALLQNLIQMISVMYVGHLG  60

Query  403  GELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLV  224
             EL+L+GASMA++FA+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + ++ LV
Sbjct  61   -ELALAGASMASSFATVTGFSLLLGMASALDTLCGQAFGARQYHLLGVYKQRAMVILTLV  119

Query  223  CIPVTGVWAYTDRII  179
             IP+  VW YT  I+
Sbjct  120  SIPLAVVWFYTGEIL  134



>ref|XP_006280376.1| hypothetical protein CARUB_v10026303mg [Capsella rubella]
 gb|EOA13274.1| hypothetical protein CARUB_v10026303mg [Capsella rubella]
Length=487

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 12/145 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
             D++R E   E+  PLI E  +         V  EV K + LAGPLI+V+LL   LQ IS
Sbjct  4    SDRERGED--ELSWPLIGEKSS---------VKEEVNKQVWLAGPLIAVSLLQFCLQVIS  52

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQS+GAK+Y MLGI  QR
Sbjct  53   VMFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQSFGAKKYGMLGIQMQR  111

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+ L  IP++ +WA T+ ++ F
Sbjct  112  AMFVLTLSSIPLSIIWANTEHLLVF  136



>ref|XP_010444869.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
 ref|XP_010444875.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Camelina 
sativa]
Length=486

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 12/145 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            +D++R E   E+  PLI    +         V  EVKK + L+GPLI+V+LL   LQ IS
Sbjct  3    EDRERGED--ELSWPLIGAKSS---------VKEEVKKQLWLSGPLIAVSLLQFCLQVIS  51

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQS+GAK+Y MLGI  QR
Sbjct  52   VMFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQSFGAKKYGMLGIQMQR  110

Query  247  GIPVILLVCIPVTGVWAYTDRIIGF  173
             + V+ L  IP++ +WA T+  + F
Sbjct  111  AMFVLTLASIPLSIIWANTEHFLVF  135



>ref|XP_006410581.1| hypothetical protein EUTSA_v10016570mg [Eutrema salsugineum]
 gb|ESQ52034.1| hypothetical protein EUTSA_v10016570mg [Eutrema salsugineum]
Length=490

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 97/143 (68%), Gaps = 7/143 (5%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQFISLM  422
            + ER+  +  PLI E+E    +KC     +  EVKK + LA PLI+V+LL  SLQ IS+M
Sbjct  2    KEEREDVLSWPLIGETE----KKCIITGGIKVEVKKQLWLACPLIAVSLLQFSLQVISVM  57

Query  421  FAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGI  242
            F G+ G  L LS A++AT+FASVTGF+F+ G A ALDT+CGQSYGAK Y MLGI  QR +
Sbjct  58   FLGHLG-SLPLSAAAVATSFASVTGFTFLMGTASALDTVCGQSYGAKMYGMLGIQMQRAM  116

Query  241  PVILLVCIPVTGVWAYTDRIIGF  173
             V+ L  +P++ +WA T+  + F
Sbjct  117  LVLTLYSVPLSIIWANTEHFLVF  139



>ref|XP_010540012.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Tarenaya 
hassleriana]
Length=494

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            E +   RR     V  EVK+ + L+ PLI V+LL   LQ IS+MF G+ G  L LS AS+
Sbjct  26   EEDGKLRR-----VKAEVKRQLWLSAPLIVVSLLQFCLQLISVMFVGHLG-SLPLSAASI  79

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FAS+TGFS + G A ALDTLCGQSYGAK Y MLGI  QR + V+L++C P++ +WA 
Sbjct  80   ATSFASITGFSLLMGTASALDTLCGQSYGAKVYNMLGIHMQRAMVVLLILCCPLSIIWAN  139

Query  193  TDRIIGF  173
            T+  + F
Sbjct  140  TEHFLLF  146



>ref|XP_008374800.1| PREDICTED: MATE efflux family protein 6-like [Malus domestica]
Length=496

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 12/151 (8%)
 Frame = -3

Query  598  KRMERKAEMEIPLILESENDERRKC-----------WDEVSGEVKKLMVLAGPLISVNLL  452
            +R + K  +  PLI   E D  ++              E+  EVKK + LAGPLI V+LL
Sbjct  2    EREDNKPSLSSPLIQACEEDVTKETGRNNHGIKGFKRKEIVEEVKKQIWLAGPLICVSLL  61

Query  451  LTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYK  272
              S Q I++MF G+ G ELSLSGA+MA +F SVTGFS + G++ ALDTL GQ YGAKQY+
Sbjct  62   QYSTQIIAIMFVGHLG-ELSLSGATMALSFTSVTGFSLLMGMSSALDTLSGQCYGAKQYR  120

Query  271  MLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            ++GI  QR + V+ LVC+P+  + A T  I+
Sbjct  121  LMGIHMQRAMLVLSLVCVPLAIISANTKTIL  151



>ref|XP_002440937.1| hypothetical protein SORBIDRAFT_09g017220 [Sorghum bicolor]
 gb|EES19367.1| hypothetical protein SORBIDRAFT_09g017220 [Sorghum bicolor]
Length=442

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 92/138 (67%), Gaps = 8/138 (6%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            M+ KA  E PL++              + E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MDNKAATEEPLLVPRPEHT-------ATSEAKRLLSLAGPLVASCILQNVVQLVSVMFVG  53

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  54   HLG-ELPLAGASLASSLANVTGFSLLAGMASALDTLCGQAFGARQYGLLGVYKQRAMLVL  112

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA   RI+
Sbjct  113  ALACLPIAVVWANAGRIL  130



>ref|XP_008240199.1| PREDICTED: MATE efflux family protein 6-like [Prunus mume]
Length=499

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 12/132 (9%)
 Frame = -3

Query  553  ESENDE-------RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGEL  395
            E E DE       +RK   E+  EVKK + LAGPLI V+LL  S+Q I++MF G+ G EL
Sbjct  27   EIEKDEGSHGRGFKRK---EIVEEVKKQLWLAGPLICVSLLQYSVQIIAVMFVGHLG-EL  82

Query  394  SLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIP  215
            SLSGASMA +F+SVTGFS + G++ ALDTL GQ YGAKQY M+GI  QR + V+ +VCIP
Sbjct  83   SLSGASMALSFSSVTGFSLLMGMSSALDTLSGQCYGAKQYHMMGIHMQRAMLVLSIVCIP  142

