BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24596_g1_i1 len=1845 path=[2477:0-486 2964:487-536 4886:537-607
1263:608-1618 2274:1619-1844]

Length=1845
                                                                      Score     E

ref|XP_009620064.1|  PREDICTED: uncharacterized protein LOC104111...    512   6e-168   
ref|XP_009620063.1|  PREDICTED: uncharacterized protein LOC104111...    508   4e-166   
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    512   1e-165   
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    508   6e-164   
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             492   6e-158   
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    487   5e-156   
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    452   3e-142   
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             448   6e-141   
ref|XP_008350700.1|  PREDICTED: uncharacterized protein LOC103414060    442   2e-139   
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    443   5e-139   
ref|XP_010241227.1|  PREDICTED: uncharacterized protein LOC104585...    434   4e-138   
ref|XP_002517810.1|  conserved hypothetical protein                     436   2e-136   Ricinus communis
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    434   5e-136   
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    434   1e-135   Vitis vinifera
ref|XP_003605757.1|  EFR3-like protein                                  432   4e-135   
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    431   1e-134   
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             429   9e-134   
ref|XP_010653792.1|  PREDICTED: uncharacterized protein LOC100255...    419   2e-131   
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                421   2e-131   
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    423   2e-131   
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    422   3e-131   
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    421   4e-131   
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476    422   6e-131   
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    420   9e-131   
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    419   5e-130   
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    418   6e-130   Vitis vinifera
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    417   2e-129   
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    417   5e-129   
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             416   7e-129   
ref|XP_008463098.1|  PREDICTED: uncharacterized protein LOC103501...    414   2e-128   
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...    414   2e-128   
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    414   6e-128   
ref|XP_008350294.1|  PREDICTED: uncharacterized protein LOC103413615    408   1e-127   
ref|XP_004171248.1|  PREDICTED: uncharacterized LOC101219905            409   2e-127   
emb|CDP18636.1|  unnamed protein product                                410   1e-126   
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    407   7e-126   
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219905    409   1e-125   
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    407   2e-125   
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    405   1e-124   
ref|XP_004136123.1|  PREDICTED: uncharacterized protein LOC101211879    403   7e-124   
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    402   8e-124   
ref|XP_008784322.1|  PREDICTED: uncharacterized protein LOC103703...    399   4e-123   
gb|KDP43492.1|  hypothetical protein JCGZ_16779                         387   6e-123   
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    399   1e-122   
ref|XP_008443203.1|  PREDICTED: uncharacterized protein LOC103486...    395   2e-122   
ref|XP_008443202.1|  PREDICTED: uncharacterized protein LOC103486...    395   2e-122   
ref|XP_008461316.1|  PREDICTED: uncharacterized protein LOC103499...    395   4e-122   
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    397   6e-122   
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  397   6e-122   
ref|XP_010927191.1|  PREDICTED: uncharacterized protein LOC105049285    395   1e-121   
ref|XP_004136762.1|  PREDICTED: uncharacterized protein LOC101210251    395   3e-121   
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    394   5e-121   
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    395   7e-121   
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...    394   8e-121   
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    395   9e-121   
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    394   2e-120   
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         392   8e-120   
ref|XP_006838291.1|  hypothetical protein AMTR_s00103p00108190          391   2e-119   
gb|KHG10001.1|  hypothetical protein F383_03012                         385   3e-119   
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    389   7e-119   
gb|KHG10000.1|  hypothetical protein F383_03012                         384   9e-119   
emb|CBI24919.3|  unnamed protein product                                394   2e-118   
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    387   3e-118   
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    387   5e-118   
gb|KHN11694.1|  Protein EFR3 like B                                     385   2e-117   
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    385   3e-117   
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    384   1e-116   
ref|XP_007203028.1|  hypothetical protein PRUPE_ppa018106mg             372   2e-116   
gb|KHG08769.1|  Protein EFR3 B                                          382   2e-116   
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             382   5e-116   
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    379   3e-115   
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    380   3e-115   
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    379   5e-115   
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    378   7e-115   
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    378   9e-115   
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    376   7e-114   
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                374   2e-113   
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             374   3e-113   
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       372   1e-112   
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    372   1e-112   
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         371   4e-112   
emb|CDY09095.1|  BnaA02g05210D                                          370   5e-112   
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...    367   1e-111   
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       366   1e-110   
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       367   1e-110   
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    364   8e-110   
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...    364   8e-110   
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         364   1e-109   
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    364   2e-109   
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    363   4e-109   
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             363   4e-109   
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    362   9e-109   
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    362   1e-108   
ref|XP_002322714.1|  cyclin-related family protein                      362   2e-108   Populus trichocarpa [western balsam poplar]
emb|CBI29857.3|  unnamed protein product                                365   2e-108   
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    360   7e-108   
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             360   9e-108   
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       358   1e-107   
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       358   3e-107   
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     358   4e-107   
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    358   6e-107   
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       357   6e-107   
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    357   7e-107   
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    357   8e-107   
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    356   2e-106   
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       355   4e-106   
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    355   7e-106   
ref|NP_181714.3|  uncharacterized protein                               353   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             353   2e-105   
dbj|BAF00551.1|  hypothetical protein                                   352   4e-105   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68493.1|  hypothetical protein M569_06272                         350   2e-104   
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             350   3e-104   
emb|CDY06905.1|  BnaA04g24100D                                          350   3e-104   
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    348   3e-103   
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    348   3e-103   
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       347   4e-103   
ref|XP_009610963.1|  PREDICTED: uncharacterized protein LOC104104...    345   5e-103   
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    347   6e-103   
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       346   8e-103   
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       344   2e-102   
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       345   3e-102   
ref|XP_004166917.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    344   3e-102   
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       345   3e-102   
gb|KDP26045.1|  hypothetical protein JCGZ_21078                         344   4e-102   
ref|XP_009142014.1|  PREDICTED: uncharacterized protein LOC103865...    341   2e-101   
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 341   2e-101   
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    342   2e-101   
emb|CDY14788.1|  BnaC04g47850D                                          342   3e-101   
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    342   7e-101   
ref|NP_197607.5|  uncharacterized protein                               341   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    341   1e-100   
gb|AAC02765.1|  hypothetical protein                                    338   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             339   5e-100   
ref|XP_008655591.1|  PREDICTED: uncharacterized protein LOC103634...    333   2e-99    
ref|XP_008655590.1|  PREDICTED: uncharacterized protein LOC103634...    333   6e-99    
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    333   4e-98    
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    333   6e-98    
dbj|BAK01387.1|  predicted protein                                      333   9e-98    
emb|CDX79909.1|  BnaA05g02470D                                          331   2e-97    
gb|EEC81712.1|  hypothetical protein OsI_25322                          332   4e-97    Oryza sativa Indica Group [Indian rice]
ref|NP_001059150.1|  Os07g0205900                                       332   4e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KHG10450.1|  Protein EFR3                                            329   6e-97    
ref|XP_006858684.1|  hypothetical protein AMTR_s00066p00085830          330   9e-97    
ref|XP_009351152.1|  PREDICTED: uncharacterized protein LOC103942690    308   8e-94    
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    317   3e-92    
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    317   3e-92    
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    317   3e-92    
ref|XP_002529611.1|  conserved hypothetical protein                     317   4e-92    Ricinus communis
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    314   7e-91    
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656    314   8e-91    
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    312   3e-90    
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    313   4e-90    
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    311   9e-90    
emb|CDY48767.1|  BnaC04g02200D                                          313   2e-89    
emb|CAJ44368.1|  putative cyclin-related protein                        306   3e-89    Malus domestica [apple tree]
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             309   4e-89    
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    308   1e-88    
gb|KDO53677.1|  hypothetical protein CISIN_1g0359232mg                  300   5e-88    
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    305   1e-87    
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    304   2e-87    
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          303   2e-87    Sorghum bicolor [broomcorn]
gb|AFW69348.1|  hypothetical protein ZEAMMB73_015704                    297   2e-86    
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...    301   4e-86    
ref|XP_004951915.1|  PREDICTED: uncharacterized protein LOC101783...    299   4e-86    
gb|KHN07377.1|  hypothetical protein glysoja_012675                     299   5e-86    
ref|XP_007028782.1|  Uncharacterized protein isoform 2                  293   7e-86    
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...    300   1e-85    
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    298   3e-85    
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             298   4e-85    
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...    298   4e-85    
ref|XP_006648007.1|  PREDICTED: protein EFR3 homolog B-like isofo...    295   5e-85    
ref|NP_001048304.1|  Os02g0780500                                       297   8e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648008.1|  PREDICTED: protein EFR3 homolog B-like isofo...    295   1e-84    
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...    296   1e-84    
gb|EMS53000.1|  Protein EFR3-like protein B                             296   2e-84    
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    295   5e-84    
ref|NP_001045867.1|  Os02g0143200                                       293   2e-83    Oryza sativa Japonica Group [Japonica rice]
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                    293   2e-83    
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    293   2e-83    
gb|EEC72466.1|  hypothetical protein OsI_05818                          293   3e-83    Oryza sativa Indica Group [Indian rice]
gb|EEE56284.1|  hypothetical protein OsJ_05346                          293   3e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EMT11310.1|  hypothetical protein F775_16040                         291   2e-82    
gb|KEH23652.1|  cyclin-like protein                                     288   1e-81    
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          288   2e-81    Sorghum bicolor [broomcorn]
ref|XP_008387298.1|  PREDICTED: uncharacterized protein LOC103449...    272   4e-81    
gb|KHN32414.1|  Protein EFR3 like B                                     286   5e-81    
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             285   1e-80    
ref|XP_010233799.1|  PREDICTED: uncharacterized protein LOC100821...    284   2e-80    
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    283   1e-79    
ref|XP_008387296.1|  PREDICTED: uncharacterized protein LOC103449...    267   3e-79    
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488    280   8e-79    
dbj|BAK04246.1|  predicted protein                                      278   5e-78    
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    277   1e-77    
gb|EEE57911.1|  hypothetical protein OsJ_08605                          274   3e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EMT12879.1|  hypothetical protein F775_15212                         274   7e-77    
ref|XP_002308951.2|  cyclin-related family protein                      273   9e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    272   5e-76    
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    271   9e-76    
ref|XP_010650558.1|  PREDICTED: uncharacterized protein LOC100264...    270   1e-75    
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    270   5e-75    Vitis vinifera
ref|XP_008790621.1|  PREDICTED: uncharacterized protein LOC103707...    268   8e-75    
gb|KDP42800.1|  hypothetical protein JCGZ_23742                         268   1e-74    
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    268   1e-74    
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    268   2e-74    
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    267   3e-74    
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    267   3e-74    
ref|XP_010672160.1|  PREDICTED: uncharacterized protein LOC104888...    266   4e-74    
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    266   1e-73    
gb|AFW70124.1|  hypothetical protein ZEAMMB73_889435                    264   2e-73    
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    265   2e-73    
ref|XP_006590941.1|  PREDICTED: uncharacterized protein LOC100817...    264   2e-73    
gb|AFW70122.1|  hypothetical protein ZEAMMB73_889435                    263   3e-73    
gb|AFW70123.1|  hypothetical protein ZEAMMB73_889435                    263   4e-73    
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    264   4e-73    
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    263   1e-72    
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    263   1e-72    
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    263   1e-72    
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    263   2e-72    
ref|XP_006595062.1|  PREDICTED: uncharacterized protein LOC100806...    260   2e-72    
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    261   3e-72    
ref|XP_007033976.1|  ARM repeat superfamily protein isoform 6           258   3e-72    
ref|XP_008644202.1|  PREDICTED: uncharacterized protein LOC100501...    260   3e-72    
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    261   3e-72    
gb|KHN06209.1|  Protein EFR3 like B                                     261   4e-72    
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    261   5e-72    
gb|KEH39475.1|  cyclin-like protein                                     260   7e-72    
ref|XP_008800011.1|  PREDICTED: uncharacterized protein LOC103714...    259   7e-72    
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    259   1e-71    
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    260   1e-71    
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    259   1e-71    
gb|KHN25286.1|  Protein EFR3 like B                                     259   2e-71    
gb|KEH30318.1|  cyclin-like protein                                     259   2e-71    
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    259   3e-71    
ref|XP_010932402.1|  PREDICTED: uncharacterized protein LOC105053...    254   3e-71    
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    258   3e-71    
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    259   3e-71    
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           258   7e-71    
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313176    258   7e-71    
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    254   1e-70    
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    257   1e-70    
gb|AAX94774.1|  cyclin-related protein 1                                247   2e-70    Cucumis sativus [cucumbers]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           256   2e-70    
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    256   3e-70    
ref|XP_003597513.1|  EFR3-like protein                                  255   4e-70    
ref|XP_006597231.1|  PREDICTED: uncharacterized protein LOC100811...    253   4e-70    
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             255   5e-70    
ref|XP_006597230.1|  PREDICTED: uncharacterized protein LOC100811...    253   9e-70    
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    254   1e-69    
gb|KHG30683.1|  Protein EFR3 cmp44E                                     253   2e-69    
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    253   3e-69    
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    253   3e-69    
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    253   3e-69    
ref|XP_004486921.1|  PREDICTED: uncharacterized protein LOC101509...    250   4e-69    
gb|KHN30101.1|  Protein EFR3 like B                                     251   9e-69    
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             251   1e-68    
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             251   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    250   2e-68    
ref|XP_004164509.1|  PREDICTED: uncharacterized LOC101211879            238   2e-68    
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    251   2e-68    
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    249   5e-68    
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    249   7e-68    
ref|XP_008369216.1|  PREDICTED: uncharacterized protein LOC103432787    248   8e-68    
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             248   9e-68    
ref|XP_002533049.1|  conserved hypothetical protein                     248   1e-67    Ricinus communis
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    247   2e-67    
ref|XP_004168868.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    246   3e-67    
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203725    246   8e-67    
gb|KCW57606.1|  hypothetical protein EUGRSUZ_H00374                     243   2e-66    
gb|KHN33312.1|  Protein EFR3 like B                                     244   3e-66    
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...    242   7e-66    
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       243   1e-65    
ref|XP_006443049.1|  hypothetical protein CICLE_v100186801mg            241   2e-65    
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   241   2e-65    
ref|XP_006478686.1|  PREDICTED: uncharacterized protein LOC102614...    241   3e-65    
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    241   4e-65    
gb|EYU18742.1|  hypothetical protein MIMGU_mgv1a0012533mg               233   1e-64    
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    239   2e-64    
ref|NP_001168091.1|  uncharacterized protein LOC100381825               223   5e-63    Zea mays [maize]
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   232   4e-62    
ref|XP_010097526.1|  hypothetical protein L484_024737                   234   5e-62    
emb|CDP16550.1|  unnamed protein product                                231   7e-62    
ref|XP_010313084.1|  PREDICTED: uncharacterized protein LOC101250...    231   8e-62    
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...    231   8e-62    
ref|XP_009784840.1|  PREDICTED: uncharacterized protein LOC104233...    229   1e-61    
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    230   2e-61    
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    230   2e-61    
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     229   5e-61    
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   228   1e-60    
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    221   3e-58    
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    221   3e-58    
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    219   7e-58    
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    217   4e-57    
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    217   5e-57    
ref|NP_001183056.1|  uncharacterized protein LOC100501399               211   7e-57    
ref|XP_009784839.1|  PREDICTED: uncharacterized protein LOC104233...    214   4e-56    
ref|XP_004158232.1|  PREDICTED: protein EFR3 homolog cmp44E-like        213   6e-56    
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    214   6e-56    
gb|EMS60662.1|  Protein EFR3-like protein                               211   4e-55    
ref|NP_001045092.1|  Os01g0898300                                       209   2e-54    
gb|EMT06694.1|  Putative mitochondrial protein                          210   3e-54    
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg             206   1e-53    
ref|XP_010522187.1|  PREDICTED: uncharacterized protein LOC104800...    206   1e-53    
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    207   2e-53    
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                   204   3e-53    
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  204   4e-53    
ref|XP_010092918.1|  hypothetical protein L484_004959                   201   5e-53    
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    205   6e-53    
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    205   7e-53    
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         205   1e-52    
gb|ACN33230.1|  unknown                                                 201   5e-52    
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    201   1e-51    
ref|XP_001770437.1|  predicted protein                                  202   1e-51    
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    199   9e-51    
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    198   2e-50    
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    198   2e-50    
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             194   3e-49    
ref|XP_010092920.1|  hypothetical protein L484_004961                   182   1e-47    
ref|XP_010557097.1|  PREDICTED: uncharacterized protein LOC104826...    189   1e-47    
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...    189   2e-47    
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    189   2e-47    
ref|XP_010102566.1|  hypothetical protein L484_018038                   187   3e-47    
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    187   8e-47    
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    187   9e-47    
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    186   3e-46    
ref|XP_009784842.1|  PREDICTED: uncharacterized protein LOC104233...    182   2e-45    
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    182   4e-45    
ref|XP_006840435.1|  hypothetical protein AMTR_s00045p00164850          182   5e-45    
emb|CDM85315.1|  unnamed protein product                                181   8e-45    
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       179   2e-44    
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    180   3e-44    
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    179   4e-44    
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             179   7e-44    
ref|NP_001049903.1|  Os03g0308200                                       177   2e-43    
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          176   3e-43    
ref|NP_563755.1|  ARM repeat superfamily protein                        176   6e-43    
ref|NP_001154308.1|  ARM repeat superfamily protein                     176   7e-43    
gb|EEE55815.1|  hypothetical protein OsJ_04415                          175   1e-42    
gb|AFW70125.1|  hypothetical protein ZEAMMB73_889435                    172   1e-42    
ref|XP_010102564.1|  hypothetical protein L484_018036                   167   1e-42    
ref|XP_001767624.1|  predicted protein                                  172   2e-42    
gb|EAY89716.1|  hypothetical protein OsI_11254                          174   2e-42    
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    174   3e-42    
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    174   3e-42    
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              171   4e-42    
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    173   5e-42    
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         172   1e-41    
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          171   1e-41    
gb|KGN45115.1|  hypothetical protein Csa_7G426560                       170   5e-41    
gb|EMS54754.1|  Protein EFR3-like protein A                             169   1e-40    
emb|CDY09999.1|  BnaC08g44520D                                          169   1e-40    
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    169   1e-40    
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    168   2e-40    
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    168   2e-40    
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    167   3e-40    
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    166   1e-39    
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             166   1e-39    
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    165   2e-39    
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    165   2e-39    
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    164   3e-39    
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    164   3e-39    
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    164   4e-39    
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       162   2e-38    
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    162   2e-38    
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    162   2e-38    
emb|CAN82509.1|  hypothetical protein VITISV_012725                     162   3e-38    
ref|XP_002892313.1|  predicted protein                                  161   6e-38    
ref|XP_002438965.1|  hypothetical protein SORBIDRAFT_10g029070          157   6e-38    
emb|CDY06190.1|  BnaA09g50130D                                          160   7e-38    
gb|KDP23388.1|  hypothetical protein JCGZ_23221                         159   2e-37    
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    158   3e-37    
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    158   4e-37    
ref|XP_006303898.1|  hypothetical protein CARUB_v10008206mg             155   7e-37    
gb|KDO81672.1|  hypothetical protein CISIN_1g0461821mg                  156   8e-37    
gb|KHG26707.1|  Efr3b                                                   157   9e-37    
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  156   1e-36    
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    156   2e-36    
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             155   2e-36    
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    155   2e-36    
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             155   3e-36    
gb|KHG02153.1|  Protein EFR3                                            154   5e-36    
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                154   7e-36    
emb|CDX88246.1|  BnaA06g28370D                                          154   7e-36    
dbj|BAH57285.1|  AT5G26850                                              154   7e-36    
ref|NP_198037.3|  uncharacterized protein                               154   8e-36    
dbj|BAC41892.1|  unknown protein                                        154   9e-36    
gb|KHG26706.1|  Protein EFR3 B                                          154   9e-36    
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313033    153   1e-35    
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  153   2e-35    
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  153   2e-35    
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             152   2e-35    
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    152   4e-35    
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    151   6e-35    
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    151   7e-35    
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             150   7e-35    
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             150   9e-35    
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    150   1e-34    
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    150   1e-34    
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    149   2e-34    
emb|CDP18254.1|  unnamed protein product                                148   5e-34    
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          147   8e-34    
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    147   1e-33    
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    147   1e-33    
ref|XP_007031157.1|  Uncharacterized protein isoform 3                  146   1e-33    
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           146   1e-33    
emb|CDY19753.1|  BnaA09g04060D                                          146   2e-33    
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             145   3e-33    
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    145   5e-33    
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             145   5e-33    
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    145   6e-33    
gb|KEH43106.1|  cyclin-like protein                                     144   7e-33    
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    144   1e-32    
ref|XP_010421541.1|  PREDICTED: uncharacterized protein LOC104706...    144   1e-32    
emb|CDX80597.1|  BnaC07g28470D                                          144   1e-32    
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    143   2e-32    
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    143   2e-32    
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    143   2e-32    
emb|CDX87029.1|  BnaC09g03440D                                          143   2e-32    
gb|EEC75095.1|  hypothetical protein OsI_11253                          139   5e-32    
ref|XP_004165925.1|  PREDICTED: uncharacterized LOC101202927            142   7e-32    
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    141   8e-32    
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    140   1e-31    
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             141   1e-31    
ref|NP_001170324.1|  hypothetical protein                               135   4e-31    
ref|XP_009111017.1|  PREDICTED: protein EFR3 homolog isoform X2         138   9e-31    
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         138   9e-31    
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         138   9e-31    
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             136   3e-30    
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             136   4e-30    
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    135   6e-30    
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    135   6e-30    
emb|CDY47707.1|  BnaA10g03960D                                          135   1e-29    
emb|CDY10165.1|  BnaC05g04080D                                          134   2e-29    
ref|XP_003636946.1|  Mitogen-activated protein kinase                   132   9e-29    
emb|CDY63789.1|  BnaA08g31700D                                          132   1e-28    
emb|CDX86545.1|  BnaC08g01580D                                          132   1e-28    
ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    131   2e-28    
ref|XP_010092978.1|  hypothetical protein L484_018915                   131   2e-28    
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    128   1e-27    
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    128   2e-27    
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    128   2e-27    
gb|ABF95548.1|  cyclin, putative, expressed                             125   1e-26    
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    122   2e-25    
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    121   3e-25    
gb|ACN36551.1|  unknown                                                 115   1e-24    
gb|EAY84451.1|  hypothetical protein OsI_05824                          111   2e-24    
ref|XP_006372882.1|  hypothetical protein POPTR_0017s05950g             110   5e-23    
emb|CDX70960.1|  BnaC03g10440D                                          112   6e-23    
gb|KHN23226.1|  hypothetical protein glysoja_046386                     109   4e-22    
ref|XP_008347368.1|  PREDICTED: uncharacterized protein LOC103410445    103   1e-20    
gb|ACN31300.1|  unknown                                                 100   6e-20    
gb|KHN23227.1|  Protein EFR3 like cmp44E                              99.8    2e-18    
ref|XP_010910850.1|  PREDICTED: uncharacterized protein LOC105036814  92.8    1e-17    
ref|NP_001146145.1|  uncharacterized protein LOC100279714             92.8    2e-17    
ref|XP_008348049.1|  PREDICTED: uncharacterized protein LOC103411...  90.5    3e-17    
ref|XP_002453296.1|  hypothetical protein SORBIDRAFT_04g003430        88.2    2e-16    
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004            91.7    8e-16    
gb|EYU18741.1|  hypothetical protein MIMGU_mgv1a0012532mg             81.6    4e-14    
ref|XP_010911447.1|  PREDICTED: uncharacterized protein LOC105037488  80.9    5e-14    
gb|KHN26320.1|  hypothetical protein glysoja_029274                   80.1    6e-14    
ref|XP_006605815.1|  PREDICTED: uncharacterized protein LOC100808778  82.4    6e-14    
ref|XP_008348050.1|  PREDICTED: uncharacterized protein LOC103411...  77.4    8e-13    
gb|EPS66652.1|  hypothetical protein M569_08124                       75.1    9e-13    
gb|EMT28557.1|  Protein EFR3-like protein                             81.6    1e-12    
gb|EPS66114.1|  hypothetical protein M569_08663                       76.3    5e-12    
ref|XP_002512512.1|  conserved hypothetical protein                   79.0    7e-12    
ref|XP_006483677.1|  PREDICTED: uncharacterized protein LOC102609214  74.7    7e-12    
gb|AAB61061.1|  Hypothetical protein F2P16.24                         70.9    2e-09    
gb|EPS68833.1|  hypothetical protein M569_05934                       70.1    3e-09    
gb|KHN25508.1|  RNA polymerase II-associated protein 3                66.2    6e-08    
gb|KDO37359.1|  hypothetical protein CISIN_1g034282mg                 61.6    7e-08    
emb|CDY54108.1|  BnaC04g53870D                                        62.0    4e-07    
ref|XP_010094723.1|  hypothetical protein L484_003597                 62.0    9e-07    
ref|XP_007052500.1|  Uncharacterized protein TCM_005861               56.2    5e-06    
ref|XP_006605812.1|  PREDICTED: uncharacterized protein LOC102659728  56.2    2e-05    
ref|XP_008348051.1|  PREDICTED: uncharacterized protein LOC103411...  53.9    4e-05    
gb|ABK95069.1|  unknown                                               53.5    4e-05    
gb|KHN23161.1|  hypothetical protein glysoja_030221                   56.6    5e-05    



>ref|XP_009620064.1| PREDICTED: uncharacterized protein LOC104111950 isoform X2 [Nicotiana 
tomentosiformis]
Length=833

 Score =   512 bits (1319),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 299/547 (55%), Positives = 377/547 (69%), Gaps = 44/547 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  290   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPTSVHPRSTKASGIQR  349

Query  182   TLSRTVSVFSSSAALFDKLGKNQS------SGKD------GMDQNTQNMLNRLTSTYSRS  325
             TLSRTVSVFSSSAALFDKL K QS      +GK+       M +N Q+ML RLTSTYSR+
Sbjct  350   TLSRTVSVFSSSAALFDKLKKEQSPSHDNVAGKEKTFNAKSMVKN-QSMLKRLTSTYSRA  408

Query  326   LSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              +VK    PG++E    G N +E  +G+SLK+K RQIS+LLSS++VQAIS  NTPE++E+
Sbjct  409   YTVKRNSLPGTDEGKEIG-NTEEEQDGISLKLKIRQISLLLSSLWVQAISPANTPENYES  467

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS+  +  +PPSRRRSLF LATSMII
Sbjct  468   IAHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIGGKGSLPPSRRRSLFMLATSMII  527

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAK  847
             FLSK Y+FIP+   AKA LTDKT+DPFLQLVD+C L+ V  N  +A   YGSKEDD+ A 
Sbjct  528   FLSKAYNFIPVVACAKAALTDKTVDPFLQLVDDCKLQAVTGNTEQAVKVYGSKEDDDDAL  587

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
             +SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++ 
Sbjct  588   KSLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSET  647

Query  1025  ---LRNHNQSDDKTNDEVVDPTFTVDDLGSHSD----PNAHPD-STPNLLDVNEFLDSVL  1180
                +      DDK+ DEV DPT  + + G  ++     N+H     P+LL V +FLDSV 
Sbjct  648   SGQIYQFGSEDDKSLDEVGDPTLPILEDGVPTENKNISNSHLTLQIPDLLTVTQFLDSVS  707

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFSEETIWQ  1354
             +T+ QVGR S +  + MT+ D+A  CEA Q GK  +M+       + E  F+F  +   Q
Sbjct  708   DTTLQVGRLSVS-TSDMTYKDMAGHCEALQAGKQEKMSHLMIAQASRENPFDFYGQDYIQ  766

Query  1355  P---PSGNPFADNNTaaagqpvnaaapaS---------CATEYQRHPSFMQLPASSPYDN  1498
                 PS +     +T    +  + +  ++         CATE Q HP+F  LPASSPYDN
Sbjct  767   ANMKPSYSCVDMKSTPVHVKHGSDSNLSNPFINVTPTPCATESQCHPNFFALPASSPYDN  826

Query  1499  FLKAAGS  1519
             FLKAAGS
Sbjct  827   FLKAAGS  833



>ref|XP_009620063.1| PREDICTED: uncharacterized protein LOC104111950 isoform X1 [Nicotiana 
tomentosiformis]
Length=834

 Score =   508 bits (1307),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 299/548 (55%), Positives = 377/548 (69%), Gaps = 45/548 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  290   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPTSVHPRSTKASGIQR  349

Query  182   TLSRTVSVFSSSAALFDKLGKNQS------SGKD------GMDQNTQNMLNRLTSTYSRS  325
             TLSRTVSVFSSSAALFDKL K QS      +GK+       M +N Q+ML RLTSTYSR+
Sbjct  350   TLSRTVSVFSSSAALFDKLKKEQSPSHDNVAGKEKTFNAKSMVKN-QSMLKRLTSTYSRA  408

Query  326   LSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              +VK    PG++E    G N +E  +G+SLK+K RQIS+LLSS++VQAIS  NTPE++E+
Sbjct  409   YTVKRNSLPGTDEGKEIG-NTEEEQDGISLKLKIRQISLLLSSLWVQAISPANTPENYES  467

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS+  +  +PPSRRRSLF LATSMII
Sbjct  468   IAHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIGGKGSLPPSRRRSLFMLATSMII  527

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAK  847
             FLSK Y+FIP+   AKA LTDKT+DPFLQLVD+C L+ V  N  +A   YGSKEDD+ A 
Sbjct  528   FLSKAYNFIPVVACAKAALTDKTVDPFLQLVDDCKLQAVTGNTEQAVKVYGSKEDDDDAL  587

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
             +SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++ 
Sbjct  588   KSLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSET  647

Query  1025  ---LRNHNQSDDKTNDEVV-DPTFTVDDLGSHSD----PNAHPD-STPNLLDVNEFLDSV  1177
                +      DDK+ DE V DPT  + + G  ++     N+H     P+LL V +FLDSV
Sbjct  648   SGQIYQFGSEDDKSLDEQVGDPTLPILEDGVPTENKNISNSHLTLQIPDLLTVTQFLDSV  707

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFSEETIW  1351
              +T+ QVGR S +  + MT+ D+A  CEA Q GK  +M+       + E  F+F  +   
Sbjct  708   SDTTLQVGRLSVS-TSDMTYKDMAGHCEALQAGKQEKMSHLMIAQASRENPFDFYGQDYI  766

Query  1352  QP---PSGNPFADNNTaaagqpvnaaapaS---------CATEYQRHPSFMQLPASSPYD  1495
             Q    PS +     +T    +  + +  ++         CATE Q HP+F  LPASSPYD
Sbjct  767   QANMKPSYSCVDMKSTPVHVKHGSDSNLSNPFINVTPTPCATESQCHPNFFALPASSPYD  826

Query  1496  NFLKAAGS  1519
             NFLKAAGS
Sbjct  827   NFLKAAGS  834



>ref|XP_009789840.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Nicotiana 
sylvestris]
Length=1028

 Score =   512 bits (1319),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 296/550 (54%), Positives = 370/550 (67%), Gaps = 47/550 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  482   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPTSVHPRSTKASGIQR  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQS------SGKD------GMDQNTQNMLNRLTSTYSRS  325
             TLSRTVSVFSSSAALFDKL K QS      +GK+       M +N Q+ML RLTS+YSR+
Sbjct  542   TLSRTVSVFSSSAALFDKLKKEQSPSHDNVAGKEKTFNAKSMVKN-QSMLKRLTSSYSRA  600

Query  326   LSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              +VK    PG++E    G N +E  +G+ LK+K RQIS+LLSS++VQAIS  NTPE++EA
Sbjct  601   YTVKRNSLPGTDEGKEIG-NTEEEQDGIFLKLKIRQISLLLSSLWVQAISPANTPENYEA  659

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS+  +  +PPSRRRSLF LATSMII
Sbjct  660   IAHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIGGKGSLPPSRRRSLFMLATSMII  719

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAK  847
             FLSK Y+FIP+   AKA LTDKT+DPFLQLVD+C L+        A   YGSKEDD+ A 
Sbjct  720   FLSKAYNFIPVVACAKAALTDKTVDPFLQLVDDCKLQAGTGNTEHAVKVYGSKEDDDDAL  779

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
             +SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++ 
Sbjct  780   KSLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSET  839

Query  1025  ---LRNHNQSDDKTNDEVVDPTFTVDDLGSHSD----PNAHPD-STPNLLDVNEFLDSVL  1180
                +      DDK+ DEV DPT  + + G  ++     N+H     P+LL V +FLDSV 
Sbjct  840   SGQIYQFGSEDDKSLDEVGDPTLPILEDGVPTENKNITNSHLSLQIPDLLTVTQFLDSVS  899

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFSEETIWQ  1354
             +T+ QVGR S +  + MT+ D+A  CEA Q GK  +M+       + E  F+F  +   Q
Sbjct  900   DTTLQVGRLSVST-SDMTYKDMAGHCEALQAGKQEKMSHLMIAQASRENPFDFYGQDYIQ  958

Query  1355  PPSGNPFADNNTaaagqpvnaaapaS---------------CATEYQRHPSFMQLPASSP  1489
                  P+   +T +           S               CATE +RHP+F  LPASSP
Sbjct  959   ANIKPPYNCVDTKSTPVEHTHVKHGSDSNLSNPFINVTPTPCATESKRHPNFFALPASSP  1018

Query  1490  YDNFLKAAGS  1519
             YDNFLKAAGS
Sbjct  1019  YDNFLKAAGS  1028



>ref|XP_009789839.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Nicotiana 
sylvestris]
Length=1029

 Score =   508 bits (1307),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 296/551 (54%), Positives = 370/551 (67%), Gaps = 48/551 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  482   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPTSVHPRSTKASGIQR  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQS------SGKD------GMDQNTQNMLNRLTSTYSRS  325
             TLSRTVSVFSSSAALFDKL K QS      +GK+       M +N Q+ML RLTS+YSR+
Sbjct  542   TLSRTVSVFSSSAALFDKLKKEQSPSHDNVAGKEKTFNAKSMVKN-QSMLKRLTSSYSRA  600

Query  326   LSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              +VK    PG++E    G N +E  +G+ LK+K RQIS+LLSS++VQAIS  NTPE++EA
Sbjct  601   YTVKRNSLPGTDEGKEIG-NTEEEQDGIFLKLKIRQISLLLSSLWVQAISPANTPENYEA  659

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS+  +  +PPSRRRSLF LATSMII
Sbjct  660   IAHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIGGKGSLPPSRRRSLFMLATSMII  719

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAK  847
             FLSK Y+FIP+   AKA LTDKT+DPFLQLVD+C L+        A   YGSKEDD+ A 
Sbjct  720   FLSKAYNFIPVVACAKAALTDKTVDPFLQLVDDCKLQAGTGNTEHAVKVYGSKEDDDDAL  779

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
             +SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++ 
Sbjct  780   KSLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSET  839

Query  1025  ---LRNHNQSDDKTNDEVV-DPTFTVDDLGSHSD----PNAHPD-STPNLLDVNEFLDSV  1177
                +      DDK+ DE V DPT  + + G  ++     N+H     P+LL V +FLDSV
Sbjct  840   SGQIYQFGSEDDKSLDEQVGDPTLPILEDGVPTENKNITNSHLSLQIPDLLTVTQFLDSV  899

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFSEETIW  1351
              +T+ QVGR S +  + MT+ D+A  CEA Q GK  +M+       + E  F+F  +   
Sbjct  900   SDTTLQVGRLSVST-SDMTYKDMAGHCEALQAGKQEKMSHLMIAQASRENPFDFYGQDYI  958

Query  1352  QPPSGNPFADNNTaaagqpvnaaapaS---------------CATEYQRHPSFMQLPASS  1486
             Q     P+   +T +           S               CATE +RHP+F  LPASS
Sbjct  959   QANIKPPYNCVDTKSTPVEHTHVKHGSDSNLSNPFINVTPTPCATESKRHPNFFALPASS  1018

Query  1487  PYDNFLKAAGS  1519
             PYDNFLKAAGS
Sbjct  1019  PYDNFLKAAGS  1029



>ref|XP_004229640.1| PREDICTED: protein EFR3 homolog B-like [Solanum lycopersicum]
Length=1018

 Score =   492 bits (1266),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 289/548 (53%), Positives = 357/548 (65%), Gaps = 52/548 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  481   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPKSVQSRSTKATGIQR  540

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN-----------TQNMLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL K Q+  +D M               Q+ML RLTS+YSR+ 
Sbjct  541   TLSRTVSVFSSSAALFDKLKKEQTPAQDNMAGKEKTFNAKSLVKNQSMLKRLTSSYSRAY  600

Query  329   SVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             +VK    PG++E   NG N +E  +G+ LK+K RQIS+LLSS++VQAIS  NTPE++EAI
Sbjct  601   TVKRNSLPGTDEGKENG-NTEEEQDGIFLKLKIRQISLLLSSLWVQAISTTNTPENYEAI  659

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             AHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS++ +  +P SRRRSLF LATSMIIF
Sbjct  660   AHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIAGKGSLPSSRRRSLFMLATSMIIF  719

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKR  850
             LSK YSFIP+   AKA LTDKT+DPFLQLVD+C L+        A   YGSKEDDE A +
Sbjct  720   LSKAYSFIPVVACAKAALTDKTVDPFLQLVDDCKLEAVTGKTEHAVKVYGSKEDDEDALK  779

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND--  1024
             SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++  
Sbjct  780   SLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSETS  839

Query  1025  --LRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDS-----TPNLLDVNEFLDSVLE  1183
               +      DD + DEV D T  + + G  ++     DS      P+L+ V +FLDSV +
Sbjct  840   GKIYGFGSVDDNSPDEVGDLTMPILEDGLTTENQNLSDSHLTLQIPDLITVTQFLDSVSD  899

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFSEETIWQP  1357
             T+ Q GR S +  + MTF D+A  CEA Q GK  +M+         E  F+F    +   
Sbjct  900   TTIQGGRLSVS-TSDMTFKDMAGHCEALQAGKQQKMSHLMIAQAPQENSFDFFLSNL--K  956

Query  1358  PSGNPFADNNTaaagqpvnaaapaS--------------CATEYQRHPSFMQLPASSPYD  1495
             P+ N   DN  +            S              CA E     +F  LPASSPYD
Sbjct  957   PANN--CDNIISPVEPSHVKHPSESNLSNPFITTIPPMPCAAE----SNFFALPASSPYD  1010

Query  1496  NFLKAAGS  1519
             NFLKAAGS
Sbjct  1011  NFLKAAGS  1018



>ref|XP_006345431.1| PREDICTED: uncharacterized protein LOC102584593 [Solanum tuberosum]
Length=1017

 Score =   487 bits (1253),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 289/553 (52%), Positives = 361/553 (65%), Gaps = 64/553 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQILLAMVSPD+ETRL AHRVFSVVLVPSSVCPR        +K   IQR
Sbjct  482   KNKAFPEALFHQILLAMVSPDHETRLVAHRVFSVVLVPSSVCPRPKSVHPRSTKATGIQR  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN-----------TQNMLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL K Q+  +D M               Q+ML RLTS+YSR+ 
Sbjct  542   TLSRTVSVFSSSAALFDKLKKEQTPAQDNMAGKEKTFNAKSLVKNQSMLKRLTSSYSRAY  601

Query  329   SVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             +VK    PG++E   NG N +E  +G+ LK+K RQIS+LLSS++VQAIS  NTPE++EAI
Sbjct  602   TVKRNSLPGTDEGKENG-NTEEEQDGIFLKLKIRQISLLLSSLWVQAISATNTPENYEAI  660

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             AHTYSL++LFS+TKKSSHE+LIR FQLAFSLR+IS++ +  +P SRRRSLF LATSMIIF
Sbjct  661   AHTYSLVVLFSQTKKSSHEALIRSFQLAFSLRNISIAGKGSLPSSRRRSLFMLATSMIIF  720

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK--VNPNPKARASYGSKEDDEAAKR  850
             LSK YSFIP+   AKA LT+KT+DPFLQLVD+C L+        A   YGSKEDD+ A +
Sbjct  721   LSKAYSFIPVVACAKAALTEKTVDPFLQLVDDCKLEAVTGKTEHAVKVYGSKEDDDDALK  780

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND--  1024
             SLS I++S  Q+TE FAS+IVESL+ S  +KT  IK+QLL+DFLPD+VCP+G Q +++  
Sbjct  781   SLSAIQLSSNQTTEYFASIIVESLRNSYKNKTAAIKDQLLKDFLPDDVCPLGAQLVSETS  840

Query  1025  --LRNHNQSDDKTNDEVV-DPTFTVDDLGSHSD----PNAHPD-STPNLLDVNEFLDSVL  1180
               +      DD ++DE V D T  + + G  ++     N+H     P+L+ V +FLDSV 
Sbjct  841   GKIYRFGSIDDNSSDEQVGDLTLPILEDGLTTENQNLSNSHLTLQIPDLITVTQFLDSVS  900

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNF-------  1333
             +T+ Q GR S +  + MTF D+A  CEA Q GK  +M+       + E  F+F       
Sbjct  901   DTTLQGGRLSVS-TSDMTFKDMAGHCEALQAGKQQKMSHLMIAQASQENSFDFFLSNMKP  959

Query  1334  ----------SEET-IWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
                        E T + +P   NPF                P  CA E     +F  LPA
Sbjct  960   ANNCDNVISPVEPTHVKRPSESNPFI-----------TTIPPMPCAAE----SNFFALPA  1004

Query  1481  SSPYDNFLKAAGS  1519
             SSPYDNFLKAAGS
Sbjct  1005  SSPYDNFLKAAGS  1017



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   452 bits (1162),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 279/581 (48%), Positives = 364/581 (63%), Gaps = 82/581 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+L+AMV  D+ETR+GAHR+FSVVLVPSSVCPR   A    +KR  I R
Sbjct  478   QNKTFPEALFHQLLVAMVCADHETRVGAHRIFSVVLVPSSVCPRPCAATPHTAKRNDIGR  537

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS-----------------------------------  256
             TLSRTVSVFSSSAALF+KL +  +S                                   
Sbjct  538   TLSRTVSVFSSSAALFEKLNERSTSQENICQEMKDNAVIEEESKVTNESMLNRLKSKFSS  597

Query  257   -----------GKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNGENPQ--EHHEG-  394
                        G +    N+Q+++NRL STYSR+ S+K     T  + E P+   H E  
Sbjct  598   RRHQSTTSDYVGNEDSAINSQSVMNRLKSTYSRAYSMKRNPSNTTAD-EKPRSISHKEST  656

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             +SL++ SRQI++LLSSI+VQ+IS LN P+++EAIAHTYSL++L++RTK +S E+LIR FQ
Sbjct  657   MSLRLSSRQITLLLSSIWVQSISPLNMPDNYEAIAHTYSLVLLYARTKNTSDETLIRSFQ  716

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             LAFSLRSISL     + PSRRRSLF LATSMIIF +K Y+ + LA  AK  LT++T+DPF
Sbjct  717   LAFSLRSISLG--GGLQPSRRRSLFTLATSMIIFSAKAYNIVALAPCAKVALTNETVDPF  774

Query  755   LQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L+LVD+C L+ VN  P + R  YGSKED+E A RSLS IEIS+ QS ESFA+MIV++L  
Sbjct  775   LRLVDDCKLQAVNSGPDQVRQVYGSKEDNEDAVRSLSAIEISESQSKESFATMIVQTLGN  834

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDEVVDPTFTVDD  1096
             S  ++++ I++QLL DFLPD+ CP+GTQ   +    +      D+ T D V  P FT++D
Sbjct  835   S-PNESSTIRQQLLNDFLPDDACPLGTQLCMETPIQIYQFGIEDNGTRDMVEPPLFTIED  893

Query  1097  --LGSHSDPNAHPDS-----TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
               L + ++    PD      + +L+ V+E LDSVLET++QVGR S +    M ++++A  
Sbjct  894   DVLPNATESQTDPDKKLSMESLSLISVDELLDSVLETTHQVGRLSVSTATDMPYLEMAGL  953

Query  1256  CEAFQEGKGNRMN------FREDG--NDEP-DFNFSEET-----IWQPPSGNPFADNNTa  1393
             CEA Q GK  R +       R++      P D N  +ET     +  P SGNPF D+N  
Sbjct  954   CEALQMGKQQRFSAFVAAQLRQESLMRFSPHDCNQQKETPSVVPLGAPTSGNPFLDSNDI  1013

Query  1394  aagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  Q V        ATEYQ +P F QLPASSPYDNFLKAAG
Sbjct  1014  SLNQSVGNGQTL-WATEYQHYPRF-QLPASSPYDNFLKAAG  1052



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   448 bits (1153),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 279/581 (48%), Positives = 362/581 (62%), Gaps = 83/581 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+L+AMV  D+ETR+GAHR+FSVVLVPSSVCPR   A    +KR  I R
Sbjct  478   QNKTFPEALFHQLLVAMVCADHETRVGAHRIFSVVLVPSSVCPRPCAATPHTAKRNDIGR  537

Query  182   TLSRTVSVFSSSAALFDKLG----------------------------------------  241
             TLSRTVSVFSSSAALF+KL                                         
Sbjct  538   TLSRTVSVFSSSAALFEKLNERSASQENICEEMKDKAVIEEEAKVTNESMLNRLKSKFSS  597

Query  242   -KNQSSGKDGMDQ-----NTQNMLNRLTSTYSRSLSVKPGSEETPNNGENPQ--EHHEG-  394
              ++QS+  D +       N+ +++NRL STYSR+ S+K     T  + E P+   H E  
Sbjct  598   RRHQSATSDSVGNEDSAINSHSVMNRLKSTYSRAYSMKRNPSNTTVD-EKPRSISHKEST  656

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             +SL++ SRQI++LLSSI+VQ+IS LNTP+++EAIAHTYSL++L++RTK +S E+LIR FQ
Sbjct  657   MSLRLSSRQITLLLSSIWVQSISPLNTPDNYEAIAHTYSLVLLYARTKNTSDETLIRSFQ  716

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             LAFSLRSISL     + PSRRRSLF LATSMIIF +K Y+ + LA  AK  LT++T+DPF
Sbjct  717   LAFSLRSISLG--GGLQPSRRRSLFTLATSMIIFSAKAYNIVALAPCAKVALTNETIDPF  774

Query  755   LQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L+LVD+  L+ VN  P + R  YGSKED+E A RSLS IEIS+ QS ESFA+MIV++L  
Sbjct  775   LRLVDDSKLQAVNSGPDQVREVYGSKEDNEDALRSLSAIEISESQSKESFATMIVQTLGN  834

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDEVVDPTFTVDD  1096
             S    T  I++QLL DFLPD+ CP+GTQ   +    +      D+ T D V  P FT++D
Sbjct  835   SPNSST--IRQQLLNDFLPDDACPLGTQLCMETPIQIYQFGIEDNGTRDMVEPPLFTIED  892

Query  1097  --LGSHSDPNAHPDS-----TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
               L + ++    PD      + +L+ V+E LDSVLET++QVGR S +    M ++++A  
Sbjct  893   DVLPNATESQTDPDKKVSMESLSLISVDELLDSVLETTHQVGRLSVSTATDMPYLEMAGL  952

Query  1256  CEAFQEGKGNRMN------FREDG---NDEPDFNFSEET-----IWQPPSGNPFADNNTa  1393
             CEA Q GK  R++       R++        D N  +ET     +  P SGNPF D+N  
Sbjct  953   CEALQMGKQQRLSTFVAAQLRQESLMRFSPHDCNQQKETPSVVLLGAPTSGNPFLDSNAI  1012

Query  1394  aagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  Q V        ATEYQ +P F QLPASSPYDNFLKAAG
Sbjct  1013  SLNQSVGNGQTL-WATEYQHYPRF-QLPASSPYDNFLKAAG  1051



>ref|XP_008350700.1| PREDICTED: uncharacterized protein LOC103414060 [Malus domestica]
Length=969

 Score =   442 bits (1136),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 266/581 (46%), Positives = 360/581 (62%), Gaps = 80/581 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+L+AMV  D+ETR+GAHR+FSVVLVPSSVCPR   A    +++ +I R
Sbjct  392   QNKTFPEALFHQLLVAMVCVDHETRVGAHRIFSVVLVPSSVCPRPCAATPITTEKNNIGR  451

Query  182   TLSRTVSVFSSSAALFDKLGKN----QSSGKDGMDQ------------------------  277
             TLSRTVSVFSSSAALF+KL K     Q+ G++  D+                        
Sbjct  452   TLSRTVSVFSSSAALFEKLNKGSHSQQNIGQELKDKVVIQEEAKVPNESMLNRLKSKFSS  511

Query  278   ------------------NTQNMLNRLTSTYSRSLSVKPGSEETPNNGENP---QEHHEG  394
                               +  +++NRL STYSR+ S++     TP+  E      +    
Sbjct  512   RRHPSATSDPVGNEDASVSNHSVMNRLKSTYSRAYSIRRNPSNTPSXDEKTTSISDKEST  571

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             +SL++ +RQI++LLSSI+ Q+IS LNTPE++EAIA+TYSL++L++RTK +S E+LIR FQ
Sbjct  572   MSLRLSTRQITLLLSSIWAQSISPLNTPENYEAIANTYSLVLLYARTKNTSDETLIRSFQ  631

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             LAFSLRSISL     + PSRRRSLF LATSMIIF +K Y+ + LA  AKA LT++T+DPF
Sbjct  632   LAFSLRSISLG--GGLQPSRRRSLFTLATSMIIFSAKAYNVVALAPCAKAALTNETVDPF  689

Query  755   LQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L+LVD+  L+ V   P + R  YGSKEDDE A RSLS IE S+ QS ESFA+MIV++L+ 
Sbjct  690   LRLVDDHKLQAVISGPDQVRKVYGSKEDDENALRSLSAIEKSENQSKESFATMIVQTLRN  749

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGT----QRINDLRNHNQSDDKTNDEVVDPTFTVDD  1096
             S  D +++IK+QLL DF+PD+ CP+G     +   ++      DD   D+   P FT++D
Sbjct  750   SPED-SSIIKQQLLNDFMPDDACPLGAPLSMETPIEIDQVGVQDDGEPDKAEPPLFTIED  808

Query  1097  --LGSHSDPNAHPDS-----TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
               L + S+    PD+     + +L+ ++E L+SV ET++QVGR S +    M +M++A Q
Sbjct  809   DVLANASENQTEPDTKVAVESLSLISIDELLNSVSETTHQVGRLSVSVATNMPYMEMAGQ  868

Query  1256  CEAFQEGKGNRMN--------------FREDGNDEPDFNFSEETIWQPPSGNPFADNNTa  1393
             CEA Q GK  +++              F  D N +     S   +  P SGNPF ++   
Sbjct  869   CEALQMGKQQKLSTFIVAQQRQESLIRFSNDCNQQEKETPSLLPLGAPTSGNPFLESXAV  928

Query  1394  aagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  Q V   +   CATEYQ +P F QLPASSPYDNFLKAAG
Sbjct  929   SLNQSVGNGSSMLCATEYQYYPHF-QLPASSPYDNFLKAAG  968



>ref|XP_004506319.1| PREDICTED: uncharacterized protein LOC101489771 [Cicer arietinum]
Length=1032

 Score =   443 bits (1139),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 268/579 (46%), Positives = 358/579 (62%), Gaps = 79/579 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCP+ + +   L+K   IQR
Sbjct  458   QNKAFPEALFHQLLLAMVHADHETRVGAHRIFSVVLVPSSVCPQPSSSNPPLTKGTDIQR  517

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMD----QNTQNMLNRLTSTYSRSLSV-KPG-  343
              LSR VSVFSSSAALF+KL + + S ++  +     N  ++LNR+ STYSR+ S  KPG 
Sbjct  518   MLSRNVSVFSSSAALFEKLERKRHSSQEDTNTDGKSNDSSILNRVKSTYSRTSSTRKPGM  577

Query  344   -----------------------------------SEETPNNGENPQEHHEGLSLKMKSR  418
                                                 EE   +  N Q+    L +++ S 
Sbjct  578   TISESSKVNNPSMMNRLKSSYSRVTSVRKPQIPVTVEEDATDSSNTQQ---VLPIRLSSH  634

Query  419   QISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSI  598
             QI++LLSSI+VQ+I  LNTPE+FEAIAHTYSL++L +R+K SSHE+LI+ FQLAFSLRSI
Sbjct  635   QITLLLSSIWVQSIYPLNTPENFEAIAHTYSLVLLVARSKNSSHEALIQSFQLAFSLRSI  694

Query  599   SLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECH  778
             SL+E+ K+P SRRRSLF LATSMIIF SK Y+ + L   AK  LTDKT+DPFLQLV++  
Sbjct  695   SLNEKVKLPASRRRSLFTLATSMIIFTSKAYNILSLISIAKMALTDKTVDPFLQLVNDSK  754

Query  779   LK--VNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNL  952
             ++  V+   +    YGSKEDDE A ++LS I +++ QS ESFA+MIV+SL KS +++ ++
Sbjct  755   IQAVVDTVRQPNKVYGSKEDDEDAIKALSSIRLTESQSNESFATMIVQSLGKS-SNEPSM  813

Query  953   IKEQLLQDFLPDEVCPMGTQ-RINDLRNHNQS---DDKTNDEVVDPTFTVDD--------  1096
             +KE+LL +F PD+ CP+G Q  +N   N  QS   DDK  D V  P FT+DD        
Sbjct  814   LKERLLNNFAPDDACPLGVQLSLNTTGNIYQSGLKDDKHPDMVDIPLFTIDDDIPACGLE  873

Query  1097  LGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEG  1276
               +++D    P    +LL V++ L SVLET++ VGR S + P+ M + ++A  CEA   G
Sbjct  874   TQANADAQQQPSENQSLLSVDDILGSVLETTHHVGRISVSTPSNMPYKEMALHCEALLAG  933

Query  1277  KGNR------------MNFR------EDGNDEPDFNFSEETIWQPPSGNPFADNNTaaag  1402
             K  +            ++FR        G +EP  +  ++++  P SGNPF D+N  +  
Sbjct  934   KQQKISTFMGAHPFHGISFRIPVPHYNQGKEEPTNSNVQQSL-PPLSGNPFLDSNVGSTP  992

Query  1403  qpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                        CAT YQ   +F QLPAS PYDNFLKAAG
Sbjct  993   PSTLPETGPRLCATAYQHQAAFFQLPASRPYDNFLKAAG  1031



>ref|XP_010241227.1| PREDICTED: uncharacterized protein LOC104585894 isoform X2 [Nelumbo 
nucifera]
Length=812

 Score =   434 bits (1117),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 258/541 (48%), Positives = 344/541 (64%), Gaps = 41/541 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQ+LLAMV PD ETR+ AHR+FSVVLVPSSVCP+Q  A     K   ++R
Sbjct  276   KNKAFPEALFHQLLLAMVHPDQETRVAAHRIFSVVLVPSSVCPQQCSAVPHTLKANDLRR  335

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSV  334
             TLSRTVSVFSSSAALF+KL K +SS ++ + +         N+ ++ +RL S+YSR+ SV
Sbjct  336   TLSRTVSVFSSSAALFEKLKKEKSSHQENIHKEIDDGKLKTNSSSVFSRLRSSYSRAYSV  395

Query  335   KPGS-----EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             K        EE P     P++  + + L++ +RQI++LLSS++ QA+S  N PE+F AI+
Sbjct  396   KDSPFPLTPEEQP--MIKPKKEVDPIYLRLSTRQITLLLSSLWAQALSPQNMPENFVAIS  453

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             HTY L++LFSR K SS+ESLIR FQLAFSL+ ISL E+ ++ PSRRRSLF LATSMIIF 
Sbjct  454   HTYCLVLLFSRAKNSSNESLIRSFQLAFSLQRISLKEERQLKPSRRRSLFTLATSMIIFS  513

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRS  853
             +KTY+ +PL   AKA LTDKT+DPFL+L+++C L+            YGS +DD AA ++
Sbjct  514   AKTYNILPLVPFAKAPLTDKTVDPFLKLIEDCKLQAVDTASTHPPKLYGSIDDDNAALKA  573

Query  854   LSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND---  1024
             LS IE    QS E+ AS IV SL K    + + I+ QLL +F PDE+CP+G Q   +   
Sbjct  574   LSTIE---GQSKEALASTIVNSLGKFSDKEASTIRRQLLNEFFPDELCPLGAQLFMETPQ  630

Query  1025  LRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGR  1204
             + +  +S D  + E  D   + +   +  DPN     T NLL VN+ LDSV+ETS+QVGR
Sbjct  631   IASSLESKDDKSLEANDDDISTEANENQKDPNLQLVETSNLLSVNQLLDSVVETSHQVGR  690

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGN---------DEPDFNFSEETIWQP  1357
              SA+   G+ + ++A  CEA   GK  +M+   +           D  D N  +     P
Sbjct  691   FSASTTPGVPYKEMARHCEALLMGKQEKMSTFINAQQKQENLISFDVDDHNVDKMASSNP  750

Query  1358  P-------SGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
             P       +GNPF D+ ++A G   +     + CATEYQ HP+F  LPASSPYDNFLKAA
Sbjct  751   PVDMGIQMNGNPFVDHCSSANGNKPSVGMGPTLCATEYQNHPNFFTLPASSPYDNFLKAA  810

Query  1514  G  1516
             G
Sbjct  811   G  811



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   436 bits (1120),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 270/561 (48%), Positives = 349/561 (62%), Gaps = 67/561 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALS-KRKSIQ  178
             QNKAFPEALFHQ+LLAMV  D+ETR+GAHR+FS+VLVPSSVCPR A A   +S K  ++Q
Sbjct  475   QNKAFPEALFHQLLLAMVYEDHETRVGAHRIFSIVLVPSSVCPRPAVAASFISSKATNMQ  534

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ-------------NTQNMLNRLTSTYS  319
             R LSRTVSVFSSSAALF+KL K + S ++ + +             N  +MLNRL S+YS
Sbjct  535   RMLSRTVSVFSSSAALFEKLKKEEHSPQENVLEDKDKPINFEDSVMNNPSMLNRLKSSYS  594

Query  320   RSLSVKPGSEETPNNGENPQEHHEG----LSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             R+ +VK     +P   E       G    +SL++ S QI++LLSSI+ Q++S LNTP ++
Sbjct  595   RAYTVK--RHTSPITTEEITRSSLGKKQVMSLRLNSHQITLLLSSIWAQSLSPLNTPANY  652

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             EAIAHTYSL++LF+RTK SS+E+LIR FQLAFSLRS ++     + PSRRRSLF L+TSM
Sbjct  653   EAIAHTYSLVLLFARTKNSSNETLIRSFQLAFSLRSFAIG-GGPLQPSRRRSLFTLSTSM  711

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNP--KARASYGSKEDDEA  841
             I+F SK ++  PL   A+A +TDKT DPFLQLVDEC L+   N     R SYGSKED+E 
Sbjct  712   ILFSSKAFNIPPLVPCARATITDKTADPFLQLVDECKLQAVDNQLDHPRKSYGSKEDNED  771

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKS---ITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             A +SLS IEIS+ QS ESFA+MI + LKKS    T + + I+E+LL+ F+PD+VCP+G  
Sbjct  772   ALKSLSAIEISEAQSKESFATMISKFLKKSSDIFTQQKSAIREELLKSFVPDDVCPLGAD  831

Query  1013  RINDLRNHNQ---SDDKTNDEVVDPTFTVD----------DLGSHSDPNAHPDSTPNLLD  1153
                ++        S++K +D+V+  +F             D G   D    P  +  LL 
Sbjct  832   LFMEMAEQTSEAVSEEKFSDKVIIFSFYDGIVPNTSEGQVDRGVDLDLELEPSGSSGLLS  891

Query  1154  VNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF------REDG--  1309
             V E L +V ET+NQVGR S + P  + ++++A  CEA   GK  +M+       R++G  
Sbjct  892   VGELLSAVSETTNQVGRFSVSTPPDLPYIEMAGHCEALSAGKHKKMSALLSSQQRQEGVI  951

Query  1310  -------NDEP----DFNFSEETIWQPPSGNPFADNNTa-aagqpvnaaapaSCATEYQR  1453
                    N E     DF F +        GNPF D N    A  P     P  CATEYQ 
Sbjct  952   RIPAYENNQEKQSSSDFPFQQR-------GNPFLDQNFGPNAYLPSATTGPLLCATEYQH  1004

Query  1454  HPSFMQLPASSPYDNFLKAAG  1516
             H  F QLPASSPYDNFLKAAG
Sbjct  1005  H-QFFQLPASSPYDNFLKAAG  1024



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   434 bits (1116),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 258/541 (48%), Positives = 344/541 (64%), Gaps = 41/541 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQ+LLAMV PD ETR+ AHR+FSVVLVPSSVCP+Q  A     K   ++R
Sbjct  469   KNKAFPEALFHQLLLAMVHPDQETRVAAHRIFSVVLVPSSVCPQQCSAVPHTLKANDLRR  528

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSV  334
             TLSRTVSVFSSSAALF+KL K +SS ++ + +         N+ ++ +RL S+YSR+ SV
Sbjct  529   TLSRTVSVFSSSAALFEKLKKEKSSHQENIHKEIDDGKLKTNSSSVFSRLRSSYSRAYSV  588

Query  335   KPGS-----EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             K        EE P     P++  + + L++ +RQI++LLSS++ QA+S  N PE+F AI+
Sbjct  589   KDSPFPLTPEEQP--MIKPKKEVDPIYLRLSTRQITLLLSSLWAQALSPQNMPENFVAIS  646

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             HTY L++LFSR K SS+ESLIR FQLAFSL+ ISL E+ ++ PSRRRSLF LATSMIIF 
Sbjct  647   HTYCLVLLFSRAKNSSNESLIRSFQLAFSLQRISLKEERQLKPSRRRSLFTLATSMIIFS  706

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKAR--ASYGSKEDDEAAKRS  853
             +KTY+ +PL   AKA LTDKT+DPFL+L+++C L+            YGS +DD AA ++
Sbjct  707   AKTYNILPLVPFAKAPLTDKTVDPFLKLIEDCKLQAVDTASTHPPKLYGSIDDDNAALKA  766

Query  854   LSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND---  1024
             LS IE    QS E+ AS IV SL K    + + I+ QLL +F PDE+CP+G Q   +   
Sbjct  767   LSTIE---GQSKEALASTIVNSLGKFSDKEASTIRRQLLNEFFPDELCPLGAQLFMETPQ  823

Query  1025  LRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGR  1204
             + +  +S D  + E  D   + +   +  DPN     T NLL VN+ LDSV+ETS+QVGR
Sbjct  824   IASSLESKDDKSLEANDDDISTEANENQKDPNLQLVETSNLLSVNQLLDSVVETSHQVGR  883

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGN---------DEPDFNFSEETIWQP  1357
              SA+   G+ + ++A  CEA   GK  +M+   +           D  D N  +     P
Sbjct  884   FSASTTPGVPYKEMARHCEALLMGKQEKMSTFINAQQKQENLISFDVDDHNVDKMASSNP  943

Query  1358  P-------SGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
             P       +GNPF D+ ++A G   +     + CATEYQ HP+F  LPASSPYDNFLKAA
Sbjct  944   PVDMGIQMNGNPFVDHCSSANGNKPSVGMGPTLCATEYQNHPNFFTLPASSPYDNFLKAA  1003

Query  1514  G  1516
             G
Sbjct  1004  G  1004



>ref|XP_002277709.2| PREDICTED: uncharacterized protein LOC100265428 [Vitis vinifera]
Length=1012

 Score =   434 bits (1115),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 266/538 (49%), Positives = 345/538 (64%), Gaps = 39/538 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQ+L+AMV  D+ETR+GAHR+FSVVL+PSSV PR         K     R
Sbjct  480   RNKAFPEALFHQLLVAMVCADHETRVGAHRIFSVVLIPSSVSPRPHSDNPNRKKATDFHR  539

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGK------------DGMDQNTQN--MLNRLTSTYS  319
             TLSR VSVFSSSAALFDKLG+ QSS +            D  D NT N  ML+RL STYS
Sbjct  540   TLSRNVSVFSSSAALFDKLGREQSSSQENTSQDKKVKFVDTEDSNTNNNSMLSRLKSTYS  599

Query  320   RSLSVKPGSE--ETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             R+ SVK  S    T     N  +  E +SL++ + QI +LLSSI+ Q+IS LN PE++EA
Sbjct  600   RAYSVKKNSSPITTDETMSNSDKEPEAISLRLSTHQIILLLSSIWAQSISPLNMPENYEA  659

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             I+HT+SL++LF+RTK SS E+LIR FQLAFSLR ISL +   +PPSRRRSLF LA SMII
Sbjct  660   ISHTFSLVLLFARTKNSSLEALIRSFQLAFSLRCISLGKGGTLPPSRRRSLFTLANSMII  719

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECH-LKVNP---NPKARASYGSKEDDEA  841
             F SK Y+ +PL   AKA LTDKT+DPFL+L+D+   L V P   NPK    YGSKEDD+ 
Sbjct  720   FSSKAYNILPLVPCAKAALTDKTVDPFLRLIDDRKLLAVKPGVENPK--NVYGSKEDDDG  777

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             A +SLS IEI++ QS ESFASM+V+ L KS   +++ I+EQL+ DFLP +VCPMG Q   
Sbjct  778   ALKSLSAIEITENQSKESFASMVVKMLGKS-EPESSAIREQLVHDFLPVDVCPMGAQFFT  836

Query  1022  D----LRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAH-PDSTPNLLDVNEFL  1168
             +    +      D K+ DE + P  ++DD        S + PN+       +LL  ++ L
Sbjct  837   EAPGQIYQSGTEDKKSPDE-LPPLLSMDDDAIPEAFESQTGPNSQLALVNHSLLSADQLL  895

Query  1169  DSVLETSNQVGRQS-AAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET  1345
             ++V+ETS QVGR S ++PP  M++ ++AS CE   + K  +M+         + + +  +
Sbjct  896   ETVVETS-QVGRFSVSSPPDDMSYKEMASHCEELLKEKQQKMSTFMIAQQSQEISNTFPS  954

Query  1346  IWQPPSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              +  P GNPF D +T+   +   N A    CA EY  HP F +LPASSPYDNFLK AG
Sbjct  955   NYDRP-GNPFLDEDTSDISEQPSNGAGLVLCAAEYHNHPYFFRLPASSPYDNFLKVAG  1011



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   432 bits (1112),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 270/573 (47%), Positives = 356/573 (62%), Gaps = 71/573 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV  D+ETR+GAHR+FS+VLVPSSVCP+ + +   L+K   IQR
Sbjct  458   QNKAFPEALFHQLLLAMVHADHETRVGAHRIFSLVLVPSSVCPQPSSSNPPLAKATDIQR  517

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM----DQNTQNMLNRLTSTYSRSLSV-KPG-  343
              LSR VSVFSSSAALFDKL K Q S  + +      N  ++LNRL S+YSR+ S+ KP  
Sbjct  518   MLSRNVSVFSSSAALFDKLEKKQLSIDEDIPLDGKSNDSSVLNRLKSSYSRTASIRKPAL  577

Query  344   --SEETPNNG---------------------------ENPQEHHEGLSLKMKSRQISMLL  436
               +E T  N                            EN     + L +++ S QI++LL
Sbjct  578   TSTESTKVNNPSMMNRLKSSYSRATSVKRPQVTIIVEENATTQKQVLPIRLSSHQITLLL  637

Query  437   SSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQA  616
             SSI+VQ+I  LNTPE+FEAIAHTYSL++L +R+K SSHE+LI+ FQLAFSLRSISL+E  
Sbjct  638   SSIWVQSIYPLNTPENFEAIAHTYSLVLLVARSKNSSHEALIQSFQLAFSLRSISLNENV  697

Query  617   KMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPN  796
             K+  SRRRSLF LATSMI+F SK Y+ + L   AK  LTDKT+DPFLQLV++  L+   +
Sbjct  698   KLQASRRRSLFTLATSMIVFTSKAYNILSLISIAKMALTDKTVDPFLQLVNDSKLQSVDD  757

Query  797   PKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLL  970
                + S  YGSKEDDE A +SLS I+I++ QS ESFA+MIV+SL K   ++++++KE+LL
Sbjct  758   TVRQPSKAYGSKEDDEDALKSLSSIKITESQSNESFATMIVQSLGKP-ANESSVLKERLL  816

Query  971   QDFLPDEVCPMGTQRINDLRNHNQS--DDKTNDEVVDPTFTVDD------LGSH--SDPN  1120
              +F PD+ CP+G Q   D   +     DDK +D V  P FT+DD      L S   +D  
Sbjct  817   NNFSPDDACPLGVQLSLDTTGYQSGLKDDKHSDMVDVPLFTIDDDIPASGLESQTSTDAQ  876

Query  1121  AHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM---  1291
               P    +L+ V++ L SV+ET++ VGR S + P+ M + ++A  CE    GK  ++   
Sbjct  877   QQPLENLSLITVDDILGSVVETTHHVGRISVSTPSNMPYKEMALHCENLLAGKQQKISTF  936

Query  1292  ---------NFR---EDGNDEPDFNFSEETIWQPP-----SGNPFADNNTaa-agqpvna  1417
                      +FR    D N E D + +     QP      SGNPF D+N  A +   +  
Sbjct  937   MGAQSLLANSFRIPLPDYNQEKDESTNSNV--QPSLPLLQSGNPFLDSNLGAPSPTTLPE  994

Query  1418  aapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             + P  CAT YQ+  +F QLPAS PYDNFLKAAG
Sbjct  995   SGPMLCATAYQQQAAFFQLPASRPYDNFLKAAG  1027



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   431 bits (1109),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 264/583 (45%), Positives = 354/583 (61%), Gaps = 82/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCP+ + +G  ++K   IQR
Sbjct  458   QNKAFPEALFHQLLLAMVHADHETRVGAHRIFSVVLVPSSVCPQPSSSGTPMTKAAGIQR  517

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS-----GKDGMDQNTQNMLNRLTSTYSRSLSVKPGS  346
              LSR VSVFSSS+ALF+KL + Q+S       DG + N  ++LNRL STYSR+ S +  +
Sbjct  518   MLSRNVSVFSSSSALFEKLERKQNSLSEDSHTDG-NVNDNSILNRLKSTYSRTTSTRKSA  576

Query  347   ----EETPN----------------------NGENPQ-------------EHHEGLSLKM  409
                 E T N                      + + PQ                + L +++
Sbjct  577   MISAESTDNKNSKVHNSSMMNRLKSSYSRATSAKKPQIPTTVEENTTNTSNKQQVLPIRL  636

Query  410   KSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSL  589
              S QI++LLSSI+ Q+I  LNT E+FEAIAHTYSL++L +R+K SSHE+L + FQLAFSL
Sbjct  637   SSHQINLLLSSIWAQSIYPLNTSENFEAIAHTYSLVLLVARSKNSSHEALTQSFQLAFSL  696

Query  590   RSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVD  769
             RSISL+E  K+ PSRRRSLF LATSMIIF SK Y+ + L   AK  LTD+T+DPFLQLV+
Sbjct  697   RSISLNENVKLQPSRRRSLFTLATSMIIFASKAYNILSLISIAKTTLTDRTVDPFLQLVN  756

Query  770   ECHLK--VNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDK  943
             +  L+  ++ + +    YGSKEDDE A ++LS I +++ QS ESFA+MIV+SL KS +++
Sbjct  757   DSKLQAVIDTDRQPSKVYGSKEDDEDALKALSAIRLTENQSKESFATMIVQSLGKS-SNE  815

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDD----L  1099
             +++++EQLL DF PD+ CP+G Q       ++      +DK  D V    FT+DD     
Sbjct  816   SSILREQLLNDFSPDDACPLGAQLSAETTGNMYQSGLKEDKLPDMVDISLFTIDDDIPPC  875

Query  1100  G----SHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAF  1267
             G    ++SDP   P    +LL V++ L SV ET++QVGR S + P  M + ++A  CEA 
Sbjct  876   GLESQANSDPQQQPSQNLSLLSVDDILGSVSETTHQVGRISISTPFDMPYKEMALHCEAL  935

Query  1268  QEGKGNRM-------------NFR------EDGNDEPDFNFSEETIWQPPSGNPFADNNT  1390
               GK  +M             +FR          DE   +  ++T+  P SGNPF D+N 
Sbjct  936   LMGKQQKMSTFMGTHPMQGYFSFRIPAPEYNQQKDESSNSSVQQTL--PSSGNPFLDSNF  993

Query  1391  aaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              +             CAT YQ   +F QLPAS PYDNFLKAAG
Sbjct  994   DSNSYHTLPDTSPRLCATAYQHQAAFFQLPASRPYDNFLKAAG  1036



>ref|XP_007131432.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
 gb|ESW03426.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
Length=1037

 Score =   429 bits (1103),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 266/580 (46%), Positives = 348/580 (60%), Gaps = 77/580 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK+FPEALFHQ+LLAMV  D+ETR+GAHRVFSVVLVPSSVCP+ + +    +K   IQR
Sbjct  459   QNKSFPEALFHQLLLAMVHADHETRVGAHRVFSVVLVPSSVCPQPSSSEFPTTKSSDIQR  518

Query  182   TLSRTVSVFSSSAALFDKLGKNQS-----SGKDGMDQNTQNMLNRLTSTYSRSLSVKPGS  346
              LSR VSVFSSSAALF+KL + Q+     S  D    N  ++LNRL STYSR+ S +  S
Sbjct  519   MLSRNVSVFSSSAALFEKLERKQNLLSEDSNTDA-KVNDNSILNRLKSTYSRTASSRKSS  577

Query  347   EETPNNGENPQEHHEG---------------------------------------LSLKM  409
               +    +N                                              L +++
Sbjct  578   LASVEYMDNRNSKGSSNSSVMNRLKSSYSRATSMRKSQVNTTVEENTTNTSTKHVLPIRL  637

Query  410   KSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSL  589
              S QI++LLSSI+ Q++   NTPE+FEAIAHTYSLL+L +R+K SSHE+L + FQLAFSL
Sbjct  638   SSHQITLLLSSIWAQSVYSQNTPENFEAIAHTYSLLLLVARSKNSSHEALTQSFQLAFSL  697

Query  590   RSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVD  769
             R+ISL++  K+ PSRRRSLF LAT+MI+F SK Y+ + L   AK+ LTDKTMDPFLQLV 
Sbjct  698   RNISLNDNVKLQPSRRRSLFTLATAMIVFTSKAYNILSLISIAKSTLTDKTMDPFLQLVS  757

Query  770   ECHLKVNPNP--KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDK  943
             +C L+   +   K   +YGSKEDDE A +SLS I++++ QS ESF++MIV+SL  S  ++
Sbjct  758   DCKLQAVADAVRKPSRAYGSKEDDEEALKSLSAIKLTESQSKESFSTMIVQSLGISF-NE  816

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDD-----  1096
             ++++KE+LL DF PD+ CP+G Q       D+      DDK  D V    FT+DD     
Sbjct  817   SSILKERLLGDFTPDDACPLGCQLSSETTGDMYQSGLKDDKLPDMVDISLFTIDDDISHS  876

Query  1097  -LGSHSDPNAHPDSTPN--LLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAF  1267
              L SH++P+    S+ N  LL V++ L SV ET++QVGR S + P  M + ++A  CEA 
Sbjct  877   GLESHANPDPQEQSSQNLSLLSVDDILGSVSETTHQVGRISISTPFDMPYKEMAHHCEAL  936

Query  1268  QEGKGNRM------------NFR--EDGNDEPDFNFSEETIWQ--PPSGNPFADNNTaaa  1399
               GK  +M            +FR   +   E D   S   I Q  P SGNPF D+N  + 
Sbjct  937   LVGKQQKMSTFLSTHSIQGYSFRIPTEYRQEKDGVSSNLHILQALPSSGNPFLDSNMDST  996

Query  1400  gqpvn-aaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                    +AP  CAT YQ   +F QLPAS PYDNFLKAAG
Sbjct  997   SHNALPDSAPRPCATAYQHQAAFFQLPASRPYDNFLKAAG  1036



>ref|XP_010653792.1| PREDICTED: uncharacterized protein LOC100255472 isoform X3 [Vitis 
vinifera]
Length=882

 Score =   419 bits (1077),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 251/539 (47%), Positives = 333/539 (62%), Gaps = 38/539 (7%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVP SVCPR  P    L K   + R 
Sbjct  346   NKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPFSVCPRPCPITPELKKASDLPRM  405

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSVK  337
             LSRTVSVFSSSAALF+KL K +S  K+ + Q         N   +LNR+ S+ SR+ S+K
Sbjct  406   LSRTVSVFSSSAALFEKLRKEKSFSKENICQENKEDELKNNNAGILNRMKSSLSRAYSLK  465

Query  338   PGSEET---PNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +       N   N     E +SLK+ SRQI++LLSSI+ Q+IS  N PE++EAIAHTY
Sbjct  466   SSAMSLTTDANFTSNSNNELEAVSLKLSSRQIALLLSSIWAQSISPANMPENYEAIAHTY  525

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K S HE L+R FQLAFSLRSISL +   +PP+RRRSLF LA SMI+F SK 
Sbjct  526   SLVLLFSRAKNSIHEVLVRSFQLAFSLRSISLVDGGPLPPARRRSLFTLAISMIVFSSKA  585

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPK-ARASYGSKEDDEAAKRSLSG  862
             Y  +PL   AKA L D+ +DPFL LV +  L+ VN     A   YGSKEDDE A ++LS 
Sbjct  586   YDILPLVPCAKAALLDRMVDPFLHLVQDNKLQAVNSGSDCASKVYGSKEDDECALKALSQ  645

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ  1042
             I+I+++Q+ ESFA++IV+SL+     ++++++EQL+ +FLPD+V   GTQ + D    + 
Sbjct  646   IKIAEEQTRESFATIIVKSLENLSESESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF  705

Query  1043  SDDKTNDEVVDPTFTVDD--LGSHSDPNAH----PDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +++ +E    + T DD  L  +     H        PNLL +N+ L+SVLE +++VGR
Sbjct  706   KSNESPEEAAAISATDDDAFLDLYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGR  765

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNR--------------MNFREDGNDEPDFNFSEE  1342
              S +    +++ +++  CEA   GK  +              MNF    +D+        
Sbjct  766   FSVSTAPDVSYKEMSGHCEALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITH  825

Query  1343  TIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                     NPF+D N  A   +P    AP  CATEY  HP F +LPASSPYDNFLKAAG
Sbjct  826   CY---DVRNPFSDQNFAANLHKPPIDPAPIHCATEYLHHPHFFKLPASSPYDNFLKAAG  881



>gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Erythranthe guttata]
Length=974

 Score =   421 bits (1082),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 270/533 (51%), Positives = 348/533 (65%), Gaps = 46/533 (9%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQILLAMV+PD+ETRLGAHR+FSVVLVPSSVCP  A      +   S++RTLS
Sbjct  458   AFPEALFHQILLAMVTPDHETRLGAHRIFSVVLVPSSVCPNTASTSQNCA---SLERTLS  514

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             R+ S FSSSAALF+KL K  S  +  +DQ              Q++L RLTS+YSR  +V
Sbjct  515   RSASAFSSSAALFEKLRKEHSLSQKFVDQADEILIGTEGKAKDQSLLKRLTSSYSRKSTV  574

Query  335   KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSL  514
             K  S   P    N +   +G+SLK+K+RQIS+LLSSI+VQAISHLNTP ++EAIAHTYSL
Sbjct  575   KRHS--LPPILCNMENELKGISLKLKTRQISLLLSSIWVQAISHLNTPANYEAIAHTYSL  632

Query  515   LMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYS  694
             LMLFSR KKSS+E LIR FQLAFSLRSISL     + PSRRRSLF LA SMI+FLSK + 
Sbjct  633   LMLFSRNKKSSNEILIRSFQLAFSLRSISL-RAGPLQPSRRRSLFTLAASMILFLSKAHG  691

Query  695   FIPLAVSAKALLTDKTMDPFLQLVDECHL-----KVNPNPKARASYGSKEDDEAAKRSLS  859
             F+PLA  AKA LTD+ +DPFL+LVD+C L     K   N   +  YGSKEDDE A +SLS
Sbjct  692   FLPLATYAKAALTDEIIDPFLRLVDDCKLEALDHKTGGNDMVKV-YGSKEDDEDALKSLS  750

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-----  1024
              I I+++QSTE FAS+I++++ K   D+++ IKE+LL+DF+PDE+CP+G Q + D     
Sbjct  751   TIRINEEQSTEYFASIILKNMGKLSDDESSNIKEELLKDFIPDEICPLGPQLVIDTPGVT  810

Query  1025  --LRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPD-STPNLLDVNEFLDSVLETSNQ  1195
               L   + S   T+D+     +  D   S +D  +     +P+LL V++F+D V ET+ +
Sbjct  811   YRLSEADNSIFSTSDD-----YPTDSFISQTDSCSQLTLDSPSLLSVDQFMDMVSETTKE  865

Query  1196  VGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM-NFREDG----NDEPDFNFSEETIWQPP  1360
             V + S+  P+ + F D+AS CEA Q GK   M NF         D  D N + +T  QP 
Sbjct  866   VVQLSSLTPSELPFKDMASHCEALQIGKHQVMSNFMAAPLLLIQDSQDINEAHDT--QPS  923

Query  1361  SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
               +  A     +   P+   +P  C  E+Q  P F +LPASSP+DNFLKAAGS
Sbjct  924   DDD--ACPQPGSFTIPLITGSPIRCGPEFQTQPDFFRLPASSPFDNFLKAAGS  974



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   423 bits (1087),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 266/581 (46%), Positives = 353/581 (61%), Gaps = 82/581 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+L+AMV PD+ETR+GAHR+FSVVLVPSSVCPR   A     K+  I R
Sbjct  472   QNKTFPEALFHQLLVAMVYPDHETRVGAHRIFSVVLVPSSVCPRPLAATHHAPKKNPIGR  531

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN--------------MLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL K  S  ++ +  +T++              MLNRL S +S
Sbjct  532   TLSRTVSVFSSSAALFEKLKKEPSHSQEHISHDTKDNALIGEEAKITNHTMLNRLKSKFS  591

Query  320   ----RSLSVKPGSEE-TPNNGEN------------------------------PQEHHEG  394
                  + S++ G++E T NN                                 PQ+    
Sbjct  592   LKKHEAASIELGAQEATANNHPTVNRLKSTLSRAYSMKRQSSTMSTDSTAPIVPQK-EST  650

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             +SL++ SRQI++LLSSI+ Q+I  LNTPE+++AIAH+YSL++L++RTK +SHE+LIR FQ
Sbjct  651   MSLRLSSRQITLLLSSIWAQSIYPLNTPENYQAIAHSYSLVLLYARTKNTSHETLIRSFQ  710

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             LAFSLRSISL E   + PSRRRSLF LATSMIIF +K Y+ + LA SAKA L ++T+DPF
Sbjct  711   LAFSLRSISLGE--GLQPSRRRSLFTLATSMIIFSAKAYNIVGLAPSAKAALANETVDPF  768

Query  755   LQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             LQLVD+  L+ +   P + R  YGSKEDDE A RSLS +E +  QS ES+A+MIV++L K
Sbjct  769   LQLVDDSKLQAIESGPDQPRKVYGSKEDDEDALRSLSALEKADTQSKESYATMIVKTLAK  828

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL-RNHNQS---DDKTNDEVVDPTFTVDD  1096
             S +D+ + +++QLL DFLPD+ CP+G     +     NQS   ++   + V  P F +D+
Sbjct  829   S-SDEFSTMRQQLLNDFLPDDTCPLGAPLCMETPVQINQSGLPENAAPNTVEPPMFIIDE  887

Query  1097  LGSHSDPNAHPDSTP-------NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
                 S   +  D+         +L+ VNE LDSVLET++QVGR S +  + + +M++A  
Sbjct  888   DALPSASESQTDTNTKLAVENLSLISVNELLDSVLETTHQVGRISVSTASDIPYMEMAGH  947

Query  1256  CEAFQEGKGNRMN--FREDGNDEPDFNFSEE------------TIWQPPSGNPFADNNTa  1393
             CEA Q GK  +++         E    FS +             +  P SGNPF D N  
Sbjct  948   CEALQMGKQKKLSAFTVAQQRQESLIRFSTQDRSVLNEVPPSVVLGVPTSGNPFLDANA-  1006

Query  1394  aagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                       P  CAT +Q +P F QLPASSPYDNFLKAAG
Sbjct  1007  VPVNQPVGNGPMPCATGFQHYPRF-QLPASSPYDNFLKAAG  1046



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   422 bits (1086),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 258/552 (47%), Positives = 347/552 (63%), Gaps = 48/552 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEAL HQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP ++       K  +  R
Sbjct  485   QNKAFPEALIHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVCPSRSLPNAESKKALNFPR  544

Query  182   TLSRTVSVFSSSAALFDKLGK-------------NQSSGKDGMDQNTQN-MLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL +             N++S  DG   +T + +L+RL S+YS
Sbjct  545   TLSRTVSVFSSSAALFEKLKREKISSRDSTCEEDNENSVADGEQGDTNSGILSRLRSSYS  604

Query  320   RSLSVKPG---SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
             R+ S+K     S    N+  N  +  E  SL++ S QI++LL SI+VQ+IS  N PE++E
Sbjct  605   RTYSMKSSPAPSAINENSVNNSIKEPEANSLRLSSHQITLLLLSIWVQSISPGNMPENYE  664

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMI  670
             AIAHT+SL++LFSR K S  E L+R FQLAFSLR+ISL+E   +PPSRRRSLF LATSMI
Sbjct  665   AIAHTHSLVVLFSRAKNSRIEVLVRSFQLAFSLRNISLNEGGVLPPSRRRSLFTLATSMI  724

Query  671   IFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAA  844
             +FLSK Y+ + L   AKA+L DK +DPFL+LV++C L+ V   P   R  YGS+EDD  A
Sbjct  725   LFLSKAYNIVSLVRRAKAVLVDKIVDPFLRLVEDCKLQAVKTGPDHPRHLYGSEEDDRLA  784

Query  845   KRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND  1024
              +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+VCP+G Q   D
Sbjct  785   LKSLSEINITEEQTKEFFASEVVKSLERLLDAELSTIREELLSEFLPDDVCPLGAQFCMD  844

Query  1025  ----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPNLLDVNEFLDS  1174
                 L   +  D K+  E   P F++DD    GS      + D    +PNLL VN+F++S
Sbjct  845   APQKLYQVDSRDSKSMKEDA-PIFSLDDDSFPGSFDSQKNNLDFSADSPNLLSVNQFIES  903

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF-------NF  1333
             VLET++QVGR S +    + + ++A  CEA   GK  +M+       + ++       N 
Sbjct  904   VLETAHQVGRPSVSNAPDVPYKEMARHCEALLMGKQQKMSNLMSSQQKQEYLMNQSLQNH  963

Query  1334  SEETIWQPP----------SGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
             +++  W             SGNPF D+  T+    P    A   C  EYQ HP   +LPA
Sbjct  964   NDDAKWITSGFHADFGSYRSGNPFVDDTATSYNPPPTTGRASVMCVNEYQHHPHSFRLPA  1023

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  1024  SSPYDNFLKAAG  1035



>ref|XP_011087843.1| PREDICTED: uncharacterized protein LOC105169196 [Sesamum indicum]
Length=1011

 Score =   421 bits (1083),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 343/539 (64%), Gaps = 45/539 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQILLAMV+PD+ETRLGAHR+FSVVLVPSSVCP  A      +    + R
Sbjct  483   QNKAFPEALFHQILLAMVNPDHETRLGAHRIFSVVLVPSSVCPHIAFTSQCSTIGADLGR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRS  325
             TLSR+ S FSSSAALF+KL K   S    +DQ              Q++L RL S+YSR 
Sbjct  543   TLSRSASAFSSSAALFEKLRKEHGSLPKIVDQADETLTDTEGNSEDQSLLTRLKSSYSRK  602

Query  326   LSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHT  505
              ++K  S   P    N ++  +G+SLK+K+RQIS+LLSS++VQAISHLNTP ++EAIAHT
Sbjct  603   ATIKRHS--LPPALGNMEKELKGISLKLKTRQISLLLSSVWVQAISHLNTPVNYEAIAHT  660

Query  506   YSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSK  685
             YSL++LFS+ KKSS++ LIR FQLA SLRSISL +  ++ PSRRRSLF LATSMI+FLSK
Sbjct  661   YSLVVLFSQNKKSSNDILIRSFQLALSLRSISL-QGGQLQPSRRRSLFTLATSMILFLSK  719

Query  686   TYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA----RASYGSKEDDEAAKRS  853
              Y+F+PL  SAK  L D+ +DPFL+LVD+C L+   +          YGSKEDDE A + 
Sbjct  720   AYNFLPLVTSAKTALRDEIVDPFLRLVDDCKLQAVDHRTGIDGMVKVYGSKEDDEDALKL  779

Query  854   LSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRN  1033
             LS I+IS++QSTE FASMI+E+L K    + + IKEQL++DFLPD+VCP+G Q +++   
Sbjct  780   LSAIKISEEQSTEYFASMILENLGKLPNAELSNIKEQLIKDFLPDDVCPLGAQLVSETPG  839

Query  1034  H-NQSDDKTNDEVVDPTFTVDDLGSHSDPN----AHPDS-------TPNLLDVNEFLDSV  1177
                +S  K   EV    F+  D     DP     +  DS       +P+LL V++F+D V
Sbjct  840   KICESGSKDLSEVEHSIFSASD----DDPGDSFLSRTDSCSPLTLESPSLLSVDQFMDMV  895

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM-NFREDGNDEPDFNFSEETIW-  1351
              ET+ +VG+ S+  P+ M F D+ASQCEA Q GK   M NF       P    S  ++  
Sbjct  896   SETTKEVGQLSSLIPSNMPFKDMASQCEALQIGKQQVMSNFMA----APVIQDSSTSLCS  951

Query  1352  ----QPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 Q  +   ++D         +    P  C  E+Q  P F  LPASSPYDNFLKAAG
Sbjct  952   QDSTQAHTKPSYSDLQPGYFTTSLITGVPMRCGAEFQHQPDFFCLPASSPYDNFLKAAG  1010



>ref|XP_008240995.1| PREDICTED: uncharacterized protein LOC103339476 [Prunus mume]
Length=1046

 Score =   422 bits (1084),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 261/550 (47%), Positives = 343/550 (62%), Gaps = 47/550 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHRVFSVVLVPSSVCP  + +     K     R
Sbjct  498   QNKAFPEALFHQLLPAMVHPDHETRVGAHRVFSVVLVPSSVCPGLSSSNTESKKALDFPR  557

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM----DQNTQN----------MLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL + + S ++ +    D+N  N          +L+RL S+YS
Sbjct  558   TLSRTVSVFSSSAALFEKLRREKISSRESICEDNDENVVNEGEQRDTNNGILSRLKSSYS  617

Query  320   RSLSVKPG-SEETPN--NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
             R+ S+K   +  TPN  +  N  + HE  SL++ S QI++LL SI+ Q++S  N PE++E
Sbjct  618   RTYSLKISPAPSTPNEISMSNSTKEHEANSLRLSSHQITLLLLSIWAQSLSPGNMPENYE  677

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMI  670
             AIAHT+SL+ LFSR K SS E L++ FQLAFSLR ISL+E   +PPSR RSLF LATSMI
Sbjct  678   AIAHTHSLVSLFSRAKHSSVEVLVQSFQLAFSLRDISLTEGGPLPPSRCRSLFTLATSMI  737

Query  671   IFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAA  844
             +FLSK Y+ + L   AKA L DKT+DPFL LV++  L+     +     +YGSKEDD  A
Sbjct  738   LFLSKAYNILSLVHRAKASLMDKTVDPFLHLVEDRKLQAVKTGSDHPTIAYGSKEDDILA  797

Query  845   KRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND  1024
              +SLS I I+++Q+ E FAS IV+SL K    + + I+EQL+ +FLPD+VCP+G Q   D
Sbjct  798   LKSLSEIAITEEQTREFFASQIVKSLDKLSDSELSTIREQLVSEFLPDDVCPLGAQLFMD  857

Query  1025  LRNHNQSDDKTNDEVVD---PTFTVDD---LGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                     D +N E +    P F++DD    GS      +  + P+LL VN+ ++SVLET
Sbjct  858   APQKLYQVDLSNSEAIKEDAPIFSLDDDSFPGSFDRQKNNSANLPDLLSVNQLMESVLET  917

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNR----MNFREDGNDEPDFNFS-----E  1339
             ++QVGR S +    M + ++A  CEA   GK  +    MNF++  N E   N S     +
Sbjct  918   AHQVGRLSISNAPDMPYKEMAGHCEALLIGKQQKMSSLMNFQQ--NQEYLMNLSLQNRND  975

Query  1340  ETIWQP----------PSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
             +  W             SGNPFA+   T+          P  CATEYQ+HP   +LPASS
Sbjct  976   DVKWMTSDFQADAGSHKSGNPFANQTATSYIPPQTPGCVPMMCATEYQQHPHSFRLPASS  1035

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  1036  PYDNFLKAAG  1045



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   420 bits (1079),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 249/526 (47%), Positives = 332/526 (63%), Gaps = 34/526 (6%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVP SVCPR  P    L K   + R 
Sbjct  481   NKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPFSVCPRPCPITPELKKASDLPRM  540

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSVK  337
             LSRTVSVFSSSAALF+KL K +S  K+ + Q         N   +LNR+ S+ SR+ S+K
Sbjct  541   LSRTVSVFSSSAALFEKLRKEKSFSKENICQENKEDELKNNNAGILNRMKSSLSRAYSLK  600

Query  338   PGSEET---PNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +       N   N     E +SLK+ SRQI++LLSSI+ Q+IS  N PE++EAIAHTY
Sbjct  601   SSAMSLTTDANFTSNSNNELEAVSLKLSSRQIALLLSSIWAQSISPANMPENYEAIAHTY  660

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K S HE L+R FQLAFSLRSISL +   +PP+RRRSLF LA SMI+F SK 
Sbjct  661   SLVLLFSRAKNSIHEVLVRSFQLAFSLRSISLVDGGPLPPARRRSLFTLAISMIVFSSKA  720

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPK-ARASYGSKEDDEAAKRSLSG  862
             Y  +PL   AKA L D+ +DPFL LV +  L+ VN     A   YGSKEDDE A ++LS 
Sbjct  721   YDILPLVPCAKAALLDRMVDPFLHLVQDNKLQAVNSGSDCASKVYGSKEDDECALKALSQ  780

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ  1042
             I+I+++Q+ ESFA++IV+SL+     ++++++EQL+ +FLPD+V   GTQ + D    + 
Sbjct  781   IKIAEEQTRESFATIIVKSLENLSESESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF  840