Query  214  VTGVWAYTDRII  179
            +  + A T RII
Sbjct  143  LAIISANT-RII  153



>ref|XP_006360464.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=485

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = -3

Query  574  MEIPLILESE----------NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            +++PL+   E          N+E+  C  E+  E+K+ + LA PLI+VN+L   LQ IS+
Sbjct  4    LQVPLLSNQETNHDFDTITTNNEQEYCRGEIIEEIKRQLGLAVPLIAVNILQYCLQVISI  63

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G EL LSGASMAT+FASVTGFS + G+  AL+TLCGQ+YGAKQY MLGI+TQR 
Sbjct  64   MFVGHLG-ELPLSGASMATSFASVTGFSVLLGMGSALETLCGQAYGAKQYHMLGIYTQRA  122

Query  244  IPVILLVCIPVTGVWAYTDRIIGFC  170
            + V+L + I +  +W  T  I+  C
Sbjct  123  MLVLLSLSILLLLIWFNTSTILIAC  147



>gb|KDP34992.1| hypothetical protein JCGZ_09280 [Jatropha curcas]
Length=481

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -3

Query  505  EVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGL  326
            E KK + LAGPLI+V+LL   L+ ISLMF G+ G EL+LSGASMAT+FASVTGFS + G+
Sbjct  34   EAKKQLWLAGPLIAVSLLQYCLELISLMFVGHLG-ELALSGASMATSFASVTGFSVLLGM  92

Query  325  AGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRI  182
              AL+TLCGQ++GAKQY +LG+ TQR +  +L + IP++ +W +T  I
Sbjct  93   GSALETLCGQAFGAKQYHLLGVHTQRAMLTLLTMSIPLSFIWYFTTTI  140



>ref|XP_010540011.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Tarenaya 
hassleriana]
Length=500

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = -3

Query  553  ESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASM  374
            E +   RR     V  EVK+ + L+ PLI V+LL   LQ IS+MF G+ G  L LS AS+
Sbjct  26   EEDGKLRR-----VKAEVKRQLWLSAPLIVVSLLQFCLQLISVMFVGHLG-SLPLSAASI  79

Query  373  ATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAY  194
            AT+FAS+TGFS + G A ALDTLCGQSYGAK Y MLGI  QR + V+L++C P++ +WA 
Sbjct  80   ATSFASITGFSLLMGTASALDTLCGQSYGAKVYNMLGIHMQRAMVVLLILCCPLSIIWAN  139

Query  193  TDRIIGF  173
            T+  + F
Sbjct  140  TEHFLLF  146



>ref|NP_001266817.1| uncharacterized protein LOC101027220 [Zea mays]
 gb|ACN36039.1| unknown [Zea mays]
Length=474

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME+KA      +L   ++        V+ E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MEKKAATTEEPLLAPRSEH------TVAAEAKRLLSLAGPLVASCILQNVVQLVSVMFVG  54

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  55   HLG-ELPLAGASLASSLANVTGFSLLVGMASALDTLCGQAFGARQYGLLGLYKQRAMLVL  113

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA   RI+
Sbjct  114  ALACVPIAAVWANAGRIL  131



>gb|AFW77706.1| putative MATE efflux family protein [Zea mays]
Length=474

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME+KA      +L   ++        V+ E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MEKKAATTEEPLLAPRSEH------TVAAEAKRLLSLAGPLVASCILQNVVQLVSVMFVG  54

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  55   HLG-ELPLAGASLASSLANVTGFSLLVGMASALDTLCGQAFGARQYGLLGLYKQRAMLVL  113

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA   RI+
Sbjct  114  ALACVPIAAVWANAGRIL  131



>ref|XP_008452139.1| PREDICTED: MATE efflux family protein 6-like isoform X2 [Cucumis 
melo]
Length=485

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 99/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCW--DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            ++K  ++ PLIL   +D+   C+  DE+  EVK+ + LAGPL++VN+L+  LQ IS+MF 
Sbjct  5    QKKQSLDSPLILPPADDDG-GCFTRDEIREEVKRQLRLAGPLMTVNVLINCLQMISVMFV  63

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G +L L+ ASMAT+FA+VTGFS + G+  AL+T CGQSYGAKQY MLGI  QR + V
Sbjct  64   GHLG-QLPLASASMATSFAAVTGFSLLNGMCSALETFCGQSYGAKQYHMLGIHLQRAMVV  122

Query  235  ILLVCIPVTGVWAYTDRIIGF  173
            +LLV +P+  VW     I+ F
Sbjct  123  LLLVSLPLAAVWFNAGDILRF  143



>ref|NP_001147687.1| transparent testa 12 protein [Zea mays]
 gb|ACG28390.1| transparent testa 12 protein [Zea mays]
Length=474

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME+KA      +L   ++        V+ E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MEKKAATTEEPLLAPRSEH------TVAAEAKRLLSLAGPLVASCILQNVVQLVSVMFVG  54

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  55   HLG-ELPLAGASLASSLANVTGFSLLVGMASALDTLCGQAFGARQYGLLGLYKQRAMLVL  113

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA   RI+
Sbjct  114  ALACVPIAAVWANAGRIL  131



>ref|XP_006843980.1| hypothetical protein AMTR_s00006p00135140 [Amborella trichopoda]
 gb|ERN05655.1| hypothetical protein AMTR_s00006p00135140 [Amborella trichopoda]
Length=492

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = -3

Query  628  PCHVRIWQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLL  449
            P  +R W+D    E   E+E      ++  + RK  ++V GE+KK + L GPL++ NLL 
Sbjct  10   PLLIRRWED----ESAKELEF-----ADGPKWRK--EDVLGELKKQVALGGPLVTANLLQ  58

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
              +Q +S+MF G+ G EL L+GASMAT+FA+  GFS + G+AGALDTLCGQ+YGAKQY M
Sbjct  59   KCMQIVSVMFVGHLG-ELPLAGASMATSFANAIGFSVLYGMAGALDTLCGQAYGAKQYHM  117

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +G+  QR   +  ++ IP++ V   T+ I+
Sbjct  118  VGVHAQRAQFIFFVIGIPISLVLYNTEGIL  147



>ref|XP_004983270.1| PREDICTED: MATE efflux family protein 5-like [Setaria italica]
Length=472

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 99/162 (61%), Gaps = 19/162 (12%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME KA  E  L+L    +        V+ E K+L+ LAGPL++  +L   +Q +S+MF G
Sbjct  1    MENKAGTEEALLLSRPENT-------VAAEAKRLLRLAGPLVASCILQNVVQLVSVMFVG  53

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+A++ A+VTGFS + G+A ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  54   HLG-ELPLAGASLASSLANVTGFSLLAGMASALDTLCGQAFGARQYGLLGVYKQRAMLVL  112

Query  232  LLVCIPVTGVWAYTDRIIGFC-----------VFYRAIILCF  140
             L C+P+  VWA   +I+               + R +ILC 
Sbjct  113  ALACVPIAVVWANAGQILALIGQDHDISAEAGAYSRWLILCL  154



>ref|XP_002280229.1| PREDICTED: MATE efflux family protein 5 isoform X3 [Vitis vinifera]
Length=511

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -3

Query  526  CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTG  347
            C  E+  E KK + LAGPL++V++L   LQ IS+MF G+ G EL LSGASMAT+FASVTG
Sbjct  35   CRREIIEEAKKQLWLAGPLVAVSMLQYCLQVISIMFVGHLG-ELPLSGASMATSFASVTG  93

Query  346  FSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            FS + G+  AL+TLCGQ+YGA++Y M+GI TQR +  +L++ IP+  +W +T  I+
Sbjct  94   FSLLLGIGSALETLCGQAYGAREYHMVGIHTQRAMLTLLVLSIPLAFIWFFTAPIL  149



>ref|XP_006302211.1| hypothetical protein CARUB_v10020223mg [Capsella rubella]
 gb|EOA35109.1| hypothetical protein CARUB_v10020223mg [Capsella rubella]
Length=476

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = -3

Query  535  RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFAS  356
            ++   + V  EVKK + L+ PLI V+LL  SLQ IS+MF G+ G  L LS AS+AT+FAS
Sbjct  14   KKTTMNHVKEEVKKQLWLSAPLIGVSLLQYSLQVISVMFVGHLG-SLPLSAASIATSFAS  72

Query  355  VTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            VTGF+F+ G A AL+TLCGQ+YGAK Y  LGI  QR + V+L++ +P++ +WAYT++I+
Sbjct  73   VTGFTFLLGTASALETLCGQAYGAKLYGKLGIQMQRAMFVLLILSVPLSIIWAYTEQIL  131



>ref|XP_010661327.1| PREDICTED: MATE efflux family protein 5 isoform X2 [Vitis vinifera]
Length=569

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -3

Query  526  CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTG  347
            C  E+  E KK + LAGPL++V++L   LQ IS+MF G+ G EL LSGASMAT+FASVTG
Sbjct  35   CRREIIEEAKKQLWLAGPLVAVSMLQYCLQVISIMFVGHLG-ELPLSGASMATSFASVTG  93

Query  346  FSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            FS + G+  AL+TLCGQ+YGA++Y M+GI TQR +  +L++ IP+  +W +T  I+
Sbjct  94   FSLLLGIGSALETLCGQAYGAREYHMVGIHTQRAMLTLLVLSIPLAFIWFFTAPIL  149



>ref|XP_010661271.1| PREDICTED: MATE efflux family protein 5 isoform X1 [Vitis vinifera]
Length=569

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -3

Query  526  CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTG  347
            C  E+  E KK + LAGPL++V++L   LQ IS+MF G+ G EL LSGASMAT+FASVTG
Sbjct  35   CRREIIEEAKKQLWLAGPLVAVSMLQYCLQVISIMFVGHLG-ELPLSGASMATSFASVTG  93

Query  346  FSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            FS + G+  AL+TLCGQ+YGA++Y M+GI TQR +  +L++ IP+  +W +T  I+
Sbjct  94   FSLLLGIGSALETLCGQAYGAREYHMVGIHTQRAMLTLLVLSIPLAFIWFFTAPIL  149



>ref|XP_004983271.1| PREDICTED: MATE efflux family protein 5-like [Setaria italica]
Length=473

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -3

Query  574  MEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGEL  395
            ME P + E     R       + E K+L+ LAGPL+   +L  ++Q +S+MF G+ G EL
Sbjct  1    MEEPSMEEPLLVPRPTVSGSAATEAKRLLRLAGPLVVSFILRNAVQMVSVMFVGHLG-EL  59

Query  394  SLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIP  215
             L+GAS+A++ A+VTGFSF+ G+AGAL+TLCGQ++GA+QY +LG++ QR + V+ + C+P
Sbjct  60   PLAGASLASSLANVTGFSFLSGMAGALNTLCGQAFGARQYGLLGVYKQRAMVVLAVACVP  119

Query  214  VTGVWAYTDRII  179
            +  VWA  +RI+
Sbjct  120  IALVWACAERIL  131



>emb|CDX91652.1| BnaC02g15080D [Brassica napus]
Length=486

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
             D+ +K    V  EVKK + L+GPL+ V+LL   LQ IS+MF G+ G  L LS AS+AT+
Sbjct  15   KDQEKK--SSVKEEVKKQLWLSGPLMGVSLLQYCLQVISVMFVGHLG-SLPLSTASLATS  71

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FASVTGFSF+ G A ALDTLCGQSYGAK+Y MLGI  QR + V+ L+ +P++ +W  T+ 
Sbjct  72   FASVTGFSFLMGTASALDTLCGQSYGAKKYGMLGIQMQRAMFVLTLLSVPLSIIWYNTEH  131

Query  184  IIGF  173
             + F
Sbjct  132  FLVF  135



>emb|CDY27066.1| BnaA02g10860D [Brassica napus]
Length=487

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
             D+ +K    V  EVKK + L+GPL+ V+LL   LQ IS+MF G+ G  L LS AS+AT+
Sbjct  15   KDQEKK--SSVKEEVKKQLWLSGPLMGVSLLQYCLQVISVMFVGHLG-SLPLSTASLATS  71