Query  1043  SDDKTNDEVVDPTFTVDD--LGSHSDPNAH----PDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +++ +E    + T DD  L  +     H        PNLL +N+ L+SVLE +++VGR
Sbjct  841   KSNESPEEAAAISATDDDAFLDLYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGR  900

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPPSGNPFADN  1384
              S +    +++ +++  CEA   GK  +M+             +  +  Q    NPF+D 
Sbjct  901   FSVSTAPDVSYKEMSGHCEALLMGKQQKMS-------------NLISTQQKQVRNPFSDQ  947

Query  1385  N-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
             N  A   +P    AP  CATEY  HP F +LPASSPYDNFLKAAG 
Sbjct  948   NFAANLHKPPIDPAPIHCATEYLHHPHFFKLPASSPYDNFLKAAGC  993



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   419 bits (1077),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 261/582 (45%), Positives = 350/582 (60%), Gaps = 81/582 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCP+ + +G  ++    IQR
Sbjct  458   QNKAFPEALFHQLLLAMVHADHETRVGAHRIFSVVLVPSSVCPQPSSSGTPMTHAADIQR  517

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS-----GKDGMDQNTQNMLNRLTSTYSRSLSVKPGS  346
              LSR VSVFSSS+ALF+KL + Q+S       DG + N  ++LNRL STYSR+ S +  +
Sbjct  518   MLSRNVSVFSSSSALFEKLERKQNSLPEDSHADG-NVNDNSILNRLKSTYSRTTSTRKSA  576

Query  347   ----EETPNNG----------------------ENPQ-------------EHHEGLSLKM  409
                 E T N                        + PQ                + L +++
Sbjct  577   LTSAEYTDNRNSKVHNSSMMSRLKSSYSRATSVKKPQIPTTVEENTTNTSNKQQVLPIRL  636

Query  410   KSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSL  589
              S QI++LLSSI+ Q+I  LNT E+FEAIAHTYSL++L +R+K SSHE+L + FQLAFSL
Sbjct  637   SSHQITLLLSSIWAQSIYPLNTSENFEAIAHTYSLVLLVARSKNSSHEALTQSFQLAFSL  696

Query  590   RSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVD  769
             R+ISL+E  K+ PSRRRSLF LATSMIIF SK Y+ + L   AK  LTD+T+DPFLQLV+
Sbjct  697   RNISLNENVKLQPSRRRSLFTLATSMIIFASKAYNILSLISIAKTTLTDRTVDPFLQLVN  756

Query  770   ECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDK  943
             +  L+   +   + S  YGSKEDDE A +SLS I++++ QS ESFA+MIV+SL KS +++
Sbjct  757   DSKLQAVTDTDKQPSKVYGSKEDDEDALKSLSAIKLTESQSKESFATMIVQSLGKS-SNE  815

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDD----L  1099
             +++++E+LL DF PD+ CP+G Q       ++      +DK  D V    FT+DD     
Sbjct  816   SSILRERLLNDFSPDDACPLGAQLSAETTGNMYQSGLKEDKLPDMVDISLFTIDDDIPPC  875

Query  1100  G----SHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAF  1267
             G    ++SD    P    +LL V++ L SV ET++QVGR S + P  M + ++A  CEA 
Sbjct  876   GLESQANSDSMQQPSQNLSLLSVDDILGSVSETTHQVGRISISTPFDMPYKEMALHCEAL  935

Query  1268  QEGKGNRM------------NFR------EDGNDEPDFNFSEETIWQPPSGNPFADNNTa  1393
               GK  +M            +FR          DE   +  ++T+    SGNPF D+N  
Sbjct  936   LVGKQQKMSTFMGTLPMQGYSFRIPAPEYYQQKDESSNSSVQQTL--SSSGNPFLDSNFD  993

Query  1394  aagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +             CAT YQ   +F QLPAS PYDNFLKAAG
Sbjct  994   SNSHNTLPDTAPRLCATAYQHQAAFFQLPASRPYDNFLKAAG  1035



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   418 bits (1075),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 251/540 (46%), Positives = 333/540 (62%), Gaps = 38/540 (7%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVP SVCPR  P    L K   + R 
Sbjct  481   NKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPFSVCPRPCPITPELKKASDLPRM  540

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSVK  337
             LSRTVSVFSSSAALF+KL K +S  K+ + Q         N   +LNR+ S+ SR+ S+K
Sbjct  541   LSRTVSVFSSSAALFEKLRKEKSFSKENICQENKEDELKNNNAGILNRMKSSLSRAYSLK  600

Query  338   PGSEET---PNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +       N   N     E +SLK+ SRQI++LLSSI+ Q+IS  N PE++EAIAHTY
Sbjct  601   SSAMSLTTDANFTSNSNNELEAVSLKLSSRQIALLLSSIWAQSISPANMPENYEAIAHTY  660

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K S HE L+R FQLAFSLRSISL +   +PP+RRRSLF LA SMI+F SK 
Sbjct  661   SLVLLFSRAKNSIHEVLVRSFQLAFSLRSISLVDGGPLPPARRRSLFTLAISMIVFSSKA  720

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPK-ARASYGSKEDDEAAKRSLSG  862
             Y  +PL   AKA L D+ +DPFL LV +  L+ VN     A   YGSKEDDE A ++LS 
Sbjct  721   YDILPLVPCAKAALLDRMVDPFLHLVQDNKLQAVNSGSDCASKVYGSKEDDECALKALSQ  780

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ  1042
             I+I+++Q+ ESFA++IV+SL+     ++++++EQL+ +FLPD+V   GTQ + D    + 
Sbjct  781   IKIAEEQTRESFATIIVKSLENLSESESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF  840

Query  1043  SDDKTNDEVVDPTFTVDD--LGSHSDPNAH----PDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +++ +E    + T DD  L  +     H        PNLL +N+ L+SVLE +++VGR
Sbjct  841   KSNESPEEAAAISATDDDAFLDLYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGR  900

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNR--------------MNFREDGNDEPDFNFSEE  1342
              S +    +++ +++  CEA   GK  +              MNF    +D+        
Sbjct  901   FSVSTAPDVSYKEMSGHCEALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITH  960

Query  1343  TIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
                     NPF+D N  A   +P    AP  CATEY  HP F +LPASSPYDNFLKAAG 
Sbjct  961   CY---DVRNPFSDQNFAANLHKPPIDPAPIHCATEYLHHPHFFKLPASSPYDNFLKAAGC  1017



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   417 bits (1073),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 348/556 (63%), Gaps = 52/556 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEAL HQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP ++       K  +  R
Sbjct  485   QNKAFPEALIHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVCPSRSLPNAESKKALNFPR  544

Query  182   TLSRTVSVFSSSAALFDKLGK-------------NQSSGKDGMDQNTQN-MLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL +             N++S  DG   +T + +L+RL S+YS
Sbjct  545   TLSRTVSVFSSSAALFEKLKREKISSRDSTCEEDNENSVADGEQGDTNSGILSRLRSSYS  604

Query  320   RSLSVKPG---SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
             R+ S+K     S    N+  N  +  E  SL++ S QI++LL SI+VQ+IS  N PE++E
Sbjct  605   RTYSMKSSPAPSAINENSVNNSIKEPEANSLRLSSHQITLLLLSIWVQSISPGNMPENYE  664

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAK----MPPSRRRSLFALA  658
             AIAHT+SL++LFSR K S  E L+R FQLAFSLR+ISL+E  +    +PPSRRRSLF LA
Sbjct  665   AIAHTHSLVVLFSRAKNSRIEVLVRSFQLAFSLRNISLNEGGEPHSVLPPSRRRSLFTLA  724

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKED  832
             TSMI+FLSK Y+ + L   AKA+L DK +DPFL+LV++C L+ V   P   R  YGS+ED
Sbjct  725   TSMILFLSKAYNIVSLVRRAKAVLVDKIVDPFLRLVEDCKLQAVKTGPDHPRHLYGSEED  784

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D  A +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+VCP+G Q
Sbjct  785   DRLALKSLSEINITEEQTKEFFASEVVKSLERLLDAELSTIREELLSEFLPDDVCPLGAQ  844

Query  1013  RIND----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPNLLDVNE  1162
                D    L   +  D K+  E   P F++DD    GS      + D    +PNLL VN+
Sbjct  845   FCMDAPQKLYQVDSRDSKSMKEDA-PIFSLDDDSFPGSFDSQKNNLDFSADSPNLLSVNQ  903

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF-----  1327
             F++SVLET++QVGR S +    + + ++A  CEA   GK  +M+       + ++     
Sbjct  904   FIESVLETAHQVGRPSVSNAPDVPYKEMARHCEALLMGKQQKMSNLMSSQQKQEYLMNQS  963

Query  1328  --NFSEETIWQPP----------SGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFM  1468
               N +++  W             SGNPF D+  T+    P    A   C  EYQ HP   
Sbjct  964   LQNHNDDAKWITSGFHADFGSYRSGNPFVDDTATSYNPPPTTGRASVMCVNEYQHHPHSF  1023

Query  1469  QLPASSPYDNFLKAAG  1516
             +LPASSPYDNFLKAAG
Sbjct  1024  RLPASSPYDNFLKAAG  1039



>ref|XP_008463083.1| PREDICTED: uncharacterized protein LOC103501308 isoform X2 [Cucumis 
melo]
Length=1064

 Score =   417 bits (1072),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 260/593 (44%), Positives = 349/593 (59%), Gaps = 93/593 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  476   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPHASVPHSAKPTYIQR  535

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNT--------------QNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q                 ++ NRL S+YS
Sbjct  536   TLSRTVSVFSSSAALFQKVKVEPHSAPENIFQKVDEKPIIQQPTKVEGDSIFNRLKSSYS  595

Query  320   RSLSVK---PGS----------------------------------EETPN--NGENP--  376
             R  +VK   P S                                  + TP+    E P  
Sbjct  596   RVHTVKKDPPISVQASIIEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTPSTVTDEKPLG  655

Query  377   -QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHE  553
               E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SSHE
Sbjct  656   SSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSSHE  715

Query  554   SLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLT  733
             +LIR FQLAFSLRSISL+   ++ PS RRSLF LATSMIIF +K Y+ +PLA  AK  LT
Sbjct  716   TLIRSFQLAFSLRSISLA-GGQLQPSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVALT  774

Query  734   DKTMDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
              + +DPFL+LV++C L+V    + NP  R  YGSKED+E A++SLS ++ S+ QS ESFA
Sbjct  775   SEVVDPFLRLVEDCKLQVSHLGHDNP--RPDYGSKEDNEDAEKSLSAVDTSESQSKESFA  832

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVD  1075
              +I+++L     ++ + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    VD
Sbjct  833   KLILQTLHNMSENELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTVD  892

Query  1076  PTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMT  1234
             P F++D+     +P +  D         P+++  +E L+ + + +NQVGR S + P  M 
Sbjct  893   PLFSMDNDNLCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNMP  952

Query  1235  FMDVASQCEAFQEGKGNRM-NF---------------RED---GNDEPDFNFSEETIWQP  1357
             + ++A  CEA  E K  ++ NF                +D   G +EP     + T+ + 
Sbjct  953   YKEMAGNCEALSEEKQQKISNFITSQPTNESSVRTPTHDDDNLGKEEPSQRHVQFTVNK-  1011

Query  1358  PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  1012  -SGNPFVDSDVPMYWNSSINTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  1063



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   416 bits (1068),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 255/545 (47%), Positives = 339/545 (62%), Gaps = 43/545 (8%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD+ETR+GAHRVFSVVLVPSSVCP  + +     K     RTLS
Sbjct  476   AFPEALFHQLLPAMVHPDHETRVGAHRVFSVVLVPSSVCPGLSSSNTESKKAFDFPRTLS  535

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGM----DQNTQN----------MLNRLTSTYSRSL  328
             RTVSVFSSSAALF+KL + + S ++ +    D+N  N          +L+RL S+YSR+ 
Sbjct  536   RTVSVFSSSAALFEKLRREKISSRESICEDNDENVVNEGEQRDTNNGILSRLKSSYSRTY  595

Query  329   SVKPG-SEETPN--NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             S+K   +  TPN  +  N  + HE  SL++ S QI +LL SI+ Q++S  N PE++EAIA
Sbjct  596   SLKISPAPSTPNEISMSNSTKEHEANSLRLSSHQIILLLLSIWAQSLSPGNMPENYEAIA  655

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             HT+SL+ LFSR K SS E L++ FQLAFSLR ISL+E   +PPSRRRSLF LATSMI+FL
Sbjct  656   HTHSLVSLFSRAKHSSVEVLVQSFQLAFSLRDISLTEGGPLPPSRRRSLFTLATSMILFL  715

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRS  853
             SK Y+ + L   AKA L DKT+DPFL LV++  L+     +     +YGSKEDD  A +S
Sbjct  716   SKAYNILSLVHRAKASLMDKTVDPFLHLVEDRKLQAVKTGSDHPTIAYGSKEDDNLALKS  775

Query  854   LSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRN  1033
             LS I I+ +Q+ E FAS +V+SL K    + + I+EQL+ +FLPD+VCP+G Q   D   
Sbjct  776   LSEIAITDEQTREFFASQVVKSLDKLSDSELSTIREQLVSEFLPDDVCPLGAQLFMDAPQ  835

Query  1034  HNQSDDKTNDEVVD---PTFTVDD---LGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQ  1195
                  D +N E +    P F++DD    GS      +  + P+LL VN+ ++SVLET++Q
Sbjct  836   KLYQVDLSNSEAIKEDAPIFSLDDDSFPGSFDSQKNNSANLPDLLSVNQLMESVLETAHQ  895

Query  1196  VGRQSAAPPAGMTFMDVASQCEAFQEGKGNR----MNFREDGNDEPDF---NFSEETIWQ  1354
             VGR S +    + + ++A  CEA   GK  +    MNF+++     +    N +++  W 
Sbjct  896   VGRLSISNAPDVPYKEMAGHCEALLIGKQQKMSSLMNFQQNQGYLMNLSLHNRNDDVKWM  955

Query  1355  P----------PSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNF  1501
                         SGNPFAD   T+          P  CATEYQ+HP   +LPASSPYDNF
Sbjct  956   TSYFQADAGSHKSGNPFADQTATSYIPPQTPGCVPMMCATEYQQHPYSFRLPASSPYDNF  1015

Query  1502  LKAAG  1516
             LKAAG
Sbjct  1016  LKAAG  1020



>ref|XP_008463098.1| PREDICTED: uncharacterized protein LOC103501308 isoform X4 [Cucumis 
melo]
Length=1000

 Score =   414 bits (1064),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 259/594 (44%), Positives = 348/594 (59%), Gaps = 94/594 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  411   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPHASVPHSAKPTYIQR  470

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNT--------------QNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q                 ++ NRL S+YS
Sbjct  471   TLSRTVSVFSSSAALFQKVKVEPHSAPENIFQKVDEKPIIQQPTKVEGDSIFNRLKSSYS  530

Query  320   RSLSVKPG-------------------------------------SEETPN--NGENP--  376
             R  +VK                                        + TP+    E P  
Sbjct  531   RVHTVKKDPPISVQASIIEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTPSTVTDEKPLG  590

Query  377   -QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHE  553
               E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SSHE
Sbjct  591   SSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSSHE  650

Query  554   SLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLT  733
             +LIR FQLAFSLRSISL+   ++ PS RRSLF LATSMIIF +K Y+ +PLA  AK  LT
Sbjct  651   TLIRSFQLAFSLRSISLA-GGQLQPSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVALT  709

Query  734   DKTMDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
              + +DPFL+LV++C L+V    + NP  R  YGSKED+E A++SLS ++ S+ QS ESFA
Sbjct  710   SEVVDPFLRLVEDCKLQVSHLGHDNP--RPDYGSKEDNEDAEKSLSAVDTSESQSKESFA  767

Query  902   SMIVESLKK-SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVV  1072
              +I+++L   S  ++ + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    V
Sbjct  768   KLILQTLHNMSEQNELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTV  827

Query  1073  DPTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
             DP F++D+     +P +  D         P+++  +E L+ + + +NQVGR S + P  M
Sbjct  828   DPLFSMDNDNLCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNM  887

Query  1232  TFMDVASQCEAFQEGKGNRM-NF---------------RED---GNDEPDFNFSEETIWQ  1354
              + ++A  CEA  E K  ++ NF                +D   G +EP     + T+ +
Sbjct  888   PYKEMAGNCEALSEEKQQKISNFITSQPTNESSVRTPTHDDDNLGKEEPSQRHVQFTVNK  947

Query  1355  PPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  948   --SGNPFVDSDVPMYWNSSINTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  999



>ref|XP_008463089.1| PREDICTED: uncharacterized protein LOC103501308 isoform X3 [Cucumis 
melo]
Length=1030

 Score =   414 bits (1065),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 259/594 (44%), Positives = 348/594 (59%), Gaps = 94/594 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  441   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPHASVPHSAKPTYIQR  500

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNT--------------QNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q                 ++ NRL S+YS
Sbjct  501   TLSRTVSVFSSSAALFQKVKVEPHSAPENIFQKVDEKPIIQQPTKVEGDSIFNRLKSSYS  560

Query  320   RSLSVKPG-------------------------------------SEETPN--NGENP--  376
             R  +VK                                        + TP+    E P  
Sbjct  561   RVHTVKKDPPISVQASIIEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTPSTVTDEKPLG  620

Query  377   -QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHE  553
               E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SSHE
Sbjct  621   SSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSSHE  680

Query  554   SLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLT  733
             +LIR FQLAFSLRSISL+   ++ PS RRSLF LATSMIIF +K Y+ +PLA  AK  LT
Sbjct  681   TLIRSFQLAFSLRSISLA-GGQLQPSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVALT  739

Query  734   DKTMDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
              + +DPFL+LV++C L+V    + NP  R  YGSKED+E A++SLS ++ S+ QS ESFA
Sbjct  740   SEVVDPFLRLVEDCKLQVSHLGHDNP--RPDYGSKEDNEDAEKSLSAVDTSESQSKESFA  797

Query  902   SMIVESLKK-SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVV  1072
              +I+++L   S  ++ + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    V
Sbjct  798   KLILQTLHNMSEQNELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTV  857

Query  1073  DPTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
             DP F++D+     +P +  D         P+++  +E L+ + + +NQVGR S + P  M
Sbjct  858   DPLFSMDNDNLCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNM  917

Query  1232  TFMDVASQCEAFQEGKGNRM-NF---------------RED---GNDEPDFNFSEETIWQ  1354
              + ++A  CEA  E K  ++ NF                +D   G +EP     + T+ +
Sbjct  918   PYKEMAGNCEALSEEKQQKISNFITSQPTNESSVRTPTHDDDNLGKEEPSQRHVQFTVNK  977

Query  1355  PPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  978   --SGNPFVDSDVPMYWNSSINTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  1029



>ref|XP_008463075.1| PREDICTED: uncharacterized protein LOC103501308 isoform X1 [Cucumis 
melo]
Length=1065

 Score =   414 bits (1065),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 261/594 (44%), Positives = 350/594 (59%), Gaps = 94/594 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  476   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPHASVPHSAKPTYIQR  535

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNT--------------QNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q                 ++ NRL S+YS
Sbjct  536   TLSRTVSVFSSSAALFQKVKVEPHSAPENIFQKVDEKPIIQQPTKVEGDSIFNRLKSSYS  595

Query  320   RSLSVK---PGS----------------------------------EETPN--NGENP--  376
             R  +VK   P S                                  + TP+    E P  
Sbjct  596   RVHTVKKDPPISVQASIIEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTPSTVTDEKPLG  655

Query  377   -QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHE  553
               E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SSHE
Sbjct  656   SSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSSHE  715

Query  554   SLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLT  733
             +LIR FQLAFSLRSISL+   ++ PS RRSLF LATSMIIF +K Y+ +PLA  AK  LT
Sbjct  716   TLIRSFQLAFSLRSISLA-GGQLQPSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVALT  774

Query  734   DKTMDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
              + +DPFL+LV++C L+V    + NP  R  YGSKED+E A++SLS ++ S+ QS ESFA
Sbjct  775   SEVVDPFLRLVEDCKLQVSHLGHDNP--RPDYGSKEDNEDAEKSLSAVDTSESQSKESFA  832

Query  902   SMIVESLKK-SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVV  1072
              +I+++L   S  ++ + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    V
Sbjct  833   KLILQTLHNMSEQNELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTV  892

Query  1073  DPTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
             DP F++D+     +P +  D         P+++  +E L+ + + +NQVGR S + P  M
Sbjct  893   DPLFSMDNDNLCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNM  952

Query  1232  TFMDVASQCEAFQEGKGNRM-NF---------------RED---GNDEPDFNFSEETIWQ  1354
              + ++A  CEA  E K  ++ NF                +D   G +EP     + T+ +
Sbjct  953   PYKEMAGNCEALSEEKQQKISNFITSQPTNESSVRTPTHDDDNLGKEEPSQRHVQFTVNK  1012

Query  1355  PPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  1013  --SGNPFVDSDVPMYWNSSINTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  1064



>ref|XP_008350294.1| PREDICTED: uncharacterized protein LOC103413615 [Malus domestica]
Length=851

 Score =   408 bits (1048),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 252/556 (45%), Positives = 346/556 (62%), Gaps = 52/556 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEAL HQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP ++       K  +  R
Sbjct  296   QNKAFPEALIHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVCPSRSLPNAESKKALNFPR  355

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM-DQNTQN-------------MLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL + + S +D + +++ +N             +L+RL S+YS
Sbjct  356   TLSRTVSVFSSSAALFEKLKREKISSRDSICEEDNENSVADGEQGDTNSGILSRLRSSYS  415

Query  320   RSLSVKPG---SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
             R+ S+K     S    N+  N  +  E  SL++   QI++LL SI+VQ+IS  N PE++E
Sbjct  416   RTYSMKSSPAPSAINENSVNNSIKEPEADSLRLSXHQITLLLLSIWVQSISPGNMPENYE  475

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSE----QAKMPPSRRRSLFALA  658
             AIAHT+SL++LFS  K S  E L+R FQLAFSLR+ISL+E    ++ +PPSRRRSLF LA
Sbjct  476   AIAHTHSLVVLFSXAKNSRIEVLVRSFQLAFSLRNISLNEGGEPRSVLPPSRRRSLFTLA  535

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKED  832
             TSMI+FLSK Y+ + L   A A+L DK +DPFL+LV++  L+ V   P   R  YGS+ED
Sbjct  536   TSMILFLSKAYNIVSLVRRANAVLVDKIVDPFLRLVEDRKLQAVKTGPDHPRHLYGSEED  595

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D  A +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+VCP+G Q
Sbjct  596   DRLALKSLSEINITEEQTKEFFASEVVKSLERLLDAELSTIREELLSEFLPDDVCPLGAQ  655

Query  1013  RIND----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPNLLDVNE  1162
                D    L   +  D K+  E   P F++DD    GS      + D    +PNLL VN+
Sbjct  656   LCMDAPQKLYQVDSRDSKSMKEDA-PIFSLDDDSFPGSFDSQKNNLDFSADSPNLLSVNQ  714

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF-----  1327
             F++SVLET++QVGR S +    + + ++A  CEA   GK  +M+       + ++     
Sbjct  715   FIESVLETAHQVGRLSVSNAPDVPYKEMAGHCEALLIGKQQKMSNLMSSQQKQEYLMNQS  774

Query  1328  --NFSEETIWQPP----------SGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFM  1468
               N +++  W             SGNPF D+  T+    P    A   C  EYQ HP   
Sbjct  775   LQNHNDDAKWITSGFHADFGSYRSGNPFVDDTATSYNPPPTAGHASVMCVNEYQHHPHSF  834

Query  1469  QLPASSPYDNFLKAAG  1516
             +LPASSPYDNFLKAAG
Sbjct  835   RLPASSPYDNFLKAAG  850



>ref|XP_004171248.1| PREDICTED: uncharacterized LOC101219905, partial [Cucumis sativus]
Length=920

 Score =   409 bits (1051),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 257/592 (43%), Positives = 345/592 (58%), Gaps = 90/592 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   +QR
Sbjct  331   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPNASVPPSAKPTYLQR  390

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN--------------TQNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q               + ++ NRL S+YS
Sbjct  391   TLSRTVSVFSSSAALFQKVKVEPLSPPENIFQKVDEKTIVQQPTKVESDSIFNRLKSSYS  450

Query  320   RSLSVK---PGSEETP------------NNG--------------------------ENP  376
             R  +VK   P S +              NN                           E P
Sbjct  451   RVHTVKKDPPISVQASIIEEEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTSSTVTDEKP  510

Query  377   ---QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
                 E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SS
Sbjct  511   SGSSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSS  570

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             HE+LIR FQLAFSLRSISL+   ++  S RRSLF LATSMIIF +K Y+ +PLA  AK  
Sbjct  571   HETLIRSFQLAFSLRSISLA-GGQLQSSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVA  629

Query  728   LTDKTMDPFLQLVDECHLKVN--PNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             LT + +DPFL+LV++C L+V    +   R  YGSKED+E A +SLS ++ S+ QS ESFA
Sbjct  630   LTSEVVDPFLRLVEDCKLQVANLGHDHPRPDYGSKEDNEDAVKSLSAVDTSESQSKESFA  689

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVD  1075
              +I+++L K    + + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    VD
Sbjct  690   KLILQTLHKMSQKELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTVD  749

Query  1076  PTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMT  1234
             P F++D+  +  +P +  D         P+++  +E L+ + + +NQVGR S + P  M 
Sbjct  750   PLFSMDNDNTCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNMP  809

Query  1235  FMDVASQCEAFQEGKGNRM-NF---------------REDGN--DEPDFNFSEETIWQPP  1360
             + ++A  CEA  E K  ++ NF                +D N   EP     + T+ +  
Sbjct  810   YKEMAGNCEALSEEKQQKITNFIASQPTNESSVRTPTHDDDNLGKEPSQRHVQFTVNK--  867

Query  1361  SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  868   SGNPFVDSDAPMYWNSSVNTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  919



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   410 bits (1054),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 246/551 (45%), Positives = 332/551 (60%), Gaps = 54/551 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP    A     K   +QR
Sbjct  484   QNKAFPESLFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVCPYTGSAEPESKKPTDLQR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNT--------------QNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF+KL K +SS ++ + Q                + ML+R+ STYS
Sbjct  544   TLSRTVSVFSSSAALFEKL-KTRSSSRESVVQEVKEKPTGDEVQSRVNEGMLSRIRSTYS  602

Query  320   RSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             R+ S K  P   ++ N     +   + +SL++ S QIS+LLSSI+ Q+IS  N PE++EA
Sbjct  603   RAYSFKNPPADADSKN-----KTSVDPISLRLSSHQISLLLSSIWAQSISPANMPENYEA  657

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTY L++LFSR K SS + L++ FQLAFSLR  SL++   +PPSRRRSLF LATSMI+
Sbjct  658   IAHTYCLVLLFSRAKNSSRDHLVQSFQLAFSLRHYSLAQGGPVPPSRRRSLFVLATSMIV  717

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAK  847
             F SK YS IPL   AKA+ + K +DPFL LV +  L+V    +      YGSKEDD +A 
Sbjct  718   FSSKAYSIIPLVPCAKAVFSKKVIDPFLSLVGDSKLQVVDTGSRLGNVDYGSKEDDSSAM  777

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             + LS IEI+K Q+ E   S+IV+SL   +  + + I+E LL +FLPD VCP+G+Q + + 
Sbjct  778   KCLSEIEITKDQTREHMVSIIVKSLDNLLDGEVSNIRELLLSNFLPDYVCPLGSQFLTET  837

Query  1028  RNHNQSDDKTNDEVVD---PTFTVDD--------LGSHSDPNAHPDSTPNLLDVNEFLDS  1174
               + +  ++ NDE ++   P FT++D        + S  +P    +  P+LL VN+ L+S
Sbjct  838   SENARQSNEKNDENLEKAGPIFTLEDDPVSDSSEIISKQNPELAIE-IPDLLSVNQLLES  896

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF-----------------RE  1303
             VLET++QVGR S +  + + + ++A  CEA   GK  +M++                   
Sbjct  897   VLETAHQVGRLSVSTASDVPYKEMAHHCEALLMGKQQKMSYLMNNQQRQESLLIRVSQHS  956

Query  1304  DGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPAS  1483
             D ND    +     I      NPF D +T              CA E Q  P   +LPAS
Sbjct  957   DENDRGMVSHVHTDISLKLVTNPFLDMDTFGMASKPPVVPLL-CAAECQHRPQSFKLPAS  1015

Query  1484  SPYDNFLKAAG  1516
             SPYD+FLKAAG
Sbjct  1016  SPYDHFLKAAG  1026



>ref|XP_010257180.1| PREDICTED: uncharacterized protein LOC104597386 isoform X2 [Nelumbo 
nucifera]
Length=1010

 Score =   407 bits (1047),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 247/546 (45%), Positives = 331/546 (61%), Gaps = 43/546 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV PD ETR+GAHR+FSVVLVPSSVCP    A    SK    QR
Sbjct  468   QNKAFPEALFHQLLLAMVHPDQETRVGAHRIFSVVLVPSSVCPHPCSAIPGTSKVYGFQR  527

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSV  334
             TLSRTVS FSSSAALF+KL K +S+ ++   Q         N++ +L+RL S+Y+R  S 
Sbjct  528   TLSRTVSAFSSSAALFEKLIKEKSTSQENGCQDIDVGKLRTNSEGLLSRLKSSYTRVYSA  587

Query  335   KPGSEETPNNG--ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             + GS  T +      P +  + + L++ SRQI++LLSS++ Q++S  N PE++EAIAHTY
Sbjct  588   R-GSPSTSDEECMNTPNKEGDPMYLRLSSRQITLLLSSLWAQSLSPENMPENYEAIAHTY  646

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
              L++LFSR K   H++LIR FQ+AFSLR  SL+    + PSRRRS+F LATSMIIF +K 
Sbjct  647   CLVLLFSRGKNCIHDALIRSFQIAFSLRGFSLN-GGPLQPSRRRSIFTLATSMIIFSAKA  705

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSG  862
             Y+  PL    K  LTDKT+DPFL+LV +C L+      +  S  YGS +DD AA  +LS 
Sbjct  706   YNIGPLVPCVKVSLTDKTVDPFLKLVRDCKLQAIDIGSSHPSKVYGSIDDDSAALETLSS  765

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LR  1030
             I I++ QS ES A++IV+SL+     + + I EQL  +FLPD++CP+G Q   D    + 
Sbjct  766   INITEDQSKESLAAIIVKSLQNLSDPEASAISEQLQNEFLPDDICPLGAQLYMDTPQKIS  825

Query  1031  NHNQSDDKTNDEVVDPTFTVDDLGS------HSDPNAHPDSTPNLLDVNEFLDSVLETSN  1192
                  D    DE++ P FT D   S       + PN     T +LL VNE LDSVL+T+ 
Sbjct  826   QLGSKDGCPLDEMMHPIFTEDGFISPITFERQNGPNLQLSETADLLSVNELLDSVLDTAR  885

Query  1193  QVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF---------------REDGNDEPDF  1327
             QVGR S +    + + + A  CE   +GK  +++                 +D N+    
Sbjct  886   QVGRFSVSTTPDVPYTETALHCETLLKGKQKKLSTFTTAQQKLENLISISVQDHNEAKTI  945

Query  1328  -NFSEETIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNF  1501
              + S   +  P +GNPF D++ +A   +      P  CA EYQ H +F +LPASSPYDNF
Sbjct  946   SSHSHVDMGLPLTGNPFLDHDLSAKGCKSSVGTTPMLCAVEYQHHSNF-RLPASSPYDNF  1004

Query  1502  LKAAGS  1519
             LKAAG 
Sbjct  1005  LKAAGC  1010



>ref|XP_004147289.1| PREDICTED: uncharacterized protein LOC101219905 [Cucumis sativus]
Length=1065

 Score =   409 bits (1050),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 257/592 (43%), Positives = 345/592 (58%), Gaps = 90/592 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+K FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   +QR
Sbjct  476   QDKGFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPNASVPPSAKPTYLQR  535

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN--------------TQNMLNRLTSTYS  319
             TLSRTVSVFSSSAALF K+     S  + + Q               + ++ NRL S+YS
Sbjct  536   TLSRTVSVFSSSAALFQKVKVEPLSPPENIFQKVDEKTIVQQPTKVESDSIFNRLKSSYS  595

Query  320   RSLSVK---PGSEETP------------NNG--------------------------ENP  376
             R  +VK   P S +              NN                           E P
Sbjct  596   RVHTVKKDPPISVQASIIEEEEEEEPKINNNTMMNRLKSSYSRAYSMKKTTSSTVTDEKP  655

Query  377   ---QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
                 E  +   L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+RTK SS
Sbjct  656   SGSSEKEQTTFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARTKNSS  715

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             HE+LIR FQLAFSLRSISL+   ++  S RRSLF LATSMIIF +K Y+ +PLA  AK  
Sbjct  716   HETLIRSFQLAFSLRSISLA-GGQLQSSHRRSLFTLATSMIIFTAKAYNIVPLAPRAKVA  774

Query  728   LTDKTMDPFLQLVDECHLKVN--PNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             LT + +DPFL+LV++C L+V    +   R  YGSKED+E A +SLS ++ S+ QS ESFA
Sbjct  775   LTSEVVDPFLRLVEDCKLQVANLGHDHPRPDYGSKEDNEDAVKSLSAVDTSESQSKESFA  834

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVD  1075
              +I+++L K    + + I+EQLLQDFLPD+ CP+GTQ     R   Q   K+++    VD
Sbjct  835   KLILQTLHKMSQKELSSIREQLLQDFLPDDTCPLGTQFFVTPREIYQCGPKSDETSNTVD  894

Query  1076  PTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMT  1234
             P F++D+  +  +P +  D         P+++  +E L+ + + +NQVGR S + P  M 
Sbjct  895   PLFSMDNDNTCDEPQSQNDIEIEKVPEGPSVMSADELLNLISDITNQVGRLSGSLPTNMP  954

Query  1235  FMDVASQCEAFQEGKGNRM-NF---------------REDGN--DEPDFNFSEETIWQPP  1360
             + ++A  CEA  E K  ++ NF                +D N   EP     + T+ +  
Sbjct  955   YKEMAGNCEALSEEKQQKITNFIASQPTNESSVRTPTHDDDNLGKEPSQRHVQFTVNK--  1012

Query  1361  SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             SGNPF D++            PA CATEYQ +P  +QLP+SSPYDNFLKAAG
Sbjct  1013  SGNPFVDSDAPMYWNSSVNTYPALCATEYQYYPHLIQLPSSSPYDNFLKAAG  1064



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   407 bits (1046),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 247/546 (45%), Positives = 331/546 (61%), Gaps = 43/546 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV PD ETR+GAHR+FSVVLVPSSVCP    A    SK    QR
Sbjct  484   QNKAFPEALFHQLLLAMVHPDQETRVGAHRIFSVVLVPSSVCPHPCSAIPGTSKVYGFQR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSV  334
             TLSRTVS FSSSAALF+KL K +S+ ++   Q         N++ +L+RL S+Y+R  S 
Sbjct  544   TLSRTVSAFSSSAALFEKLIKEKSTSQENGCQDIDVGKLRTNSEGLLSRLKSSYTRVYSA  603

Query  335   KPGSEETPNNG--ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             + GS  T +      P +  + + L++ SRQI++LLSS++ Q++S  N PE++EAIAHTY
Sbjct  604   R-GSPSTSDEECMNTPNKEGDPMYLRLSSRQITLLLSSLWAQSLSPENMPENYEAIAHTY  662

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
              L++LFSR K   H++LIR FQ+AFSLR  SL+    + PSRRRS+F LATSMIIF +K 
Sbjct  663   CLVLLFSRGKNCIHDALIRSFQIAFSLRGFSLN-GGPLQPSRRRSIFTLATSMIIFSAKA  721

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSG  862
             Y+  PL    K  LTDKT+DPFL+LV +C L+      +  S  YGS +DD AA  +LS 
Sbjct  722   YNIGPLVPCVKVSLTDKTVDPFLKLVRDCKLQAIDIGSSHPSKVYGSIDDDSAALETLSS  781

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LR  1030
             I I++ QS ES A++IV+SL+     + + I EQL  +FLPD++CP+G Q   D    + 
Sbjct  782   INITEDQSKESLAAIIVKSLQNLSDPEASAISEQLQNEFLPDDICPLGAQLYMDTPQKIS  841

Query  1031  NHNQSDDKTNDEVVDPTFTVDDLGS------HSDPNAHPDSTPNLLDVNEFLDSVLETSN  1192
                  D    DE++ P FT D   S       + PN     T +LL VNE LDSVL+T+ 
Sbjct  842   QLGSKDGCPLDEMMHPIFTEDGFISPITFERQNGPNLQLSETADLLSVNELLDSVLDTAR  901

Query  1193  QVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF---------------REDGNDEPDF  1327
             QVGR S +    + + + A  CE   +GK  +++                 +D N+    
Sbjct  902   QVGRFSVSTTPDVPYTETALHCETLLKGKQKKLSTFTTAQQKLENLISISVQDHNEAKTI  961

Query  1328  -NFSEETIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNF  1501
              + S   +  P +GNPF D++ +A   +      P  CA EYQ H +F +LPASSPYDNF
Sbjct  962   SSHSHVDMGLPLTGNPFLDHDLSAKGCKSSVGTTPMLCAVEYQHHSNF-RLPASSPYDNF  1020

Query  1502  LKAAGS  1519
             LKAAG 
Sbjct  1021  LKAAGC  1026



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   405 bits (1040),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 256/552 (46%), Positives = 338/552 (61%), Gaps = 50/552 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCPR + A   L K++ +QR
Sbjct  479   QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPRPSSASVGLYKKQDLQR  538

Query  182   TLSRTVSVFSSSAALFDKLGKN-----QSSGKDGMD---------QNTQN--MLNRLTST  313
             TLSR VSVFSSSAALF KL ++     +S+ +D +D         QN+ N   L +L S+
Sbjct  539   TLSRAVSVFSSSAALFGKLRRDVFSLRESTCQDNVDKVSNSDDGQQNSSNDAKLYKLQSS  598

Query  314   YSRSLSVKPGS-----EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
              SR  SVK  S     EE  N   +P    + +SL++ SRQI+++LSS++ QA+S  NTP
Sbjct  599   QSRMRSVKGTSLPSISEE--NFSSSPYREKDPISLRLSSRQITLILSSLWAQAMSLENTP  656

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             E++EAIAHTY L +LFSR K S +E L+R FQLAFSLR+ISL     MPPSRRRSLF LA
Sbjct  657   ENYEAIAHTYCLALLFSRAKNSFNEVLVRSFQLAFSLRNISLRGDGTMPPSRRRSLFTLA  716

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNP-NPKARASYGSKED  832
             TSMI+F +K ++ +PL   AK+ LT+KT+DP+L+LV++C L+ VN    +    YG KED
Sbjct  717   TSMIVFSAKAFNIVPLIPIAKSSLTEKTVDPYLRLVEDCKLQAVNTVTEQLTKVYGLKED  776

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D AA  SLS + I + QSTES  S+IV SL+ S+  + + I+ QLL DF  D+VCP+G  
Sbjct  777   DNAALESLSALAIMENQSTESMVSVIVNSLEDSLRSELSAIRMQLLDDFSSDDVCPLGAL  836

Query  1013  RINDLRNHNQSDDKTN---DEVVDPTFTVDD------LGSHSDPNAHPDSTPNLLDVNEF  1165
              +           KTN    EV+ P F +DD        S +D  ++     N+L VN+ 
Sbjct  837   FMELPGQSISFGSKTNSISQEVMPPAFAIDDDIFTEASDSPADYKSNLSRDTNILSVNQL  896

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNF----  1333
             LDS+LET+ +VGR S +  A + F ++ASQCEA   GK  +++       + +       
Sbjct  897   LDSILETATEVGRLSVSSTADVPFKEMASQCEALLVGKQRKLSVFTSARQQQEIFLSGLS  956

Query  1334  ---------SEETIWQPPS-GNPF-ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
                      S   I Q  + G+PF  + N  A    V       C TEYQ  P F +LPA
Sbjct  957   QDDNRMKHSSHLCIGQLQTVGSPFDHEQNFNAYACTVTTTTTLLCPTEYQWQPQF-RLPA  1015

Query  1481  SSPYDNFLKAAG  1516
             SSP+DNFLKA G
Sbjct  1016  SSPFDNFLKAVG  1027



>ref|XP_004136123.1| PREDICTED: uncharacterized protein LOC101211879 [Cucumis sativus]
Length=1054

 Score =   403 bits (1036),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 258/590 (44%), Positives = 339/590 (57%), Gaps = 93/590 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  472   QDKAFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPRASIPHTTKPAYIQR  531

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG----MDQ------------------------  277
             TLSRTVSVFSSSAALF K+     S ++     MD+                        
Sbjct  532   TLSRTVSVFSSSAALFQKVKVEHYSVQENIILKMDEKPIIQQVTKIESDPILTRLKSSYS  591

Query  278   ------------------------NTQNMLNRLTSTYSR--SLSVKPGSEETPNNGENPQ  379
                                     N   +LNRL S+YSR  SL V P S           
Sbjct  592   RVYTVKKNPSIRATGSIIEEDSMVNNNTVLNRLKSSYSRAYSLKVYPSSVVADEKPLGSS  651

Query  380   EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESL  559
             E+   + L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+R+K SSHE+L
Sbjct  652   ENEPTMFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARSKHSSHETL  711

Query  560   IRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDK  739
             IR FQLAFSLRSI+L+   K+ PSRRRSLF LATSMIIF SK Y+ +PL   AKA LT++
Sbjct  712   IRSFQLAFSLRSIALA-GGKLQPSRRRSLFTLATSMIIFTSKAYNIVPLVPCAKAALTNE  770

Query  740   TMDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASM  907
             T+DPF++L ++C L+V      NPK    YGSKED+E A +SLS ++ S+ QS ESFA +
Sbjct  771   TVDPFVKLAEDCKLQVVNLGQDNPK--QIYGSKEDNENAVKSLSAVDTSESQSKESFAKL  828

Query  908   IVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVDPT  1081
             ++++L+    ++ + IKEQLLQDFLPD+VCP+GTQ         Q   K +   E+V   
Sbjct  829   VLQTLENKSENELSSIKEQLLQDFLPDDVCPLGTQFFVTPGEIYQCGPKNDGALEMVGNV  888

Query  1082  FTVDDLGSHSDPNAH-PDSTPNLLDVNEFLDSVLETSNQVGRQSAAP-PAGMTFMDVASQ  1255
                ++  S SD     P  +P L+  +E +  V   SNQVG+   +  P  + + ++A  
Sbjct  889   NLCEEPQSQSDLEIEKPMRSPTLMSADELMKLVSTISNQVGKTPGSSFPVNLPYKEMAGN  948

Query  1256  CEAFQEGKGNRMNF----------RED------GN----DEPD---FNFSEETIWQPPSG  1366
             CEA  EGK  +++           R D      GN    +EP      FS  T     SG
Sbjct  949   CEALLEGKPEKVSSFTSSQPSEGQRSDKTSMHGGNNQEKEEPSRRRVRFSVNT-----SG  1003

Query  1367  NPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             NPF D++     +      P  C+ E Q++P   QLP+SSPYDNFLKAAG
Sbjct  1004  NPFVDSDFPTKRRSSMDILPRVCSIEVQQYPHLFQLPSSSPYDNFLKAAG  1053



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   402 bits (1034),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 254/552 (46%), Positives = 336/552 (61%), Gaps = 49/552 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+ AHR+FSVVLVPSSVCP  +       K + + R
Sbjct  486   QNKAFPEALFHQLLPAMVHPDHETRVAAHRIFSVVLVPSSVCPCPSSVISESKKGQDLPR  545

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN--------TQN----MLNRLTSTYSRS  325
             TLSRTVSVFSSSAALF+KL   +   +D   Q+        T+N    ML+RL STYSR+
Sbjct  546   TLSRTVSVFSSSAALFEKLRNEKILSRDHAPQDDKENSEGDTRNDNIGMLSRLKSTYSRA  605

Query  326   LSVKPGSEETPNNGENP----QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              S +  S    N   NP     +  E + L++ SRQI++LLSSI+ Q+IS  N PE+FEA
Sbjct  606   YSSRNPSVLL-NTDSNPVSKLNKELEAVPLRLSSRQITLLLSSIWAQSISPANMPENFEA  664

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K SS+E+L+R FQLAFSLR ISL E   +PPSRRRSLF L+TSMII
Sbjct  665   IAHTYSLVLLFSRAKNSSNEALVRSFQLAFSLRDISLKEGGPLPPSRRRSLFTLSTSMII  724

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEAAK  847
             F S  Y  +PL   AK  LT++T DPFL+LV++  L+ V+   + + + YGS EDD AA 
Sbjct  725   FSSIAYGIVPLVHCAKIALTERTADPFLKLVEDRKLQAVDTGSRHQMNVYGSTEDDAAAL  784

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             +SLS I+ ++ Q  ES AS+I+++L      + + ++EQLL +F PD+VCP+G+Q   D 
Sbjct  785   KSLSHIQFTEDQRRESCASVILKTLGSLPEPELSTVREQLLSEFFPDDVCPLGSQSFTDS  844

Query  1028  ---------RNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST--PNLLDVNEFLDS  1174
                      R     DD     V D  F  D   S +  N    +   PNLL +++ L+S
Sbjct  845   PSKIYQLESRMSESHDDPPLLPVEDDAFA-DSFESQTTQNLEDIAVGGPNLLSIDQLLES  903

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN----------------FRED  1306
             VLET++QVGR S +    + + +VA  CEA   GK  +M+                 +++
Sbjct  904   VLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSNLMSIQQKHESLRNLTLQKN  963

Query  1307  GNDEPDFNFSEETIWQPPS-GNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
              +     +F  E   Q    GNPF DN+  A   +P        C+TEYQ +PSF +LPA
Sbjct  964   NDVMTGSHFPAEMGTQNHRVGNPFLDNDHNANMQKPPVGTTALLCSTEYQHNPSFFRLPA  1023

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  1024  SSPYDNFLKAAG  1035



>ref|XP_008784322.1| PREDICTED: uncharacterized protein LOC103703292 isoform X4 [Phoenix 
dactylifera]
Length=936

 Score =   399 bits (1024),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 256/558 (46%), Positives = 338/558 (61%), Gaps = 56/558 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCPR + A   L K++ +QR
Sbjct  381   QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPRPSSASVGLYKKQDLQR  440

Query  182   TLSRTVSVFSSSAALFDKLGKN-----QSSGKDGMD---------QNTQN--MLNRLTST  313
             TLSR VSVFSSSAALF KL ++     +S+ +D +D         QN+ N   L +L S+
Sbjct  441   TLSRAVSVFSSSAALFGKLRRDVFSLRESTCQDNVDKVSNSDDGQQNSSNDAKLYKLQSS  500

Query  314   YSRSLSVKPGS-----EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
              SR  SVK  S     EE  N   +P    + +SL++ SRQI+++LSS++ QA+S  NTP
Sbjct  501   QSRMRSVKGTSLPSISEE--NFSSSPYREKDPISLRLSSRQITLILSSLWAQAMSLENTP  558

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             E++EAIAHTY L +LFSR K S +E L+R FQLAFSLR+ISL     MPPSRRRSLF LA
Sbjct  559   ENYEAIAHTYCLALLFSRAKNSFNEVLVRSFQLAFSLRNISLRGDGTMPPSRRRSLFTLA  618