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FASVTGFSF+ G A ALDTLCGQSYGAK+Y MLGI  QR + V+ L+ +P++ +W  T+ 
Sbjct  72   FASVTGFSFLMGTASALDTLCGQSYGAKKYGMLGIQMQRAMFVLTLLSVPLSIIWYNTEH  131

Query  184  IIGF  173
             + F
Sbjct  132  FLVF  135



>emb|CDY00530.1| BnaA10g07430D [Brassica napus]
Length=484

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (65%), Gaps = 10/144 (7%)
 Frame = -3

Query  595  RMERKAEMEI---PLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            R ER+    +   PLI E E          V  EVKK + L+GPLI V+LL   LQ IS+
Sbjct  2    REERETGNNVLSWPLIGEKEKK------SSVKEEVKKQLWLSGPLIGVSLLQFCLQVISV  55

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G  L LS AS+AT+FASVTGFSF+ G A ALDTLCGQS+GAK Y MLGI  QR 
Sbjct  56   MFVGHLG-SLPLSAASIATSFASVTGFSFLMGTASALDTLCGQSFGAKMYGMLGIQMQRA  114

Query  244  IPVILLVCIPVTGVWAYTDRIIGF  173
            + V+ L+ +P++ +W  T+ ++ F
Sbjct  115  MFVLTLLSVPISIIWFNTEHLLLF  138



>gb|EMT22454.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -3

Query  574  MEIPLILESENDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGG  401
            ME+PL+  S + E   C  E  V  EVKK + LAGPLI+  LL   +Q IS+MF G+ G 
Sbjct  1    MEVPLVGGSSSTEETGCPKESLVVIEVKKQLYLAGPLITGCLLQNVVQMISVMFVGHLG-  59

Query  400  ELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVC  221
            EL+LS AS+AT+FASVTGFS + G+A +LDTLCGQ++GA+QY +LGI+ QR + V+ LV 
Sbjct  60   ELALSSASIATSFASVTGFSLLSGMASSLDTLCGQAFGARQYHLLGIYKQRAMFVLTLVS  119

Query  220  IPVTGVWAYTDRII  179
            + V  VWAYT +I+
Sbjct  120  VVVAVVWAYTGQIL  133



>gb|KFK26855.1| hypothetical protein AALP_AA8G302100 [Arabis alpina]
Length=488

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
              V  EVKK + L+GPLI V+LL   LQ IS+MF G+ G  L LS AS+AT+FASVTGFS
Sbjct  23   SSVKEEVKKQLWLSGPLIGVSLLQFCLQVISVMFVGHLG-SLPLSAASIATSFASVTGFS  81

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
            F+ G A ALDTLCGQSYGAK Y MLGI  QR + V+ L+ +P++ +W  TD ++ F
Sbjct  82   FLMGTASALDTLCGQSYGAKMYGMLGIQMQRAMFVLTLLSVPLSIIWYNTDHLLVF  137



>ref|XP_009127238.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
Length=487

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -3

Query  544  NDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
             D+ +K    V  EVKK + L+GPL+ V+LL   LQ IS+MF G+ G  L LS AS+AT+
Sbjct  15   KDQEKK--SSVKEEVKKQLWLSGPLMGVSLLQYCLQVISVMFVGHLG-SLPLSTASLATS  71

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FASVTGFSF+ G A ALDTLCGQSYGAK+Y MLGI  QR + V+ L+ +P++ +W  T+ 
Sbjct  72   FASVTGFSFLMGTASALDTLCGQSYGAKKYGMLGIQMQRAMFVLTLLSVPLSIIWYNTEH  131

Query  184  IIGF  173
             + F
Sbjct  132  FLVF  135



>ref|XP_006843977.1| hypothetical protein AMTR_s00006p00131670 [Amborella trichopoda]
 gb|ERN05652.1| hypothetical protein AMTR_s00006p00131670 [Amborella trichopoda]
Length=492

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = -3

Query  628  PCHVRIWQDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLL  449
            P  +R W+D    E   E+E      ++  + RK  ++V GE+KK + L GPL++ NLL 
Sbjct  10   PLLIRSWED----ESAKELEF-----ADGPKWRK--EDVLGELKKQVALGGPLVTANLLQ  58

Query  448  TSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKM  269
              +Q +S+MF G+ G EL L+GASMAT+FA+  GFS + G+ GALDTLCGQ+YGAKQY  
Sbjct  59   KCMQIVSVMFVGHLG-ELPLAGASMATSFANAIGFSVLYGMGGALDTLCGQAYGAKQYHR  117

Query  268  LGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            +G+  QR   + L++ IP++ +   T++I+
Sbjct  118  VGVHAQRAQFIFLIIGIPMSLILYNTEKIL  147



>ref|XP_003592586.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES62837.1| MATE efflux family protein [Medicago truncatula]
Length=484

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            + V  E KK + LAGPLI+V+LL  SLQ IS+MF G+ G +L LSGAS+  +FASVTG+S
Sbjct  30   EHVVEEAKKQLWLAGPLIAVSLLQYSLQMISIMFVGHLG-KLPLSGASLGNSFASVTGYS  88

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G+  AL+TLCGQ+YGAKQY MLG+ TQR + V+L++ IP++ +W  T  ++
Sbjct  89   VLLGMGSALETLCGQAYGAKQYHMLGVHTQRAMLVLLVLSIPLSLIWFNTSNLL  142



>ref|XP_006297558.1| hypothetical protein CARUB_v10013581mg [Capsella rubella]
 gb|EOA30456.1| hypothetical protein CARUB_v10013581mg [Capsella rubella]
Length=481

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 95/142 (67%), Gaps = 7/142 (5%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISL  425
            + +   R   +   +I E  N+ R K       EV+K + L+ PLI V++L  SLQ IS+
Sbjct  2    EAETESRDIAVSQHVITEKGNNHRLKI------EVRKQIRLSAPLIGVSILQYSLQVISV  55

Query  424  MFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRG  245
            MF G+ G  L LS AS+AT+FASV+GF+F+ G AGAL+TLCGQSYGA+Q+  LGI  QR 
Sbjct  56   MFVGHLG-SLPLSAASIATSFASVSGFTFLMGTAGALETLCGQSYGARQFGNLGILMQRA  114

Query  244  IPVILLVCIPVTGVWAYTDRII  179
            + V+L++ +P++ +WA T+ I+
Sbjct  115  MCVLLVLSVPLSIIWANTEHIL  136



>gb|EMT05193.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=503

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 95/138 (69%), Gaps = 5/138 (4%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            M++ +  + PL+   E  E     +E     K+L+ LAGPL +  +L ++LQ +S+MF G
Sbjct  1    MQKPSVDDQPLLGPVERSEHVAALEEA----KRLLRLAGPLAAGGILRSALQLVSVMFVG  56

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G EL L+GAS+AT+ A+VTGFS + G++ ALDTLCGQ++GA+QY +LG++ QR + V+
Sbjct  57   HLG-ELPLAGASLATSLANVTGFSLLVGMSSALDTLCGQAFGARQYHLLGLYKQRAMVVL  115

Query  232  LLVCIPVTGVWAYTDRII  179
             L C+P+  VWA T +I+
Sbjct  116  ALACVPIALVWANTAQIL  133



>ref|XP_006401821.1| hypothetical protein EUTSA_v10013374mg [Eutrema salsugineum]
 gb|ESQ43274.1| hypothetical protein EUTSA_v10013374mg [Eutrema salsugineum]
Length=435

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (66%), Gaps = 12/149 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            +D++R E    + +PL+   E  E+      V  EVKK + L+GPLI V+LL   LQ IS
Sbjct  3    EDREREEDV--LSLPLV--GETGEK----SSVKEEVKKQLWLSGPLIGVSLLQFCLQVIS  54

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FA+VTGFSF+ G A ALDTLCGQSYGAK Y +LGI  QR
Sbjct  55   VMFVGHLG-SLPLSAASIATSFATVTGFSFLMGTASALDTLCGQSYGAKMYGLLGIQMQR  113

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + V+ L+ +P++ +W  T+    F VF+
Sbjct  114  AMFVLTLLSVPLSIIWYNTEH---FLVFF  139



>ref|XP_008645476.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Zea 
mays]
Length=459

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -3

Query  535  RRKCWDEVSG---EVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            R+    E SG   EVKK + LAGPL+   LL  ++Q +S+MF G+ G EL+L+ AS+AT+
Sbjct  13   RKDGGSEESGVVCEVKKQLYLAGPLVVGFLLQNTVQMVSVMFVGHLG-ELALASASLATS  71

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFS + G+A +LDTLCGQ++GA+Q+ +LG+  QR + V+ LV +PV  VWAYT  
Sbjct  72   FAGVTGFSLLAGMACSLDTLCGQAFGARQHHLLGVHKQRAMLVLALVSVPVALVWAYTGD  131

Query  184  IIGFC  170
            I+ +C
Sbjct  132  ILAWC  136



>ref|XP_006583449.1| PREDICTED: MATE efflux family protein DTX1-like isoform X4 [Glycine 
max]
Length=417

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            +E+S E KK + L+GP++ V++   SLQ ISLMF G+   EL L+G S+AT+F +VTGFS
Sbjct  6    NEISEEAKKQLWLSGPMVFVSVFQYSLQMISLMFVGHLD-ELLLAGVSLATSFVNVTGFS  64

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G++ ALDT CGQSYGA+QY M+GI  QR I +I+L  IP++ +WAY   I+
Sbjct  65   VLLGMSSALDTFCGQSYGAQQYHMVGIHMQRAIVIIMLATIPMSFIWAYLRPIL  118



>ref|XP_006583448.1| PREDICTED: MATE efflux family protein DTX1-like isoform X3 [Glycine 
max]
Length=436

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            +E+S E KK + L+GP++ V++   SLQ ISLMF G+   EL L+G S+AT+F +VTGFS
Sbjct  6    NEISEEAKKQLWLSGPMVFVSVFQYSLQMISLMFVGHLD-ELLLAGVSLATSFVNVTGFS  64

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G++ ALDT CGQSYGA+QY M+GI  QR I +I+L  IP++ +WAY   I+
Sbjct  65   VLLGMSSALDTFCGQSYGAQQYHMVGIHMQRAIVIIMLATIPMSFIWAYLRPIL  118



>ref|XP_003528965.1| PREDICTED: MATE efflux family protein DTX1-like isoform X1 [Glycine 
max]
Length=469

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            +E+S E KK + L+GP++ V++   SLQ ISLMF G+   EL L+G S+AT+F +VTGFS
Sbjct  6    NEISEEAKKQLWLSGPMVFVSVFQYSLQMISLMFVGHLD-ELLLAGVSLATSFVNVTGFS  64

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G++ ALDT CGQSYGA+QY M+GI  QR I +I+L  IP++ +WAY   I+
Sbjct  65   VLLGMSSALDTFCGQSYGAQQYHMVGIHMQRAIVIIMLATIPMSFIWAYLRPIL  118



>ref|XP_006401822.1| hypothetical protein EUTSA_v10013374mg [Eutrema salsugineum]
 gb|ESQ43275.1| hypothetical protein EUTSA_v10013374mg [Eutrema salsugineum]
Length=489

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (66%), Gaps = 12/149 (8%)
 Frame = -3

Query  607  QDQKRMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            +D++R E    + +PL+   E  E+      V  EVKK + L+GPLI V+LL   LQ IS
Sbjct  3    EDREREEDV--LSLPLV--GETGEK----SSVKEEVKKQLWLSGPLIGVSLLQFCLQVIS  54

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQR  248
            +MF G+ G  L LS AS+AT+FA+VTGFSF+ G A ALDTLCGQSYGAK Y +LGI  QR
Sbjct  55   VMFVGHLG-SLPLSAASIATSFATVTGFSFLMGTASALDTLCGQSYGAKMYGLLGIQMQR  113

Query  247  GIPVILLVCIPVTGVWAYTDRIIGFCVFY  161
             + V+ L+ +P++ +W  T+    F VF+
Sbjct  114  AMFVLTLLSVPLSIIWYNTEH---FLVFF  139



>ref|XP_004952272.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 7-like 
[Setaria italica]
Length=483