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKT------MDPFLQLVDECHLK-VNP-NPKARAS  814
             TSMI+F +K ++ +PL   AK+ LT+KT      +DP+L+LV++C L+ VN    +    
Sbjct  619   TSMIVFSAKAFNIVPLIPIAKSSLTEKTDVATHQVDPYLRLVEDCKLQAVNTVTEQLTKV  678

Query  815   YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEV  994
             YG KEDD AA  SLS + I + QSTES  S+IV SL+ S+  + + I+ QLL DF  D+V
Sbjct  679   YGLKEDDNAALESLSALAIMENQSTESMVSVIVNSLEDSLRSELSAIRMQLLDDFSSDDV  738

Query  995   CPMGTQRINDLRNHNQSDDKTN---DEVVDPTFTVDD------LGSHSDPNAHPDSTPNL  1147
             CP+G   +           KTN    EV+ P F +DD        S +D  ++     N+
Sbjct  739   CPLGALFMELPGQSISFGSKTNSISQEVMPPAFAIDDDIFTEASDSPADYKSNLSRDTNI  798

Query  1148  LDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF  1327
             L VN+ LDS+LET+ +VGR S +  A + F ++ASQCEA   GK  +++       + + 
Sbjct  799   LSVNQLLDSILETATEVGRLSVSSTADVPFKEMASQCEALLVGKQRKLSVFTSARQQQEI  858

Query  1328  NF-------------SEETIWQPPS-GNPF-ADNNTaaagqpvnaaapaSCATEYQRHPS  1462
                            S   I Q  + G+PF  + N  A    V       C TEYQ  P 
Sbjct  859   FLSGLSQDDNRMKHSSHLCIGQLQTVGSPFDHEQNFNAYACTVTTTTTLLCPTEYQWQPQ  918

Query  1463  FMQLPASSPYDNFLKAAG  1516
             F +LPASSP+DNFLKA G
Sbjct  919   F-RLPASSPFDNFLKAVG  935



>gb|KDP43492.1| hypothetical protein JCGZ_16779 [Jatropha curcas]
Length=545

 Score =   387 bits (993),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 248/556 (45%), Positives = 338/556 (61%), Gaps = 79/556 (14%)
 Frame = +2

Query  50    MVSPDNETRLGAHRVFSVVLVPSSVCPR----------------QAPAGGALSKRKS-IQ  178
             MV  D+ETR+GAHR+FS+VLVPSSVCPR                 A A   +  R + +Q
Sbjct  1     MVYDDHETRVGAHRIFSIVLVPSSVCPRGPAAPTAAAVAASFTVSASASVPIPSRPTNMQ  60

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKD--------------GMDQNTQNMLNRLTSTY  316
             R LSRTVSVFSSSAALF+KL K ++S ++              G   N  +MLNRL S+Y
Sbjct  61    RMLSRTVSVFSSSAALFEKLKKEENSSQENSCEDRKEKITPNEGPTANNPSMLNRLKSSY  120

Query  317   SRSLSVK---------PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHL  469
             SR+ SVK           ++ETP +  N ++    +SL++ SRQI++LLSSI+ Q++S L
Sbjct  121   SRAYSVKRTQQPVAVTVTADETPISKLNKEQI---ISLRLSSRQITLLLSSIWAQSLSPL  177

Query  470   NTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLF  649
             NTP ++EAIAH+YSL++LF+RTK SS+E+LIR FQLAFSLR  +L     + PSRRRSLF
Sbjct  178   NTPVNYEAIAHSYSLVLLFARTKNSSNETLIRSFQLAFSLRGFALG-GGPLQPSRRRSLF  236

Query  650   ALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA-RASYGSK  826
              L+TSMIIF SK ++ +PL   A+A +TDKT+DPFL+LVDEC L+   NP   R  YGSK
Sbjct  237   ILSTSMIIFSSKAFNILPLVSCARATITDKTVDPFLKLVDECKLQAVINPTGPRKVYGSK  296

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             ED+E A +SL+ IEI+  Q+ ESFA+MI +   KS + + + +KEQLL+DF+PD+VCP+G
Sbjct  297   EDNEDALKSLAAIEITDSQTKESFANMIAKFTGKS-SKQDSALKEQLLKDFVPDDVCPLG  355

Query  1007  T---QRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST----------PNL  1147
                   I + R+   S+ K +++     F+++D    + PNA               P L
Sbjct  356   ADLFMEILEERSEPVSEHKGSEKAEPLLFSLED----NLPNATEGQNNSGLLLGPELPVL  411

Query  1148  LDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF  1327
             L V E L +V ET+ QVGR SA+ P  M + ++A QCEA   GK  +M+      ++ + 
Sbjct  412   LSVGELLTAVSETTYQVGRFSASTPNDMPYKEMAGQCEALTAGKQKKMSDLMSSQEKQE-  470

Query  1328  NFSEETIW------QPP-------SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFM  1468
             N  + + +      Q P       SGNPF D N      P +      CA+E+Q H  F 
Sbjct  471   NMVKVSAYEYNQGKQMPSNSQFQQSGNPFLDENFNTQFNPASTGLLL-CASEFQYHQQF-  528

Query  1469  QLPASSPYDNFLKAAG  1516
             QLPASSPYDNFL+AAG
Sbjct  529   QLPASSPYDNFLRAAG  544



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   399 bits (1025),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 252/538 (47%), Positives = 346/538 (64%), Gaps = 38/538 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK+FPE LFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV PR +      +K   + R
Sbjct  489   QNKSFPETLFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPRPSSTNPGSNKGSDLSR  548

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN-----------MLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL ++++S ++ + Q+ +N           +L RL S+ SR  
Sbjct  549   TLSRTVSVFSSSAALFDKLRRDKTSTRENVCQDDKNNVLEGEQINNGILARLKSSTSRVH  608

Query  329   SVK-----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             S+K       S+E P N  N +   E +SL++ SRQIS+LLSSI+ Q+IS  NTP+++EA
Sbjct  609   SMKNPNVPSTSDENPVNILNKET--EVVSLRLSSRQISLLLSSIWTQSISPANTPQNYEA  666

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSRTK SS E+LIR FQLAFSLR+I+L ++  + PSRRRSLF LATSMI+
Sbjct  667   IAHTYSLVLLFSRTKNSSDEALIRSFQLAFSLRNIALKQEESLSPSRRRSLFTLATSMIL  726

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAK  847
             F SKT++ IPL    KA+LT+K +DPFL+LV++  L+         +  YGSK+DD +A 
Sbjct  727   FSSKTFNIIPLIYCTKAVLTEKMVDPFLRLVEDRKLEAVTTDSGHPAIVYGSKDDDSSAL  786

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             +SLS I+++  QS E FA+ I +SL      + +  +E+LL +FLPD+VCP+G Q   D 
Sbjct  787   KSLSEIDVTGNQSREFFAAEIAKSLANLANSQVSAKREKLLDEFLPDDVCPLGAQLFMDT  846

Query  1028  RNHNQSDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDST------PNLLDVNEFLDSVLE  1183
              N     +  ++ +V+  P FTVDD+   S       +T       NLL VN+ L+SVLE
Sbjct  847   PNQIDQVNSKDNSLVEGTPLFTVDDVFLDSSEGQTTQTTEIVFCDANLLSVNQLLESVLE  906

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDGNDEPDFNFSEET  1345
             T++QVGR S   P  +++ ++A  CE  Q GK  +M+       R++      F   ++ 
Sbjct  907   TTHQVGRLSVTAP-DVSYKEMAHHCETLQMGKQQKMSHVMSVQLRQESLMNVPFQKYDDK  965

Query  1346  IWQPPSGNPFADNNTaaa-gqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             + +  + NPF D N  A+   P        C TEYQR P+F +LPASSP+DNFLKAAG
Sbjct  966   VRK--ATNPFLDQNLIASPQIPPIGTVQMQCVTEYQRQPNFFRLPASSPFDNFLKAAG  1021



>ref|XP_008443203.1| PREDICTED: uncharacterized protein LOC103486854 isoform X3 [Cucumis 
melo]
Length=888

 Score =   395 bits (1015),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 327/537 (61%), Gaps = 50/537 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+LLAMV PD+ETR+ AHR+FSVVLVPSSVCPR   +         + R
Sbjct  369   QNKAFPEALFYQLLLAMVHPDHETRVAAHRIFSVVLVPSSVCPRPFSSDLESIAPSDLPR  428

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSG--------KDG------MDQNTQNMLNRLTSTYS  319
             TLSR VSVFSSSAALF KL   ++S         KDG       +  +  ML+RL S+YS
Sbjct  429   TLSRAVSVFSSSAALFQKLRNEKASSLENGLPDMKDGSLLDGEQESISNGMLSRLKSSYS  488

Query  320   RSLSVKPG----SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             R+ S++      ++ T  +G + +   E  SL++ SRQI++LLSSIFVQ+IS  N PE++
Sbjct  489   RAYSIRSSGPLRTDATTTDGLSKEP--ETYSLRLSSRQITLLLSSIFVQSISSANFPENY  546

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             E IAHTYSL++LFSR K SSHE L+R FQLAFSLR ISL ++  +PPSR RSLF LATSM
Sbjct  547   EGIAHTYSLILLFSRAKNSSHEVLVRSFQLAFSLRDISLCKKGSLPPSRCRSLFTLATSM  606

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEA  841
             I+F SK ++ +PL     A+   +  DPFL+LV++C L+ V      + S YGSKEDD+ 
Sbjct  607   ILFSSKAFNILPLVDRTMAIFVSRKADPFLRLVEDCKLQAVTIQSDIKTSPYGSKEDDDL  666

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             A + LS +EI++ Q+ ESF + I++SL      + + IKEQLL +FLPD++CP+G     
Sbjct  667   ASKFLSEVEITEDQTRESFVTEILKSLDILSDSQFSSIKEQLLSEFLPDDMCPLG-----  721

Query  1022  DLRNHNQSDDKTNDEV-----VDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                  NQ  +KT+++      +D     D   S +  +        LL VN+FL+SVLET
Sbjct  722   -----NQLSEKTSNKSAHFFNIDEESFADSFESQTKDSQELHFVIPLLSVNQFLESVLET  776

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIW-----  1351
             ++QVGR S +  A + F ++A  CE    GK  +M+       +      +ET+      
Sbjct  777   THQVGRISISTTADVPFKEMAQHCELLLMGKQQKMSSLLCSQQK------QETVMLVSLQ  830

Query  1352  --QPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               +   GNPF ++ TA   +P        C TEYQ      +LPASSPYDNFLKAAG
Sbjct  831   NQENEVGNPFIEHFTANPHRPPLGPIVTPCVTEYQCQTHSFRLPASSPYDNFLKAAG  887



>ref|XP_008443202.1| PREDICTED: uncharacterized protein LOC103486854 isoform X2 [Cucumis 
melo]
Length=902

 Score =   395 bits (1016),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 327/537 (61%), Gaps = 50/537 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+LLAMV PD+ETR+ AHR+FSVVLVPSSVCPR   +         + R
Sbjct  383   QNKAFPEALFYQLLLAMVHPDHETRVAAHRIFSVVLVPSSVCPRPFSSDLESIAPSDLPR  442

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSG--------KDG------MDQNTQNMLNRLTSTYS  319
             TLSR VSVFSSSAALF KL   ++S         KDG       +  +  ML+RL S+YS
Sbjct  443   TLSRAVSVFSSSAALFQKLRNEKASSLENGLPDMKDGSLLDGEQESISNGMLSRLKSSYS  502

Query  320   RSLSVKPG----SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             R+ S++      ++ T  +G + +   E  SL++ SRQI++LLSSIFVQ+IS  N PE++
Sbjct  503   RAYSIRSSGPLRTDATTTDGLSKEP--ETYSLRLSSRQITLLLSSIFVQSISSANFPENY  560

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             E IAHTYSL++LFSR K SSHE L+R FQLAFSLR ISL ++  +PPSR RSLF LATSM
Sbjct  561   EGIAHTYSLILLFSRAKNSSHEVLVRSFQLAFSLRDISLCKKGSLPPSRCRSLFTLATSM  620

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEA  841
             I+F SK ++ +PL     A+   +  DPFL+LV++C L+ V      + S YGSKEDD+ 
Sbjct  621   ILFSSKAFNILPLVDRTMAIFVSRKADPFLRLVEDCKLQAVTIQSDIKTSPYGSKEDDDL  680

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             A + LS +EI++ Q+ ESF + I++SL      + + IKEQLL +FLPD++CP+G     
Sbjct  681   ASKFLSEVEITEDQTRESFVTEILKSLDILSDSQFSSIKEQLLSEFLPDDMCPLG-----  735

Query  1022  DLRNHNQSDDKTNDEV-----VDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                  NQ  +KT+++      +D     D   S +  +        LL VN+FL+SVLET
Sbjct  736   -----NQLSEKTSNKSAHFFNIDEESFADSFESQTKDSQELHFVIPLLSVNQFLESVLET  790

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIW-----  1351
             ++QVGR S +  A + F ++A  CE    GK  +M+       +      +ET+      
Sbjct  791   THQVGRISISTTADVPFKEMAQHCELLLMGKQQKMSSLLCSQQK------QETVMLVSLQ  844

Query  1352  --QPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               +   GNPF ++ TA   +P        C TEYQ      +LPASSPYDNFLKAAG
Sbjct  845   NQENEVGNPFIEHFTANPHRPPLGPIVTPCVTEYQCQTHSFRLPASSPYDNFLKAAG  901



>ref|XP_008461316.1| PREDICTED: uncharacterized protein LOC103499940 isoform X3 [Cucumis 
melo]
Length=900

 Score =   395 bits (1014),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 251/589 (43%), Positives = 338/589 (57%), Gaps = 92/589 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  319   QDKAFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPRASIPQTTKPAYIQR  378

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG----MDQ------------------------  277
             TLSRTVSVFSSSAALF K+     S ++     MD+                        
Sbjct  379   TLSRTVSVFSSSAALFQKVKVEHYSVQENIILKMDEKPIIQQVTKIESDPILTRLKSSYS  438

Query  278   -----------------------NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQE  382
                                    N   +LNRL S+YSR+ SVK  P S           E
Sbjct  439   RVYTVKKDPSIRATGSIREEPMVNNNTVLNRLKSSYSRAYSVKVYPPSVVADEKPLGSSE  498

Query  383   HHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLI  562
             +   + L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+R+K SSHE+LI
Sbjct  499   NEPTMFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARSKHSSHETLI  558

Query  563   RGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKT  742
             R FQLAFSLRSI+L+   ++ PSRRRSLF LATSMIIF SK Y+ +PL   AKA LT++T
Sbjct  559   RSFQLAFSLRSIALA-GGQLQPSRRRSLFTLATSMIIFTSKAYNIVPLVPHAKAALTNET  617

Query  743   MDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMI  910
             +DPF++LV++C L+V      NPK    YGSKED+E A +SLS ++ S+ QS ESFA ++
Sbjct  618   VDPFVKLVEDCKLQVVNLGQDNPKQ--IYGSKEDNENAVKSLSAVDTSESQSKESFAKLV  675

Query  911   VESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVDPTF  1084
             +++L+    ++ + I++QLLQDFLPD+ CP+GTQ         Q   K +   E+V    
Sbjct  676   LQTLENKSENELSSIRKQLLQDFLPDDACPLGTQFFVTPGEIYQCGPKNDGTLEMVGSVN  735

Query  1085  TVDDLGSHSDPNAH-PDSTPNLLDVNEFLDSVLETSNQVGRQSAAP-PAGMTFMDVASQC  1258
               ++  S +D     P  +P L+  +E +  V   S++VGR S +  P  + + ++A  C
Sbjct  736   LCEEPQSQNDLEIEKPLRSPTLMSADELMKLVSSISSKVGRTSGSSFPVNLPYKEMAGNC  795

Query  1259  EAFQEGKGNRMNF----------------REDGN----DEPD---FNFSEETIWQPPSGN  1369
             EA  EGK  +++                    GN    +EP      FS        SGN
Sbjct  796   EALLEGKPEKVSSFTSSQPSEGQRSGRTSTHGGNNQEKEEPSRRRVRFSVNI-----SGN  850

Query  1370  PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             PF D++     +      P  C+ E Q++P   QLP+SSPYDNFLKAAG
Sbjct  851   PFVDSDFPRNRRSSMDILPRLCSVEVQQYPHLFQLPSSSPYDNFLKAAG  899



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   397 bits (1021),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 256/558 (46%), Positives = 338/558 (61%), Gaps = 56/558 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCPR + A   L K++ +QR
Sbjct  479   QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPRPSSASVGLYKKQDLQR  538

Query  182   TLSRTVSVFSSSAALFDKLGKN-----QSSGKDGMD---------QNTQN--MLNRLTST  313
             TLSR VSVFSSSAALF KL ++     +S+ +D +D         QN+ N   L +L S+
Sbjct  539   TLSRAVSVFSSSAALFGKLRRDVFSLRESTCQDNVDKVSNSDDGQQNSSNDAKLYKLQSS  598

Query  314   YSRSLSVKPGS-----EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
              SR  SVK  S     EE  N   +P    + +SL++ SRQI+++LSS++ QA+S  NTP
Sbjct  599   QSRMRSVKGTSLPSISEE--NFSSSPYREKDPISLRLSSRQITLILSSLWAQAMSLENTP  656

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             E++EAIAHTY L +LFSR K S +E L+R FQLAFSLR+ISL     MPPSRRRSLF LA
Sbjct  657   ENYEAIAHTYCLALLFSRAKNSFNEVLVRSFQLAFSLRNISLRGDGTMPPSRRRSLFTLA  716

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKT------MDPFLQLVDECHLK-VNP-NPKARAS  814
             TSMI+F +K ++ +PL   AK+ LT+KT      +DP+L+LV++C L+ VN    +    
Sbjct  717   TSMIVFSAKAFNIVPLIPIAKSSLTEKTDVATHQVDPYLRLVEDCKLQAVNTVTEQLTKV  776

Query  815   YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEV  994
             YG KEDD AA  SLS + I + QSTES  S+IV SL+ S+  + + I+ QLL DF  D+V
Sbjct  777   YGLKEDDNAALESLSALAIMENQSTESMVSVIVNSLEDSLRSELSAIRMQLLDDFSSDDV  836

Query  995   CPMGTQRINDLRNHNQSDDKTN---DEVVDPTFTVDD------LGSHSDPNAHPDSTPNL  1147
             CP+G   +           KTN    EV+ P F +DD        S +D  ++     N+
Sbjct  837   CPLGALFMELPGQSISFGSKTNSISQEVMPPAFAIDDDIFTEASDSPADYKSNLSRDTNI  896

Query  1148  LDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF  1327
             L VN+ LDS+LET+ +VGR S +  A + F ++ASQCEA   GK  +++       + + 
Sbjct  897   LSVNQLLDSILETATEVGRLSVSSTADVPFKEMASQCEALLVGKQRKLSVFTSARQQQEI  956

Query  1328  NF-------------SEETIWQPPS-GNPF-ADNNTaaagqpvnaaapaSCATEYQRHPS  1462
                            S   I Q  + G+PF  + N  A    V       C TEYQ  P 
Sbjct  957   FLSGLSQDDNRMKHSSHLCIGQLQTVGSPFDHEQNFNAYACTVTTTTTLLCPTEYQWQPQ  1016

Query  1463  FMQLPASSPYDNFLKAAG  1516
             F +LPASSP+DNFLKA G
Sbjct  1017  F-RLPASSPFDNFLKAVG  1033



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   397 bits (1021),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 245/540 (45%), Positives = 332/540 (61%), Gaps = 39/540 (7%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP+ +       K   I RT
Sbjct  486   NKAFPEALFHQLLPAMVHPDHETRIGAHRIFSVVLVPSSVCPQPSSVSPVTIKGSGIPRT  545

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDG--------------MDQNTQNMLNRLTSTYSR  322
             LSRTVSVFSSSAALF+KL K++S  ++               +  +   +LNRL S+YSR
Sbjct  546   LSRTVSVFSSSAALFEKLRKDKSFARENACLENKGNIDSEVELKNSNNGILNRLKSSYSR  605

Query  323   SLSVKPGSEETPNNGE---NPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             + S +      P +G    N  +  E  SL++ S QIS+LLSSI+ Q+IS  NTP+++EA
Sbjct  606   TYSSRSPPIPLPMDGNPLSNSNKQSEANSLRLSSTQISLLLSSIWAQSISPENTPQNYEA  665

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K S +++L+R FQLAFSLRSISL+E   +PPSRRRSLF LATSMI+
Sbjct  666   IAHTYSLVLLFSRAKNSGNKALVRSFQLAFSLRSISLNEGGPLPPSRRRSLFTLATSMIL  725

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAK  847
             F SK +S +P+   AK  LT++ +DPF++LV++  L+ VN    +    YGSKEDD  A 
Sbjct  726   FSSKAFSIVPIVYCAKVALTERMVDPFMRLVEDRKLEAVNAGSDQPTNVYGSKEDDNLAL  785

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
             ++LS I+I+ +Q  E+ AS I++SL      + +  + QLL +FLPD+VCP+G Q   D 
Sbjct  786   KTLSQIQITPEQRRETLASEILKSLGNLSEPELSTTRAQLLNEFLPDDVCPLGVQLPMDA  845

Query  1025  ---LRNHNQSDDKTNDEVVDPTFTVDDL-------GSHSDPNAHPDSTPNLLDVNEFLDS  1174
                +   +  D+K+  E   P F+ D+        G   D +  P   PNLLDVN+ L+S
Sbjct  846   PHKVYQVDVGDNKSIKEEA-PIFSTDNYAFPEPFEGQTKDNSELPVEIPNLLDVNQLLES  904

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDGNDEPDFNFS  1336
             VLET++Q GR S +    M++ ++A  CEA   GK  +M+       R++      F   
Sbjct  905   VLETAHQFGRSSISTGPDMSYKEMAHHCEALLTGKQKKMSDLMSAQLRQESLISLSFQHP  964

Query  1337  EETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +    Q  +G       +    +      P  CATEYQ HP   +LPASSPYDNFLKAAG
Sbjct  965   DNETKQ--AGPVLEQTGSPNPYKQSVGTLPMLCATEYQNHPLSFRLPASSPYDNFLKAAG  1022



>ref|XP_010927191.1| PREDICTED: uncharacterized protein LOC105049285 [Elaeis guineensis]
Length=955

 Score =   395 bits (1015),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 252/564 (45%), Positives = 338/564 (60%), Gaps = 59/564 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV PD ETR+GAHR+FSVVLVPSSVCP    A     K   ++R
Sbjct  391   QNKAFPEALFHQLLLAMVHPDQETRVGAHRIFSVVLVPSSVCPYPCSATPESLKTYDLRR  450

Query  182   TLSRTVSVFSSSAALFDKLGKNQS----SGKDGMDQNTQNMLNR-----------LTSTY  316
             TLSRTVSVFSSSAALF+KL +  S    + ++ +D+N+   + +           L S+ 
Sbjct  451   TLSRTVSVFSSSAALFEKLREKYSLRDNACQESLDKNSHGYIGQQKSSNEANLYTLRSSK  510

Query  317   SRSLSVK--------------PGSEETPNNGE----NPQEHHEGLSLKMKSRQISMLLSS  442
             SR+ SVK               GS      G+    N ++  + +SL++ SRQI+++LSS
Sbjct  511   SRNHSVKGARLQSFRSRVFSTKGSPLPVTEGKASMNNAKKEVDPVSLRLSSRQITLMLSS  570

Query  443   IFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKM  622
             I+ QA S  NTPE++EAIAH+YSL++LFSR K   HE+LIR FQLAFSLRSISL     +
Sbjct  571   IWAQANSPENTPENYEAIAHSYSLILLFSRAKTPIHEALIRSFQLAFSLRSISLGGGGSL  630

Query  623   PPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP  799
             PPSRRRSLF LAT+MI+F SK ++  PL    K+ L  KT+DPFLQLV++  L+ VN   
Sbjct  631   PPSRRRSLFMLATAMIVFSSKAFNIQPLIPLIKSSLNQKTVDPFLQLVEDSKLQAVNTTS  690

Query  800   KARAS-YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQD  976
                   YGSKEDD +A  SLS +E+++ QS ES  S+I+ SL  S   +   I++QLL D
Sbjct  691   DHLVKVYGSKEDDNSALISLSAVELTENQSKESMVSVILNSLGDSSDTELLTIRKQLLSD  750

Query  977   FLPDEVCPMGTQRI---NDLRNHNQSDDKTNDEVVDPTFTVD-DLGSHS-----DPNAH-  1126
             FLPD+VCP+G Q +     +       D + +EV+ PT  +D D+ + +     DP+   
Sbjct  751   FLPDDVCPLGAQFVETPGQVPPFGSKKDNSQEEVMPPTSLIDVDVFAEAFEGLVDPSPQL  810

Query  1127  PDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN----  1294
             P  T NLL VN+ LD+ LETS Q GR S +  A + F ++AS CEA   GK  +M+    
Sbjct  811   PTDTSNLLSVNQLLDTALETSWQDGRFSVSTTADVPFKEMASHCEALLMGKQQKMSAFMS  870

Query  1295  --------FREDGNDEPDFNFSEETIWQ--PPSGNPFADNNTaaagqpvnaaapaSCATE  1444
                     F +  +D+ D   S          +GNPF D N +A  Q ++         +
Sbjct  871   AQQKQEILFPDLLHDQRDMKGSSYLYMDQFQKTGNPFLDPNLSAYPQNMSDGNNILLQND  930

Query  1445  YQRHPSFMQLPASSPYDNFLKAAG  1516
              Q HP F +LPA+SP+DNFL+AAG
Sbjct  931   LQYHPQFFRLPATSPFDNFLRAAG  954



>ref|XP_004136762.1| PREDICTED: uncharacterized protein LOC101210251 [Cucumis sativus]
Length=1002

 Score =   395 bits (1015),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 242/539 (45%), Positives = 328/539 (61%), Gaps = 52/539 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+LLAMV PD+ETR+ AHR+FSVVLVPSSVCPR   +         + R
Sbjct  481   QNKAFPEALFYQLLLAMVHPDHETRVAAHRIFSVVLVPSSVCPRPCSSDLESITPSDLPR  540

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGK-------------DGMDQNTQN-MLNRLTSTYS  319
             TL+R VSVFSSSAALF KL   ++S               DG  ++  N ML+RL S+YS
Sbjct  541   TLTRAVSVFSSSAALFQKLRNEKASSLENGLPDMKDSSLLDGEQESVNNGMLSRLKSSYS  600

Query  320   RSLSVKPG----SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             R+ S++      ++ T  +G + +   E  SL++ SRQI++LLSSIFVQ+IS  N PE++
Sbjct  601   RAYSIRSSGPLRTDATTTDGLSKEP--ETYSLRLSSRQITLLLSSIFVQSISSANLPENY  658

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             E IAHTYSL++LFSR K SSHE L+R FQLAFSLR ISL ++  +PPSR RSLF LATSM
Sbjct  659   EGIAHTYSLILLFSRAKNSSHEVLVRSFQLAFSLRDISLGKKGSLPPSRCRSLFTLATSM  718

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEA  841
             I+F SK ++ +PL    KA+   +  DPFL+LVD+C L+ V      + S YGS+EDD+ 
Sbjct  719   ILFSSKAFNILPLVDRTKAIFVSRMADPFLRLVDDCKLQAVTIQSDIKTSPYGSEEDDDL  778

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             A + LS +EI++ Q+ ES  + I++SL      + + IKEQLL +FLPD++CP+G     
Sbjct  779   ASKFLSEVEITEDQTRESVVTEILKSLDILSDAEFSSIKEQLLSEFLPDDMCPLG-----  833

Query  1022  DLRNHNQSDDKTNDEV-----VDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                  NQ  DKT+++      +D     D + S +  N        LL VN+FL+SVLET
Sbjct  834   -----NQLSDKTSNKSAHFFNIDEESFADSIESQTKDNQELHFVIPLLSVNQFLESVLET  888

Query  1187  SNQVGRQSAAPPAGMT--FMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIW---  1351
             ++QVGR S +    +   F ++A  CE    GK  +M+       +      +ET+    
Sbjct  889   THQVGRISISTTTDVVPPFKEMAQHCELLLMGKQQKMSSLMCSQQK------QETVMLVS  942

Query  1352  ----QPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 +   GNPF ++ TA + +P        C TEYQ      +LPASSPYDNFLKAAG
Sbjct  943   LQNQENEVGNPFIEHFTANSHRPPLGQIVTPCVTEYQCQTHSFRLPASSPYDNFLKAAG  1001



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   394 bits (1013),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 327/537 (61%), Gaps = 50/537 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+LLAMV PD+ETR+ AHR+FSVVLVPSSVCPR   +         + R
Sbjct  484   QNKAFPEALFYQLLLAMVHPDHETRVAAHRIFSVVLVPSSVCPRPFSSDLESIAPSDLPR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSG--------KDG------MDQNTQNMLNRLTSTYS  319
             TLSR VSVFSSSAALF KL   ++S         KDG       +  +  ML+RL S+YS
Sbjct  544   TLSRAVSVFSSSAALFQKLRNEKASSLENGLPDMKDGSLLDGEQESISNGMLSRLKSSYS  603

Query  320   RSLSVKPG----SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             R+ S++      ++ T  +G + +   E  SL++ SRQI++LLSSIFVQ+IS  N PE++
Sbjct  604   RAYSIRSSGPLRTDATTTDGLSKEP--ETYSLRLSSRQITLLLSSIFVQSISSANFPENY  661

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             E IAHTYSL++LFSR K SSHE L+R FQLAFSLR ISL ++  +PPSR RSLF LATSM
Sbjct  662   EGIAHTYSLILLFSRAKNSSHEVLVRSFQLAFSLRDISLCKKGSLPPSRCRSLFTLATSM  721

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEA  841
             I+F SK ++ +PL     A+   +  DPFL+LV++C L+ V      + S YGSKEDD+ 
Sbjct  722   ILFSSKAFNILPLVDRTMAIFVSRKADPFLRLVEDCKLQAVTIQSDIKTSPYGSKEDDDL  781

Query  842   AKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             A + LS +EI++ Q+ ESF + I++SL      + + IKEQLL +FLPD++CP+G     
Sbjct  782   ASKFLSEVEITEDQTRESFVTEILKSLDILSDSQFSSIKEQLLSEFLPDDMCPLG-----  836

Query  1022  DLRNHNQSDDKTNDEV-----VDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                  NQ  +KT+++      +D     D   S +  +        LL VN+FL+SVLET
Sbjct  837   -----NQLSEKTSNKSAHFFNIDEESFADSFESQTKDSQELHFVIPLLSVNQFLESVLET  891

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIW-----  1351
             ++QVGR S +  A + F ++A  CE    GK  +M+       +      +ET+      
Sbjct  892   THQVGRISISTTADVPFKEMAQHCELLLMGKQQKMSSLLCSQQK------QETVMLVSLQ  945

Query  1352  --QPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               +   GNPF ++ TA   +P        C TEYQ      +LPASSPYDNFLKAAG
Sbjct  946   NQENEVGNPFIEHFTANPHRPPLGPIVTPCVTEYQCQTHSFRLPASSPYDNFLKAAG  1002



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   395 bits (1014),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 247/552 (45%), Positives = 331/552 (60%), Gaps = 48/552 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP ++       K  +  R
Sbjct  485   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVCPSRSSPNTESKKALNFPR  544

Query  182   TLSRTVSVFSSSAALFDKLGK-------------NQSSGKDGMDQNTQNMLNRLTSTYSR  322
             TLSRTVSVFSSSAALF+KL +             N+++G +G  ++T N +     +   
Sbjct  545   TLSRTVSVFSSSAALFEKLRREKISSRESICEEDNENTGNEGEQRDTNNGILSRLRSSYS  604

Query  323   SLSVK---PGSEETPNNGENPQEHH-EGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
                     P    T  N  N      E  SL++ S QI++LL SI+ Q+IS  N PE++E
Sbjct  605   RSYSIKSSPAPSATKENSVNSSTKEPEANSLRLSSHQITLLLLSIWAQSISPGNMPENYE  664

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMI  670
             AIAHT SL++LFS+ K S  E L+R FQLAFSLR+ISL+E   +PPSRRRSLF LATSMI
Sbjct  665   AIAHTLSLVVLFSQAKNSRIEVLVRSFQLAFSLRNISLNEGGPLPPSRRRSLFTLATSMI  724

Query  671   IFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAA  844
             +FLSK Y+ + L   AKA+L DK  DPFL LV++  L+ V   P   R  YGS+EDD  A
Sbjct  725   LFLSKAYNIVSLVRRAKAVLVDKIFDPFLHLVEDRKLQAVKTGPDHPRHLYGSEEDDNMA  784

Query  845   KRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND  1024
              +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+VCP+G Q   D
Sbjct  785   LKSLSEINITEEQTKEFFASEVVKSLERLLDAEMSTIREELLSEFLPDDVCPLGAQLCMD  844

Query  1025  ----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPNLLDVNEFLDS  1174
                 L   +  D K+  E   P F++DD    GS      + D    + NLL V++ ++S
Sbjct  845   APQKLYQVDSRDSKSMKEDA-PIFSLDDDSFQGSFDSQKNNLDFSAESHNLLSVSQLIES  903

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF-------NF  1333
             VLET++QVGR S +    + + ++A  CEA   GK  +M+       + ++       N 
Sbjct  904   VLETAHQVGRVSVSNAPDVPYKEMAGHCEALLLGKQQKMSNLMSSQPKQEYLMNQSFQNH  963

Query  1334  SEETIWQPP----------SGNPFADNNTaaag-qpvnaaapaSCATEYQRHPSFMQLPA  1480
             S++  W             SGNPF D+   +    P    AP  C TEYQ HP   +LPA
Sbjct  964   SDDAKWMTSDFLVGFGSHRSGNPFVDDTANSYKPSPSAGHAPMMCVTEYQHHPHSFRLPA  1023

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  1024  SSPYDNFLKAAG  1035



>ref|XP_008461315.1| PREDICTED: uncharacterized protein LOC103499940 isoform X2 [Cucumis 
melo]
Length=1028

 Score =   394 bits (1013),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 251/589 (43%), Positives = 338/589 (57%), Gaps = 92/589 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  447   QDKAFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPRASIPQTTKPAYIQR  506

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG----MDQ------------------------  277
             TLSRTVSVFSSSAALF K+     S ++     MD+                        
Sbjct  507   TLSRTVSVFSSSAALFQKVKVEHYSVQENIILKMDEKPIIQQVTKIESDPILTRLKSSYS  566

Query  278   -----------------------NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQE  382
                                    N   +LNRL S+YSR+ SVK  P S           E
Sbjct  567   RVYTVKKDPSIRATGSIREEPMVNNNTVLNRLKSSYSRAYSVKVYPPSVVADEKPLGSSE  626

Query  383   HHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLI  562
             +   + L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+R+K SSHE+LI
Sbjct  627   NEPTMFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARSKHSSHETLI  686

Query  563   RGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKT  742
             R FQLAFSLRSI+L+   ++ PSRRRSLF LATSMIIF SK Y+ +PL   AKA LT++T
Sbjct  687   RSFQLAFSLRSIALA-GGQLQPSRRRSLFTLATSMIIFTSKAYNIVPLVPHAKAALTNET  745

Query  743   MDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMI  910
             +DPF++LV++C L+V      NPK    YGSKED+E A +SLS ++ S+ QS ESFA ++
Sbjct  746   VDPFVKLVEDCKLQVVNLGQDNPKQ--IYGSKEDNENAVKSLSAVDTSESQSKESFAKLV  803

Query  911   VESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVDPTF  1084
             +++L+    ++ + I++QLLQDFLPD+ CP+GTQ         Q   K +   E+V    
Sbjct  804   LQTLENKSENELSSIRKQLLQDFLPDDACPLGTQFFVTPGEIYQCGPKNDGTLEMVGSVN  863

Query  1085  TVDDLGSHSDPNAH-PDSTPNLLDVNEFLDSVLETSNQVGRQSAAP-PAGMTFMDVASQC  1258
               ++  S +D     P  +P L+  +E +  V   S++VGR S +  P  + + ++A  C
Sbjct  864   LCEEPQSQNDLEIEKPLRSPTLMSADELMKLVSSISSKVGRTSGSSFPVNLPYKEMAGNC  923

Query  1259  EAFQEGKGNRMNF----------------REDGN----DEPD---FNFSEETIWQPPSGN  1369
             EA  EGK  +++                    GN    +EP      FS        SGN
Sbjct  924   EALLEGKPEKVSSFTSSQPSEGQRSGRTSTHGGNNQEKEEPSRRRVRFSVNI-----SGN  978

Query  1370  PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             PF D++     +      P  C+ E Q++P   QLP+SSPYDNFLKAAG
Sbjct  979   PFVDSDFPRNRRSSMDILPRLCSVEVQQYPHLFQLPSSSPYDNFLKAAG  1027



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   395 bits (1014),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 254/561 (45%), Positives = 336/561 (60%), Gaps = 58/561 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+ AHR+FSVVLVPSSVCP  +       K + + R
Sbjct  486   QNKAFPEALFHQLLPAMVHPDHETRVAAHRIFSVVLVPSSVCPCPSSVISESKKGQDLPR  545

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN--------TQN----MLNRLTSTYSRS  325
             TLSRTVSVFSSSAALF+KL   +   +D   Q+        T+N    ML+RL STYSR+
Sbjct  546   TLSRTVSVFSSSAALFEKLRNEKILSRDHAPQDDKENSEGDTRNDNIGMLSRLKSTYSRA  605

Query  326   LSVKPGSEETPNNGENP----QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              S +  S    N   NP     +  E + L++ SRQI++LLSSI+ Q+IS  N PE+FEA
Sbjct  606   YSSRNPSVLL-NTDSNPVSKLNKELEAVPLRLSSRQITLLLSSIWAQSISPANMPENFEA  664

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSE---------QAKMPPSRRRSL  646
             IAHTYSL++LFSR K SS+E+L+R FQLAFSLR ISL E            +PPSRRRSL
Sbjct  665   IAHTYSLVLLFSRAKNSSNEALVRSFQLAFSLRDISLKEGGLAQILHSAGPLPPSRRRSL  724

Query  647   FALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YG  820
             F L+TSMIIF S  Y  +PL   AK  LT++T DPFL+LV++  L+ V+   + + + YG
Sbjct  725   FTLSTSMIIFSSIAYGIVPLVHCAKIALTERTADPFLKLVEDRKLQAVDTGSRHQMNVYG  784

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             S EDD AA +SLS I+ ++ Q  ES AS+I+++L      + + ++EQLL +F PD+VCP
Sbjct  785   STEDDAAALKSLSHIQFTEDQRRESCASVILKTLGSLPEPELSTVREQLLSEFFPDDVCP  844

Query  1001  MGTQRINDL---------RNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST--PNL  1147
             +G+Q   D          R     DD     V D  F  D   S +  N    +   PNL
Sbjct  845   LGSQSFTDSPSKIYQLESRMSESHDDPPLLPVEDDAFA-DSFESQTTQNLEDIAVGGPNL  903

Query  1148  LDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN-----------  1294
             L +++ L+SVLET++QVGR S +    + + +VA  CEA   GK  +M+           
Sbjct  904   LSIDQLLESVLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSNLMSIQQKHES  963

Query  1295  -----FREDGNDEPDFNFSEETIWQPPS-GNPFADNN-TaaagqpvnaaapaSCATEYQR  1453
                   +++ +     +F  E   Q    GNPF DN+  A   +P        C+TEYQ 
Sbjct  964   LRNLTLQKNNDVMTGSHFPAEMGTQNHRVGNPFLDNDHNANMQKPPVGTTALLCSTEYQH  1023

Query  1454  HPSFMQLPASSPYDNFLKAAG  1516
             +PSF +LPASSPYDNFLKAAG
Sbjct  1024  NPSFFRLPASSPYDNFLKAAG  1044



>ref|XP_008461314.1| PREDICTED: uncharacterized protein LOC103499940 isoform X1 [Cucumis 
melo]
Length=1053

 Score =   394 bits (1012),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 251/589 (43%), Positives = 338/589 (57%), Gaps = 92/589 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCPR   +    +K   IQR
Sbjct  472   QDKAFPEALFHQLLLAMVCSDHETRVGAHRIFSVVLVPSSVCPRPRASIPQTTKPAYIQR  531

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG----MDQ------------------------  277
             TLSRTVSVFSSSAALF K+     S ++     MD+                        
Sbjct  532   TLSRTVSVFSSSAALFQKVKVEHYSVQENIILKMDEKPIIQQVTKIESDPILTRLKSSYS  591

Query  278   -----------------------NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQE  382
                                    N   +LNRL S+YSR+ SVK  P S           E
Sbjct  592   RVYTVKKDPSIRATGSIREEPMVNNNTVLNRLKSSYSRAYSVKVYPPSVVADEKPLGSSE  651

Query  383   HHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLI  562
             +   + L++ SRQI+ LLSSI+ Q+IS LN PE++EAIAHTY L++LF+R+K SSHE+LI
Sbjct  652   NEPTMFLRLSSRQITNLLSSIWAQSISPLNKPENYEAIAHTYCLVLLFARSKHSSHETLI  711

Query  563   RGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKT  742
             R FQLAFSLRSI+L+   ++ PSRRRSLF LATSMIIF SK Y+ +PL   AKA LT++T
Sbjct  712   RSFQLAFSLRSIALA-GGQLQPSRRRSLFTLATSMIIFTSKAYNIVPLVPHAKAALTNET  770

Query  743   MDPFLQLVDECHLKV----NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMI  910
             +DPF++LV++C L+V      NPK    YGSKED+E A +SLS ++ S+ QS ESFA ++
Sbjct  771   VDPFVKLVEDCKLQVVNLGQDNPKQ--IYGSKEDNENAVKSLSAVDTSESQSKESFAKLV  828

Query  911   VESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTND--EVVDPTF  1084
             +++L+    ++ + I++QLLQDFLPD+ CP+GTQ         Q   K +   E+V    
Sbjct  829   LQTLENKSENELSSIRKQLLQDFLPDDACPLGTQFFVTPGEIYQCGPKNDGTLEMVGSVN  888

Query  1085  TVDDLGSHSDPNAH-PDSTPNLLDVNEFLDSVLETSNQVGRQSAAP-PAGMTFMDVASQC  1258
               ++  S +D     P  +P L+  +E +  V   S++VGR S +  P  + + ++A  C
Sbjct  889   LCEEPQSQNDLEIEKPLRSPTLMSADELMKLVSSISSKVGRTSGSSFPVNLPYKEMAGNC  948

Query  1259  EAFQEGKGNRMNF----------------REDGN----DEPD---FNFSEETIWQPPSGN  1369
             EA  EGK  +++                    GN    +EP      FS        SGN
Sbjct  949   EALLEGKPEKVSSFTSSQPSEGQRSGRTSTHGGNNQEKEEPSRRRVRFSVNI-----SGN  1003

Query  1370  PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             PF D++     +      P  C+ E Q++P   QLP+SSPYDNFLKAAG
Sbjct  1004  PFVDSDFPRNRRSSMDILPRLCSVEVQQYPHLFQLPSSSPYDNFLKAAG  1052



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   392 bits (1008),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 256/580 (44%), Positives = 340/580 (59%), Gaps = 76/580 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCPR + A   L K++ +QR
Sbjct  479   QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPRPSSASVGLYKKQDLQR  538

Query  182   TLSRTVSVFSSSAALFDKLGKN-----QSSGKDGMD---------QNTQN--MLNRLTST  313
             TLSR VSVFSSSAALF KL ++     +S+ +D +D         QN+ N   L +L S+
Sbjct  539   TLSRAVSVFSSSAALFGKLRRDVFSLRESTCQDNVDKVSNSDDGQQNSSNDAKLYKLQSS  598

Query  314   YSRSLSVKPG-----SEETPNNGENPQEHHEGL---------------------------  397
              SR  SVK       SEE  ++    ++ H+ L                           
Sbjct  599   QSRMRSVKGTSLPSISEENFSSSPYREKVHDILIKYLESQLVFSNIITMTLLPCTQLQDP  658

Query  398   -SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
              SL++ SRQI+++LSS++ QA+S  NTPE++EAIAHTY L +LFSR K S +E L+R FQ
Sbjct  659   ISLRLSSRQITLILSSLWAQAMSLENTPENYEAIAHTYCLALLFSRAKNSFNEVLVRSFQ  718

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             LAFSLR+ISL     MPPSRRRSLF LATSMI+F +K ++ +PL   AK+ LT+KT+DP+
Sbjct  719   LAFSLRNISLRGDGTMPPSRRRSLFTLATSMIVFSAKAFNIVPLIPIAKSSLTEKTVDPY  778

Query  755   LQLVDECHLK-VNP-NPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L+LV++C L+ VN    +    YG KEDD AA  SLS + I + QSTES  S+IV SL+ 
Sbjct  779   LRLVEDCKLQAVNTVTEQLTKVYGLKEDDNAALESLSALAIMENQSTESMVSVIVNSLED  838

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTN---DEVVDPTFTVDD-  1096
             S+  + + I+ QLL DF  D+VCP+G   +           KTN    EV+ P F +DD 
Sbjct  839   SLRSELSAIRMQLLDDFSSDDVCPLGALFMELPGQSISFGSKTNSISQEVMPPAFAIDDD  898

Query  1097  -----LGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCE  1261
                    S +D  ++     N+L VN+ LDS+LET+ +VGR S +  A + F ++ASQCE
Sbjct  899   IFTEASDSPADYKSNLSRDTNILSVNQLLDSILETATEVGRLSVSSTADVPFKEMASQCE  958

Query  1262  AFQEGKGNRMNFREDGNDEPDFNF-------------SEETIWQPPS-GNPF-ADNNTaa  1396
             A   GK  +++       + +                S   I Q  + G+PF  + N  A
Sbjct  959   ALLVGKQRKLSVFTSARQQQEIFLSGLSQDDNRMKHSSHLCIGQLQTVGSPFDHEQNFNA  1018

Query  1397  agqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 V       C TEYQ  P F +LPASSP+DNFLKA G
Sbjct  1019  YACTVTTTTTLLCPTEYQWQPQF-RLPASSPFDNFLKAVG  1057



>ref|XP_006838291.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   391 bits (1004),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 249/565 (44%), Positives = 329/565 (58%), Gaps = 63/565 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NK FPEALFHQ+++AMV PDNETR+GAHR+FSVVLVPSSVCPR        SK   IQR
Sbjct  484   HNKEFPEALFHQLVIAMVYPDNETRVGAHRIFSVVLVPSSVCPRPHLIAVNSSKACDIQR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG---------------------MDQNTQN---  289
             TLSRTVSVFSSSAALF+KL K +S  +DG                     MD N ++   
Sbjct  544   TLSRTVSVFSSSAALFEKLKKEKSYLRDGAFEEFELKDDGIWEKPRHLDAMDANRKSDAD  603

Query  290   -MLNRLTSTYSRSLSVK-----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
               LN L S+ SR  S+K     P S    N+        E +SL++   QI++LLSSI+ 
Sbjct  604   VKLNSLKSSCSRVQSMKVSQSFPVSVTEGNSMGLANMEMELVSLRLSIHQITLLLSSIWA  663

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             QA+   NTPE++EAI+HTYSL++LFS+TK SS+E+LIR FQLAFSLR+ISL++   +PPS
Sbjct  664   QALCPENTPENYEAISHTYSLVLLFSQTKASSNEALIRSFQLAFSLRAISLAQGGSLPPS  723