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -3

Query  574  MEIPLILESENDERRKCWDE--VSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGG  401
            ME PL+  +   ++     E  V  EVKK + LAGPL++  LL   +Q IS+MF G+ G 
Sbjct  1    MEAPLVTLTGTGKKHGEGKESLVLSEVKKQLYLAGPLVTGQLLQNIVQMISIMFVGHLG-  59

Query  400  ELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVC  221
            +L L+GAS+A++FA+VTGFS + G+A +L+TLCGQ++GA ++ +LG++ QR + V+ LV 
Sbjct  60   KLPLAGASVASSFATVTGFSLLGGMAYSLETLCGQAFGAARHHLLGVYKQRAMVVLSLVS  119

Query  220  IPVTGVWAYTDRIIGFC  170
            +P   VWAYT  I+ +C
Sbjct  120  LPAAAVWAYTGEILAWC  136



>ref|XP_008645475.1| PREDICTED: MATE efflux family protein 9-like isoform X1 [Zea 
mays]
 gb|AFW70884.1| putative MATE efflux family protein [Zea mays]
Length=478

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -3

Query  535  RRKCWDEVSG---EVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATA  365
            R+    E SG   EVKK + LAGPL+   LL  ++Q +S+MF G+ G EL+L+ AS+AT+
Sbjct  13   RKDGGSEESGVVCEVKKQLYLAGPLVVGFLLQNTVQMVSVMFVGHLG-ELALASASLATS  71

Query  364  FASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDR  185
            FA VTGFS + G+A +LDTLCGQ++GA+Q+ +LG+  QR + V+ LV +PV  VWAYT  
Sbjct  72   FAGVTGFSLLAGMACSLDTLCGQAFGARQHHLLGVHKQRAMLVLALVSVPVALVWAYTGD  131

Query  184  IIGFC  170
            I+ +C
Sbjct  132  ILAWC  136



>ref|XP_010044148.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Eucalyptus 
grandis]
Length=516

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 21/161 (13%)
 Frame = -3

Query  604  DQKRMERKAEMEIPLIL------ESE---NDERRKCWDE----------VSGEVKKLMVL  482
            DQ   +  A +E PLI       E E   ND+   C             ++ EVKK + L
Sbjct  7    DQAN-DEPALLETPLIQNPSRDREHEYDGNDDDAACSSSLVRRDGSRAIITEEVKKQLWL  65

Query  481  AGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLC  302
            +GPLI +++L  S+  IS MF G+ G +L LSGASM  AFASVTGFS + G+ GAL+TLC
Sbjct  66   SGPLIGMSMLQESVPVISAMFVGHLG-KLPLSGASMGFAFASVTGFSVLSGMGGALETLC  124

Query  301  GQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            GQ+YGAKQY MLG+ TQR + ++L + IP+  +W YT  I+
Sbjct  125  GQAYGAKQYHMLGVHTQRAMLMLLCLSIPLAVIWLYTSDIL  165



>gb|KHN44604.1| MATE efflux family protein DTX1 [Glycine soja]
Length=525

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
            +E+S E KK + L+GP++ V++   SLQ ISLMF G+   EL L+G S+AT+F +VTGFS
Sbjct  6    NEISEEAKKQLWLSGPMVFVSVFQYSLQMISLMFVGHLD-ELLLAGVSLATSFVNVTGFS  64

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G++ ALDT CGQSYGA+QY M+GI  QR I +I+L  IP++ +WAY   I+
Sbjct  65   VLLGMSSALDTFCGQSYGAQQYHMVGIHMQRAIVIIMLATIPMSFIWAYLRPIL  118



>ref|XP_009106027.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
 ref|XP_009106028.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
 emb|CDY60134.1| BnaA07g39000D [Brassica napus]
Length=473

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 89/129 (69%), Gaps = 5/129 (4%)
 Frame = -3

Query  565  PLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLS  386
            PL++   N    +    V GEVKK + L+ PLI V+LL  SLQ IS+MF G+ G  L LS
Sbjct  8    PLLITETNTTMMR----VKGEVKKQLWLSAPLIGVSLLQYSLQVISVMFVGHLG-SLPLS  62

Query  385  GASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTG  206
             AS+AT+FASVTGF+F+ G A AL+TLCGQ+YGAK Y  LGI  QR + V+LL+ IP++ 
Sbjct  63   AASIATSFASVTGFTFLLGTASALETLCGQAYGAKLYGKLGIQMQRAMFVLLLLSIPLSV  122

Query  205  VWAYTDRII  179
            +W  T+ I+
Sbjct  123  IWFNTEHIL  131



>emb|CAN78228.1| hypothetical protein VITISV_022105 [Vitis vinifera]
Length=471

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -3

Query  526  CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTG  347
            C  E+  E KK + LAGPL++V++L   LQ IS+MF G+ G EL LSGASMAT+FASVTG
Sbjct  35   CRREIIEEAKKQLWLAGPLVAVSMLQYCLQVISIMFVGHLG-ELPLSGASMATSFASVTG  93

Query  346  FSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            FS + G+  AL+TLCGQ+YGA++Y M+G  TQR +  +L++ IP+  +W +T  I+
Sbjct  94   FSLLLGIGSALETLCGQAYGAREYHMVGXHTQRAMLTLLVLSIPLAFIWFFTAPIL  149



>gb|KHG10126.1| MATE efflux family protein 9 [Gossypium arboreum]
Length=489

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 93/141 (66%), Gaps = 4/141 (3%)
 Frame = -3

Query  586  RKAEMEIPLILESENDE---RRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            +K  ME  LIL+ EN+E   R   W     E+K+   LAGP+++V L    LQ IS M  
Sbjct  6    KKNIMEESLILKLENEEKSTRWLSWAAFVEEIKRAGYLAGPMVAVTLSQYLLQVISTMMV  65

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G EL+LS +++A + A VTGFSF+ G+A AL+TLCGQ+YGA+QY+ LGI T   I  
Sbjct  66   GHLG-ELALSSSAIAISLAGVTGFSFLLGMACALETLCGQAYGAQQYRKLGIHTYTAIFC  124

Query  235  ILLVCIPVTGVWAYTDRIIGF  173
            ++LVCIP++ +W Y  R++ F
Sbjct  125  LILVCIPLSILWLYMGRLLVF  145



>ref|XP_002532229.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30160.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=476