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARA  811
             R RSLF LATSMIIF SK Y+   +    KA LT+K +DPFL LV +  L+V+   K   
Sbjct  724   RCRSLFTLATSMIIFASKAYNIQSIVPCLKAALTEKMVDPFLHLVGDSRLQVSDFKK--V  781

Query  812   SYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDE  991
              YGSK+DD  A + LS + ++  Q+TES  SMI++SL      +++ IK +LL  F PD+
Sbjct  782   VYGSKDDDNDALKFLSALALTNSQATESLVSMIIKSLGLLSESESSTIKRELLCGFAPDD  841

Query  992   VCPMGTQRINDLRNHNQ---SDDKTNDEVVDPTFTVDD-------LGSHSD-PNAHPDST  1138
             VCP+G Q   D   H+    S + T    V P+ T+ D        G  ++  +  P   
Sbjct  842   VCPLGAQLFMDTPQHSSLFGSKESTFLAEVTPSVTLTDEEPFLEIFGDQAELEDNLPSKE  901

Query  1139  PNLLDVNEFLDSVLETSNQVG--RQSAAPPAGMTFMDVASQCEAFQEGKGNRMN-FREDG  1309
             P+LL VN+ L+SVLET++QVG  R S +P   + F ++ S+CEA   GK  +M+ F    
Sbjct  902   PHLLSVNQLLESVLETAHQVGSFRISISPE--VPFQELTSRCEALLMGKQEKMSAFMNSY  959

Query  1310  NDEP----------DFNFSEETIWQ-----PPSGNPFADNNTaaagqpvnaaapaSCATE  1444
               E           D     ++ WQ       + NPF D++             + C+ E
Sbjct  960   QKEEILLLPMSSPGDCEVKLQSAWQLDQSFQENRNPFIDHDFPLNPYGSACNPASQCSME  1019

Query  1445  YQRHPSFMQLPASSPYDNFLKAAGS  1519
             Y     F +LPASSPYDNFLKAAG 
Sbjct  1020  YHHPTQFFKLPASSPYDNFLKAAGC  1044



>gb|KHG10001.1| hypothetical protein F383_03012 [Gossypium arboreum]
 gb|KHG16152.1| hypothetical protein F383_02476 [Gossypium arboreum]
Length=806

 Score =   385 bits (988),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 239/527 (45%), Positives = 316/527 (60%), Gaps = 33/527 (6%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPE+LFHQ+L AMV PD+ETR+GAHR+FSVVLVP+SVCP+Q+         K+I RT
Sbjct  289   NKAFPESLFHQLLPAMVHPDHETRIGAHRIFSVVLVPTSVCPQQSSVPPL--TNKAIPRT  346

Query  185   LSRTVSVFSSSAALFDKLGK------------NQSSGKDGMDQNTQNMLNRLTSTYSRSL  328
             LSRTVSVFSSSAALF+KL K             QS   +G +    N LN   S  S S 
Sbjct  347   LSRTVSVFSSSAALFEKLRKEKSFSRGNGYIEKQSIVNEGSNNMILNRLNSSYSRASSSR  406

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             ++    E   N+  N     E  SL++ S QIS+LLSSI+ Q++S  NTP ++EAIAHTY
Sbjct  407   NLYVPLETDKNSLSNSNTESEAHSLRLSSTQISLLLSSIWAQSVSPQNTPRNYEAIAHTY  466

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SS+E+L+R FQLAFSLR ISL+E   +PPS RRSLF LATSMI+F SK 
Sbjct  467   SLVLLFSRAKNSSNEALVRSFQLAFSLRCISLNEGGPLPPSCRRSLFTLATSMILFSSKA  526

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSG  862
              + +P+  S K  L ++ +DPFL LV++C LKV      R +  YGSKEDD+ A ++LS 
Sbjct  527   SNILPIVYSTKVALRERVVDPFLHLVEDCKLKVVDTGSDRPTNVYGSKEDDDLAAKTLSQ  586

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ-RINDLRNHN  1039
             I+I+ +Q  ES AS I++SL  S   + +  +  LL  FLPD+VCP+G+   I+ L    
Sbjct  587   IQITPEQDNESLASEILKSLGISSEPELSNTRAHLLSKFLPDDVCPLGSHLTIDQLHKEY  646

Query  1040  QS---DDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQS  1210
             Q+   + K+  E  D  F         D +     TP  LDVN+ LDSVLETS+Q+GR S
Sbjct  647   QAGAEESKSTKE--DDAFAEPFECQTKDGSGFSQETPKPLDVNQLLDSVLETSDQLGRIS  704

Query  1211  AAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPP-----SGNPF  1375
              +    M++ D+A  CE    GK  +M      +D    +  +++ +Q P      G  F
Sbjct  705   VSTGPDMSYKDMAHHCETLLTGKQQKM------SDLMSVHLRQDSYFQNPFHAEQPGPVF  758

Query  1376  ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +   + Q      P  CATEYQ H      P+S+PYDN LKAAG
Sbjct  759   EQTSGTNSLQQPVGTLPMLCATEYQNHLQPFSFPSSTPYDNILKAAG  805



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   389 bits (1000),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 243/556 (44%), Positives = 319/556 (57%), Gaps = 58/556 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             ++K FPE+LFHQ+LLAMV PD  T + AHR+FSVVLVPSSVCPR   A     K   IQR
Sbjct  484   KDKTFPESLFHQLLLAMVLPDRLTHIEAHRIFSVVLVPSSVCPRPCSATAEAPKIHDIQR  543

Query  182   TLSRTVSVFSSSAALFDKLGK--------------NQSSGKDGMD-QNTQNMLNRLTSTY  316
             TLSRTVSVFSSSAALF KL +              N++   DG+   N+    ++L S+ 
Sbjct  544   TLSRTVSVFSSSAALFGKLRREKFSFRQTGLQNNVNRAQSDDGLSVGNSDVKFHKLQSSR  603

Query  317   SRSLSVKPGS---EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             SR  S++  S      PN   N     E   L + SRQI ++LSSI+VQAIS  NTPE++
Sbjct  604   SRVHSIRTNSLIPSADPNLSSNSSMDMEPTFLTLSSRQIMLMLSSIWVQAISPENTPENY  663

Query  488   EAIAHTYSLLMLFSRTK--KSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALAT  661
             EAIAHTYSL+++FSR K   S HE L R FQLAFS+R +SL     + PSRRRSLF LAT
Sbjct  664   EAIAHTYSLVLIFSRDKMQNSIHEILTRSFQLAFSIRDVSLRRGGSLSPSRRRSLFTLAT  723

Query  662   SMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS-----YGSK  826
             SMI+F SK ++  PL  +A++ LT++ +DPFL LV++C L+V+   KA A      YGSK
Sbjct  724   SMIVFSSKAFNIAPLIPTARSSLTERMVDPFLHLVEDCRLEVS---KAAADNQIKVYGSK  780

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             EDD A+  SLS I  +   STE+  SMIV SL      + + +K+QLL DF PD+VCP+G
Sbjct  781   EDDNASLESLSAITTAGHVSTEAMVSMIVNSLGDLPDSELSTLKKQLLSDFSPDDVCPLG  840

Query  1007  TQRINDLRNHN----QSDDKTNDEVVDPTFTVDDLGSHS-----DPNAHPDSTPNLLDVN  1159
              Q I +L   N       D  + EV+     +DD  + S     D  +      NLL VN
Sbjct  841   AQFI-ELPGFNSPLCSKKDLKSQEVMPALLAIDDDFTESFENPADSESQLTVKNNLLSVN  899

Query  1160  EFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPD-----  1324
             + L+SVLET+ QVGR S +    + F ++A  CEA   GK  +++       +PD     
Sbjct  900   QILESVLETAWQVGRLSVSNNCNIPFGEMAGNCEALLMGKQQKLSIFMSAQQKPDIILSG  959

Query  1325  ------------FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFM  1468
                         ++ +E + W    GNPF + N  +       +  + CA  Y   P   
Sbjct  960   NSQNQNEVTISLYSCTETSQW---IGNPFLEPNIVSYTYQAPTSTASFCAVGYHYQPQLY  1016

Query  1469  QLPASSPYDNFLKAAG  1516
             QLPASSP+DNFLKAAG
Sbjct  1017  QLPASSPFDNFLKAAG  1032



>gb|KHG10000.1| hypothetical protein F383_03012 [Gossypium arboreum]
 gb|KHG16151.1| hypothetical protein F383_02476 [Gossypium arboreum]
Length=836

 Score =   384 bits (987),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 239/527 (45%), Positives = 316/527 (60%), Gaps = 33/527 (6%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPE+LFHQ+L AMV PD+ETR+GAHR+FSVVLVP+SVCP+Q+         K+I RT
Sbjct  289   NKAFPESLFHQLLPAMVHPDHETRIGAHRIFSVVLVPTSVCPQQSSVPPL--TNKAIPRT  346

Query  185   LSRTVSVFSSSAALFDKLGK------------NQSSGKDGMDQNTQNMLNRLTSTYSRSL  328
             LSRTVSVFSSSAALF+KL K             QS   +G +    N LN   S  S S 
Sbjct  347   LSRTVSVFSSSAALFEKLRKEKSFSRGNGYIEKQSIVNEGSNNMILNRLNSSYSRASSSR  406

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             ++    E   N+  N     E  SL++ S QIS+LLSSI+ Q++S  NTP ++EAIAHTY
Sbjct  407   NLYVPLETDKNSLSNSNTESEAHSLRLSSTQISLLLSSIWAQSVSPQNTPRNYEAIAHTY  466

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SS+E+L+R FQLAFSLR ISL+E   +PPS RRSLF LATSMI+F SK 
Sbjct  467   SLVLLFSRAKNSSNEALVRSFQLAFSLRCISLNEGGPLPPSCRRSLFTLATSMILFSSKA  526

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSG  862
              + +P+  S K  L ++ +DPFL LV++C LKV      R +  YGSKEDD+ A ++LS 
Sbjct  527   SNILPIVYSTKVALRERVVDPFLHLVEDCKLKVVDTGSDRPTNVYGSKEDDDLAAKTLSQ  586

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ-RINDLRNHN  1039
             I+I+ +Q  ES AS I++SL  S   + +  +  LL  FLPD+VCP+G+   I+ L    
Sbjct  587   IQITPEQDNESLASEILKSLGISSEPELSNTRAHLLSKFLPDDVCPLGSHLTIDQLHKEY  646

Query  1040  QS---DDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQS  1210
             Q+   + K+  E  D  F         D +     TP  LDVN+ LDSVLETS+Q+GR S
Sbjct  647   QAGAEESKSTKE--DDAFAEPFECQTKDGSGFSQETPKPLDVNQLLDSVLETSDQLGRIS  704

Query  1211  AAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPP-----SGNPF  1375
              +    M++ D+A  CE    GK  +M      +D    +  +++ +Q P      G  F
Sbjct  705   VSTGPDMSYKDMAHHCETLLTGKQQKM------SDLMSVHLRQDSYFQNPFHAEQPGPVF  758

Query  1376  ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +   + Q      P  CATEYQ H      P+S+PYDN LKAAG
Sbjct  759   EQTSGTNSLQQPVGTLPMLCATEYQNHLQPFSFPSSTPYDNILKAAG  805



>emb|CBI24919.3| unnamed protein product [Vitis vinifera]
Length=1322

 Score =   394 bits (1011),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 252/535 (47%), Positives = 329/535 (61%), Gaps = 64/535 (12%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L+AMV  D+ETR+GAH        P+                    RTLS
Sbjct  818   AFPEALFHQLLVAMVCADHETRVGAH--------PTD-----------------FHRTLS  852

Query  191   RTVSVFSSSAALFDKLGKNQSSGK------------DGMDQNTQN--MLNRLTSTYSRSL  328
             R VSVFSSSAALFDKLG+ QSS +            D  D NT N  ML+RL STYSR+ 
Sbjct  853   RNVSVFSSSAALFDKLGREQSSSQENTSQDKKVKFVDTEDSNTNNNSMLSRLKSTYSRAY  912

Query  329   SVKPGSE--ETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAH  502
             SVK  S    T     N  +  E +SL++ + QI +LLSSI+ Q+IS LN PE++EAI+H
Sbjct  913   SVKKNSSPITTDETMSNSDKEPEAISLRLSTHQIILLLSSIWAQSISPLNMPENYEAISH  972

Query  503   TYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLS  682
             T+SL++LF+RTK SS E+LIR FQLAFSLR ISL +   +PPSRRRSLF LA SMIIF S
Sbjct  973   TFSLVLLFARTKNSSLEALIRSFQLAFSLRCISLGKGGTLPPSRRRSLFTLANSMIIFSS  1032

Query  683   KTYSFIPLAVSAKALLTDKTMDPFLQLVDECH-LKVNP---NPKARASYGSKEDDEAAKR  850
             K Y+ +PL   AKA LTDKT+DPFL+L+D+   L V P   NPK    YGSKEDD+ A +
Sbjct  1033  KAYNILPLVPCAKAALTDKTVDPFLRLIDDRKLLAVKPGVENPK--NVYGSKEDDDGALK  1090

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND--  1024
             SLS IEI++ QS ESFASM+V+ L KS   +++ I+EQL+ DFLP +VCPMG Q   +  
Sbjct  1091  SLSAIEITENQSKESFASMVVKMLGKS-EPESSAIREQLVHDFLPVDVCPMGAQFFTEAP  1149

Query  1025  --LRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAH-PDSTPNLLDVNEFLDSV  1177
               +      D K+ DE + P  ++DD        S + PN+       +LL  ++ L++V
Sbjct  1150  GQIYQSGTEDKKSPDE-LPPLLSMDDDAIPEAFESQTGPNSQLALVNHSLLSADQLLETV  1208

Query  1178  LETSNQVGRQS-AAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQ  1354
             +ETS QVGR S ++PP  M++ ++AS CE   + K  +M+         + + +  + + 
Sbjct  1209  VETS-QVGRFSVSSPPDDMSYKEMASHCEELLKEKQQKMSTFMIAQQSQEISNTFPSNYD  1267

Query  1355  PPSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              P GNPF D +T+   +   N A    CA EY  HP F +LPASSPYDNFLK AG
Sbjct  1268  RP-GNPFLDEDTSDISEQPSNGAGLVLCAAEYHNHPYFFRLPASSPYDNFLKVAG  1321



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   387 bits (995),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 252/539 (47%), Positives = 333/539 (62%), Gaps = 43/539 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+L AMV  D+ETR+ AHR+FSVVLVPSSV PRQ  +     K   I+R
Sbjct  483   QHKAFPEALFHQLLPAMVHRDHETRIVAHRIFSVVLVPSSVAPRQTSSLPLSGKAAHIRR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM----DQNTQNMLNRLTSTYSRSLSVK-PGS  346
             +LSR+VSVFSSS ALF+KL K++   K+ +      N   +LNRL S+YSR+ S++ P  
Sbjct  543   SLSRSVSVFSSSTALFEKLRKDRPGSKENIPFEGGNNNSGVLNRLKSSYSRATSIRNPVH  602

Query  347   EETPNNG-ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
               T +N   N  +   G SL++ SRQI +LLSSI+ Q+IS  N PE++EA+AHTYSL++L
Sbjct  603   VPTEDNSLGNLNKEVVGSSLRLSSRQIILLLSSIWAQSISPENVPENYEAVAHTYSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K SS E+L+R FQL+FSLR ISL+E   +PPSR RSLF LAT+MIIF +K Y    
Sbjct  663   FSRAKSSSQEALVRSFQLSFSLRGISLAEGGPLPPSRCRSLFTLATAMIIFSAKAYEIHS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGIEISKK  880
             L   AKA L +K +DPFL LV +  L+ VN N  A   +GSKEDD +A R LS I  ++ 
Sbjct  723   LVSCAKATLNNKLVDPFLCLVGDSKLQAVNKN--ATIEFGSKEDDSSALRYLSDIIFTED  780

Query  881   QSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK--  1054
             Q+ ESFA+ IV SL+K    +   +KEQLL +FLPD+VCP+G Q         + D +  
Sbjct  781   QTRESFAAEIVRSLEKMKDAEICTVKEQLLSEFLPDDVCPLGAQMFESPSKIYELDARQS  840

Query  1055  -TNDEVVDPTFTVDDLGSHSDPNAHPDSTP-----------NLLDVNEFLDSVLETSNQV  1198
                DE + P FT+DD       ++ PD+ P           NLL VN+ L+SVL+T++QV
Sbjct  841   VCQDETM-PLFTLDD-------DSLPDNQPKQESLLTIENANLLSVNQLLESVLDTAHQV  892

Query  1199  GRQSAAPPAGMTFMDVASQCEAFQEGKGNRM-NFREDGNDEPDFNFS--------EETIW  1351
             GR S +    + + ++AS CEA   GK  +M +       E  F+F         ++T+ 
Sbjct  893   GRFSVSTAPDLPYKEMASHCEALLMGKQQKMSHLMTAQRQENLFSFCVQNIDLEPDKTVP  952

Query  1352  QPPSGNPFADNNTaaagqpvnaaapaS---CATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
             Q   GNPF D+N           A  +   CATEYQ+ P   +LPA SPYDNFLKAAG 
Sbjct  953   QSLGGNPFLDDNVMVPTFKALPPAHPAPMLCATEYQQQPQHYKLPALSPYDNFLKAAGC  1011



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   387 bits (995),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 252/556 (45%), Positives = 337/556 (61%), Gaps = 53/556 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+L AMV PD ETR+GAH++FSVVLVPSSVCP  +       K   + R
Sbjct  485   QNKAFPEALFYQLLPAMVHPDRETRVGAHQIFSVVLVPSSVCPNPSTNSAESRKAGDLPR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD-------------GMDQNTQNM-LNRLTSTYS  319
              LSRTVSVFSSSAALFDKL ++++  +D             G  +N+ N  LNRL S+YS
Sbjct  545   ALSRTVSVFSSSAALFDKLRRDKTMSRDYTHQDNRDNIASEGQPRNSGNGGLNRLKSSYS  604

Query  320   RSLSVK--PGSEETPNNG-ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
             R+ S K  P S  T  N   + +      SL++ SRQI++LLSSI+ Q+IS  N PE++E
Sbjct  605   RAYSRKASPASAMTDGNSMSDFKTEPAANSLRLSSRQITLLLSSIWAQSISPANMPENYE  664

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMI  670
             AIAHTYSL++LFSR K SS+E LIR FQL+FSLR+ISL+E + +PPS RRSLF LATSMI
Sbjct  665   AIAHTYSLVLLFSRAKNSSNEVLIRSFQLSFSLRNISLNEGSPLPPSCRRSLFTLATSMI  724

Query  671   IFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAA  844
             +F +K +S   L   +K LLT+K +DPFL L ++  L+     +   +  +GSKEDD+ A
Sbjct  725   LFSAKAFSIHSLVQPSKLLLTEKKVDPFLHLFEDKKLRAIHTGSDLPKIIFGSKEDDDLA  784

Query  845   KRSLSGIEISKKQSTESFASMIVESLKKSIT-----DKTNLIKEQLLQDFLPDEVCPMGT  1009
              + LS IE +  Q+ ES  S I++SL+   T      + + +KEQLL +FLPD++CP+G 
Sbjct  785   LKFLSEIENTDDQTRESLTSEILKSLENLPTIQLSSSELSSMKEQLLSEFLPDDLCPLGA  844

Query  1010  QRI---NDLRNHNQSDDKTNDEVVDPTFTVDDLG----SHSDPNAHPD---STPNLLDVN  1159
             Q +   N +   +  + K+  E+    FT+DD        S   ++P+     P LL VN
Sbjct  845   QFMDNPNKIYLVDSKNSKSQKEIAT-LFTIDDDAFNDSYESQDKSNPELAKEIPCLLSVN  903

Query  1160  EFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGN--DEPDFNF  1333
             + L+SVLET++QVGR S +  A M + ++A  CEA   GK  +M+         E   NF
Sbjct  904   QLLESVLETTHQVGRISVS-TADMPYKEMAGHCEALLVGKQKKMSHLMSAQLRQESLINF  962

Query  1334  S-----EETIWQPPS---------GNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFM  1468
             S      E     PS         GNPF D   T  + +P        CA+EYQ HP + 
Sbjct  963   SITNHENEVNEVLPSQVDAGSLMVGNPFTDERITPNSNKPPVGTVTTQCASEYQHHPQYF  1022

Query  1469  QLPASSPYDNFLKAAG  1516
             +LPASSPYDNFLKAAG
Sbjct  1023  RLPASSPYDNFLKAAG  1038



>gb|KHN11694.1| Protein EFR3 like B [Glycine soja]
Length=1010

 Score =   385 bits (989),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 252/574 (44%), Positives = 337/574 (59%), Gaps = 91/574 (16%)
 Frame = +2

Query  2     QNKA---FPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS  172
             QNKA   FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCP+ + +G  ++    
Sbjct  458   QNKARLAFPEALFHQLLLAMVHADHETRVGAHRIFSVVLVPSSVCPQPSSSGTPMTHAAD  517

Query  173   IQRTLSRTVSVFSSSAALFDKLGKNQSS-----GKDGMDQNTQNMLNRLTSTYSRSLSVK  337
             IQR LSR VSVFSSS+ALF+KL + Q+S       DG + N  ++LNRL STYSR+ S +
Sbjct  518   IQRMLSRNVSVFSSSSALFEKLERKQNSLPEDSHADG-NVNDNSILNRLKSTYSRTTSTR  576

Query  338   PGS----EETPNNG----------------------ENPQ-------------EHHEGLS  400
               +    E T N                        + PQ                + L 
Sbjct  577   KSALTSAEYTDNRNSKVHNSSMMSRLKSSYSRATSVKKPQIPTTVEENTTNTSNKQQVLP  636

Query  401   LKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLA  580
             +++ S QI++LLSSI+ Q+I  LNT E+FEAIAHTYSL++L +R+K SSHE+L + FQLA
Sbjct  637   IRLSSHQITLLLSSIWAQSIYPLNTSENFEAIAHTYSLVLLVARSKNSSHEALTQSFQLA  696

Query  581   FSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQ  760
             FSLR+ISL+E  K+ PSRRRSLF LATSMIIF SK Y+ + L   AK  LTD+T+DPFLQ
Sbjct  697   FSLRNISLNENVKLQPSRRRSLFTLATSMIIFASKAYNILSLISIAKTTLTDRTVDPFLQ  756

Query  761   LVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSI  934
             LV++  L+   +   + S  YGSKEDDE A +SLS I++++ QS ESFA+MIV+SL KS 
Sbjct  757   LVNDSKLQAVTDTDKQPSKVYGSKEDDEDALKSLSAIKLTESQSKESFATMIVQSLGKS-  815

Query  935   TDKTNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDD--  1096
             ++++++++E+LL DF PD+ CP+G Q       ++      +DK  D V    FT+DD  
Sbjct  816   SNESSILRERLLNDFSPDDACPLGAQLSAETTGNMYQSGLKEDKLPDMVDISLFTIDDDI  875

Query  1097  --LG----SHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQ-------SAAPPAGMTF  1237
                G    ++SD    P    +LL V++ L S L     VG+Q          P  G +F
Sbjct  876   PPCGLESQANSDSMQQPSQNLSLLSVDDILGSAL----LVGKQQKMSTFMGTLPMQGYSF  931

Query  1238  MDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvna  1417
                A   E +Q+             DE   +  ++T+    SGNPF D+N  +       
Sbjct  932   RIPAP--EYYQQ------------KDESSNSSVQQTL--SSSGNPFLDSNFDSNSHNTLP  975

Query  1418  aapaS-CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                   CAT YQ   +F QLPAS PYDNFLKAAG
Sbjct  976   DTAPRLCATAYQHQAAFFQLPASRPYDNFLKAAG  1009



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   385 bits (990),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 251/565 (44%), Positives = 338/565 (60%), Gaps = 67/565 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P    A         ++R
Sbjct  485   QNKAFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVWPYPCLATPESQMMYDLRR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD-----GMDQNT-----QNM------LNRLTST  313
             TLSRTVSVFSSSAALF+KL + + S +D      +D+N+     Q M      L  L S+
Sbjct  545   TLSRTVSVFSSSAALFEKLRREKYSLRDNACQESLDKNSHGYDAQQMSSNDANLYTLPSS  604

Query  314   YSRSLSVKPGSEET-------------PNNGEN-----PQEHHEGLSLKMKSRQISMLLS  439
              SR+ S+K    ++             P   EN      ++  + +SL++ SRQI+++LS
Sbjct  605   KSRNRSMKGPRLQSFRSHVFSTKGSPLPVTAENVSMNNAKKEVDPVSLRLSSRQITLMLS  664

Query  440   SIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAK  619
             SI+ QA S  NTPE++EAIAHTYSL++LFSR K S HE+LIR FQLAFSLR ISL     
Sbjct  665   SIWAQANSPENTPENYEAIAHTYSLILLFSRPKTSIHEALIRSFQLAFSLRRISLGGGGS  724

Query  620   MPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NP  793
             +PPSRRRSLF LAT+MI+F SK ++  PL    K+ L +KT+DPFLQLV++  L+     
Sbjct  725   LPPSRRRSLFMLATAMIVFSSKAFNVQPLIPLVKSSLNEKTVDPFLQLVEDSKLQAVNTA  784

Query  794   NPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQ  973
             +      YGSKEDD  A  SLS +E+++ Q  ES  S+I+ SL  S   +   I++QLL 
Sbjct  785   SDHLVKVYGSKEDDNCALISLSAVELTENQLKESMVSVILNSLGDSSDTELPTIRKQLLS  844

Query  974   DFLPDEVCPMGTQRI---NDLRNHNQSDDKTNDEVVDPTFTVD-DLGSHS-----DPNAH  1126
             DFLPD+VCP+G Q +     +       D + +EV+ PT  +D D+ + +     DP+  
Sbjct  845   DFLPDDVCPLGAQFVEAPGQVPPFGSKKDNSQEEVIPPTSLIDVDIFTEAFEGLVDPSPQ  904

Query  1127  -PDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN---  1294
              P  T NLL VN+ LD+VLETS QVGR S +    + F ++AS CEA   GK  +M+   
Sbjct  905   LPSDTSNLLSVNQLLDTVLETSLQVGRFSVSTTPDVPFKEMASHCEALMMGKQQKMSAFM  964

Query  1295  ---------FREDGNDEPDFNFSEETIWQ--PPSGNPFADNNTaaagqpvnaaapaSCAT  1441
                      F +  +D+ D   S   +      + NPF D N++A G  +          
Sbjct  965   SAQQKQELLFPDLLHDQGDMKGSSYLLMDQLQKTSNPFLDPNSSACGDNILLQ------N  1018

Query  1442  EYQRHPSFMQLPASSPYDNFLKAAG  1516
             ++Q HP F +LPASSP+DNFL+AAG
Sbjct  1019  DFQSHPQF-KLPASSPFDNFLRAAG  1042



>ref|XP_010555004.1| PREDICTED: uncharacterized protein LOC104824606 [Tarenaya hassleriana]
Length=1042

 Score =   384 bits (985),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 233/550 (42%), Positives = 329/550 (60%), Gaps = 45/550 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  492   QNKVFPEALFHQLLQAMVHPDHETRIGAHRIFSVVLVPTSVCPRPSLVNADLKKGMGLPR  551

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ--------------NTQNMLNRLTSTYS  319
             +LSRTVSVFSSSAALF+KL K++ S     DQ              N  ++L RL S+Y+
Sbjct  552   SLSRTVSVFSSSAALFEKLKKDKFSSMLNSDQIINESVMSEDEPQSNNGDILGRLQSSYN  611

Query  320   RSLSVKPGSEETPN-NGENPQEHHEGL-SLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             ++ S K  +    + N  N       +  L++ S QI++LLSSI+ Q+IS  NTPE++EA
Sbjct  612   QTYSTKNQTVAMVDANSVNVSNSDPDVGCLRLSSHQINVLLSSIWAQSISPANTPENYEA  671

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IA+TYSL++LFSR K SSHE+LIR FQ+A SLR ISL E   +PPSRRRSLF LATSMI+
Sbjct  672   IANTYSLVLLFSRAKNSSHEALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLATSMIL  731

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKR  850
             F SK ++ +PL    KA L  +T+DPFL LV++  L+ V P+ +   +YGSKEDD +A  
Sbjct  732   FSSKAFNLLPLVDFTKAALQGETVDPFLHLVEDRKLEAVKPDQRQTTAYGSKEDDASALD  791

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLR  1030
             +LS +  SKKQS E   + IV+SL+     + + ++EQLL +FLPD+ CP+GT+ +   +
Sbjct  792   TLSNVSFSKKQSREILVAEIVKSLENMCNTEMDKMREQLLSEFLPDDACPLGTRFLEAAQ  851

Query  1031  NHNQSDDKTNDEVVDPT--FTVDD------LGSHSDPN-AHPDSTPNLLDVNEFLDSVLE  1183
               ++ D +    + + T  F+++D      +G H+  N       P LL VN+ ++SV++
Sbjct  852   KIHRVDSRDAKSLKEDTVPFSLEDQEFGDGIGIHAKNNPVKLTEIPQLLSVNQLIESVVD  911

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNR--------------MNFREDGNDEP  1321
             T++Q GR S    + +++ ++   CEA   GK  +              +N     +DE 
Sbjct  912   TNHQAGRISFHTASDVSYKEMTLHCEALLMGKQQKISSLLNPQLRQESLINLSPRKHDEA  971

Query  1322  DFNFSE----ETIWQPPSGNPFADNNTaaag-qpvnaaapaSCATEYQRHPSFMQLPASS  1486
               N +      + +    GNPF       A  + +       C+TE+Q      +LPASS
Sbjct  972   TKNTTPYPQISSCFPAAVGNPFLPGEIETASPRTLVGTVQPRCSTEFQNQAQSFRLPASS  1031

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  1032  PYDNFLKAAG  1041



>ref|XP_007203028.1| hypothetical protein PRUPE_ppa018106mg, partial [Prunus persica]
 gb|EMJ04227.1| hypothetical protein PRUPE_ppa018106mg, partial [Prunus persica]
Length=612

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 314/531 (59%), Gaps = 51/531 (10%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD+ET +GA RVF VVLVPSSVCP  + +     K     RTLS
Sbjct  103   AFPEALFHQLLPAMVHPDHETCVGALRVFFVVLVPSSVCPGLSSSNTESRKAMDFPRTLS  162

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGM-DQNTQNMLNRLTSTYSRSLSVKPGSEETPNNG  367
             RTV VFSSSAALF+KL + +   ++ + + N +N+L    S                   
Sbjct  163   RTVYVFSSSAALFEKLRREKIYLRESICEDNDENVLEISMS-------------------  203

Query  368   ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
              N  + HE  SL++ S QI++LL SI+ Q++S  N PE++EAIAHT+SL+ LFSR K SS
Sbjct  204   -NSTKEHEANSLRLSSHQITLLLLSIWAQSLSPGNMPENYEAIAHTHSLVSLFSRAKHSS  262

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
              E L++ FQLAFSLR ISL+E   +PPSRRRSLF LATSMI+FLSK Y+ + L   AKA 
Sbjct  263   VEVLVQSFQLAFSLRDISLTEGGPLPPSRRRSLFTLATSMILFLSKAYNILSLVHRAKAS  322

Query  728   LTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             L DKT+DPFL LV++  L+     +     +YGSKE D  + +SLS I  + +Q+ E FA
Sbjct  323   LMDKTVDPFLHLVEDRKLQAVKTGSDHPTTAYGSKEYDNLSLKSLSEIVFTDEQTREFFA  382

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVD--  1075
             S I++SL K    + + I+EQL+ +FLPD+VCP+G Q   D        D +N+E +   
Sbjct  383   SQILKSLDKLSDSELSTIREQLVSEFLPDDVCPLGAQLFMDAPQKLYQVDLSNNEAIKED  442

Query  1076  -PTFTVDD---LGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMD  1243
              P F++DD    GS      +  + P+LL VN+  +SVLET++QVGR S +    + + +
Sbjct  443   APIFSLDDDSFPGSFDSQKNNSANLPDLLSVNQLTESVLETAHQVGRLSISNAPDVPYKE  502

Query  1244  VASQCEAFQEGKGNR----MNFREDGNDEPDFNFS-----EETIWQP----------PSG  1366
             +A  CEA   GK  +    MNF++  N E   N S     ++  W             S 
Sbjct  503   MAGHCEALLIGKQQKMSSLMNFQQ--NQEYLMNLSLQNRNDDVKWMTSDFQADACSHKSS  560

Query  1367  NPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             NPFAD   T+          P  CATEYQ+H    +LPASSPY NFLKAAG
Sbjct  561   NPFADQTATSYIPPQTLLCVPMLCATEYQQHAHSFRLPASSPYGNFLKAAG  611



>gb|KHG08769.1| Protein EFR3 B [Gossypium arboreum]
Length=1010

 Score =   382 bits (981),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 245/546 (45%), Positives = 332/546 (61%), Gaps = 60/546 (11%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFPEALFHQ+L AMV PD+E R+GAHR+FSVVLVPSSVCP  +       K  SI RT
Sbjct  470   NKAFPEALFHQLLPAMVHPDHEVRVGAHRIFSVVLVPSSVCPHPSSTREVKLKASSIPRT  529

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMD-QNTQNM-------------LNRLTSTYSR  322
             LSRTVSVFSSSAALF+KL K +S  ++    +N +N+             L RL S+YS+
Sbjct  530   LSRTVSVFSSSAALFEKLRKEKSFSRENASLENKENIASEEQLEISQNEILIRLKSSYSK  589

Query  323   SLSVK--PGSEETPNNG-ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             + S +  P S E   N   N    +E  SL++ S QIS+LLSSI+ Q++S  NTP+++EA
Sbjct  590   AYSSRSPPVSSEADENPLSNSNTEYEANSLRLSSTQISLLLSSIWAQSVSPQNTPQNYEA  649

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K SS+E+L+R FQLAFSL+SI+ +E   +PPSRRRSLF LATSMI+
Sbjct  650   IAHTYSLVLLFSRAKNSSNEALVRSFQLAFSLQSIAFNEGGPLPPSRRRSLFTLATSMIL  709

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEAAK  847
             F SK ++ +P+A  AKA LT+ T+DPFL+LVD+  L+ VN      A+ YGSKEDD  A 
Sbjct  710   FSSKAFNILPIADCAKAALTEITVDPFLRLVDDRKLQAVNTGLNQPANVYGSKEDDTLAL  769

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             ++LS I++  +Q  E+ AS IV+SL      + + I+ +LL++FLPD+VCP+G+Q   D 
Sbjct  770   KTLSQIQLPSEQHRETLASEIVKSLGHLSEPELSSIRARLLREFLPDDVCPLGSQFPTDA  829

Query  1028  RNH-NQSDDKTNDEVVD---PTFTVDDL----------GSHSDPNAHPDSTPNLLDVNEF  1165
              +   Q+  + N+ ++    P  ++DD           G   D +      PNL+DVN+ 
Sbjct  830   PHKVYQASAEENEFIIKEGAPILSIDDDDDDAFVEPFEGQIMDNSEFSGEMPNLMDVNQL  889

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDGNDEPDF  1327
             L+SVLET+ Q GR S      M++ ++   CE    GK  +M+       R+D       
Sbjct  890   LESVLETAYQFGRSSVCTGPNMSYKEITRHCETLVTGKQQKMSHLLSAQLRQDNMTNQLG  949

Query  1328  NFSEET----IWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYD  1495
                E+T    +++ P G                   P  CATEY  HP F  LPAS+PYD
Sbjct  950   PIVEQTGNTNLFKQPMGT-----------------LPMPCATEYHNHPPFFSLPASTPYD  992

Query  1496  NFLKAA  1513
             NFLKAA
Sbjct  993   NFLKAA  998



>ref|XP_006400678.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
 gb|ESQ42131.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
Length=1020

 Score =   382 bits (980),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 241/556 (43%), Positives = 327/556 (59%), Gaps = 62/556 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  476   ENKAFPDALFHQLLQAMVCVDHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  531

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL  +     DG  +                           
Sbjct  532   RTLSRTVSVFSSSAALFRKLKVDSDDSVDGNAKIERVSTLSRSQSKFTRGESFDDEEPKN  591

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+Y+R+ SVK  P    +  N          + L++ S QI +LLSSI+V
Sbjct  592   NTSSVLSRLKSSYNRTQSVKRNPSLMISDQNSSGGSPDKPVIPLRLSSHQICLLLSSIWV  651

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+TYSL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  652   QSLSPHNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  709

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV---NPNPK  802
             RRRSLF LATSMIIF ++ ++  PL  SAK  L +KT+DPFLQLV++C L         +
Sbjct  710   RRRSLFTLATSMIIFSARAFNIPPLVNSAKTALQEKTVDPFLQLVEDCKLDAVFYGQEEQ  769

Query  803   ARASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKEDD+ A  SL  I E ++ Q  E +A+MI++ L K     ++ IKEQL+ DF
Sbjct  770   PAKNYGSKEDDDDALNSLVAIEETTQNQPREYYATMIMKFLGKLSDQDSSSIKEQLVSDF  829

Query  980   LPDEVCPMGTQRINDLRNHNQSDDKT---------------NDEVVDPTFTVDDLGSHSD  1114
             +P + CP+GTQ         +S++K                ND +  P    D LG  + 
Sbjct  830   IPIDGCPVGTQLTESPVQVYRSEEKNNKPRENAETQLLITENDAMASP--PEDQLGLDTQ  887

Query  1115  PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN  1294
             PNA    T  LL ++E L++V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+
Sbjct  888   PNA---KTAFLLSIDELLNAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMS  944

Query  1295  FREDGNDEPDFNFSEETIWQPPSGNPFADN-NTaaagqpvnaaapaSCATEYQRHPSFMQ  1471
             F    +++   N ++ET   P  GNPF D  N+         AA   C TEYQ HP F  
Sbjct  945   FMSAKSNKFS-NQTKETTALPCGGNPFVDQRNSLEMMGLSAPAASNMCVTEYQNHPPFFN  1003

Query  1472  LPASSPYDNFLKAAGS  1519
              PAS+P+DNFLK  GS
Sbjct  1004  PPASTPFDNFLKPVGS  1019



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   379 bits (974),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 323/540 (60%), Gaps = 40/540 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS--I  175
             +NKAFPEALFHQ++ AM+ PD  TR+GAH++FSVVLVPSSVCP Q  +   ++K+ +  +
Sbjct  474   KNKAFPEALFHQLIPAMLHPDYVTRIGAHQIFSVVLVPSSVCP-QTTSTVTVAKKNNMVV  532

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGK--DGMDQNT----------QNMLNRLTSTYS  319
              RTLSRTVSVFSSSAALF+KL KNQ   +  + + Q              +LNR+ STYS
Sbjct  533   PRTLSRTVSVFSSSAALFEKL-KNQKGPQPPEPIIQRPLVEADHGPPPAGVLNRIRSTYS  591

Query  320   RSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             R  S +  P  E       NP +  + + L++ S QI++LLSSI+ Q++S  N PE++EA
Sbjct  592   RVYSFRHPPAPEGADATTTNPSKEPDAVPLRLSSHQITLLLSSIWEQSLSPANMPENYEA  651

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K S  ++LIR FQLAF+LR +SL +   +PPSRRRSLF L+T MII
Sbjct  652   IAHTYSLVLLFSRAKTSYVDALIRSFQLAFTLRILSLKDGGTLPPSRRRSLFVLSTCMII  711

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRS  853
             F SK Y+  P+    K  ++D+ +DP+L L ++C L+++       +YGSKEDD +A + 
Sbjct  712   FSSKAYNIFPVVPHVKVTISDRVIDPYLTLAEDCKLEISSR-AGHVAYGSKEDDSSALKC  770

Query  854   LSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRN  1033
             LS I++S+ Q  E   S+IV+++ +   D+ + +++QLL+DF  D++C +G Q  ND   
Sbjct  771   LSEIKLSEDQMREHLVSLIVKNMGEVELDEDS-VRQQLLEDFSHDDLCSLGGQLFNDSPK  829

Query  1034  HNQSDDKTNDEV----VDPTFTVDDLGSHSDPNAH-PDSTPNLLDVNEFLDSVLETSNQV  1198
               Q D K    V    +D     D + S+   NA      P+LL V++ L SVLET++ V
Sbjct  830   KGQ-DGKLEKAVSLFGLDDDPRTDSVESNVPQNAKLTIEFPSLLSVDQLLQSVLETAHHV  888

Query  1199  GRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDE-------PDFNFSEETIWQP  1357
             GR S +     ++ D+A+ CE    GK  +M++    N         P  NF E      
Sbjct  889   GRMSVSTAPDTSYRDMANHCETLLVGKQQKMSYLISTNSRHGNLLAIPSRNFGEADKQIA  948

Query  1358  P------SGNPFADNNT-aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             P      SGNPF D N             P  CATEYQ HP    LPASSPYDNFLKAAG
Sbjct  949   PYSGVHKSGNPFLDQNMPGVVPGLPVGGPPVLCATEYQHHPHSFSLPASSPYDNFLKAAG  1008



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   380 bits (975),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 264/553 (48%), Positives = 344/553 (62%), Gaps = 53/553 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFPEALFHQ+L AMV PD+ETR+GAH VFSVVLVPSSV P    +     K     R
Sbjct  480   HNKAFPEALFHQLLPAMVHPDHETRIGAHCVFSVVLVPSSVSPNLFSSNTETKKAFDHHR  539

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGK------------DGMDQNTQNMLNRLTSTYSRS  325
             TLSR VSVFSSSAALF+KL + + S +            +G   N    L+RLTS+YSR+
Sbjct  540   TLSRAVSVFSSSAALFEKLRREKISSRESICEEDENNVPEGERNNNNGFLSRLTSSYSRT  599

Query  326   LSVKP-GSEETPN-NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S+K   +  TPN N  +  +  EG  L++ S QI++LL SI  Q+IS  N PE++EAI+
Sbjct  600   YSLKSLPAPSTPNENSMSNIKDLEGNYLRLSSHQITLLLLSISGQSISPGNMPENYEAIS  659

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             HTYSL++LFSR K SS E L+R FQLAFSLRSISL+E   +PPSRRRSLF LATSMI+FL
Sbjct  660   HTYSLVLLFSRAKNSSVEVLVRSFQLAFSLRSISLTE-GPLPPSRRRSLFTLATSMILFL  718

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL---KVNPNPKARASYGSKEDDEAAKR  850
             SK Y+F+ L   AKA LTDK +DPFLQLV+E  L   K  P+   R  YGS+EDD  A +
Sbjct  719   SKAYNFVSLVDRAKAKLTDKQVDPFLQLVEEYKLRTKKAGPD-HPRNIYGSQEDDNLAVK  777

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL-  1027
             +LS I I+ +QS ES+AS IVESL K    + + IKE+LL DF+PD++CP+G Q   +  
Sbjct  778   TLSRIVITDEQSRESYASEIVESLDKLSEPELSSIKEELLNDFVPDDICPLGAQLFMEAP  837

Query  1028  RNHNQSDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDST------PNLLDVNEFLDSVLE  1183
             +   Q D K ++ + +  P F V+D       N+H ++       PNLL+VN+ ++SV E
Sbjct  838   KKLYQVDFKNSESLKEDAPLFLVEDDYFPGSFNSHQNNVELSVDLPNLLNVNQLMESVQE  897

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM---------------NFREDGNDE  1318
             T+NQVGR S +  + +++ ++A  CEA   GK  +M               N  +  ND+
Sbjct  898   TANQVGRVSVSSKSDVSYKEMAGHCEALLLGKQQKMSKLVSSQKKQEYGMNNSSKIHNDD  957

Query  1319  -----PDFNFSEETIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHP-SFMQLP  1477
                  PD   S   +    SGNPFAD+  T+    P     P  CA EYQ++P S  +LP
Sbjct  958   LQEVTPD---SHMEVGSHMSGNPFADHTPTSHKLLPTQGHVPMLCAAEYQQNPHSSFRLP  1014

Query  1478  ASSPYDNFLKAAG  1516
             AS+PYDNFLKAAG
Sbjct  1015  ASNPYDNFLKAAG  1027



>ref|XP_011033325.1| PREDICTED: uncharacterized protein LOC105131844 isoform X3 [Populus 
euphratica]
Length=1000

 Score =   379 bits (972),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 340/539 (63%), Gaps = 44/539 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAH +FSVVLVPSS     +P   + +K   + R
Sbjct  471   QNKAFPEALFHQLLPAMVHPDHETRIGAHCIFSVVLVPSS----VSPCPSSNNKGSDLSR  526

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN-----------MLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL ++++S ++ + Q+++N           ML RL S+ S+  
Sbjct  527   TLSRTVSVFSSSAALFDKLRRDKTSTRENVFQDSKNYAHEGEQISNGMLARLKSSTSQVY  586

Query  329   SVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             S+K    P + +  N   N  +  E  SL++ SRQI++LLSSI+ Q+IS  NTP+++EAI
Sbjct  587   SLKNPLVPSTSD-ENLVSNLNKETEAGSLRLSSRQITLLLSSIWTQSISPANTPQNYEAI  645

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             +HTYSL++LFSR K SS E+LIR FQLAFSLR+I+L ++  +PPSRRRSLFALATSMI+F
Sbjct  646   SHTYSLVLLFSRAKNSSDEALIRSFQLAFSLRNIALKQEEPLPPSRRRSLFALATSMILF  705

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKR  850
              SK Y+ IPL    K +LT+K +DPFL LV++  L+         +  YGSK+DD +A +
Sbjct  706   TSKVYNIIPLIYCTKVVLTEKMIDPFLHLVEDRKLQAVSTESGHPAIVYGSKDDDSSALK  765

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLR  1030
             SLS I+++  QS E FA+ I +SL      + + I+E+LL +FLPD+VCP+G Q   D  
Sbjct  766   SLSEIDVTGNQSREFFAAEIAKSLGNLAKFEASTIQEKLLNEFLPDDVCPLGAQLFMDTP  825

Query  1031  NHNQSDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDST------PNLLDVNEFLDSVLET  1186
                   D  ++ +++  P FT+DD+   S  +    +T       +LL VN+ L+SVLET
Sbjct  826   MQIDQVDSEDNSLMEGTPLFTLDDVFLDSLEDQTTKATEIVFQDTDLLSVNQLLESVLET  885

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFSEE  1342
             + QVGR S   P  +++ ++A  CE    GK  +M+       +++   N  P  N  +E
Sbjct  886   TQQVGRLSVTAP-DVSYKEMARHCETLLMGKQQKMSHVMSVQLKQESLMNVSPQ-NHDDE  943

Query  1343  TIWQPPSGNPFADNNTaaa-gqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                     NPF + N  A+   P+       C  EYQ HP+F +LPASSP+DNFLKAAG
Sbjct  944   I---RKVTNPFLEQNIIASPHLPLVGTVQMQCGAEYQHHPNFFRLPASSPFDNFLKAAG  999



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   378 bits (971),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 243/535 (45%), Positives = 337/535 (63%), Gaps = 44/535 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAH +FSVVLVPSS     +P   + +K   + R
Sbjct  489   QNKAFPEALFHQLLPAMVHPDHETRIGAHCIFSVVLVPSS----VSPCPSSNNKGSDLSR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN-----------MLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL ++++S ++ + Q+++N           ML RL S+ S+  
Sbjct  545   TLSRTVSVFSSSAALFDKLRRDKTSTRENVFQDSKNYAHEGEQISNGMLARLKSSTSQVY  604