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 93/137 (68%), Gaps = 4/137 (3%)
 Frame = -3

Query  586  RKAEMEIPLILESENDERRK-CWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGN  410
            +   ME  L+L+  +D R    W   + EVKKL  +AGP+++V L    LQ ISLM  G+
Sbjct  5    QDKAMEESLLLK--DDSRTALTWPVFTQEVKKLGYIAGPMVAVILSQYLLQVISLMMVGH  62

Query  409  RGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVIL  230
             G EL+LS  ++AT+ A VTGFSF+ G+A AL+TLCGQ+YGAKQYK LGI TQ  I  ++
Sbjct  63   LG-ELALSSTAIATSLAGVTGFSFLLGMASALETLCGQAYGAKQYKKLGIQTQTAIFCLI  121

Query  229  LVCIPVTGVWAYTDRII  179
            LVCIP++ +W +  +++
Sbjct  122  LVCIPLSIIWTFMGKLL  138



>gb|EMS50494.1| MATE efflux family protein DTX1 [Triticum urartu]
Length=642

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 95/139 (68%), Gaps = 5/139 (4%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            RM++ +  E PL+   E  E     +E     K+L+ LAGPL +  +L ++LQ +S+MF 
Sbjct  109  RMQKPSVDEQPLLGPVERSEHVAALEEA----KRLLRLAGPLAAGGILRSALQLVSVMFV  164

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G EL L+GAS+AT+ A+VTGFS + G++ ALDTLCGQ++GA+QY +LG++ QR + V
Sbjct  165  GHLG-ELPLAGASLATSLANVTGFSLLVGMSSALDTLCGQAFGARQYHLLGLYKQRAMVV  223

Query  235  ILLVCIPVTGVWAYTDRII  179
            + L C+ +  VW+ T RI+
Sbjct  224  LALACVLIALVWSNTTRIL  242



>ref|XP_010103000.1| MATE efflux family protein 9 [Morus notabilis]
 gb|EXB94567.1| MATE efflux family protein 9 [Morus notabilis]
Length=511

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 95/165 (58%), Gaps = 27/165 (16%)
 Frame = -3

Query  589  ERKAEMEIPLILESENDERRKCWD------EVSGEVKKLMVLAGPLISVNLLLTSLQFIS  428
            ER+A + +P  +   +  +  C        E+  E KK + LAGPL+ VN+L   LQ IS
Sbjct  5    ERRAPLLLPQAVPVTSQVQENCLRQGVSKGEIVAEAKKQLQLAGPLVCVNVLTNCLQVIS  64

Query  427  LMFAGNRGGELSLSGASMATAFASVTGFSFMR--------------------GLAGALDT  308
            +MF G+ G EL+LSGASMAT+FASVTGFS +                     G+  AL+T
Sbjct  65   VMFVGHLG-ELALSGASMATSFASVTGFSLLFLSLWIEPYQTLPDKRQFSTIGMGSALET  123

Query  307  LCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGF  173
             CGQSYG KQ+ MLGI  QR + V+L+V +P+  +WA   +I+ F
Sbjct  124  FCGQSYGGKQFHMLGIHMQRAMLVLLIVSVPLAFIWANAGQILEF  168



>gb|KGN63859.1| hypothetical protein Csa_1G024910 [Cucumis sativus]
Length=472

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -3

Query  547  ENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMAT  368
              +++     +V+ E+K+ + LAGPL  V LL  SLQ IS+MF G+ G EL LSGASMAT
Sbjct  30   RTNDKNHTRQQVARELKRQLWLAGPLTLVGLLQYSLQMISVMFIGHLG-ELPLSGASMAT  88

Query  367  AFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTD  188
            +FA+VTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + V+LLV +P+  +WA T 
Sbjct  89   SFATVTGFSLLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMVVLLLVSVPLAVIWANTG  148

Query  187  RII  179
             I+
Sbjct  149  EIL  151



>ref|XP_002888942.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65201.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=476

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = -3

Query  538  ERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFA  359
            ER      V  EVKK + L+ PLI V+LL  SLQ IS+MF G+ G  L LS AS+AT+FA
Sbjct  13   ERDTTMIRVKEEVKKQLWLSAPLIGVSLLQYSLQVISVMFVGHLG-SLPLSAASIATSFA  71

Query  358  SVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            SVTGF+F+ G A AL+TLCGQ+YGAK Y  LGI  QR + V+L++ +P++ +WA T++I+
Sbjct  72   SVTGFTFLLGTASALETLCGQAYGAKLYGKLGIHMQRAMFVLLILSVPLSIIWANTEQIL  131



>ref|XP_004137334.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
Length=496

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -3

Query  547  ENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMAT  368
              +++     +V+ E+K+ + LAGPL  V LL  SLQ IS+MF G+ G EL LSGASMAT
Sbjct  30   RTNDKNHTRQQVARELKRQLWLAGPLTLVGLLQYSLQMISVMFIGHLG-ELPLSGASMAT  88

Query  367  AFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTD  188
            +FA+VTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + V+LLV +P+  +WA T 
Sbjct  89   SFATVTGFSLLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMVVLLLVSVPLAVIWANTG  148

Query  187  RII  179
             I+
Sbjct  149  EIL  151



>ref|XP_010044149.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Eucalyptus 
grandis]
Length=489

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -3

Query  514  VSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFM  335
            ++ EVKK + L+GPLI +++L  S+  IS MF G+ G +L LSGASM  AFASVTGFS +
Sbjct  55   ITEEVKKQLWLSGPLIGMSMLQESVPVISAMFVGHLG-KLPLSGASMGFAFASVTGFSVL  113

Query  334  RGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             G+ GAL+TLCGQ+YGAKQY MLG+ TQR + ++L + IP+  +W YT  I+
Sbjct  114  SGMGGALETLCGQAYGAKQYHMLGVHTQRAMLMLLCLSIPLAVIWLYTSDIL  165



>ref|XP_004160423.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
Length=496

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -3

Query  547  ENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMAT  368
              +++     +V+ E+K+ + LAGPL  V LL  SLQ IS+MF G+ G EL LSGASMAT
Sbjct  30   RTNDKNHTRQQVARELKRQLWLAGPLTLVGLLQYSLQMISVMFIGHLG-ELPLSGASMAT  88

Query  367  AFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTD  188
            +FA+VTGFS + G+A ALDT CGQSYGAKQY MLGI  QR + V+LLV +P+  +WA T 
Sbjct  89   SFATVTGFSLLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMVVLLLVSVPLAVIWANTG  148

Query  187  RII  179
             I+
Sbjct  149  EIL  151



>ref|XP_004952275.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Setaria 
italica]
Length=383

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -3

Query  505  EVKKLMVLAGPLISVNLLLTSL-QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRG  329
            EVKK + LA PL+ V LLL +L Q +S+MF G+ G EL+L+ AS+AT+FA VTGFS + G
Sbjct  26   EVKKQLYLAVPLV-VGLLLQNLVQMVSVMFVGHLG-ELALASASLATSFAGVTGFSLLAG  83

Query  328  LAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
            +A +LDTLCGQ++GA+QY  +G++ QR + V+ LV +PV  VWAYT  I+ +C
Sbjct  84   MACSLDTLCGQAFGARQYHQIGVYKQRAMLVLALVSVPVAAVWAYTGEILAWC  136



>ref|XP_004137333.1| PREDICTED: MATE efflux family protein 9-like [Cucumis sativus]
Length=496

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
             +V+ E+K+ + LAGPLI V+LL  SLQ IS+MF G+ G EL LSGASMAT+FA+VTGFS
Sbjct  39   QQVAEELKRQLWLAGPLILVSLLQYSLQMISVMFVGHLG-ELPLSGASMATSFATVTGFS  97

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LLV +P+  +WA T  I+
Sbjct  98   LLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMVVLLLVSVPLAVIWANTGGIL  151



>ref|XP_004160425.1| PREDICTED: MATE efflux family protein 9-like [Cucumis sativus]
Length=496

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  520  DEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFS  341
             +V+ E+K+ + LAGPLI V+LL  SLQ IS+MF G+ G EL LSGASMAT+FA+VTGFS
Sbjct  39   QQVAEELKRQLWLAGPLILVSLLQYSLQMISVMFVGHLG-ELPLSGASMATSFATVTGFS  97

Query  340  FMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
             + G+A ALDT CGQSYGAKQY MLGI  QR + V+LLV +P+  +WA T  I+
Sbjct  98   LLMGMASALDTFCGQSYGAKQYHMLGIHMQRAMVVLLLVSVPLAVIWANTGGIL  151



>emb|CDX84324.1| BnaC04g10860D [Brassica napus]
Length=484

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 91/141 (65%), Gaps = 9/141 (6%)
 Frame = -3

Query  595  RMERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFA  416
            + E    +  PLI +  +  +         EVKK + LAGPLI+V+LL   LQ IS+MF 
Sbjct  2    KKESNDVLSWPLIEQKSSGIKE--------EVKKQLWLAGPLIAVSLLQFCLQVISVMFV  53

Query  415  GNRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPV  236
            G+ G  L LS A++AT+FASVTGF+F+ G A ALDT+CGQSYGAK Y MLGI  QR + V
Sbjct  54   GHLG-SLPLSAAAVATSFASVTGFTFLMGTASALDTVCGQSYGAKLYGMLGIQMQRAMLV  112

Query  235  ILLVCIPVTGVWAYTDRIIGF  173
            + L  IP++ +WA T+  + F
Sbjct  113  LTLYSIPLSIIWANTEHFLLF  133



>ref|XP_010468567.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=439

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 13/138 (9%)
 Frame = -3

Query  592  MERKAEMEIPLILESENDERRKCWDEVSGEVKKLMVLAGPLISVNLLLTSLQFISLMFAG  413
            ME  A + +P     +N+  +        EVKK + L+ PLI V++L  SLQ IS+MF G
Sbjct  1    MEADAALPLP-----QNNNLKV-------EVKKQLRLSAPLIGVSILQYSLQVISVMFVG  48

Query  412  NRGGELSLSGASMATAFASVTGFSFMRGLAGALDTLCGQSYGAKQYKMLGIFTQRGIPVI  233
            + G  L LS AS+AT+FASVTGF+F+ G AGAL+TLCGQSYGA+++  LGI  QR + V+
Sbjct  49   HLG-SLRLSAASIATSFASVTGFTFLMGTAGALETLCGQSYGARRFGNLGILMQRAMCVL  107

Query  232  LLVCIPVTGVWAYTDRII  179
            L++ +P++ +WA T+ I+
Sbjct  108  LVLSVPLSIIWANTEHIL  125



>ref|XP_003579577.1| PREDICTED: MATE efflux family protein 5-like [Brachypodium distachyon]
Length=481

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = -3

Query  505  EVKKLMVLAGPLISVNLLLTSLQFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRGL  326
            EVKK + LAGPLI+  LL   +Q IS+MF G+ G EL+LS AS+AT+FA VTGFS + G+
Sbjct  29   EVKKQLYLAGPLIAGCLLQNVVQMISVMFVGHLG-ELALSSASIATSFAGVTGFSLLSGM  87

Query  325  AGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRII  179
            A +LDTLCGQ++GAKQY +LGI+ QR I V+ LV   V  +W YT +I+
Sbjct  88   ASSLDTLCGQAFGAKQYNLLGIYKQRAILVLTLVSFVVAIIWVYTGQIL  136



>ref|XP_004952274.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Setaria 
italica]
Length=478

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -3

Query  505  EVKKLMVLAGPLISVNLLLTSL-QFISLMFAGNRGGELSLSGASMATAFASVTGFSFMRG  329
            EVKK + LA PL+ V LLL +L Q +S+MF G+ G EL+L+ AS+AT+FA VTGFS + G
Sbjct  26   EVKKQLYLAVPLV-VGLLLQNLVQMVSVMFVGHLG-ELALASASLATSFAGVTGFSLLAG  83

Query  328  LAGALDTLCGQSYGAKQYKMLGIFTQRGIPVILLVCIPVTGVWAYTDRIIGFC  170
            +A +LDTLCGQ++GA+QY  +G++ QR + V+ LV +PV  VWAYT  I+ +C
Sbjct  84   MACSLDTLCGQAFGARQYHQIGVYKQRAMLVLALVSVPVAAVWAYTGEILAWC  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 922580742716