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             S+K      P       E+ E  SL++ SRQI++LLSSI+ Q+IS  NTP+++EAI+HTY
Sbjct  605   SLK-----NPLVPSTSDENLEAGSLRLSSRQITLLLSSIWTQSISPANTPQNYEAISHTY  659

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SS E+LIR FQLAFSLR+I+L ++  +PPSRRRSLFALATSMI+F SK 
Sbjct  660   SLVLLFSRAKNSSDEALIRSFQLAFSLRNIALKQEEPLPPSRRRSLFALATSMILFTSKV  719

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSG  862
             Y+ IPL    K +LT+K +DPFL LV++  L+         +  YGSK+DD +A +SLS 
Sbjct  720   YNIIPLIYCTKVVLTEKMIDPFLHLVEDRKLQAVSTESGHPAIVYGSKDDDSSALKSLSE  779

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ  1042
             I+++  QS E FA+ I +SL      + + I+E+LL +FLPD+VCP+G Q   D      
Sbjct  780   IDVTGNQSREFFAAEIAKSLGNLAKFEASTIQEKLLNEFLPDDVCPLGAQLFMDTPMQID  839

Query  1043  SDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDST------PNLLDVNEFLDSVLETSNQV  1198
               D  ++ +++  P FT+DD+   S  +    +T       +LL VN+ L+SVLET+ QV
Sbjct  840   QVDSEDNSLMEGTPLFTLDDVFLDSLEDQTTKATEIVFQDTDLLSVNQLLESVLETTQQV  899

Query  1199  GRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFSEETIWQ  1354
             GR S   P  +++ ++A  CE    GK  +M+       +++   N  P  N  +E    
Sbjct  900   GRLSVTAP-DVSYKEMARHCETLLMGKQQKMSHVMSVQLKQESLMNVSPQ-NHDDEI---  954

Query  1355  PPSGNPFADNNTaaa-gqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 NPF + N  A+   P+       C  EYQ HP+F +LPASSP+DNFLKAAG
Sbjct  955   RKVTNPFLEQNIIASPHLPLVGTVQMQCGAEYQHHPNFFRLPASSPFDNFLKAAG  1009



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   378 bits (971),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 340/539 (63%), Gaps = 44/539 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAH +FSVVLVPSS     +P   + +K   + R
Sbjct  489   QNKAFPEALFHQLLPAMVHPDHETRIGAHCIFSVVLVPSS----VSPCPSSNNKGSDLSR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN-----------MLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALFDKL ++++S ++ + Q+++N           ML RL S+ S+  
Sbjct  545   TLSRTVSVFSSSAALFDKLRRDKTSTRENVFQDSKNYAHEGEQISNGMLARLKSSTSQVY  604

Query  329   SVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             S+K    P + +  N   N  +  E  SL++ SRQI++LLSSI+ Q+IS  NTP+++EAI
Sbjct  605   SLKNPLVPSTSD-ENLVSNLNKETEAGSLRLSSRQITLLLSSIWTQSISPANTPQNYEAI  663

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             +HTYSL++LFSR K SS E+LIR FQLAFSLR+I+L ++  +PPSRRRSLFALATSMI+F
Sbjct  664   SHTYSLVLLFSRAKNSSDEALIRSFQLAFSLRNIALKQEEPLPPSRRRSLFALATSMILF  723

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKR  850
              SK Y+ IPL    K +LT+K +DPFL LV++  L+         +  YGSK+DD +A +
Sbjct  724   TSKVYNIIPLIYCTKVVLTEKMIDPFLHLVEDRKLQAVSTESGHPAIVYGSKDDDSSALK  783

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLR  1030
             SLS I+++  QS E FA+ I +SL      + + I+E+LL +FLPD+VCP+G Q   D  
Sbjct  784   SLSEIDVTGNQSREFFAAEIAKSLGNLAKFEASTIQEKLLNEFLPDDVCPLGAQLFMDTP  843

Query  1031  NHNQSDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDST------PNLLDVNEFLDSVLET  1186
                   D  ++ +++  P FT+DD+   S  +    +T       +LL VN+ L+SVLET
Sbjct  844   MQIDQVDSEDNSLMEGTPLFTLDDVFLDSLEDQTTKATEIVFQDTDLLSVNQLLESVLET  903

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFSEE  1342
             + QVGR S   P  +++ ++A  CE    GK  +M+       +++   N  P  N  +E
Sbjct  904   TQQVGRLSVTAP-DVSYKEMARHCETLLMGKQQKMSHVMSVQLKQESLMNVSPQ-NHDDE  961

Query  1343  TIWQPPSGNPFADNNTaaa-gqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                     NPF + N  A+   P+       C  EYQ HP+F +LPASSP+DNFLKAAG
Sbjct  962   I---RKVTNPFLEQNIIASPHLPLVGTVQMQCGAEYQHHPNFFRLPASSPFDNFLKAAG  1017



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   376 bits (965),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 245/559 (44%), Positives = 329/559 (59%), Gaps = 62/559 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  474   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  529

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL        DG  +                           
Sbjct  530   RTLSRTVSVFSSSAALFRKLKMESDKSADGAAKIERVSTLSRSQSRFASRGESFDEEEPK  589

Query  278   -NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIF  448
              NT ++L+RL S+YSRS SVK  P S  +  +     E    + L++ S QI +LLSSI+
Sbjct  590   NNTSSVLSRLKSSYSRSQSVKRNPSSMVSDQDPLGGSEEKPVIPLRLSSHQICLLLSSIW  649

Query  449   VQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPP  628
             VQ++S  N P+++EAIA+TYSL++LF RTK SS+E L+  FQLAFSLR++SL     + P
Sbjct  650   VQSLSPHNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVWSFQLAFSLRNLSLG--GPLQP  707

Query  629   SRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV---NPNP  799
             SRRRSLF LATSMIIF ++ ++  PL  +AK  L +KT+DPFLQLV++  L         
Sbjct  708   SRRRSLFTLATSMIIFAARAFNIPPLVNNAKTALQEKTVDPFLQLVEDSKLDAVFYGQEE  767

Query  800   KARASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQD  976
             +    YGSKEDD+ A  SL  I E ++ Q  E +A+MI++ L K     ++ I+EQL+ D
Sbjct  768   QPAKGYGSKEDDDDALISLVAIEETTQNQPREHYAAMIMKFLGKLSDQDSSSIREQLVSD  827

Query  977   FLPDEVCPMGTQRINDLRNHNQSDDKTN-----DEV------VD--PTFTVDDLGSHSDP  1117
             F+P + CP+GTQ      + ++S+DK N     DE       +D  PT   D L   + P
Sbjct  828   FIPIDGCPVGTQLTESPVHVHRSEDKNNKPREMDETQSLIPEIDAAPTPPEDQLALDTQP  887

Query  1118  NAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF  1297
             NA    T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+F
Sbjct  888   NA---KTAFLLSIDELLSAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMSF  944

Query  1298  REDGNDEPDFNFSEETIWQPPS---GNPFAD--NNTaaagqpvnaaapaSCATEYQRHPS  1462
                 +++      E T    PS   GNPF D  N+    G    AAA   C TEYQ HP 
Sbjct  945   MSAKSNKFSNQTKESTSPALPSGGGGNPFVDQPNSWETMGLGAPAAASNMCVTEYQNHPP  1004

Query  1463  FMQLPASSPYDNFLKAAGS  1519
             F   P+S+P+DNFLK  GS
Sbjct  1005  FFNPPSSTPFDNFLKPVGS  1023



>gb|EYU20743.1| hypothetical protein MIMGU_mgv1a000711mg [Erythranthe guttata]
Length=1009

 Score =   374 bits (961),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 229/536 (43%), Positives = 322/536 (60%), Gaps = 41/536 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             + KAFPEALFHQ++ AM+ PD+ETR+GAHR+FSVVLVP+SV P+        +K   I R
Sbjct  483   KKKAFPEALFHQLIQAMLHPDHETRIGAHRIFSVVLVPTSVAPQANSCVTDSNKSMGIPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGK--------DGMDQNTQNMLNRLTSTYSRSLSVK  337
             TLSRTVSVFSSSAALF+KL KNQ   K        D  +     + NRL STYSR+ S++
Sbjct  543   TLSRTVSVFSSSAALFEKL-KNQRVPKENQIELNIDPRNNPANGVFNRLKSTYSRAYSIR  601

Query  338   PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLL  517
                   P    +  +  E + L++ S QI++LLSS++ Q++S  N PE++EAIAHTYSL+
Sbjct  602   ESPAPAP--ATDATKEMENVPLRLSSHQITLLLSSLWAQSMSPANMPENYEAIAHTYSLV  659

Query  518   MLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSF  697
             +LFSR K S  ++LIR FQLAFSLR+ SL++   +PPSRRRSLF L+TSMIIF SK Y+ 
Sbjct  660   LLFSRAKNSYRDALIRSFQLAFSLRNFSLAQGGNLPPSRRRSLFVLSTSMIIFSSKAYNV  719

Query  698   IPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             +PL    K+ +++K +DPFL LVD+  L+++ +      YGSKEDD +A + LS I+I++
Sbjct  720   LPLIEHLKSAVSNKVVDPFLYLVDDSKLQLS-DKNQNILYGSKEDDSSALKLLSEIKINQ  778

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL--RNHNQSDD  1051
              Q+ E   S+I+++L   +  +   I+EQLL++F PD++C  G Q  ND     H+ S +
Sbjct  779   NQTKEFLVSVIIKNLANLLEPEEATIREQLLKEFAPDDLCSFGGQMFNDSPEEAHHMSLE  838

Query  1052  KTNDEVVDPTFTVDDLGSHSDPN--AHPDST------PNLLDVNEFLDSVLETSNQVGRQ  1207
             K           +DD  SH D N  + P ++      PNLL V++ L SVLET++ VGR 
Sbjct  839   KAVS-----ICGIDDF-SHQDSNESSFPHNSRLTIEFPNLLSVDQLLQSVLETAHHVGRM  892

Query  1208  SAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDE--------PDFNFSEETIWQPPS  1363
             S +     ++ ++A+ CE    GK  +M++  + +          P  ++  E    P  
Sbjct  893   SVSNAPDASYKEMANHCETLLMGKQQKMSYLINTHPRQGSMLTISPQNSYETEKQNLPSH  952

Query  1364  GNPFADNNTaaagqpvnaaap-----aSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                   N T   G   N  +      + C  EYQ HP   +LPASSPYDNFLKAAG
Sbjct  953   VVGLQKNTTTQGGVVPNRPSSGGPTPSQCGAEYQHHPLSFRLPASSPYDNFLKAAG  1008



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   374 bits (961),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 246/553 (44%), Positives = 333/553 (60%), Gaps = 53/553 (10%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALF+Q+L AMV PD+ETR+GAH++FSVVLVPSSV P  +       K   + R LS
Sbjct  476   AFPEALFYQLLPAMVHPDHETRVGAHQIFSVVLVPSSVYPNPSTNSAESRKAGDLPRALS  535

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ-NTQNM-------------LNRLTSTYSRSL  328
             RTVSVFSSSAALFDKL ++++  +D   Q N  N+             LNRL S+YSR+ 
Sbjct  536   RTVSVFSSSAALFDKLRRDKTMSRDNTHQDNRDNIASEGQPRNSGNGGLNRLKSSYSRAY  595

Query  329   SVK--PGSEETPNNG-ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             S K  P S  T  N   + +      SL++ SRQI++LLSSI+ Q+IS  N PE++EAIA
Sbjct  596   SRKASPASAMTDGNSMSDFKTEPAANSLRLSSRQITLLLSSIWAQSISPANMPENYEAIA  655

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             HTYSL++LFSR K SS+E LIR FQL+FSLR+ISL+E + +PPSRRRSLF LATSMI+F 
Sbjct  656   HTYSLVLLFSRAKNSSNEVLIRSFQLSFSLRNISLNEGSPLPPSRRRSLFTLATSMILFS  715

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRS  853
             +K ++   L   +K LLT+K +DPFL L ++  L+     +   +  +GSKEDD+ A + 
Sbjct  716   AKAFNIHSLVQPSKLLLTEKKVDPFLHLFEDKKLRAIHTGSDLPKIIFGSKEDDDLALKF  775

Query  854   LSGIEISKKQSTESFASMIVESLKKSIT-----DKTNLIKEQLLQDFLPDEVCPMGTQRI  1018
             LS IE +  Q+ ES  S I++SL+   T      + + +KEQLL +FLPD++CP+G Q +
Sbjct  776   LSEIENTDDQTRESLTSEILKSLENLPTIQLSSSELSSMKEQLLSEFLPDDLCPLGAQFM  835

Query  1019  ---NDLRNHNQSDDKTNDEVVDPTFTVDDLG----SHSDPNAHPD---STPNLLDVNEFL  1168
                N +   +  + K+  E+    FT+DD        S   ++P+     P LL VN+ L
Sbjct  836   DNPNKIYLVDSKNSKSQKEIAT-LFTIDDDAFNDSYESQDKSNPELAKEIPCLLSVNQLL  894

Query  1169  DSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGN--DEPDFNFS--  1336
             +SVLET++QVGR S +  A M + ++A  CEA   GK  +M+         E   NFS  
Sbjct  895   ESVLETTHQVGRISVS-TADMPYKEMAGHCEALLIGKQKKMSHLMSAQLRQESLINFSIT  953

Query  1337  -------EETIWQPPSG-----NPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLP  1477
                    E    Q  +G     NP  D   T  + +P        CA+EYQ HP + +LP
Sbjct  954   NHENEVNEVLPSQVDAGSLMVDNPLTDERITPNSNKPPVGTVTTQCASEYQHHPQYFRLP  1013

Query  1478  ASSPYDNFLKAAG  1516
             ASSPYDNFLKAAG
Sbjct  1014  ASSPYDNFLKAAG  1026



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   372 bits (956),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 242/529 (46%), Positives = 319/529 (60%), Gaps = 30/529 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+IS  N PE++EAIAHT+SL++L
Sbjct  603   PAPIEESTNKPSNEMGPISLRLSSHQIVLLLSSIWVQSISPANMPENYEAIAHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  663   FSRAKNSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  723   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  783   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSN--  840

Query  1058  NDEVVDPTFTVDDLGS---HSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                +VD T   DD G    HS    +  S    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  841   ---LVDLTSIFDDDGPDLFHSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRMSVST  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFRED----GNDEPDFNFSEETIWQPPSGN  1369
                 ++ ++A  CEA   GK  +M        R+D    G  E   +  EE+       N
Sbjct  898   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIGISESSSDQGEESASDNQVEN  957

Query  1370  PFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
               AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  958   QLADQKVADVSDKPTREIVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  1006



>ref|XP_010523669.1| PREDICTED: uncharacterized protein LOC104801976 isoform X3 [Tarenaya 
hassleriana]
Length=985

 Score =   372 bits (954),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 239/567 (42%), Positives = 324/567 (57%), Gaps = 76/567 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             QNKAFP+ALFHQ+L AMV  D+E+R+GAHR+FS+VLVPSSVCP   P     S+R + IQ
Sbjct  433   QNKAFPDALFHQLLQAMVCTDHESRMGAHRIFSIVLVPSSVCPNSVPK----SRRPADIQ  488

Query  179   RTLSRTVSVFSSSAALFDKLGK------------------NQSSGK--------------  262
             RTLSRTVSVFSSSAALF KL                    N+S  K              
Sbjct  489   RTLSRTVSVFSSSAALFRKLKVESDKSTEDTAKVNRVSTLNRSKSKFTRGYSIKEHQASE  548

Query  263   -----DGMDQNTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQ  421
                  D    N+ ++L++L S+YSR+ S+K  P S     N          + L++ S Q
Sbjct  549   YFDDDDEPKNNSNSVLSKLKSSYSRTRSLKKNPSSVVADQNATGNSSEKPVIPLRLSSHQ  608

Query  422   ISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSIS  601
             I++LLSSI+VQ++S  N P+++EAIA+TYSL++LF RTK SS+E L+R FQLAFSLR+IS
Sbjct  609   ITLLLSSIWVQSMSPQNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVRSFQLAFSLRNIS  668

Query  602   LSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL  781
             L     + PSRRRSLF LATSMIIF +K +   PL  SAKA L +KT+DPFLQLV++C L
Sbjct  669   LGALGSLQPSRRRSLFTLATSMIIFSAKAFDVPPLVNSAKAALNEKTVDPFLQLVEDCKL  728

Query  782   K-----VNPNPKARASYGSKEDDEAAKRSLSGIEIS-KKQSTESFASMIVESLKKSITDK  943
                   +   P+ +  YGSKEDD+ A  SL+ IE + + Q  E +A+MIV+ L K     
Sbjct  729   DALFYGLENQPEKK--YGSKEDDDDALNSLAAIEETIQHQPREYYATMIVKFLGKLSDQN  786

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHS  1111
                IKEQL+ DF+PD+ CP+G Q     + ++    +  DK+     +P   V    + S
Sbjct  787   AWSIKEQLVADFIPDDGCPVGAQLTETLVQEVYQSEEKRDKSQATYAEPPLLVPGSDALS  846

Query  1112  DPNAHPDSTP-----NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEG  1276
              P+   D+ P     +LL ++E L++V +T+ Q+GR S   P  MT+ ++A  CEA   G
Sbjct  847   SPHPELDAQPSVNKLSLLSIDELLNAVSQTTAQLGRYSVTEPPEMTYSEMAGHCEALMMG  906

Query  1277  KGNRMNFREDGND---EPDFNFS---EETIWQPPSGNPFADNNTaaagqpvnaaapaSCA  1438
             K  +M+F    N+     + N +   EE +    +GNPF                    A
Sbjct  907   KQEKMSFMGSNNNMMVHSNHNCARREEEELRVSMTGNPFVQEKRERERV---------IA  957

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAGS  1519
              EYQ H      P S+P+DNFLKAAGS
Sbjct  958   GEYQHHHHHFNPPPSTPFDNFLKAAGS  984



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   371 bits (953),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 239/567 (42%), Positives = 324/567 (57%), Gaps = 76/567 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             QNKAFP+ALFHQ+L AMV  D+E+R+GAHR+FS+VLVPSSVCP   P     S+R + IQ
Sbjct  476   QNKAFPDALFHQLLQAMVCTDHESRMGAHRIFSIVLVPSSVCPNSVPK----SRRPADIQ  531

Query  179   RTLSRTVSVFSSSAALFDKLGK------------------NQSSGK--------------  262
             RTLSRTVSVFSSSAALF KL                    N+S  K              
Sbjct  532   RTLSRTVSVFSSSAALFRKLKVESDKSTEDTAKVNRVSTLNRSKSKFTRGYSIKEHQASE  591

Query  263   -----DGMDQNTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQ  421
                  D    N+ ++L++L S+YSR+ S+K  P S     N          + L++ S Q
Sbjct  592   YFDDDDEPKNNSNSVLSKLKSSYSRTRSLKKNPSSVVADQNATGNSSEKPVIPLRLSSHQ  651

Query  422   ISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSIS  601
             I++LLSSI+VQ++S  N P+++EAIA+TYSL++LF RTK SS+E L+R FQLAFSLR+IS
Sbjct  652   ITLLLSSIWVQSMSPQNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVRSFQLAFSLRNIS  711

Query  602   LSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL  781
             L     + PSRRRSLF LATSMIIF +K +   PL  SAKA L +KT+DPFLQLV++C L
Sbjct  712   LGALGSLQPSRRRSLFTLATSMIIFSAKAFDVPPLVNSAKAALNEKTVDPFLQLVEDCKL  771

Query  782   K-----VNPNPKARASYGSKEDDEAAKRSLSGIEIS-KKQSTESFASMIVESLKKSITDK  943
                   +   P+ +  YGSKEDD+ A  SL+ IE + + Q  E +A+MIV+ L K     
Sbjct  772   DALFYGLENQPEKK--YGSKEDDDDALNSLAAIEETIQHQPREYYATMIVKFLGKLSDQN  829

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHS  1111
                IKEQL+ DF+PD+ CP+G Q     + ++    +  DK+     +P   V    + S
Sbjct  830   AWSIKEQLVADFIPDDGCPVGAQLTETLVQEVYQSEEKRDKSQATYAEPPLLVPGSDALS  889

Query  1112  DPNAHPDSTP-----NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEG  1276
              P+   D+ P     +LL ++E L++V +T+ Q+GR S   P  MT+ ++A  CEA   G
Sbjct  890   SPHPELDAQPSVNKLSLLSIDELLNAVSQTTAQLGRYSVTEPPEMTYSEMAGHCEALMMG  949

Query  1277  KGNRMNFREDGND---EPDFNFS---EETIWQPPSGNPFADNNTaaagqpvnaaapaSCA  1438
             K  +M+F    N+     + N +   EE +    +GNPF                    A
Sbjct  950   KQEKMSFMGSNNNMMVHSNHNCARREEEELRVSMTGNPFVQEKRERERV---------IA  1000

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAGS  1519
              EYQ H      P S+P+DNFLKAAGS
Sbjct  1001  GEYQHHHHHFNPPPSTPFDNFLKAAGS  1027



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   370 bits (951),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 244/556 (44%), Positives = 327/556 (59%), Gaps = 62/556 (11%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQRTL  187
             AFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +QRTL
Sbjct  449   AFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQRTL  504

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDG-----------------------MDQ-----NT  283
             SRTVSVFSSSAALF KL        DG                        D+     NT
Sbjct  505   SRTVSVFSSSAALFRKLKMESDKSADGGAKIERVSTLSRSQSRFASRGESFDEEEPKNNT  564

Query  284   QNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
              ++L+RL S+YSRS SVK  P S  +  +     E    + L++ S QI +LLSSI+VQ+
Sbjct  565   SSVLSRLKSSYSRSQSVKRNPSSMVSDQDPLGGSEEKPVIPLRLSSHQICLLLSSIWVQS  624

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             +S  N P+++EAIA+TYSL++LF RTK SS+E L+  FQLAFSLR++SL     + PSRR
Sbjct  625   LSPHNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVWSFQLAFSLRNLSLG--GPLQPSRR  682

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV---NPNPKAR  808
             RSLF LATSMIIF ++ ++  PL  +AK  L +KT+DPFLQLV++  L         +  
Sbjct  683   RSLFTLATSMIIFAARAFNIPPLVNNAKTALQEKTVDPFLQLVEDSKLDAVFYGQEEQPA  742

Query  809   ASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLP  985
               YGSKEDD+ A  SL  I E ++ Q  E +A+MI++ L K     ++ I+EQL+ DF+P
Sbjct  743   KGYGSKEDDDDALISLVAIEETTQNQPREHYAAMIMKFLGKLSDQDSSSIREQLVSDFIP  802

Query  986   DEVCPMGTQRINDLRNHNQSDDKTN-----DEV------VD--PTFTVDDLGSHSDPNAH  1126
              + CP+GTQ      + ++S+DK N     DE       +D  PT   D L   + PNA 
Sbjct  803   IDGCPVGTQLTESPVHVHRSEDKNNKPREMDETQSLIPEIDAAPTPPEDQLALDTQPNA-  861

Query  1127  PDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFRED  1306
                T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+F   
Sbjct  862   --KTAFLLSIDELLSAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMSFMSA  919

Query  1307  GNDEPDFNFSEETIWQPPS---GNPFAD--NNTaaagqpvnaaapaSCATEYQRHPSFMQ  1471
              +++      E T    PS   GNPF D  N+    G    AAA   C TEYQ HP F  
Sbjct  920   KSNKFSNQTKESTSPALPSGGGGNPFVDQPNSWETMGLGAPAAASNMCVTEYQNHPPFFN  979

Query  1472  LPASSPYDNFLKAAGS  1519
              P+S+P+DNFLK  GS
Sbjct  980   PPSSTPFDNFLKPVGS  995



>ref|XP_010319194.1| PREDICTED: uncharacterized protein LOC101246912 isoform X4 [Solanum 
lycopersicum]
Length=914

 Score =   367 bits (943),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 239/534 (45%), Positives = 319/534 (60%), Gaps = 36/534 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  385   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  444

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  445   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  504

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+IS  N PE++EAIAHT+SL++L
Sbjct  505   PAPIEESTNKPSNEMGPISLRLSSHQIVLLLSSIWVQSISPANMPENYEAIAHTFSLVLL  564

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  565   FSRAKNSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  624

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  625   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  684

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  685   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSN--  742

Query  1058  NDEVVDPTFTVDDLGS---HSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                +VD T   DD G    HS    +  S    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  743   ---LVDLTSIFDDDGPDLFHSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRMSVST  799

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM---------------NFREDGNDEPDFNFSEETIWQ  1354
                 ++ ++A  CEA   GK  +M                  E  +D+ + + S+  +  
Sbjct  800   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIGISESSSDQGEESASDNQV-D  858

Query  1355  PPSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
                 N  AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  859   NQVENQLADQKVADVSDKPTREIVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  912



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   366 bits (940),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 242/533 (45%), Positives = 319/533 (60%), Gaps = 34/533 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  444   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  503

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  504   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  563

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+IS  N PE++EAIAHT+SL++L
Sbjct  564   PAPIEESTNKPSNEMGPISLRLSSHQIVLLLSSIWVQSISPANMPENYEAIAHTFSLVLL  623

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  624   FSRAKNSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  683

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  684   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  743

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  744   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSN--  801

Query  1058  NDEVVDPTFTVDDLGS---HSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                +VD T   DD G    HS    +  S    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  802   ---LVDLTSIFDDDGPDLFHSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRMSVST  858

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFRED----GNDEPDFNFSEETI----WQP  1357
                 ++ ++A  CEA   GK  +M        R+D    G  E   +  EE+        
Sbjct  859   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIGISESSSDQGEESASDNQVDN  918

Query  1358  PSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
                N  AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  919   QVENQLADQKVADVSDKPTREIVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  971



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   367 bits (942),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 239/534 (45%), Positives = 319/534 (60%), Gaps = 36/534 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+IS  N PE++EAIAHT+SL++L
Sbjct  603   PAPIEESTNKPSNEMGPISLRLSSHQIVLLLSSIWVQSISPANMPENYEAIAHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  663   FSRAKNSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  723   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  783   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSN--  840

Query  1058  NDEVVDPTFTVDDLGS---HSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                +VD T   DD G    HS    +  S    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  841   ---LVDLTSIFDDDGPDLFHSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRMSVST  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM---------------NFREDGNDEPDFNFSEETIWQ  1354
                 ++ ++A  CEA   GK  +M                  E  +D+ + + S+  +  
Sbjct  898   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIGISESSSDQGEESASDNQV-D  956

Query  1355  PPSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
                 N  AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  957   NQVENQLADQKVADVSDKPTREIVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  1010



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   364 bits (934),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 239/529 (45%), Positives = 315/529 (60%), Gaps = 30/529 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  444   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  503

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  504   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  563

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+I   N PE++EAIAHT+SL++L
Sbjct  564   PAPIEESMNKPSNEMGPISLRLSSHQIVLLLSSIWVQSIYPANMPENYEAIAHTFSLVLL  623

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  624   FSRAKNSYREALVQSFQLAFSLRNVALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  683

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  684   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  743

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  744   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSNS-  802

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNAHPD-STPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD T   DD G     S S  N       PNLL VN+ L+SVLET++QVGR S + 
Sbjct  803   ----VDLTSIFDDDGPDLFYSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISVST  858

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFREDGN----DEPDFNFSEETIWQPPSGN  1369
                 ++ ++A  CEA   GK  +M        R+D       E   +  EE+       N
Sbjct  859   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIEISESSSDQGEESASDNQVEN  918

Query  1370  PFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
               AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  919   QLADQKVADVSDKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  967



>ref|XP_006350205.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Solanum tuberosum]
Length=974

 Score =   364 bits (934),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 239/529 (45%), Positives = 315/529 (60%), Gaps = 30/529 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  449   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  508

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  509   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  568

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+I   N PE++EAIAHT+SL++L
Sbjct  569   PAPIEESMNKPSNEMGPISLRLSSHQIVLLLSSIWVQSIYPANMPENYEAIAHTFSLVLL  628

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  629   FSRAKNSYREALVQSFQLAFSLRNVALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  688

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  689   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  748

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  749   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSNS-  807

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNAHPD-STPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD T   DD G     S S  N       PNLL VN+ L+SVLET++QVGR S + 
Sbjct  808   ----VDLTSIFDDDGPDLFYSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISVST  863

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFREDGN----DEPDFNFSEETIWQPPSGN  1369
                 ++ ++A  CEA   GK  +M        R+D       E   +  EE+       N
Sbjct  864   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIEISESSSDQGEESASDNQVEN  923

Query  1370  PFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
               AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  924   QLADQKVADVSDKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  972



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   364 bits (935),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 236/567 (42%), Positives = 321/567 (57%), Gaps = 85/567 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             QNKAFP+ALFHQ+L AMV  D+E+R+GAHR+FS+VLVPSSVCP   P     S+R + IQ
Sbjct  476   QNKAFPDALFHQLLQAMVCTDHESRMGAHRIFSIVLVPSSVCPNSVPK----SRRPADIQ  531

Query  179   RTLSRTVSVFSSSAALFDKLGK------------------NQSSGK--------------  262
             RTLSRTVSVFSSSAALF KL                    N+S  K              
Sbjct  532   RTLSRTVSVFSSSAALFRKLKVESDKSTEDTAKVNRVSTLNRSKSKFTRGYSIKEHQASE  591

Query  263   -----DGMDQNTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQ  421
                  D    N+ ++L++L S+YSR+ S+K  P S     N          + L++ S Q
Sbjct  592   YFDDDDEPKNNSNSVLSKLKSSYSRTRSLKKNPSSVVADQNATGNSSEKPVIPLRLSSHQ  651

Query  422   ISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSIS  601
             I++LLSSI+VQ++S  N P+++EAIA+TYSL++LF RTK SS+E L+R FQLAFSLR+IS
Sbjct  652   ITLLLSSIWVQSMSPQNMPQNYEAIANTYSLVLLFGRTKNSSNEVLVRSFQLAFSLRNIS  711

Query  602   LSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL  781
             L     + PSRRRSLF LATSMIIF +K +   PL  SAKA L +KT+DPFLQLV++C L
Sbjct  712   LGALGSLQPSRRRSLFTLATSMIIFSAKAFDVPPLVNSAKAALNEKTVDPFLQLVEDCKL  771

Query  782   K-----VNPNPKARASYGSKEDDEAAKRSLSGIEIS-KKQSTESFASMIVESLKKSITDK  943
                   +   P+ +  YGSKEDD+ A  SL+ IE + + Q  E +A+MI  +        
Sbjct  772   DALFYGLENQPEKK--YGSKEDDDDALNSLAAIEETIQHQPREYYATMIQNAWS------  823

Query  944   TNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHS  1111
                IKEQL+ DF+PD+ CP+G Q     + ++    +  DK+     +P   V    + S
Sbjct  824   ---IKEQLVADFIPDDGCPVGAQLTETLVQEVYQSEEKRDKSQATYAEPPLLVPGSDALS  880

Query  1112  DPNAHPDSTP-----NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEG  1276
              P+   D+ P     +LL ++E L++V +T+ Q+GR S   P  MT+ ++A  CEA   G
Sbjct  881   SPHPELDAQPSVNKLSLLSIDELLNAVSQTTAQLGRYSVTEPPEMTYSEMAGHCEALMMG  940

Query  1277  KGNRMNFREDGND---EPDFNFS---EETIWQPPSGNPFADNNTaaagqpvnaaapaSCA  1438
             K  +M+F    N+     + N +   EE +    +GNPF                    A
Sbjct  941   KQEKMSFMGSNNNMMVHSNHNCARREEEELRVSMTGNPFVQEKRERERVI---------A  991

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAGS  1519
              EYQ H      P S+P+DNFLKAAGS
Sbjct  992   GEYQHHHHHFNPPPSTPFDNFLKAAGS  1018



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   364 bits (934),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 239/529 (45%), Positives = 315/529 (60%), Gaps = 30/529 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++      L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVSEETHLRKAADFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD----GMDQ--NTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +S   +    GM+Q  N   MLNR+ STYS   S+K  
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSPSMEKVTLGMEQKDNNSGMLNRIKSTYSGVYSMKGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P      +SL++ S QI +LLSSI+VQ+I   N PE++EAIAHT+SL++L
Sbjct  603   PAPIEESMNKPSNEMGPISLRLSSHQIVLLLSSIWVQSIYPANMPENYEAIAHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMIIF SK Y+   
Sbjct  663   FSRAKNSYREALVQSFQLAFSLRNVALIEGGSLPPSRKRSLFVLATSMIIFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+DKT+DPFL LV++  L+   + +   + +YGS EDD +A++ LS I I++
Sbjct  723   LVPRVKAALSDKTVDPFLHLVEDSKLQAAESSSGNGKVTYGSNEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QST+S  S+I++SL      + + ++E+LL+ F PD+   +GTQ   D +   Q  +  
Sbjct  783   EQSTQSMISLILKSLSNLSDLEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSNS-  841

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNAHPD-STPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD T   DD G     S S  N       PNLL VN+ L+SVLET++QVGR S + 
Sbjct  842   ----VDLTSIFDDDGPDLFYSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISVST  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFREDGN----DEPDFNFSEETIWQPPSGN  1369
                 ++ ++A  CEA   GK  +M        R+D       E   +  EE+       N
Sbjct  898   EPEFSYKEMAHHCEALLTGKQQKMYNLMNSQHRQDNALIEISESSSDQGEESASDNQVEN  957

Query  1370  PFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASSPYDNFLKAA  1513
               AD   A            S C  EYQ +P   +LPASSPYDNFLKAA
Sbjct  958   QLADQKVADVSDKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAA  1006



>ref|XP_010454428.1| PREDICTED: uncharacterized protein LOC104736187 [Camelina sativa]
Length=1034

 Score =   363 bits (933),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 238/553 (43%), Positives = 322/553 (58%), Gaps = 63/553 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  486   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  541

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL     S  D   +                           
Sbjct  542   RTLSRTVSVFSSSAALFRKLKLESDSSVDDTAKMERVSTLSRSKSKFTRGESFDDEEPKN  601

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+YSR+ SVK  P S     N          + L++ S QI +LLSSI+V
Sbjct  602   NTSSVLSRLKSSYSRTQSVKRNPSSTVLDQNSSGSSPEKPVIPLRLSSHQICLLLSSIWV  661

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  662   QSLSPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  719

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA--  805
             RRRSLF LATSMIIF ++ ++  PL  SAK  L +KT+DPF+ LV++C L      +A  
Sbjct  720   RRRSLFTLATSMIIFSARAFNIPPLVNSAKTALQEKTVDPFIHLVEDCKLDAVFYGQAEQ  779

Query  806   -RASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKEDDE A RS   I E ++ Q  E +ASMI++ L K     ++ IKEQL+ DF
Sbjct  780   PEKNYGSKEDDEDALRSFVAIEETTQNQPREHYASMIMKFLGKLSDQDSSSIKEQLVSDF  839

Query  980   LPDEVCPMGTQRINDLRNHNQSDDKT---------------NDEVVDPTFTVDDLGSHSD  1114
             LP + CP+GTQ     +   +S++K                ND V  P+   + LG  + 
Sbjct  840   LPIDGCPVGTQLTESPKQVYRSEEKNNKTRDNAETQLLIPENDAV--PSPLEEQLGLDTQ  897

Query  1115  PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN  1294
             PNA    T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+
Sbjct  898   PNA---KTAFLLSIDELLSAVSQTTAQMGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMS  954

Query  1295  FRE-DGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFM  1468
             F     N   +    E T      GNPF +  ++     + A A ++ C TEYQ  P F 
Sbjct  955   FMSAKSNKFGNSQTKEPTALPCGGGNPFVEQRSSWEMMGLGAPASSNVCVTEYQT-PPFF  1013

Query  1469  QLPASSPYDNFLK  1507
               PAS+P+DNFLK
Sbjct  1014  NPPASTPFDNFLK  1026



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   363 bits (932),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 237/554 (43%), Positives = 327/554 (59%), Gaps = 62/554 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  477   ENKAFPDALFHQLLQAMVCVDHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  532

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL     S  D   +                           
Sbjct  533   RTLSRTVSVFSSSAALFRKLKLESDSSVDDTAKMERVSTLSRSNSKFTRGESFDDEEPKN  592

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+YSRS SVK  P S     N          + L++ S QI +LLSSI+V
Sbjct  593   NTSSVLSRLKSSYSRSQSVKRNPSSTILDQNSLGGSPEKPVIPLRLSSHQICLLLSSIWV  652

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  653   QSLSPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  710

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV---NPNPK  802
             RRRSLF LATSMIIF ++ ++  PL  SAK  L +KT+DPFL LV++C L         +
Sbjct  711   RRRSLFTLATSMIIFSARAFNIPPLVNSAKTALQEKTVDPFLHLVEDCKLDAVFYGHAEQ  770

Query  803   ARASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKED++ A  SL  I E ++ Q  E +ASMI++ L K     ++ IKEQL+ DF
Sbjct  771   PEKNYGSKEDNDDALHSLVVIEETTQNQPREHYASMIMKFLGKLSEQDSSSIKEQLVSDF  830

Query  980   LPDEVCPMGTQ---------RINDLRNHNQSDDKT------NDEVVDPTFTVDDLGSHSD  1114
             +P + CP+GTQ         R  +  N  + + +T      ND    P+   D L   + 
Sbjct  831   IPIDGCPVGTQLTESPVQVYRCEEKNNKPRENAETQLLIPENDAA--PSPPEDQLALDTQ  888

Query  1115  PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN  1294
             PNA    T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+
Sbjct  889   PNA---KTAFLLSIDELLSAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMS  945

Query  1295  FREDGNDEPDFNFSEETIWQPP-SGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFM  1468
             F    +++   + ++E    P   GNPF ++ ++     + A A ++ C TEYQ HP F 
Sbjct  946   FMSAKSNKFSSSQTKEPTALPSGGGNPFVEHGSSWEMVGMGAPAASNVCLTEYQNHPPFF  1005

Query  1469  QLPASSPYDNFLKA  1510
               PAS+P+DNFLKA
Sbjct  1006  NPPASTPFDNFLKA  1019



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   362 bits (930),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 235/551 (43%), Positives = 324/551 (59%), Gaps = 59/551 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  476   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  531

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL     S  D   +                           
Sbjct  532   RTLSRTVSVFSSSAALFRKLKLESDSSVDDTAKMERVSTLSRSKSKFIRGESFDDEEPKN  591

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+YSR+ SVK  P S     N          + L++ S QI +LLSSI+V
Sbjct  592   NTSSVLSRLKSSYSRTQSVKRNPSSTVLDQNSSGSSPEKPVIPLRLSSHQICLLLSSIWV  651

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  652   QSLSPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  709

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA--  805
             RRRSLF LATSMIIF +K ++  PL  SAK  L +KT+DPFL LV++C L      +A  
Sbjct  710   RRRSLFTLATSMIIFSAKAFNIPPLVTSAKTALQEKTVDPFLHLVEDCKLDAVFYGQAEQ  769

Query  806   -RASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKEDDE A RS   I E ++ Q  E +A MI++ L K     ++ IKEQL+ DF
Sbjct  770   PEKNYGSKEDDEDALRSFVAIEETTQNQPREHYAFMIMKFLGKLSDQDSSSIKEQLVSDF  829

Query  980   LPDEVCPMGTQRINDLR-------NHNQSDDKTNDEVVDPTFTV------DDLGSHSDPN  1120
             +P + CP+GTQ     +       N+N+  D    +++ P          + LG  + PN
Sbjct  830   IPIDGCPVGTQLTESPKKVYRSEENNNKPRDNAETQLLIPENDAVPSPPEEQLGLDTQPN  889

Query  1121  AHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFR  1300
             A    T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+F 
Sbjct  890   A---KTAFLLSIDELLSAVSQTTAQMGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMSFM  946

Query  1301  EDGNDEPDFNFSEETIWQPP-SGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQL  1474
                +++   + ++E    P   GNPF +  ++     + A A ++ C TEYQ  P F   
Sbjct  947   SAKSNKFGSSQTKEPTALPCGGGNPFVEQRSSWEMMGLGAPASSNVCVTEYQT-PPFFNP  1005

Query  1475  PASSPYDNFLK  1507
             PAS+P+DNFLK
Sbjct  1006  PASTPFDNFLK  1016



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   362 bits (929),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 238/557 (43%), Positives = 327/557 (59%), Gaps = 69/557 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P     S+R + +Q
Sbjct  476   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPNSVPK----SRRPADMQ  531

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------------------------  277
             RTLSRTVSVFSSSAALF KL     S  D   +                           
Sbjct  532   RTLSRTVSVFSSSAALFRKLKLESDSSVDDTAKMERVSTLSRSKSKFTRDESFDDEEPKN  591

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+YSR+ SVK  P S     N          + L++ S QI +LLSSI+V
Sbjct  592   NTSSVLSRLKSSYSRTQSVKRNPSSTVLDQNSSGSSPEKPVIPLRLSSHQICLLLSSIWV  651

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  652   QSLSPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  709

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA--  805
             RRRSLF LATSMIIF ++ ++  PL  SAK  L +KT+DPFL LV++C L      +A  
Sbjct  710   RRRSLFTLATSMIIFSARAFNIPPLVNSAKTALQEKTVDPFLHLVEDCKLDAVFYGQAEQ  769

Query  806   -RASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKEDDE A RS   I E ++ Q  E +A MI++ L K     ++ IKEQL+ DF
Sbjct  770   PEKNYGSKEDDEDALRSFVAIEETTQNQPREHYAFMIMKFLGKLSDQDSSSIKEQLVSDF  829

Query  980   LPDEVCPMGTQRINDLRNHNQSDDKT---------------NDEVVDP---TFTVDDLGS  1105
             +P + CP+GTQ     +   +S++K                ND V  P    F++D    
Sbjct  830   IPIDGCPVGTQLTESPKKVYRSEEKNNKPRDNAETQLLIPENDAVPSPPEEQFSLD----  885

Query  1106  HSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGN  1285
              + PNA    T  LL ++E L +V +T+ Q+GR S + P  MT+ ++A  CEA   GK  
Sbjct  886   -TQPNA---KTAFLLSIDELLSAVSQTTAQMGRYSVSDPPDMTYTEMAGHCEALLMGKQE  941

Query  1286  RMNFREDGNDEPDFNFSEETIWQPPS-GNPFADNNTaaagqpvnaaapaS-CATEYQRHP  1459
             +M+F    +++   + ++E    P S GNPF +  ++     + A A ++ C TEYQ  P
Sbjct  942   KMSFMSGKSNKFGSSQTKEPTALPCSGGNPFVEQRSSWEMMGLGAPASSNVCVTEYQT-P  1000

Query  1460  SFMQLPASSPYDNFLKA  1510
              F   PAS+P+DNFLKA
Sbjct  1001  PFFNPPASTPFDNFLKA  1017



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   362 bits (928),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 242/554 (44%), Positives = 336/554 (61%), Gaps = 64/554 (12%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P  +      +K   + RTLS
Sbjct  480   AFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPCPSSN----NKGSDLSRTLS  535

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN-----------MLNRLTSTYSRSLSVK  337
             RTVSVFSSSAALFDK  ++++S ++ + Q+++N           ML RL S+ SR  S+K
Sbjct  536   RTVSVFSSSAALFDKQRRDKTSTRENVFQDSKNNAHEGEQISNGMLARLKSSTSRVYSLK  595

Query  338   -PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSL  514
              P    T +  ENP    E  SL++ SRQI++LLSSI+ Q+IS  NTP+++EAI+HTY+L
Sbjct  596   NPLVPSTSD--ENP----EAGSLRLSSRQITLLLSSIWTQSISPANTPQNYEAISHTYNL  649

Query  515   LMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYS  694
             ++LF+R K SS E+LIR FQLAFSLR+I+L ++  +PPSRRRSLFALATSMI+F SK Y+
Sbjct  650   VLLFNRAKNSSDEALIRSFQLAFSLRNIALKQEEPLPPSRRRSLFALATSMILFTSKAYN  709

Query  695   FIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIE  868
              IPL    K +LT+K +DPFL LV++  L+         +  YGSKEDD +A +SLS I+
Sbjct  710   IIPLIYCTKVVLTEKMIDPFLHLVEDRKLQAVSTESGHPAIVYGSKEDDCSALKSLSEID  769

Query  869   ISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL-RNHNQS  1045
             ++  QS E FA+ I +SL      + + I+E+LL +FLP++VCP+G Q   D     +Q 
Sbjct  770   VTGNQSREFFAAEIAKSLGNLAKFEASTIQEKLLNEFLPNDVCPLGAQLFMDTPMQIDQV  829

Query  1046  DDKTNDEVV-----------------------DPTFTVDDLGSHSDPNAHPDST------  1138
             D + N  +                         P FT+DD+   S  +    +T      
Sbjct  830   DSEDNSLMERERERERERVLGTLIILFLFLQGTPLFTLDDVFLDSLEDQTTQTTEIVFQD  889

Query  1139  PNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FR  1300
              +LL VN+ L+SVLET+ QVGR S   P  +++ ++A  CE    GK  +M+       +
Sbjct  890   TDLLSVNQLLESVLETTQQVGRLSVTAP-DVSYKEMAHHCETLLMGKQQKMSHVMSVQLK  948

Query  1301  EDGNDEPDFNFSEETIWQPPSGNPFADNNTaaa-gqpvnaaapaSCATEYQRHPSFMQLP  1477
             ++          ++ I +    NPF + N  A+   P+       C  EYQ HP+F +LP
Sbjct  949   QESLMNVSLQNHDDEIRK--VTNPFLEQNIIASPQLPLVGTVQMQCGAEYQHHPNFFRLP  1006

Query  1478  ASSPYDNFLKAAGS  1519
             ASSP+DNFLKAAG 
Sbjct  1007  ASSPFDNFLKAAGC  1020



>emb|CBI29857.3| unnamed protein product [Vitis vinifera]
Length=1195

 Score =   365 bits (936),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 313/539 (58%), Gaps = 64/539 (12%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             N AFPEALFHQ+L AMV PD+ETRL                           K   + R 
Sbjct  685   NSAFPEALFHQLLPAMVHPDHETRL--------------------------KKASDLPRM  718

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ---------NTQNMLNRLTSTYSRSLSVK  337
             LSRTVSVFSSSAALF+KL K +S  K+ + Q         N   +LNR+ S+ SR+ S+K
Sbjct  719   LSRTVSVFSSSAALFEKLRKEKSFSKENICQENKEDELKNNNAGILNRMKSSLSRAYSLK  778

Query  338   PGSEET---PNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +       N   N     E +SLK+ SRQI++LLSSI+ Q+IS  N PE++EAIAHTY
Sbjct  779   SSAMSLTTDANFTSNSNNELEAVSLKLSSRQIALLLSSIWAQSISPANMPENYEAIAHTY  838

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K S HE L+R FQLAFSLRSISL +   +PP+RRRSLF LA SMI+F SK 
Sbjct  839   SLVLLFSRAKNSIHEVLVRSFQLAFSLRSISLVDGGPLPPARRRSLFTLAISMIVFSSKA  898

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPK-ARASYGSKEDDEAAKRSLSG  862
             Y  +PL   AKA L D+ +DPFL LV +  L+ VN     A   YGSKEDDE A ++LS 
Sbjct  899   YDILPLVPCAKAALLDRMVDPFLHLVQDNKLQAVNSGSDCASKVYGSKEDDECALKALSQ  958

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ  1042
             I+I+++Q+ ESFA++IV+SL+     ++++++EQL+ +FLPD+V   GTQ + D    + 
Sbjct  959   IKIAEEQTRESFATIIVKSLENLSESESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF  1018

Query  1043  SDDKTNDEVVDPTFTVDD--LGSHSDPNAH----PDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +++ +E    + T DD  L  +     H        PNLL +N+ L+SVLE +++VGR
Sbjct  1019  KSNESPEEAAAISATDDDAFLDLYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGR  1078

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNR--------------MNFREDGNDEPDFNFSEE  1342
              S +    +++ +++  CEA   GK  +              MNF    +D+        
Sbjct  1079  FSVSTAPDVSYKEMSGHCEALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITH  1138

Query  1343  TIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                     NPF+D N  A   +P    AP  CATEY  HP F +LPASSPYDNFLKAAG
Sbjct  1139  CY---DVRNPFSDQNFAANLHKPPIDPAPIHCATEYLHHPHFFKLPASSPYDNFLKAAG  1194



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   360 bits (924),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 227/544 (42%), Positives = 318/544 (58%), Gaps = 40/544 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE+LFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSVCP+         K   +QR
Sbjct  485   QNKAFPESLFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVCPQPCSVTPESPKNSDLQR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM----------------LNRLTST  313
             TLSRTVSVFSSSAALF+KL + + S  +   Q   N+                L +L S+
Sbjct  545   TLSRTVSVFSSSAALFEKLRREKGSLTEKPYQQNVNIVPYSYDGRENSSNEAQLYKLQSS  604

Query  314   YSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              SR+ S+K     T +N    + + + + L++ +RQI++LLSSI+ QA+S  N P+++EA
Sbjct  605   RSRARSIKVTPPVTADNVTMNKSNKDSVLLRLNNRQITLLLSSIWAQALSPENMPDNYEA  664

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAH+YSL +LFSR K S HE L + FQL FSLRSISL     +PPSRRRSL+ L T+M I
Sbjct  665   IAHSYSLTLLFSRAKTSIHECLCQSFQLTFSLRSISLG-GGSLPPSRRRSLYTLTTAMFI  723

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VN-PNPKARASYGSKEDDEAAK  847
             F SK ++  PL    K+ L ++T+DPFL+LV++  L+ VN  +     +YGS+EDD  A 
Sbjct  724   FSSKAFNIGPLIPIVKSSLNERTVDPFLRLVEDGKLQAVNTASNNFSIAYGSQEDDNNAL  783

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND-  1024
              SL  +E+++ QS ES  S+I+ SL      + + IK QLL DFLPD+V P+  Q +   
Sbjct  784   ESLQAVELTESQSKESIVSLIMNSLSDLSDSEISTIKTQLLSDFLPDDVGPLRPQFVETS  843

Query  1025  ---LRNHNQSDDK---TNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                L   +Q ++    T+  ++D     +   + +D +   + T +LL V++ L++VLET
Sbjct  844   GQILPFESQKENTLEVTSRNLIDFDNFPEGFETVTDHSQLANGTFDLLSVDQLLETVLET  903

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSE--ETIWQ--  1354
             +  VGR SA+  + + F ++A  CEA   GK  +M+         D  F    E +++  
Sbjct  904   AWPVGRFSASSTSDVPFKEMAGHCEALTMGKQQKMSVFTSAQQNHDILFGGPLEELYEEK  963

Query  1355  ----------PPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
                         SGNPF D    A  Q            E+   P  ++LPASSPYDNFL
Sbjct  964   KSSFSNTNQSEKSGNPFLDEKLCADLQRQFCGNNMILNAEFHHQPQCLRLPASSPYDNFL  1023

Query  1505  KAAG  1516
             KAAG
Sbjct  1024  KAAG  1027



>ref|XP_002881801.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58060.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
Length=1025

 Score =   360 bits (923),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 227/550 (41%), Positives = 315/550 (57%), Gaps = 53/550 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHNTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN------------TQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S     DQ+            T  +L+RL S+YS++
Sbjct  543   SLSRTASVFSSSAALFEKLKKDKFSSMLTSDQSQNGMPEEECGSTTGEILDRLKSSYSQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPVTSVADNSVDLLNSELDAVHIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   K  L    +DPFL LVD+  LK   + + + SYG ++DD +A  +LS
Sbjct  723   SKAFNLFSLADFTKVTLQGPRLDPFLNLVDDHKLKAINSDQLKGSYGCEKDDASALDTLS  782

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + D +   
Sbjct  783   NIALSTEHSRGNLVYEIVKSLESMCNSEMDKMREQLLTEFMPDDACPLGTRFLEDTQKTY  842

Query  1040  QSD---------DKTNDEVVDPTFTVDDLGSHSDPNAHP---DSTPNLLDVNEFLDSVLE  1183
             Q D         D  + E  D T TV           HP      P+LL VN+ L+SV+E
Sbjct  843   QVDSGDVKSQKVDAEDQEFGDGTETV--------AKNHPVTFSEIPDLLTVNQILESVVE  894

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFS----EET  1345
             T+ QVGR S    A  ++ ++   CE    GK  +++         E   N S    +E 
Sbjct  895   TTGQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNCSPRQHDEE  954

Query  1346  I----WQP---PSGN-----PFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASS  1486
             I    + P   P+ +     P   N+              S C  E Q +P   +LPASS
Sbjct  955   IKIASFHPMLNPTFHTEVEVPLLSNSFDMKSPRTPVGTIQSPCFAELQNNPQAFRLPASS  1014

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  1015  PYDNFLKAAG  1024



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   358 bits (920),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 232/534 (43%), Positives = 318/534 (60%), Gaps = 34/534 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P    L K     R
Sbjct  444   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVPEETHLKKATDFSR  503

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   ++S  + +        N   MLNR+ STYS   +    
Sbjct  504   ALSRTVSVFSSSAALFGKLRDQRTSSTENITLETEQKDNNSGMLNRIKSTYSGVYNTIGS  563

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P +    +SL++ S QI +LLSS++VQ+IS  N PE++EAI+HT+SL++L
Sbjct  564   PAPVGESTNKPSKEAGPISLRLSSHQIVLLLSSLWVQSISPANMPENYEAISHTFSLVLL  623

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMI+F SK Y+   
Sbjct  624   FSRAKHSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMILFSSKAYNIPS  683

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+D T+DPFL LV++C L+   + +   +  YGSKEDD +A++ LS I I++
Sbjct  684   LIPCVKATLSDNTVDPFLHLVEDCKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINITE  743

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q   D ++  Q  +  
Sbjct  744   EQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFFADAQHRVQQSNS-  802

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNA-HPDSTPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD +  +DD G     S S  N  +    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  803   ----VDLSSILDDDGPDLSQSSSKQNEQYAMEIPNLLSVNQLLESVLETAHQVGRISLSN  858

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQP  1357
                 ++ ++   CEA   GK  RM        R+D         + E D   S +   + 
Sbjct  859   EPDFSYKEMTHHCEALLTGKQQRMYNLLNSQHRQDSALIRISQNSSEQDKESSSDNQVEN  918

Query  1358  PSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + N   D   A   Q   +      C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  919   QAKNQLVDQKVANVSQKPSSGTVDWHCGAQCQSNPEMFRLPASSPYDNFLKAAG  972



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   358 bits (919),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 232/534 (43%), Positives = 318/534 (60%), Gaps = 34/534 (6%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P    L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVPEETHLKKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   ++S  + +        N   MLNR+ STYS   +    
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRTSSTENITLETEQKDNNSGMLNRIKSTYSGVYNTIGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P +    +SL++ S QI +LLSS++VQ+IS  N PE++EAI+HT+SL++L
Sbjct  603   PAPVGESTNKPSKEAGPISLRLSSHQIVLLLSSLWVQSISPANMPENYEAISHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMI+F SK Y+   
Sbjct  663   FSRAKHSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMILFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+D T+DPFL LV++C L+   + +   +  YGSKEDD +A++ LS I I++
Sbjct  723   LIPCVKATLSDNTVDPFLHLVEDCKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q   D ++  Q  +  
Sbjct  783   EQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFFADAQHRVQQSNS-  841

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNA-HPDSTPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD +  +DD G     S S  N  +    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  842   ----VDLSSILDDDGPDLSQSSSKQNEQYAMEIPNLLSVNQLLESVLETAHQVGRISLSN  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQP  1357
                 ++ ++   CEA   GK  RM        R+D         + E D   S +   + 
Sbjct  898   EPDFSYKEMTHHCEALLTGKQQRMYNLLNSQHRQDSALIRISQNSSEQDKESSSDNQVEN  957

Query  1358  PSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + N   D   A   Q   +      C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  958   QAKNQLVDQKVANVSQKPSSGTVDWHCGAQCQSNPEMFRLPASSPYDNFLKAAG  1011



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   358 bits (918),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 239/552 (43%), Positives = 318/552 (58%), Gaps = 75/552 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR                            K + + R
Sbjct  486   QNKAFPEALFHQLLPAMVHPDHETRS--------------------------KKGQDLPR  519

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQN--------TQN----MLNRLTSTYSRS  325
             TLSRTVSVFSSSAALF+KL   +   +D   Q+        T+N    ML+RL STYSR+
Sbjct  520   TLSRTVSVFSSSAALFEKLRNEKILSRDHAPQDDKENSEGDTRNDNIGMLSRLKSTYSRA  579

Query  326   LSVKPGSEETPNNGENP----QEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              S +  S    N   NP     +  E + L++ SRQI++LLSSI+ Q+IS  N PE+FEA
Sbjct  580   YSSRNPSV-LLNTDSNPVSKLNKELEAVPLRLSSRQITLLLSSIWAQSISPANMPENFEA  638

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K SS+E+L+R FQLAFSLR ISL E   +PPSRRRSLF L+TSMII
Sbjct  639   IAHTYSLVLLFSRAKNSSNEALVRSFQLAFSLRDISLKEGGPLPPSRRRSLFTLSTSMII  698

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEAAK  847
             F S  Y  +PL   AK  LT++T DPFL+LV++  L+ V+   + + + YGS EDD AA 
Sbjct  699   FSSIAYGIVPLVHCAKIALTERTADPFLKLVEDRKLQAVDTGSRHQMNVYGSTEDDAAAL  758

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             +SLS I+ ++ Q  ES AS+I+++L      + + ++EQLL +F PD+VCP+G+Q   D 
Sbjct  759   KSLSHIQFTEDQRRESCASVILKTLGSLPEPELSTVREQLLSEFFPDDVCPLGSQSFTDS  818

Query  1028  ---------RNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST--PNLLDVNEFLDS  1174
                      R     DD     V D  F  D   S +  N    +   PNLL +++ L+S
Sbjct  819   PSKIYQLESRMSESHDDPPLLPVEDDAFA-DSFESQTTQNLEDIAVGGPNLLSIDQLLES  877

Query  1175  VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN----------------FRED  1306
             VLET++QVGR S +    + + +VA  CEA   GK  +M+                 +++
Sbjct  878   VLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSNLMSIQQKHESLRNLTLQKN  937

Query  1307  GNDEPDFNFSEETIWQPPS-GNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
              +     +F  E   Q    GNPF DN+  A   +P        C+TEYQ +PSF +LPA
Sbjct  938   NDVMTGSHFPAEMGTQNHRVGNPFLDNDHNANMQKPPVGTTALLCSTEYQHNPSFFRLPA  997

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  998   SSPYDNFLKAAG  1009



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   358 bits (919),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 244/568 (43%), Positives = 335/568 (59%), Gaps = 73/568 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSSVCP   P    +SKR + +Q
Sbjct  476   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSSVCPSSVP----MSKRPADMQ  531

Query  179   RTLSRTVSVFSSSAALFDKL--------------GK----NQSSGK-------------D  265
             RTLSRTVSVFSSSAALF KL              G+    N+S  K             +
Sbjct  532   RTLSRTVSVFSSSAALFRKLNLESDNAVDDTAKMGRVSTLNRSKSKFSRGYSIKEHQPTE  591

Query  266   GMD-----QNTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQI  424
               D     QNT ++LNRL S+YSR+ SVK  P S  +  N          + L++ S QI
Sbjct  592   SFDDEEPKQNTSSVLNRLKSSYSRTQSVKRNPSSMVSDQNSSGSSSEKPVIPLRLSSHQI  651

Query  425   SMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISL  604
              +LLSSI+VQ++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL
Sbjct  652   CLLLSSIWVQSLSPHNMPQNYEAIANTFSLVLLFGRTKNSSNEVLVWSFQLAFSLRNLSL  711

Query  605   SEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK  784
                  + PSRRRSLF LATSMIIF ++ ++  PL  SAK  L +KT+DPFLQLV++C L 
Sbjct  712   G--GPLQPSRRRSLFTLATSMIIFSARAFNIPPLVNSAKTALQEKTIDPFLQLVEDCKLD  769

Query  785   V---NPNPKARASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNL  952
                   + +   SYGSKEDD+ A +SL  I E +++Q  E + +MI++ L K     ++ 
Sbjct  770   AVFYGQSHQPEKSYGSKEDDDDALKSLVAIEETTQQQPREDYTTMIMKFLGKLSDQDSSS  829

Query  953   IKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTN-------------DEVVDPTFTVD  1093
             IKEQL+ DF+P + CP+GTQ  ++     +S+DK N             D    P+   D
Sbjct  830   IKEQLVSDFIPIDGCPVGTQLTDNPVQVYRSEDKNNKPRDMAEAQLLIPDNDAVPSPPED  889

Query  1094  DLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQE  1273
              L   + PNA    T  LL ++E L++V +T+ Q+GR S + P  MT+ ++A  CEA   
Sbjct  890   QLSLDTQPNA---KTAFLLSIDELLNAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLM  946

Query  1274  GKGNRMNFREDGNDEPDFNFSEETIWQPPS----GNPFADNNTaaagqpvnaaapaS---  1432
             GK  +M+F    +++      E +    PS    GNPF D   +     + A A +S   
Sbjct  947   GKQEKMSFMSTKSNKFSNQTKETSASSLPSGGGGGNPFVDERNSWEMNGMGAPAASSSNM  1006

Query  1433  CATEYQ-RHPSFMQLPASSPYDNFLKAA  1513
             C TE+Q   P F   PAS+P+DNFLKA 
Sbjct  1007  CVTEFQNHPPPFFNPPASTPFDNFLKAV  1034



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   357 bits (916),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 233/534 (44%), Positives = 318/534 (60%), Gaps = 36/534 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P    L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVPEETHLKKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   ++S  + +        N   MLNR+ STYS   +    
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRTSSTENITLETEQKDNNSGMLNRIKSTYSGVYNTIGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P +    +SL++ S QI +LLSS++VQ+IS  N PE++EAI+HT+SL++L
Sbjct  603   PAPVGESTNKPSKEAGPISLRLSSHQIVLLLSSLWVQSISPANMPENYEAISHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMI+F SK Y+   
Sbjct  663   FSRAKHSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMILFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+D T+DPFL LV++C L+   + +   +  YGSKEDD +A++ LS I I++
Sbjct  723   LIPCVKATLSDNTVDPFLHLVEDCKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q   D ++  Q  +  
Sbjct  783   EQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFFADAQHRVQQSNS-  841

Query  1058  NDEVVDPTFTVDDLG-----SHSDPNA-HPDSTPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD +  +DD G     S S  N  +    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  842   ----VDLSSILDDDGPDLSQSSSKQNEQYAMEIPNLLSVNQLLESVLETAHQVGRISLSN  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQP  1357
                 ++ ++   CEA   GK  RM        R+D         + E D   S +   Q 
Sbjct  898   EPDFSYKEMTHHCEALLTGKQQRMYNLLNSQHRQDSALIRISQNSSEQDKESSSDN--QG  955

Query  1358  PSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + N   D   A   Q   +      C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  956   QAKNQLVDQKVANVSQKPSSGTVDWHCGAQCQSNPEMFRLPASSPYDNFLKAAG  1009



>ref|XP_010546486.1| PREDICTED: uncharacterized protein LOC104818426 isoform X2 [Tarenaya 
hassleriana]
Length=1025

 Score =   357 bits (916),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 230/550 (42%), Positives = 332/550 (60%), Gaps = 53/550 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             ++KAF EALFHQ+L +MV PD+ETR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   RDKAFHEALFHQLLQSMVHPDHETRIGAHRIFSVVLVPTSVCPRPSLVYVDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQ-----------NMLNRLTSTYSRSL  328
             +LSRTVSVFSSSAALF+KL K++ S     DQ  +           N  NRL S+YS++ 
Sbjct  543   SLSRTVSVFSSSAALFEKLKKDKFSSILNPDQIIKESVISEEEPRSNSGNRLKSSYSQAY  602

Query  329   SVKPGSEETPNNGENPQEHHEGL---SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             S +   E T  +  +    +  L    L++ S QIS+LLSSI+ Q+IS  NTPE++EAIA
Sbjct  603   STRDQPEATTADTNSINVSNSDLDVGCLRLSSHQISVLLSSIWAQSISPANTPENYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSLL+LFSR K SSHE+LIR  Q+A SLR ISL E    PPSRRRSLF LAT MI+F 
Sbjct  663   NTYSLLLLFSRAKNSSHEALIRSLQMALSLRDISLMEGGPFPPSRRRSLFMLATCMILFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSL  856
             SK ++ +PL    KA L  + +DPFL+L ++  L+ V P+ +   +YGSKEDD  A  +L
Sbjct  723   SKAFNLLPLVDFTKAALQAQRVDPFLRLFEDHKLEAVKPDQRPTTAYGSKEDDATAIDAL  782

Query  857   SGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH  1036
             S + ISK+QS E   + IV+SL      + + ++E+LL +FLPD+ CP+GT+ + + ++ 
Sbjct  783   SSLSISKEQSREILVTEIVKSLDNVCNSEMDKMREKLLCEFLPDDACPLGTRFLGETQSI  842

Query  1037  NQ---SDDKTNDEVVDPTFTVDD--LG------SHSDPNAHPDSTPNLLDVNEFLDSVLE  1183
             +Q   SD K+  E   P F+++D  LG      + ++P  H + +  LL VN+ ++SV++
Sbjct  843   HQVDPSDAKSQKEDTMP-FSLEDQELGDGIGTLAKNNPVKHTEIS-QLLSVNQLMESVVD  900

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFSE  1339
             T++QVGR S    +  ++ ++   CEA   GK  + +       R++   N  P  N +E
Sbjct  901   TTHQVGRISVHTASDFSYKEMTFHCEALLMGKQQKFSSLLSTQLRQESLKNVSPR-NHNE  959

Query  1340  E-----------TIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
             E           + +    G P     + A+ +          ++E + +P   +LPASS
Sbjct  960   EIEHTTLHSQISSCFHAAVGIP-----SPASSRSRVGTVQPESSSELESNPQSFRLPASS  1014

Query  1487  PYDNFLKAAG  1516
             PY+NFLKAAG
Sbjct  1015  PYENFLKAAG  1024



>ref|XP_010546363.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546433.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
Length=1026

 Score =   357 bits (916),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 230/550 (42%), Positives = 332/550 (60%), Gaps = 53/550 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             ++KAF EALFHQ+L +MV PD+ETR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  484   RDKAFHEALFHQLLQSMVHPDHETRIGAHRIFSVVLVPTSVCPRPSLVYVDLKKGMGLPR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQ-----------NMLNRLTSTYSRSL  328
             +LSRTVSVFSSSAALF+KL K++ S     DQ  +           N  NRL S+YS++ 
Sbjct  544   SLSRTVSVFSSSAALFEKLKKDKFSSILNPDQIIKESVISEEEPRSNSGNRLKSSYSQAY  603

Query  329   SVKPGSEETPNNGENPQEHHEGL---SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
             S +   E T  +  +    +  L    L++ S QIS+LLSSI+ Q+IS  NTPE++EAIA
Sbjct  604   STRDQPEATTADTNSINVSNSDLDVGCLRLSSHQISVLLSSIWAQSISPANTPENYEAIA  663

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSLL+LFSR K SSHE+LIR  Q+A SLR ISL E    PPSRRRSLF LAT MI+F 
Sbjct  664   NTYSLLLLFSRAKNSSHEALIRSLQMALSLRDISLMEGGPFPPSRRRSLFMLATCMILFS  723

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSL  856
             SK ++ +PL    KA L  + +DPFL+L ++  L+ V P+ +   +YGSKEDD  A  +L
Sbjct  724   SKAFNLLPLVDFTKAALQAQRVDPFLRLFEDHKLEAVKPDQRPTTAYGSKEDDATAIDAL  783

Query  857   SGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH  1036
             S + ISK+QS E   + IV+SL      + + ++E+LL +FLPD+ CP+GT+ + + ++ 
Sbjct  784   SSLSISKEQSREILVTEIVKSLDNVCNSEMDKMREKLLCEFLPDDACPLGTRFLGETQSI  843

Query  1037  NQ---SDDKTNDEVVDPTFTVDD--LG------SHSDPNAHPDSTPNLLDVNEFLDSVLE  1183
             +Q   SD K+  E   P F+++D  LG      + ++P  H + +  LL VN+ ++SV++
Sbjct  844   HQVDPSDAKSQKEDTMP-FSLEDQELGDGIGTLAKNNPVKHTEIS-QLLSVNQLMESVVD  901

Query  1184  TSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFSE  1339
             T++QVGR S    +  ++ ++   CEA   GK  + +       R++   N  P  N +E
Sbjct  902   TTHQVGRISVHTASDFSYKEMTFHCEALLMGKQQKFSSLLSTQLRQESLKNVSPR-NHNE  960

Query  1340  E-----------TIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
             E           + +    G P     + A+ +          ++E + +P   +LPASS
Sbjct  961   EIEHTTLHSQISSCFHAAVGIP-----SPASSRSRVGTVQPESSSELESNPQSFRLPASS  1015

Query  1487  PYDNFLKAAG  1516
             PY+NFLKAAG
Sbjct  1016  PYENFLKAAG  1025



>ref|XP_010505973.1| PREDICTED: uncharacterized protein LOC104782671 [Camelina sativa]
Length=1022

 Score =   356 bits (914),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 220/541 (41%), Positives = 311/541 (57%), Gaps = 38/541 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM------------LNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K + S     DQ+ + M            L+RL S+Y ++
Sbjct  543   SLSRTASVFSSSAALFEKLKKEKFSSMLASDQSQKEMPEEESGSNRGEILDRLKSSYIQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSNWNQPVTSLEDNSVDLLNSELDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SMI+F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMILFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   K  L +  +DPFL LVD+  LK   + + + SYG ++DD +A  +LS
Sbjct  723   SKAFNLFSLADFTKVTLQEPRLDPFLHLVDDHKLKAVNSDQLKVSYGCEKDDSSALDTLS  782

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL++    + + ++EQLL +F+PD+ CP+GT+ + D +   
Sbjct  783   NITVSTEHSRGTLVYEIVKSLEEMCNSEMDKMREQLLIEFMPDDACPLGTRFLEDTQKTY  842

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQS  1210
               D K               GS +    +P +    P+LL VN+ L+SV+ET+ QVGR S
Sbjct  843   SGDVKPQKXXXXXXXXXX--GSETVTKNNPVTVSEIPDLLTVNQILESVVETTRQVGRIS  900

Query  1211  AAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFS----EETI----WQPP  1360
                 A  ++ ++   CE    GK  +++         E   N S    +E I    + P 
Sbjct  901   FHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNCSPRQHDEEITTATFHPM  960

Query  1361  SGNPF---------ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
               + F         A      + +         C  E Q +P   +LPASSPYDNFLKAA
Sbjct  961   INSTFYTEVEVPLLAKEFGMKSPRTPVGTIQTQCFAELQNNPQAFRLPASSPYDNFLKAA  1020

Query  1514  G  1516
             G
Sbjct  1021  G  1021



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   355 bits (911),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 232/534 (43%), Positives = 317/534 (59%), Gaps = 38/534 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P    L K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKVPEETHLKKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   ++S  + +        N   MLNR+ STYS   +    
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRTSSTENITLETEQKDNNSGMLNRIKSTYSGVYNTIGS  602

Query  344   SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
                   +   P +    +SL++ S QI +LLSS++VQ+IS  N PE++EAI+HT+SL++L
Sbjct  603   PAPVGESTNKPSKEAGPISLRLSSHQIVLLLSSLWVQSISPANMPENYEAISHTFSLVLL  662

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             FSR K S  E+L++ FQLAFSLR+I+L E   +PPSR+RSLF LATSMI+F SK Y+   
Sbjct  663   FSRAKHSYREALVQSFQLAFSLRNIALIEGGSLPPSRKRSLFVLATSMILFSSKAYNIPS  722

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    KA L+D T+DPFL LV++C L+   + +   +  YGSKEDD +A++ LS I I++
Sbjct  723   LIPCVKATLSDNTVDPFLHLVEDCKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINITE  782

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT  1057
             +QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q   D ++  Q  +  
Sbjct  783   EQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFFADAQHRVQQSNS-  841

Query  1058  NDEVVDPTFTVDDLG-----SHSDPN-AHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAP  1219
                 VD +  +DD G     S S  N  +    PNLL VN+ L+SVLET++QVGR S + 
Sbjct  842   ----VDLSSILDDDGPDLSQSSSKQNEQYAMEIPNLLSVNQLLESVLETAHQVGRISLSN  897

Query  1220  PAGMTFMDVASQCEAFQEGKGNRM------NFREDG--------NDEPDFNFSEETIWQP  1357
                 ++ ++   CEA   GK  RM        R+D         + E D   S +     
Sbjct  898   EPDFSYKEMTHHCEALLTGKQQRMYNLLNSQHRQDSALIRISQNSSEQDKESSSDN----  953

Query  1358  PSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + N   D   A   Q   +      C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  954   QAKNQLVDQKVANVSQKPSSGTVDWHCGAQCQSNPEMFRLPASSPYDNFLKAAG  1007



>ref|XP_010508669.1| PREDICTED: uncharacterized protein LOC104785201 isoform X1 [Camelina 
sativa]
 ref|XP_010508670.1| PREDICTED: uncharacterized protein LOC104785201 isoform X2 [Camelina 
sativa]
Length=1026

 Score =   355 bits (910),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 224/549 (41%), Positives = 319/549 (58%), Gaps = 50/549 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM------------LNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL   + S     DQ+ + M            L+RL S+YS++
Sbjct  543   SLSRTASVFSSSAALFEKLKNEKFSSMLTSDQSQKEMPEEESGSNRGEILDRLKSSYSQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSNWNQPVTSLEDNSVDLLNSELDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SMI+F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMILFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSL  856
             SK ++   LA   K  L    +DPFL LVD+  LK VNP+ + + +YG ++DD +A  +L
Sbjct  723   SKAFNLFSLADFTKVTLQGPRLDPFLHLVDDHKLKAVNPD-QLKVAYGCEKDDSSALDTL  781

Query  857   SGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH  1036
             S I +S + S  +    IV+SL++    + + ++EQLL +F+PD+ CP+GT+ + D +  
Sbjct  782   SNIAVSTEHSRGTLVYEIVKSLEEMCNSEMDKMREQLLIEFMPDDACPLGTRFLEDTQKT  841

Query  1037  NQSDDKTNDEVVDPTFTVDDL----GSHSDPNAHPDST---PNLLDVNEFLDSVLETSNQ  1195
                D K   +     F+ +D     GS +    +P +    P+LL VN+ L+SV+ET+ Q
Sbjct  842   YSGDVKPQKDAA--LFSHEDQEFGDGSETVTKNNPVTVSEIPDLLTVNQILESVVETTRQ  899

Query  1196  VGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------NDE-----  1318
             VGR S    A  ++ ++   CE    GK  +++       R +         +DE     
Sbjct  900   VGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVICSPRQHDEEITTA  959

Query  1319  ---PDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSP  1489
                P  N +  T  + P     A      + +         C  E Q +P   +LPASSP
Sbjct  960   TFHPMINSTFYTEVEVP---LLAKEFGMKSPRTPVGTIQTQCFAELQNNPEAFRLPASSP  1016

Query  1490  YDNFLKAAG  1516
             YDNFLKAAG
Sbjct  1017  YDNFLKAAG  1025



>ref|NP_181714.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10037.1| uncharacterized protein AT2G41830 [Arabidopsis thaliana]
Length=1025

 Score =   353 bits (907),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 316/549 (58%), Gaps = 51/549 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSG-------KDGMDQ-----NTQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S        ++GM +     +T  +L+RL S+Y ++
Sbjct  543   SLSRTASVFSSSAALFEKLKKDKFSSMLTSDHSQNGMPEEERGSSTGEILDRLKSSYRQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPLTSVVDNSVDLLNSELDVVHIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   K  L    +DPFL LVD+  LK   + + + +YG ++DD +A  +LS
Sbjct  723   SKAFNLFSLADFTKVTLQGPRLDPFLNLVDDHKLKAVNSDQLKVAYGCEKDDASALDTLS  782

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + D     
Sbjct  783   NIALSTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFLEDTHKTY  842

Query  1040  QSD---------DKTNDEVVDPTFTVDDLGSHSDPNAHP--DSTPNLLDVNEFLDSVLET  1186
             Q D         D  + E  D T TV         N H      P+LL VN+ L+SV+ET
Sbjct  843   QIDSGDVKPRKEDAEDQEFGDGTETVTK-------NNHVTFSEIPDLLTVNQILESVVET  895

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFS----EETI  1348
             + QVGR S    A  ++ ++   CE    GK  +++         E   N S    +E I
Sbjct  896   TRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNCSPRQHDEEI  955

Query  1349  ----WQPPSGNPF---------ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSP  1489
                 + P   + F         +      + +       + C  E Q +P   +LPASSP
Sbjct  956   KIASFHPMINSAFHTGVEVPLLSKEFDMKSPRTPVGTIQSPCYAELQNNPQAFRLPASSP  1015

Query  1490  YDNFLKAAG  1516
             YDNFLKAAG
Sbjct  1016  YDNFLKAAG  1024



>ref|XP_006293443.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
 gb|EOA26341.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
Length=1027

 Score =   353 bits (906),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 223/551 (40%), Positives = 309/551 (56%), Gaps = 53/551 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S     DQ            N   +L+RL S+YS++
Sbjct  543   SLSRTASVFSSSAALFEKLKKDKFSSMLTSDQSQNEMPAEESGSNRGEILDRLKSSYSQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPVTSLEDNSVDLLNSELDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSHE+LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHEALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   K  L    +DPFL LVD+  LK   + + + +YG + DD +A   LS
Sbjct  723   SKAFNLFSLADFTKVALQGPRLDPFLHLVDDHKLKAVNSDQLKVAYGCERDDSSALDCLS  782

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + D     
Sbjct  783   NIAVSTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFLED-----  837

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDS-------------TPNLLDVNEFLDSVL  1180
               + KT+   V P      L SH D      S              P+LL VN+ L+SV+
Sbjct  838   --NQKTHSGDVKPQKMDAALFSHEDQEFGDGSETVTKNNPVTFSEIPDLLTVNQILESVV  895

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--NDEPDFNFS  1336
             ET+ QVGR S    A  ++ ++   CE    GK  +++       R D   N  P  +  
Sbjct  896   ETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLSSQLRHDSSVNCSPRQHDE  955

Query  1337  EET--IWQPPSGNPF---------ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPAS  1483
             E T   + P   + F                + +         C  E Q +    +LPAS
Sbjct  956   EITTATFHPMINSTFYTEVEVPLLVKEFDMKSPRTPVGTIQTQCFAELQNNQQAFRLPAS  1015

Query  1484  SPYDNFLKAAG  1516
             SPYDNFLKAAG
Sbjct  1016  SPYDNFLKAAG  1026



>dbj|BAF00551.1| hypothetical protein [Arabidopsis thaliana]
Length=1025

 Score =   352 bits (904),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 221/549 (40%), Positives = 316/549 (58%), Gaps = 51/549 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPNSVCPRPSSTTTDLKKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSG-------KDGMDQ-----NTQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S        ++GM +     +T  +L+RL S+Y ++
Sbjct  543   SLSRTASVFSSSAALFEKLKKDKFSSMLTSDHSQNGMPEEERGSSTGEILDRLKSSYRQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPLTSVVDNSVDLLNSELDVVHIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   +  L    +DPFL LVD+  LK   + + + +YG ++DD +A  +LS
Sbjct  723   SKAFNLFSLADFTRVTLQGPRLDPFLNLVDDHKLKAVNSDQLKVAYGCEKDDASALDTLS  782

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + D     
Sbjct  783   NIALSTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFLEDTHKTY  842

Query  1040  QSD---------DKTNDEVVDPTFTVDDLGSHSDPNAHP--DSTPNLLDVNEFLDSVLET  1186
             Q D         D  + E  D T TV         N H      P+LL VN+ L+SV+ET
Sbjct  843   QIDSGDVKPRKEDAEDQEFGDGTETVTK-------NNHVTFSEIPDLLTVNQILESVVET  895

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN--FREDGNDEPDFNFS----EETI  1348
             + QVGR S    A  ++ ++   CE    GK  +++         E   N S    +E I
Sbjct  896   TRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNCSPRQHDEEI  955

Query  1349  ----WQPPSGNPF---------ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSP  1489
                 + P   + F         +      + +       + C  E Q +P   +LPASSP
Sbjct  956   KIASFHPMINSAFHTGVEVPLLSKEFDMKSPRTPVGTIQSPCYAELQNNPQAFRLPASSP  1015

Query  1490  YDNFLKAAG  1516
             YDNFLKAAG
Sbjct  1016  YDNFLKAAG  1024



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   350 bits (899),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 322/549 (59%), Gaps = 71/549 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NKAFPEALFHQ+LLAMV  D ETR+GAH++FSVVLVPSSVCPR    G    K   + R
Sbjct  485   KNKAFPEALFHQLLLAMVHQDLETRIGAHQIFSVVLVPSSVCPRPDSVGFETKKSMGLPR  544

Query  182   TLSRTVSVFSSSAALFDKLGK-------------NQSSGKDGMDQNTQNMLNRLTSTYSR  322
             TLSRTVSVFSSSAA+F+KL               NQ    +  + N   MLNR+ S+Y+R
Sbjct  545   TLSRTVSVFSSSAAIFEKLRNQKRPAAKERHFEMNQQEKGEQRNNNVGGMLNRIKSSYNR  604

Query  323   SLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAH  502
             + S++   + TP    + +   +   L++ S QI++L SSI+ QA+S  N PE++EAIAH
Sbjct  605   AYSIRQQVDPTPTTVSSKEV--DAGPLRLSSHQITLLFSSIWSQAMSSSNMPENYEAIAH  662

Query  503   TYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLS  682
             TYSL++LFSR K S  ++LIR FQLAFSLR  SL+++  +PPSRRRS+F L+ SMIIF S
Sbjct  663   TYSLILLFSRIKNSYRDALIRSFQLAFSLRDFSLAQEGHLPPSRRRSVFVLSMSMIIFAS  722

Query  683   KTYSFI-PLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             K Y+   PL     A+L +K +DPFL L +E  L+++ + + +  YGS+EDD +A + LS
Sbjct  723   KAYNISHPLIPQIIAMLNNKVVDPFLCL-EEDKLQISRSGQQKI-YGSREDDSSAIKCLS  780

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I+I+   + ES AS+IV++L   +      +K QLL++F+PD+           + + N
Sbjct  781   EIKITGDYTAESIASVIVKNLDNLLEASKATVKVQLLKEFVPDD----------SISHRN  830

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSDP--NAHPDST-------PNLLDVNEFLDSVLETSN  1192
              +D+    +       +DD   H DP  N+ P ++       PNLL V++ L SV+ET+ 
Sbjct  831   DADNFKCFQKSLSLLGLDD-ALHHDPHVNSSPQNSSHVSVELPNLLSVDQLLQSVIETTP  889

Query  1193  QVGRQSA--APPAGMTFMDVASQCEAFQEGKGNRMNFREDGN--------------DEPD  1324
              VGR S   APP   ++ ++A +CE+   GK  ++++  + N              ++  
Sbjct  890   HVGRVSVSTAPPDASSYKEMAHRCESLMMGKQQKISYVINANHKHHGTTALTAYPSEKHM  949

Query  1325  FNFSEE---TIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRH--PSFMQLPASSP  1489
              +F ++    +   PS + FA N T            +SC  E Q++  P    LPAS+P
Sbjct  950   MSFEKQQSTKLDHHPSSDQFATNGT------------SSCGAESQKYHPPLSFPLPASNP  997

Query  1490  YDNFLKAAG  1516
             +DNFLKAAG
Sbjct  998   FDNFLKAAG  1006



>ref|XP_006411452.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
 gb|ESQ52905.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
Length=1037

 Score =   350 bits (899),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 224/560 (40%), Positives = 317/560 (57%), Gaps = 60/560 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAH +FSVVLVP+SVCPR +     L K   + R
Sbjct  482   QNKAFPEALFHQLLQAMVHPDHKTRIGAHSIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ-----------NTQNMLNRLTSTYSRSL  328
             +LSRT SVFSSSAALF+KL K++ S     DQ           N   +L+RL S+YS++ 
Sbjct  542   SLSRTASVFSSSAALFEKLKKDKFSSILTSDQSQNELPEESGINRGEILDRLKSSYSQAY  601

Query  329   SV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAH  502
             S   +P +    N+        + +S+++ S QI +LLSSI+ Q+IS  NTP+++EAIA+
Sbjct  602   STWNQPVTSVADNSVSLLNAELDAVSIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIAN  661

Query  503   TYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLS  682
             TYSL++LFSR K SSH++LIR FQ+A SLR ISL +   +PPSRRRSLF LA SM++F S
Sbjct  662   TYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMDGGPLPPSRRRSLFTLAASMVLFSS  721

Query  683   KTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLS  859
             K ++   LA   K  L    +DPFL LV++  LK VNP+     +YG +EDD +A  +LS
Sbjct  722   KAFNLSSLADYTKVALQGPRLDPFLHLVEDHKLKAVNPDQLLTDAYGCEEDDASALDTLS  781

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + D +   
Sbjct  782   NIAVSTEHSRGTLVYEIVKSLEDLCNSEMDKMREQLLTEFMPDDACPLGTRFLEDTQKSF  841

Query  1040  QSD-------------DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVL  1180
             Q D                + E  D T TV    + ++P    +  P+LL VN+ L+SV+
Sbjct  842   QVDFGDVKPQKDAALLSHEDQEFGDGTETV----AKNNPVTVAE-IPDLLSVNQILESVV  896

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDGND---------  1315
             ET+ QVGR S    A  ++ ++   CE    GK  +++       R + +          
Sbjct  897   ETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNCSPRQQDE  956

Query  1316  -------EPDFNFSEET-IWQPPSGNPFADNNTaaagqpvn-----aaapaSCATEYQRH  1456
                    EP  N +  T +  P  G  F   +        +           C +E Q +
Sbjct  957   EIKIATFEPMINSAFHTEVEVPLLGKEFDMKSPRTPMGMKSPRTPVGTIQTQCYSELQNN  1016

Query  1457  PSFMQLPASSPYDNFLKAAG  1516
             P   +LPASSPYDNFLKAAG
Sbjct  1017  PEAYKLPASSPYDNFLKAAG  1036



>emb|CDY06905.1| BnaA04g24100D [Brassica napus]
Length=1020

 Score =   350 bits (898),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 221/558 (40%), Positives = 322/558 (58%), Gaps = 61/558 (11%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+LS
Sbjct  467   AFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPRSLS  526

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             RT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++ S 
Sbjct  527   RTASVFSSSAALFEKLRKDKFSSILTSDQSQNELPEEEPGNNRGTILDKLEASYSQAYSS  586

Query  335   --KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA+TY
Sbjct  587   WNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIANTY  646

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F +K 
Sbjct  647   SLVLLFSRVKNSSHDALIRSFQMALSLRDISLIEGGPLPPSRRRSLFTLAASMVLFSAKA  706

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
             ++  PLA S K  L    +DPFL LV++  LK VNP+   + +YG +EDD +A  +LS I
Sbjct  707   FNLFPLADSTKVALQGPMIDPFLSLVEDHKLKAVNPDQLPKVAYGCQEDDASAINTLSNI  766

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQS  1045
              IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +   Q+
Sbjct  767   SISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKSFQT  826

Query  1046  D-------------DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
             D                + + VD T TV    + ++P    +  P+LL VN+ L+SV+ET
Sbjct  827   DFGDVKPQKDAALFSHEDQDFVDVTETV----TTNNPVTVAE-LPDLLSVNQILESVVET  881

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------NDE--  1318
             + QVGR S    A  ++ ++   CE    GK  +++       R +         +DE  
Sbjct  882   TRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHDEEN  941

Query  1319  ------PDFNFSEET-IWQPPSGNPFADNNTaaagqpvn-----aaapaSCATEYQRHPS  1462
                   P  N + +T +  P  G  F   +     +  +           C +E Q +  
Sbjct  942   KIATFHPMINSAFDTEVEVPLLGKDFDMKSPRTPVRMKSPRTPMRTIQTHCYSELQDNTE  1001

Query  1463  FMQLPASSPYDNFLKAAG  1516
               +LPASSPYDNFLKAAG
Sbjct  1002  AYKLPASSPYDNFLKAAG  1019



>ref|XP_010413002.1| PREDICTED: uncharacterized protein LOC104699388 [Camelina sativa]
Length=1046

 Score =   348 bits (893),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 221/548 (40%), Positives = 315/548 (57%), Gaps = 49/548 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  504   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPR  563

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM------------LNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K + S     DQ+ + M            L+RL S+Y ++
Sbjct  564   SLSRTASVFSSSAALFEKLKKEKFSSMLASDQSQKEMPEEESGSNRGEILDRLKSSYIQA  623

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+ +      + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  624   YSNWNQPVTSLEDNSVDLLNSELDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  683

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SMI+F 
Sbjct  684   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMILFS  743

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLS  859
             SK ++   LA   K  L     DPFL LVD+  LK   + + + +YG ++DD +A  +LS
Sbjct  744   SKAFNLFSLADFTKVTLQGPR-DPFLHLVDDHKLKAVNSDQLKVAYGCEKDDSSALDTLS  802

Query  860   GIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
              I +S + S  +    IV+SL++    + + ++EQLL +F+PD+ CP+GT+ + D +   
Sbjct  803   NIAVSTEHSRGTLVYEIVKSLEEMCNSEMDKMREQLLIEFMPDDACPLGTRFLEDTQKTY  862

Query  1040  QSDDKTNDEVVDPTFTVDDL----GSHSDPNAHPDST---PNLLDVNEFLDSVLETSNQV  1198
               D K   +     F+ +D     GS +    +P +    P+LL VN+ L+SV+ET+ QV
Sbjct  863   SGDVKPQKDAA--LFSHEDQEFGDGSETVTKNNPVTVSEIPDLLTVNQILESVVETTRQV  920

Query  1199  GRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------NDE------  1318
             GR S    A  ++ ++   CE    GK  +++       R +         +DE      
Sbjct  921   GRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVICSPRQHDEEITTAT  980

Query  1319  --PDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPY  1492
               P  N +  T  + P     A      + +         C  E Q +P   +LPASSPY
Sbjct  981   FHPMINSTFYTEVEVP---LLAKEFGMKSPRTPVGTIQTQCFAELQNNPQAFRLPASSPY  1037

Query  1493  DNFLKAAG  1516
             DNFLKAAG
Sbjct  1038  DNFLKAAG  1045



>ref|XP_009142012.1| PREDICTED: uncharacterized protein LOC103865904 isoform X4 [Brassica 
rapa]
Length=1039

 Score =   348 bits (892),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 221/561 (39%), Positives = 322/561 (57%), Gaps = 61/561 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++
Sbjct  543   SLSRTASVFSSSAALFEKLRKDKFSSILTSDQSKNEMPEEEPVNNRGTILDKLEASYSQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSL  856
             +K ++  PLA   K  L    +DPFL LV++  LK V+ +     +YG +EDD +A  +L
Sbjct  723   AKAFNLFPLADFTKVALQGPMIDPFLSLVEDHKLKAVSTDQLPTVAYGCQEDDASALDTL  782

Query  857   SGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH  1036
             S I IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +  
Sbjct  783   SNISISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKS  842

Query  1037  NQSD-------------DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSV  1177
              Q+D                + + VD T TV    + ++P    +  P+LL VN+ L+SV
Sbjct  843   FQTDFGDVKPQKDAALFSHEDQDFVDVTETV----TTNNPVTVAE-LPDLLSVNQILESV  897

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------ND  1315
             +ET+ QVGR S    A  ++ ++   CE    GK  +++       R +         +D
Sbjct  898   VETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHD  957

Query  1316  E--------PDFNFSEET-IWQPPSGNPFADNNTaaagqpvn-----aaapaSCATEYQR  1453
             E        P  N + +T +  P  G  F   +     +  +           C +E Q 
Sbjct  958   EENKIATFHPMINSAFDTEVEVPLLGKEFDMKSPRTPVRMKSPRTPMRTIQTHCYSELQD  1017

Query  1454  HPSFMQLPASSPYDNFLKAAG  1516
             +    +LPASSPYDNFLKAAG
Sbjct  1018  NTEAYKLPASSPYDNFLKAAG  1038



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   347 bits (889),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 234/535 (44%), Positives = 315/535 (59%), Gaps = 36/535 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  601

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  602   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  661

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  662   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  721

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  722   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  781

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  782   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  841

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  842   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  896

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQ  1354
                  ++ ++   CE    GK  RM        R+D         + E D   S     +
Sbjct  897   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHNQVE  956

Query  1355  PPSGNPFADNNTaaagqpvn-aaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 N   D   A   Q  +       C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  957   NQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  1011



>ref|XP_009610963.1| PREDICTED: uncharacterized protein LOC104104516 isoform X6 [Nicotiana 
tomentosiformis]
Length=916

 Score =   345 bits (884),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 312/540 (58%), Gaps = 44/540 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  385   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  444

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  445   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  503

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  504   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  563

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  564   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  623

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  624   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  683

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  684   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  743

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  744   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  798

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM-------------------NFREDGNDEPDFNFSE  1339
                  ++ ++   CE    GK  RM                   N  E   +    N  E
Sbjct  799   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHNQVE  858

Query  1340  ETIWQPPSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 Q    N   D   A   Q          C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  859   N---QGQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  915



>ref|XP_009142011.1| PREDICTED: uncharacterized protein LOC103865904 isoform X3 [Brassica 
rapa]
Length=1042

 Score =   347 bits (890),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 224/564 (40%), Positives = 320/564 (57%), Gaps = 64/564 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R
Sbjct  483   QNKAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRS  325
             +LSRT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++
Sbjct  543   SLSRTASVFSSSAALFEKLRKDKFSSILTSDQSKNEMPEEEPVNNRGTILDKLEASYSQA  602

Query  326   LSV--KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIA  499
              S   +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA
Sbjct  603   YSTWNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIA  662

Query  500   HTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFL  679
             +TYSL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F 
Sbjct  663   NTYSLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFS  722

Query  680   SKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSL  856
             +K ++  PLA   K  L    +DPFL LV++  LK V+ +     +YG +EDD +A  +L
Sbjct  723   AKAFNLFPLADFTKVALQGPMIDPFLSLVEDHKLKAVSTDQLPTVAYGCQEDDASALDTL  782

Query  857   SGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH  1036
             S I IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +  
Sbjct  783   SNISISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKS  842

Query  1037  NQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDST--------------PNLLDVNEFL  1168
              Q+D       V P   + D  L SH D +   D T              P+LL VN+ L
Sbjct  843   FQTDFGD----VKPQKYLQDAALFSHEDQD-FVDVTETVTTNNPVTVAELPDLLSVNQIL  897

Query  1169  DSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG-------  1309
             +SV+ET+ QVGR S    A  ++ ++   CE    GK  +++       R +        
Sbjct  898   ESVVETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPR  957

Query  1310  -NDE--------PDFNFSEET-IWQPPSGNPFADNNTaaagqpv-----naaapaSCATE  1444
              +DE        P  N + +T +  P  G  F   +     +              C +E
Sbjct  958   QHDEENKIATFHPMINSAFDTEVEVPLLGKEFDMKSPRTPVRMKSPRTPMRTIQTHCYSE  1017

Query  1445  YQRHPSFMQLPASSPYDNFLKAAG  1516
              Q +    +LPASSPYDNFLKAAG
Sbjct  1018  LQDNTEAYKLPASSPYDNFLKAAG  1041



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   346 bits (888),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 235/535 (44%), Positives = 314/535 (59%), Gaps = 38/535 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  601

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  602   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  661

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  662   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  721

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  722   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  781

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  782   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  841

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  842   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  896

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQ  1354
                  ++ ++   CE    GK  RM        R+D         + E D   S     Q
Sbjct  897   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHN--Q  954

Query  1355  PPSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 N   D   A   Q          C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  955   GQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  1009



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   344 bits (882),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 314/537 (58%), Gaps = 38/537 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  444   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  503

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  504   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  562

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  563   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  622

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  623   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  682

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  683   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  742

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  743   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  802

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  803   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  857

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM------NFREDGNDEPDFNFSEETIWQPPSGNPFA  1378
                  ++ ++   CE    GK  RM        R+D         S E   +  S N   
Sbjct  858   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHNQVE  917

Query  1379  DNNTaaagqpvnaaapaS-----------CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +            AA  S           C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  918   NQGQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  974



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   345 bits (884),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 234/535 (44%), Positives = 315/535 (59%), Gaps = 40/535 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  601

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  602   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  661

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  662   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  721

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  722   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  781

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  782   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  841

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  842   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  896

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM------NFRED--------GNDEPDFNFSEETIWQ  1354
                  ++ ++   CE    GK  RM        R+D         + E D    +E+   
Sbjct  897   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQD----KESSSH  952

Query  1355  PPSGNPFADNNTaaagqp-vnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 N   D   A   Q          C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  953   NQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  1007



>ref|XP_004166917.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224192, 
partial [Cucumis sativus]
Length=986

 Score =   344 bits (882),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 212/460 (46%), Positives = 291/460 (63%), Gaps = 43/460 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+LLAMV PD+ETR+ AHR+FSVVLVPSSVCPR   +         + R
Sbjct  481   QNKAFPEALFYQLLLAMVHPDHETRVAAHRIFSVVLVPSSVCPRPCSSDLESITPSDLPR  540

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGK-------------DGMDQNTQN-MLNRLTSTYS  319
             TL+R VS FSSSAALF KL   ++S               DG  ++  N ML+RL S+YS
Sbjct  541   TLTRAVSXFSSSAALFQKLRNEKASSLENGLPDMKDSSLLDGEQESVNNGMLSRLKSSYS  600

Query  320   RSLSVKPG----SEETPNNG--ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPE  481
             R+ S++      ++ T  +G  ++P+ +    SL++ SRQI++LLSSIFVQ+IS  N PE
Sbjct  601   RAYSIRSSGPLRTDATTTDGLSKDPETY----SLRLSSRQITLLLSSIFVQSISSANLPE  656

Query  482   HFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALAT  661
             ++E IAHTYSL++LFSR K SSHE L+R FQLAFSLR ISL ++  +PPSR RSLF LAT
Sbjct  657   NYEGIAHTYSLILLFSRAKNSSHEVLVRSFQLAFSLRDISLGKKGSLPPSRCRSLFTLAT  716

Query  662   SMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDD  835
             SMI+F SK ++ +PL    KA+   +  DPFL+LVD+C L+ V      + S YGS+EDD
Sbjct  717   SMILFSSKAFNILPLVDRTKAIFVSRMADPFLRLVDDCKLQAVTIQSDIKTSPYGSEEDD  776

Query  836   EAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQR  1015
             + A + LS +EI++ Q+ ES  + I++SL      + + IKEQLL +FLPD++CP+G   
Sbjct  777   DLASKFLSEVEITEDQTRESVVTEILKSLDILSDAEFSSIKEQLLSEFLPDDMCPLG---  833

Query  1016  INDLRNHNQSDDKTNDEV-----VDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVL  1180
                    NQ  DKT+++      +D     D + S +  N        LL VN+FL+SVL
Sbjct  834   -------NQLSDKTSNKSAHFFNIDEESFADSIESQTKDNQELHFVIPLLSVNQFLESVL  886

Query  1181  ETSNQVGRQSAAPPAGMT--FMDVASQCEAFQEGKGNRMN  1294
             ET++QVGR S +    +   F ++A  CE    GK  +M+
Sbjct  887   ETTHQVGRISISTTTDVVPPFKEMAQHCELLLMGKQQKMS  926



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   345 bits (884),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 314/537 (58%), Gaps = 38/537 (7%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSV P++ P      K     R
Sbjct  483   QNKAFPEALFHQLLPAMVHPDHETRVGAHRIFSVVLVPSSVSPQKIPEDTHQRKATDFSR  542

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGM------DQNTQNMLNRLTSTYSRSLSVKPG  343
              LSRTVSVFSSSAALF KL   +SS  + +        N   MLNR+ STYS   +   G
Sbjct  543   ALSRTVSVFSSSAALFGKLRDQRSSSAENITLETEQKDNNSGMLNRIKSTYSGVYNT-IG  601

Query  344   SEETPNNGENPQEHHEG-LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLM  520
             S        N      G  SL++ S QI +LLSS++VQ+IS  N PE++EAIAHT+SL++
Sbjct  602   SPAPVGECTNKSSKEAGPKSLRLSSHQIVLLLSSLWVQSISPANMPENYEAIAHTFSLVL  661

Query  521   LFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFI  700
             LFSR K S  E+L++ FQLAFSLR+++L E   +PPSR+RSLF LATSMI+F SK Y+  
Sbjct  662   LFSRAKHSYREALVQSFQLAFSLRNVALVEGGSLPPSRKRSLFVLATSMILFSSKAYNIP  721

Query  701   PLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEIS  874
              L    KA L+DKT+DPFL LV++  L+   + +   +  YGSKEDD +A++ LS I I+
Sbjct  722   SLIPCVKATLSDKTVDPFLHLVEDSKLQAADSSSGYGKVIYGSKEDDSSAQKCLSQINIT  781

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++QSTES  S+I++SL      + +  +E+LL++F PD+   +G+Q + D ++  Q  + 
Sbjct  782   EEQSTESLVSLILKSLSNLPDFEVSATREELLKEFSPDDSDSLGSQFLADAQHRVQQSNS  841

Query  1055  TNDEVVDPTFTVDDLG---SHSDPNAHPDST---PNLLDVNEFLDSVLETSNQVGRQSAA  1216
                  VD +  +DD G   S S    +  S    PNLL VN+ L+SVLET++QVGR S +
Sbjct  842   -----VDLSSILDDDGPDLSQSSSKQNEQSAMEIPNLLSVNQLLESVLETAHQVGRISLS  896

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM------NFREDGNDEPDFNFSEETIWQPPSGNPFA  1378
                  ++ ++   CE    GK  RM        R+D         S E   +  S N   
Sbjct  897   NEPDFSYKEMTHHCETLLTGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHNQVE  956

Query  1379  DNNTaaagqpvnaaapaS-----------CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +            AA  S           C  + Q +P   +LPASSPYDNFLKAAG
Sbjct  957   NQGQVKNQLVDQKAANVSQKPSPGTVDWHCGAQCQSNPETFRLPASSPYDNFLKAAG  1013



>gb|KDP26045.1| hypothetical protein JCGZ_21078 [Jatropha curcas]
Length=1000

 Score =   344 bits (882),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 225/523 (43%), Positives = 312/523 (60%), Gaps = 48/523 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE LFH +L A++ PD+E RLGAHR+FSVVLVPSSV P Q+       K   + R
Sbjct  415   QNKAFPETLFHHLLRALIHPDHEIRLGAHRIFSVVLVPSSVAPCQSLTIPKPKKGLEL-R  473

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQ-----------NMLNRLTSTYSRSL  328
             TLSRTVSVFSSSAALF+K+ K  +  K+   Q+ +            ML+ L  + SR  
Sbjct  474   TLSRTVSVFSSSAALFEKIRKENTYFKEKGYQDHEEAVLESEQIRNGMLDTLKFSKSRVY  533

Query  329   SVK-PGSEETPNNGE----NPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             S+K P +  TP+       + +   E  SL++ SRQIS++L+SIF Q++S  NTPE++EA
Sbjct  534   SMKNPPTPITPDENSVSDSDKEAAQESASLRLNSRQISLMLTSIFAQSVSPSNTPENYEA  593

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSR K SSHESLIR FQLAFSLR+I ++    +PPSR RSLF LATSMI+
Sbjct  594   IAHTYSLVLLFSRAKNSSHESLIRSFQLAFSLRNIGVNAAVPLPPSRLRSLFTLATSMIL  653

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEAAK  847
             F SK Y+ +PL   AK +LT+K +DPFLQLV +  LK VN       + YGSKEDD++A 
Sbjct  654   FSSKAYNIVPLVQRAKMVLTEKMVDPFLQLVGDRKLKSVNAETNNLTNRYGSKEDDDSAL  713

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             + LS ++++  QS ESFA+ IV+SL+     + + + ++LL +F PDEV P+G Q +++L
Sbjct  714   KFLSAMDVTGDQSKESFAAEIVKSLENLSNTEMSSVYKELLNEFSPDEVHPLGGQFMDNL  773

Query  1028  RNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST-------PNLLDVNEFLDSVLET  1186
                    D+    VV    T+DD       +A   +        P LL VN+ ++SVL++
Sbjct  774   -------DQQRASVV----TIDDDLFLDSSDALAKTNKAVVFQDPKLLSVNQLIESVLDS  822

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN-----FREDGNDEPDFNFSEETIW  1351
             ++QVGR S   P   T+ ++ + CE    GK    N      +++       N  EE   
Sbjct  823   AHQVGRVSVTAPDA-TYKEMVNHCETLLIGKQRMSNVMSAQIKQESLVNAQQNRGEEA--  879

Query  1352  QPPSGNPFADNNTaaagqpvnaaap--aSCATEYQRHPSFMQL  1474
                +GN F + N +      ++       CATEYQ HP+F  L
Sbjct  880   -KKAGNSFHNLNISTIPPSSSSVGNLPMQCATEYQHHPNFFSL  921



>ref|XP_009142014.1| PREDICTED: uncharacterized protein LOC103865904 isoform X5 [Brassica 
rapa]
Length=914

 Score =   341 bits (874),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 221/561 (39%), Positives = 318/561 (57%), Gaps = 64/561 (11%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+LS
Sbjct  358   AFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPRSLS  417

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             RT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++ S 
Sbjct  418   RTASVFSSSAALFEKLRKDKFSSILTSDQSKNEMPEEEPVNNRGTILDKLEASYSQAYST  477

Query  335   --KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA+TY
Sbjct  478   WNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIANTY  537

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F +K 
Sbjct  538   SLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFSAKA  597

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
             ++  PLA   K  L    +DPFL LV++  LK V+ +     +YG +EDD +A  +LS I
Sbjct  598   FNLFPLADFTKVALQGPMIDPFLSLVEDHKLKAVSTDQLPTVAYGCQEDDASALDTLSNI  657

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQS  1045
              IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +   Q+
Sbjct  658   SISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKSFQT  717

Query  1046  DDKTNDEVVDPTFTVDD--LGSHSDPNAHPDST--------------PNLLDVNEFLDSV  1177
             D       V P   + D  L SH D +   D T              P+LL VN+ L+SV
Sbjct  718   DFGD----VKPQKYLQDAALFSHEDQD-FVDVTETVTTNNPVTVAELPDLLSVNQILESV  772

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------ND  1315
             +ET+ QVGR S    A  ++ ++   CE    GK  +++       R +         +D
Sbjct  773   VETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHD  832

Query  1316  E--------PDFNFSEET-IWQPPSGNPFADNNTaaagqpvn-----aaapaSCATEYQR  1453
             E        P  N + +T +  P  G  F   +     +  +           C +E Q 
Sbjct  833   EENKIATFHPMINSAFDTEVEVPLLGKEFDMKSPRTPVRMKSPRTPMRTIQTHCYSELQD  892

Query  1454  HPSFMQLPASSPYDNFLKAAG  1516
             +    +LPASSPYDNFLKAAG
Sbjct  893   NTEAYKLPASSPYDNFLKAAG  913



>ref|XP_007052501.1| Uncharacterized protein TCM_005862 [Theobroma cacao]
 gb|EOX96658.1| Uncharacterized protein TCM_005862 [Theobroma cacao]
Length=920

 Score =   341 bits (874),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 214/459 (47%), Positives = 272/459 (59%), Gaps = 72/459 (16%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFH +LLAMV  D+ETR+GAH +FSVVLVPSSVCP    A    +K   +Q+TLS
Sbjct  459   AFPEALFHSLLLAMVYADHETRVGAHCIFSVVLVPSSVCPCPPAATSFPNKATKLQKTLS  518

Query  191   RTVSVFSSSAALFDKLGKN----------------------QSSGKDGMDQNTQNMLNRL  304
             RTVSVFSSSAALF KLG+                         +G +       ++LNRL
Sbjct  519   RTVSVFSSSAALFKKLGREDKENAVDDKVGNINGISMQDRLNCAGAENAKIQNHSILNRL  578

Query  305   TSTYSRSLSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
              S+YSR+ SVK    P + E   +  N  E    L L++ S QI+++LSSI+ Q+IS LN
Sbjct  579   KSSYSRAYSVKYLNPPATIEDEKSMSNAVEV-TALPLRLSSHQITLMLSSIWAQSISPLN  637

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
             TPE+FEAIAHTYSL++LF+RTK S +E++IR FQLAF+LRSISL     + PSRRRSLF 
Sbjct  638   TPENFEAIAHTYSLVLLFARTKNSCNEAMIRSFQLAFTLRSISLGGGGPLQPSRRRSLFI  697

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL---KVNPNPKARASYGS  823
             LATSMIIF SK Y+  PL    KA LT KT+DPFL+LVD+C L   K  P    +  YGS
Sbjct  698   LATSMIIFSSKAYNIPPLFPCVKASLTAKTVDPFLELVDDCKLQTAKTEPEHPGKV-YGS  756

Query  824   KEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPM  1003
             KED+E A +SLSGIEI++ QS ES A+MIV+ L     + ++ I+ QLL DF+PD+ CP+
Sbjct  757   KEDNEDALKSLSGIEIAENQSKESLATMIVKFLGNLSDEVSSKIRNQLLSDFIPDDGCPL  816

Query  1004  GT--------QRINDLRNHNQSDDK-------------------------TNDEVVDPTF  1084
             GT        Q   +    NQS +K                          N +V  P F
Sbjct  817   GTYLSMETPAQIYENGSIDNQSPEKAISFYLQFFPPPFSPSLNFIQAYNIVNVQVEPPLF  876

Query  1085  TVDD-------LGSHSDPNAH-PDSTPNLLDVNEFLDSV  1177
             TVDD         S + P+AH      N L V++ LD+V
Sbjct  877   TVDDDDVLPSKFESKTGPDAHLAPELQNFLSVDDLLDAV  915



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   342 bits (878),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 307/544 (56%), Gaps = 46/544 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE LFHQ+LLAMV PD+ETR+GAHRVFSVVLVPSSVCP+       L K   +QR
Sbjct  485   QNKAFPETLFHQLLLAMVHPDHETRVGAHRVFSVVLVPSSVCPQPCSVTPELLKNFDLQR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM----------------LNRLTST  313
             TLSR VS FSSSAALF+KL   + S  +   Q   N                 L +L S+
Sbjct  545   TLSRKVSAFSSSAALFEKLRWEKCSSTEKTYQQNMNRVPYSYDAQDNSGNEAKLFKLQSS  604

Query  314   YSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
              S + S+K        N    + + + + L++  RQI +LLSSI+ QA+S  N P+++EA
Sbjct  605   QSCTCSMKGSPLVIAENVILNKSYKDSVPLRLSRRQIMLLLSSIWAQAMSPENMPDNYEA  664

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAH+YSL +LFSR K S  +SL R FQLAFSLRS S++    +PPSRRRSL+ LAT+M+I
Sbjct  665   IAHSYSLALLFSRAKTSMPDSLTRSFQLAFSLRSTSIAA-GPLPPSRRRSLYTLATAMLI  723

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPK-ARASYGSKEDDEAAK  847
             F SK ++  PL    K+ L +KT+DP+LQLV++  L+ VN  P+     YGS+EDD  A 
Sbjct  724   FSSKAFNIGPLIPILKSPLNEKTVDPYLQLVEDSKLQAVNAAPEHCSRVYGSQEDDNNAL  783

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             +SL  +E+++ QS E   S I+ SL      + ++++ QLL DF PD++CP+G Q +   
Sbjct  784   KSLQVVELTESQSREFIVSQIMNSLSDLSDSEISMVRNQLLSDFWPDDICPLGAQFMETS  843

Query  1028  RNHNQSDDKTNDEVVDP-TFTVDDLGSHSDPNAHPDS------TPNLLDVNEFLDSVLET  1186
             R       K N + V P T  VDD+   +     PDS      + NLL V++ L+ V +T
Sbjct  844   RQLPFESKKENTQEVTPATILVDDVFPEAFETV-PDSLKLTSNSSNLLSVDQLLEMVPDT  902

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET-------  1345
             + QVGR S +  + + F ++A  C+A   GK  +M+       + D      +       
Sbjct  903   TLQVGRFSVSTTSDVPFKEMAGHCKALVMGKHQKMSVLTGAQQKHDILLGGSSTDQNGDK  962

Query  1346  ------IWQP-PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
                   + QP  S NPF D       Q             YQ     ++LPASSPYD+FL
Sbjct  963   MSSCFNVDQPGKSDNPFLDEKLNLDVQNQFGGNNM---ILYQSQ--CLRLPASSPYDHFL  1017

Query  1505  KAAG  1516
             KAAG
Sbjct  1018  KAAG  1021



>emb|CDY14788.1| BnaC04g47850D [Brassica napus]
Length=1020

 Score =   342 bits (877),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 218/553 (39%), Positives = 316/553 (57%), Gaps = 51/553 (9%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+LS
Sbjct  467   AFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRASSTTTDLQKGMGLPRSLS  526

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             RT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++ S 
Sbjct  527   RTASVFSSSAALFEKLRKDKFSSILTSDQSQNEMPEEEPGNNRGTILDKLEASYSQAYSS  586

Query  335   --KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA+TY
Sbjct  587   WNQPVASVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIANTY  646

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F +K 
Sbjct  647   SLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFSAKA  706

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
             ++  PLA   K  L   T+DPFL LV++  LK V+ +    A+YG +EDD +A  +LS I
Sbjct  707   FNLFPLADFTKVALQGPTIDPFLSLVEDHKLKAVSTDQLPTATYGCQEDDASALDTLSNI  766

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQS  1045
              IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +   Q+
Sbjct  767   SISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKSFQT  826

Query  1046  ---DDKTNDEVVDPTFTVDDLGSHSDPNAHPD-----STPNLLDVNEFLDSVLETSNQVG  1201
                D K   +    +    D G   +  A  +       P+LL VN+ L+SV+ET+ QVG
Sbjct  827   DFGDVKPQKDAALFSHEDQDFGDGIETVAKNNPVTVAEIPDLLTVNQILESVVETTRQVG  886

Query  1202  RQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------NDE-------  1318
             R S    A  ++ ++   CE    GK  +++       R +         +DE       
Sbjct  887   RISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHDEENKIATF  946

Query  1319  -PDFNFSEET-IWQPPSGNPFADNNTaaagqpv-----naaapaSCATEYQRHPSFMQLP  1477
              P  N + +T +  P  G  F   +     +              C +E Q +    +LP
Sbjct  947   HPMINSAFDTEVEVPLLGKDFDMKSPRTPLRMKSPRTPTRTIQTQCYSELQDNTEAYKLP  1006

Query  1478  ASSPYDNFLKAAG  1516
             ASSPYDNFLKAAG
Sbjct  1007  ASSPYDNFLKAAG  1019



>ref|XP_009142010.1| PREDICTED: uncharacterized protein LOC103865904 isoform X2 [Brassica 
rapa]
Length=1046

 Score =   342 bits (876),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 218/558 (39%), Positives = 319/558 (57%), Gaps = 61/558 (11%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+LS
Sbjct  493   AFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPRSLS  552

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             RT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++ S 
Sbjct  553   RTASVFSSSAALFEKLRKDKFSSILTSDQSKNEMPEEEPVNNRGTILDKLEASYSQAYST  612

Query  335   --KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA+TY
Sbjct  613   WNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIANTY  672

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F +K 
Sbjct  673   SLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFSAKA  732

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
             ++  PLA   K  L    +DPFL LV++  LK V+ +     +YG +EDD +A  +LS I
Sbjct  733   FNLFPLADFTKVALQGPMIDPFLSLVEDHKLKAVSTDQLPTVAYGCQEDDASALDTLSNI  792

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQS  1045
              IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +   Q+
Sbjct  793   SISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKSFQT  852

Query  1046  D-------------DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
             D                + + VD T TV    + ++P    +  P+LL VN+ L+SV+ET
Sbjct  853   DFGDVKPQKDAALFSHEDQDFVDVTETV----TTNNPVTVAE-LPDLLSVNQILESVVET  907

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------NDE--  1318
             + QVGR S    A  ++ ++   CE    GK  +++       R +         +DE  
Sbjct  908   TRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHDEEN  967

Query  1319  ------PDFNFSEET-IWQPPSGNPFADNNTaaagqpvn-----aaapaSCATEYQRHPS  1462
                   P  N + +T +  P  G  F   +     +  +           C +E Q +  
Sbjct  968   KIATFHPMINSAFDTEVEVPLLGKEFDMKSPRTPVRMKSPRTPMRTIQTHCYSELQDNTE  1027

Query  1463  FMQLPASSPYDNFLKAAG  1516
               +LPASSPYDNFLKAAG
Sbjct  1028  AYKLPASSPYDNFLKAAG  1045



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   341 bits (875),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 239/557 (43%), Positives = 331/557 (59%), Gaps = 68/557 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQ  178
             +NKAFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSS     +P+    S+R + +Q
Sbjct  476   ENKAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSS----VSPSSVLNSRRPADMQ  531

Query  179   RTLSRTVSVFSSSAALFDKLG---------------------------KNQSSGKDGMDQ  277
             RTLSRTVSVFSSSAALF KL                            + +S   +    
Sbjct  532   RTLSRTVSVFSSSAALFRKLKLESDNSVDDTAKMERVSTLSRSTSKFIRGESFDDEEPKN  591

Query  278   NTQNMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFV  451
             NT ++L+RL S+YSRS SVK  P S     N          + L++ S QI +LLSSI+V
Sbjct  592   NTSSVLSRLKSSYSRSQSVKRNPSSMVADQNSSGSSPEKPVIPLRLSSHQICLLLSSIWV  651

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             Q++S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PS
Sbjct  652   QSLSPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPS  709

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKA--  805
             RRRSLF LATSMIIF +K ++  PL  SAK  L +KT+DPFLQLV++C L      +A  
Sbjct  710   RRRSLFTLATSMIIFSAKAFNIPPLVNSAKTSLQEKTVDPFLQLVEDCKLDAVFYGQADQ  769

Query  806   -RASYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDF  979
                +YGSKEDD+ A RSL  I E S+ QS E +ASMI++ L K    +++ IKEQL+ DF
Sbjct  770   PAKNYGSKEDDDDASRSLVTIEEASQNQSREHYASMIMKFLGKLSDQESSAIKEQLVSDF  829

Query  980   LPDEVCPMGTQRINDLRNHNQSDDKT---------------NDEVVDP---TFTVDDLGS  1105
             +P + CP+GTQ         +S++K                ND V  P    F++D    
Sbjct  830   IPIDGCPVGTQLTESPVQVYRSEEKNNKPRENAETQLLIPENDAVPSPPEEQFSLD----  885

Query  1106  HSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGN  1285
                PNA    T  LL ++E L++V +T+ Q+GR S + P  MT+ ++A  CEA   GK  
Sbjct  886   -IQPNA---KTAFLLSIDELLNAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQE  941

Query  1286  RMNFREDGNDEPDFNFSEETIWQPPS-GNPFADNNTaaagqpvnaaapaS-CATEYQRHP  1459
             +M+F    +++   + ++E +  P S GNPF D  ++     + A A ++ C TEYQ  P
Sbjct  942   KMSFMSAKSNKFSSSQTKEAVALPCSGGNPFVDQRSSWEMMGLGAPAASNICVTEYQNQP  1001

Query  1460  SFMQLPASSPYDNFLKA  1510
              F   P+S+P+DNFL A
Sbjct  1002  PFFNPPSSTPFDNFLTA  1018



>ref|XP_009142008.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
 ref|XP_009142009.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
Length=1049

 Score =   341 bits (874),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 221/561 (39%), Positives = 317/561 (57%), Gaps = 64/561 (11%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+LS
Sbjct  493   AFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTATDLQKGMGLPRSLS  552

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             RT SVFSSSAALF+KL K++ S     DQ            N   +L++L ++YS++ S 
Sbjct  553   RTASVFSSSAALFEKLRKDKFSSILTSDQSKNEMPEEEPVNNRGTILDKLEASYSQAYST  612

Query  335   --KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
               +P +    N+  +     + + +++ S QI +LLSSI+ Q+IS  NTP+++EAIA+TY
Sbjct  613   WNQPVTSVADNSVAHLNSDLDAVYIRLSSHQIGLLLSSIWAQSISPANTPDNYEAIANTY  672

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++LFSR K SSH++LIR FQ+A SLR ISL E   +PPSRRRSLF LA SM++F +K 
Sbjct  673   SLVLLFSRVKNSSHDALIRSFQMALSLRDISLMEGGPLPPSRRRSLFTLAASMVLFSAKA  732

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
             ++  PLA   K  L    +DPFL LV++  LK V+ +     +YG +EDD +A  +LS I
Sbjct  733   FNLFPLADFTKVALQGPMIDPFLSLVEDHKLKAVSTDQLPTVAYGCQEDDASALDTLSNI  792

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQS  1045
              IS + S  +    IV+SL+     + + ++EQLL +F+PD+ CP+GT+ + + +   Q+
Sbjct  793   SISTEHSRGTLVYEIVKSLEDMCNSEMDKMREQLLTEFMPDDACPLGTRFVEETQKSFQT  852

Query  1046  DDKTNDEVVDPTFTVDD--LGSHSDPNAHPDST--------------PNLLDVNEFLDSV  1177
             D       V P   + D  L SH D +   D T              P+LL VN+ L+SV
Sbjct  853   DFGD----VKPQKYLQDAALFSHEDQD-FVDVTETVTTNNPVTVAELPDLLSVNQILESV  907

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN------FREDG--------ND  1315
             +ET+ QVGR S    A  ++ ++   CE    GK  +++       R +         +D
Sbjct  908   VETTRQVGRISFHTAADASYKEMTLHCENLLMGKQQKISSLLNSQLRHESSVNSSPRQHD  967

Query  1316  E--------PDFNFSEET-IWQPPSGNPFADNNTaaagqpv-----naaapaSCATEYQR  1453
             E        P  N + +T +  P  G  F   +     +              C +E Q 
Sbjct  968   EENKIATFHPMINSAFDTEVEVPLLGKEFDMKSPRTPVRMKSPRTPMRTIQTHCYSELQD  1027

Query  1454  HPSFMQLPASSPYDNFLKAAG  1516
             +    +LPASSPYDNFLKAAG
Sbjct  1028  NTEAYKLPASSPYDNFLKAAG  1048



>gb|AAC02765.1| hypothetical protein [Arabidopsis thaliana]
Length=961

 Score =   338 bits (867),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 222/579 (38%), Positives = 315/579 (54%), Gaps = 83/579 (14%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFPEALFHQ+L AMV PD++TR+GAHR+FSVVLVP+SVCPR +     L K   + R+L
Sbjct  389   KAFPEALFHQLLQAMVHPDHKTRIGAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPRSL  448

Query  188   SRTVSVFSSSAALFDKLGKNQSS-------GKDGMDQ-----NTQNMLNRLTSTYSRSLS  331
             SRT SVFSSSAALF+KL K++ S        ++GM +     +T  +L+RL S+Y ++ S
Sbjct  449   SRTASVFSSSAALFEKLKKDKFSSMLTSDHSQNGMPEEERGSSTGEILDRLKSSYRQAYS  508

Query  332   V--KPGSEETPN--------------------------------NGENPQEHHEGLSLKM  409
                +P +    N                                NG      ++ + +++
Sbjct  509   TWNQPLTSVVDNSVDLLNSELVHPCNLLCVKKLTRRVVHFLLTLNGTLEFYIYDVVHIRL  568

Query  410   KSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSL  589
              S QI +LLSSI+ Q+IS  NTP+++EAIA+TYSL++LFSR K SSH++LIR FQ+A SL
Sbjct  569   SSHQIGLLLSSIWAQSISPANTPDNYEAIANTYSLVLLFSRVKNSSHDALIRSFQMALSL  628

Query  590   RSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVD  769
             R ISL E   +PPSRRRSLF LA SM++F SK ++   LA   K  L    +DPFL LVD
Sbjct  629   RDISLMEGGPLPPSRRRSLFTLAASMVLFSSKAFNLFSLADFTKVTLQGPRLDPFLNLVD  688

Query  770   ECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTN  949
             +  LK   + + + +YG ++DD +A  +LS I +S + S  +    IV+SL+     + +
Sbjct  689   DHKLKAVNSDQLKVAYGCEKDDASALDTLSNIALSTEHSRGTLVYEIVKSLEDMCNSEMD  748

Query  950   LIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSD---------DKTNDEVVDPTFTVDDLG  1102
              ++EQLL +F+PD+ CP+GT+ + D     Q D         D  + E  D T TV    
Sbjct  749   KMREQLLTEFMPDDACPLGTRFLEDTHKTYQIDSGDVKPRKEDAEDQEFGDGTETVTK--  806

Query  1103  SHSDPNAHP--DSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEG  1276
                  N H      P+LL VN+ L+SV+ET+ QVGR S    A  ++ ++   CE    G
Sbjct  807   -----NNHVTFSEIPDLLTVNQILESVVETTRQVGRISFHTAADASYKEMTLHCENLLMG  861

Query  1277  KGNRMN--FREDGNDEPDFNFS----EETI----WQPPSGNPF---------ADNNTaaa  1399
             K  +++         E   N S    +E I    + P   + F         +      +
Sbjct  862   KQQKISSLLNSQLRHESSVNCSPRQHDEEIKIASFHPMINSAFHTGVEVPLLSKEFDMKS  921

Query  1400  gqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              +       + C  E Q +P   +LPASSPYDNFLKAAG
Sbjct  922   PRTPVGTIQSPCYAELQNNPQAFRLPASSPYDNFLKAAG  960



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   339 bits (869),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 232/550 (42%), Positives = 321/550 (58%), Gaps = 59/550 (11%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             +AFP+ALFHQ+L AMV  D+E+R+GAHR+FSVVLVPSS       +     +   +QRTL
Sbjct  481   EAFPDALFHQLLQAMVCADHESRMGAHRIFSVVLVPSS---VSPSSVPNSRRPADMQRTL  537

Query  188   SRTVSVFSSSAALFDKLG---------------------------KNQSSGKDGMDQNTQ  286
             SRTVSVFSSSAALF KL                            + +S   +    NT 
Sbjct  538   SRTVSVFSSSAALFRKLKLESDNSVDDTAKIERVSTLSRSTSIFTRGESFDDEEPKNNTS  597

Query  287   NMLNRLTSTYSRSLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAI  460
             ++L+RL S+YSRS SVK  P S  +  N          + L++ S QI +LLSSI+VQ++
Sbjct  598   SVLSRLKSSYSRSQSVKRNPSSMVSDQNSSGSSPEKPVIPLRLSSHQICLLLSSIWVQSL  657

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
             S  N P+++EAIA+T+SL++LF RTK SS+E L+  FQLAFSLR++SL     + PSRRR
Sbjct  658   SPHNMPQNYEAIANTFSLVLLFGRTKHSSNEVLVWSFQLAFSLRNLSLG--GPLQPSRRR  715

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKAR---A  811
             SLF LATSMIIF +K ++  PL  SAK  L +KT+DPFLQLV++C L      +A     
Sbjct  716   SLFTLATSMIIFSAKAFNIPPLVNSAKTSLQEKTVDPFLQLVEDCKLDAVFYGQAEQPAK  775

Query  812   SYGSKEDDEAAKRSLSGI-EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPD  988
             +YGSKEDD+ A +SL  I E ++ Q  E +ASMI++ L K    ++  IKEQL+ DF+P 
Sbjct  776   NYGSKEDDDDALQSLFVIEETTQNQPREHYASMIMKFLGKLSDQESTAIKEQLVSDFIPI  835

Query  989   EVCPMGTQRINDLRNHNQSDDKT---------------NDEVVDPTFTVDDLGSHSDPNA  1123
             + CP+GTQ         +S++K                ND V  P+   + LG  + PNA
Sbjct  836   DGCPVGTQLTESPVQVYRSEEKNNKPRENAETQLLIPENDAV--PSPPEEHLGLDTQPNA  893

Query  1124  HPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFRE  1303
                 T  LL ++E L++V +T+ Q+GR S + P  MT+ ++A  CEA   GK  +M+F  
Sbjct  894   ---KTAFLLSIDELLNAVSQTTAQLGRYSVSDPPDMTYTEMAGHCEALLMGKQEKMSFMS  950

Query  1304  DGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPA  1480
               +++      E T      GNPF +  ++     + A A ++ C TEYQ HP F   PA
Sbjct  951   AKSNKFSSQTKEATALPCSGGNPFVEQRSSWEMMGLGAPAASNMCVTEYQNHPPFFNPPA  1010

Query  1481  SSPYDNFLKA  1510
             S+P+DNFLKA
Sbjct  1011  STPFDNFLKA  1020



>ref|XP_008655591.1| PREDICTED: uncharacterized protein LOC103634777 isoform X4 [Zea 
mays]
Length=807

 Score =   333 bits (853),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 214/544 (39%), Positives = 311/544 (57%), Gaps = 67/544 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAM+ PD ET LGAHR+FSVVLVPSSV P  + A  + +++  ++R
Sbjct  291   QSKAFPEALFHQLLLAMLYPDCETHLGAHRIFSVVLVPSSVAPF-SFADTSQTRKIDLRR  349

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML----------------------  295
             TLSRT SVFSSSAALF KL ++  S ++   Q+   +L                      
Sbjct  350   TLSRTTSVFSSSAALFGKLKRDMLSFRESALQDNTKLLPISENANEISANDAKLFKSQTI  409

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  R +S+   ++ + ++     +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  410   QRMVST--RDISLPSSTDTSTSSEPTSYQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  467

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  E L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  468   PRNYEAISHTYSLMLLFSRAKGSGAEVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  526

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKE  829
             ATSM++F SK ++ + L    K +LT+ T+DPFL L+++C L+   + N      YGSKE
Sbjct  527   ATSMLVFFSKAFNVLALIPVVKQVLTESTVDPFLCLIEDCRLQALDSANESCTKLYGSKE  586

Query  830   DDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT  1009
             DDE A +SLS I++++ QS E+   +I++SL+     + + I++QLL++F  D+ C +G+
Sbjct  587   DDELALKSLSNIDMNENQSKETSVPLILDSLEDMSESELSAIRKQLLEEFSADDSC-LGS  645

Query  1010  QRINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNE  1162
                     +   + K +    EV+   F  +D  L   SD +  P        N+LDVN 
Sbjct  646   HFTETPSQYPAQNGKLHHKSMEVIPLGFVFEDDTLAEASDSSVEPHLQHPPCNNILDVNR  705

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF------REDGNDEPD  1324
              LDSVLETS  VGR S +    + F DVA+QCEA   GK  +++       +E G     
Sbjct  706   LLDSVLETSQHVGRSSVSTNQDLPFKDVANQCEALLIGKQQKLSACMSVCEKEAG-----  760

Query  1325  FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
                 E ++ Q    +P AD                 C  + Q HP+  +LPA  PYD FL
Sbjct  761   ----ESSVEQSSRQDPQADTFL--------------CTADEQWHPNSCKLPALCPYDRFL  802

Query  1505  KAAG  1516
               +G
Sbjct  803   ATSG  806



>ref|XP_008655590.1| PREDICTED: uncharacterized protein LOC103634777 isoform X3 [Zea 
mays]
Length=906

 Score =   333 bits (855),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 214/544 (39%), Positives = 311/544 (57%), Gaps = 67/544 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAM+ PD ET LGAHR+FSVVLVPSSV P  + A  + +++  ++R
Sbjct  390   QSKAFPEALFHQLLLAMLYPDCETHLGAHRIFSVVLVPSSVAPF-SFADTSQTRKIDLRR  448

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML----------------------  295
             TLSRT SVFSSSAALF KL ++  S ++   Q+   +L                      
Sbjct  449   TLSRTTSVFSSSAALFGKLKRDMLSFRESALQDNTKLLPISENANEISANDAKLFKSQTI  508

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  R +S+   ++ + ++     +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  509   QRMVST--RDISLPSSTDTSTSSEPTSYQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  566

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  E L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  567   PRNYEAISHTYSLMLLFSRAKGSGAEVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  625

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKE  829
             ATSM++F SK ++ + L    K +LT+ T+DPFL L+++C L+   + N      YGSKE
Sbjct  626   ATSMLVFFSKAFNVLALIPVVKQVLTESTVDPFLCLIEDCRLQALDSANESCTKLYGSKE  685

Query  830   DDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT  1009
             DDE A +SLS I++++ QS E+   +I++SL+     + + I++QLL++F  D+ C +G+
Sbjct  686   DDELALKSLSNIDMNENQSKETSVPLILDSLEDMSESELSAIRKQLLEEFSADDSC-LGS  744

Query  1010  QRINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNE  1162
                     +   + K +    EV+   F  +D  L   SD +  P        N+LDVN 
Sbjct  745   HFTETPSQYPAQNGKLHHKSMEVIPLGFVFEDDTLAEASDSSVEPHLQHPPCNNILDVNR  804

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF------REDGNDEPD  1324
              LDSVLETS  VGR S +    + F DVA+QCEA   GK  +++       +E G     
Sbjct  805   LLDSVLETSQHVGRSSVSTNQDLPFKDVANQCEALLIGKQQKLSACMSVCEKEAG-----  859

Query  1325  FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
                 E ++ Q    +P AD                 C  + Q HP+  +LPA  PYD FL
Sbjct  860   ----ESSVEQSSRQDPQADTFL--------------CTADEQWHPNSCKLPALCPYDRFL  901

Query  1505  KAAG  1516
               +G
Sbjct  902   ATSG  905



>ref|XP_008655589.1| PREDICTED: uncharacterized protein LOC103634777 isoform X2 [Zea 
mays]
Length=996

 Score =   333 bits (854),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 212/538 (39%), Positives = 310/538 (58%), Gaps = 55/538 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAM+ PD ET LGAHR+FSVVLVPSSV P  + A  + +++  ++R
Sbjct  480   QSKAFPEALFHQLLLAMLYPDCETHLGAHRIFSVVLVPSSVAPF-SFADTSQTRKIDLRR  538

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML----------------------  295
             TLSRT SVFSSSAALF KL ++  S ++   Q+   +L                      
Sbjct  539   TLSRTTSVFSSSAALFGKLKRDMLSFRESALQDNTKLLPISENANEISANDAKLFKSQTI  598

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  R +S+   ++ + ++     +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  599   QRMVST--RDISLPSSTDTSTSSEPTSYQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  656

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  E L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  657   PRNYEAISHTYSLMLLFSRAKGSGAEVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  715

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKE  829
             ATSM++F SK ++ + L    K +LT+ T+DPFL L+++C L+   + N      YGSKE
Sbjct  716   ATSMLVFFSKAFNVLALIPVVKQVLTESTVDPFLCLIEDCRLQALDSANESCTKLYGSKE  775

Query  830   DDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT  1009
             DDE A +SLS I++++ QS E+   +I++SL+     + + I++QLL++F  D+ C +G+
Sbjct  776   DDELALKSLSNIDMNENQSKETSVPLILDSLEDMSESELSAIRKQLLEEFSADDSC-LGS  834

Query  1010  QRINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNE  1162
                     +   + K +    EV+   F  +D  L   SD +  P        N+LDVN 
Sbjct  835   HFTETPSQYPAQNGKLHHKSMEVIPLGFVFEDDTLAEASDSSVEPHLQHPPCNNILDVNR  894

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEE  1342
              LDSVLETS  VGR S +    + F DVA+QCEA   GK  +++      ++      E 
Sbjct  895   LLDSVLETSQHVGRSSVSTNQDLPFKDVANQCEALLIGKQQKLSACMSVCEK---EAGES  951

Query  1343  TIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             ++ Q    +P AD                 C  + Q HP+  +LPA  PYD FL  +G
Sbjct  952   SVEQSSRQDPQADTFL--------------CTADEQWHPNSCKLPALCPYDRFLATSG  995



>ref|XP_008655586.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
 ref|XP_008655587.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
 ref|XP_008655588.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
Length=1002

 Score =   333 bits (853),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 212/538 (39%), Positives = 310/538 (58%), Gaps = 55/538 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAM+ PD ET LGAHR+FSVVLVPSSV P  + A  + +++  ++R
Sbjct  486   QSKAFPEALFHQLLLAMLYPDCETHLGAHRIFSVVLVPSSVAPF-SFADTSQTRKIDLRR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML----------------------  295
             TLSRT SVFSSSAALF KL ++  S ++   Q+   +L                      
Sbjct  545   TLSRTTSVFSSSAALFGKLKRDMLSFRESALQDNTKLLPISENANEISANDAKLFKSQTI  604

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  R +S+   ++ + ++     +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  605   QRMVST--RDISLPSSTDTSTSSEPTSYQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  662

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  E L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  663   PRNYEAISHTYSLMLLFSRAKGSGAEVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  721

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKE  829
             ATSM++F SK ++ + L    K +LT+ T+DPFL L+++C L+   + N      YGSKE
Sbjct  722   ATSMLVFFSKAFNVLALIPVVKQVLTESTVDPFLCLIEDCRLQALDSANESCTKLYGSKE  781

Query  830   DDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT  1009
             DDE A +SLS I++++ QS E+   +I++SL+     + + I++QLL++F  D+ C +G+
Sbjct  782   DDELALKSLSNIDMNENQSKETSVPLILDSLEDMSESELSAIRKQLLEEFSADDSC-LGS  840

Query  1010  QRINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNE  1162
                     +   + K +    EV+   F  +D  L   SD +  P        N+LDVN 
Sbjct  841   HFTETPSQYPAQNGKLHHKSMEVIPLGFVFEDDTLAEASDSSVEPHLQHPPCNNILDVNR  900

Query  1163  FLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEE  1342
              LDSVLETS  VGR S +    + F DVA+QCEA   GK  +++      ++      E 
Sbjct  901   LLDSVLETSQHVGRSSVSTNQDLPFKDVANQCEALLIGKQQKLSACMSVCEK---EAGES  957

Query  1343  TIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             ++ Q    +P AD                 C  + Q HP+  +LPA  PYD FL  +G
Sbjct  958   SVEQSSRQDPQADTFL--------------CTADEQWHPNSCKLPALCPYDRFLATSG  1001



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   333 bits (854),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 221/580 (38%), Positives = 321/580 (55%), Gaps = 79/580 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  + ++ + +QR
Sbjct  479   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPILQASATSQARARDMQR  538

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS--------------GKDGMDQNTQNM---LNRLTS  310
             TLSR VSVFSSSAA+FDKL K++ S              G++  +   QN+    +R +S
Sbjct  539   TLSRAVSVFSSSAAIFDKLKKDKHSDNSQGESKSNLHNVGEETGNAKRQNLPVSQSRRSS  598

Query  311   TYSRSLSVKPG-------------------------------SEETPNNGENPQEHHEGL  397
                 + S+K G                                +E  N+     +  + L
Sbjct  599   MRMPNFSMKKGPSMALRAPSSVRAPSIALRGPSMALRAPSMSVKEDKNSSSKSDDEMDTL  658

Query  398   SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQL  577
              LK+ SRQI++LL+SI+ QA+S  NTP ++EAIAHTYSLL+LFS  K S  E+L + FQ+
Sbjct  659   LLKLSSRQITLLLTSIWAQAVSPENTPANYEAIAHTYSLLLLFSGCKASIFEALTQSFQV  718

Query  578   AFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFL  757
             AF+LR  SL+E   +PPSRRRSLF LAT+M IF SK ++  PL    K ++ DKT DPFL
Sbjct  719   AFALRHYSLTEADSLPPSRRRSLFTLATAMTIFSSKAFNVAPLIPICKQMINDKTGDPFL  778

Query  758   QLVDECHLK-VNPNPK-ARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKS  931
              +VDE  L+ V  +P+    +YGS ED+ +A ++L  IE+S+ QS E   S I+ ++   
Sbjct  779   HIVDESKLQAVKDSPEDPSKTYGSPEDNASALKALEAIEVSESQSRECIVSTIMNNIANI  838

Query  932   ITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDE-----VVDPTFTVDD  1096
             I  + + ++ QLL DF PD++CPM  Q   D   H+ S    N       ++D     D 
Sbjct  839   IDAELHSVRSQLLSDFAPDDMCPMSNQFFADSDEHSLSGSHENGHHEEAMLIDLGNDNDI  898

Query  1097  LGSHSDPNAHPDS---TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQCEA  1264
              G  S+  A   +   T +L+ +++ L++V  + ++   R   +  A M FM++ SQCEA
Sbjct  899   FGEASESTATSATSVPTGDLMSIDQLLETVGADPTHHTERSQVS--ADMPFMEMTSQCEA  956

Query  1265  FQEGKGNR----MNFREDGNDEP----DFNFSEETIWQPP--------SGNPFADNNTaa  1396
                GK  +    M+F+ +    P      N  E  ++  P        S NPFAD+N   
Sbjct  957   LTMGKQQKMSTFMSFQTNMQAAPLPSHQPNQMELALFHDPPVPQAGAQSTNPFADDNFKG  1016

Query  1397  agqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               + +N   P      +Q+H  F++LPASSPYDNFL+AAG
Sbjct  1017  YPEYMNTDNPQPADDPFQQH--FLKLPASSPYDNFLRAAG  1054



>emb|CDX79909.1| BnaA05g02470D [Brassica napus]
Length=970

 Score =   331 bits (848),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 209/517 (40%), Positives = 298/517 (58%), Gaps = 46/517 (9%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             +AFPEALFHQ+L AMV PD++TR+ AHR+FSVVLVP+SVCPR +     L K   + R+L
Sbjct  485   QAFPEALFHQLLQAMVHPDHKTRIDAHRIFSVVLVPTSVCPRPSSTTTDLKKGMGLPRSL  544

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNG  367
             SR  SVFSSSAALF+KL K++ S     DQ+     N+  S ++     +P +    N+ 
Sbjct  545   SRNASVFSSSAALFEKLRKDKVSSVPTSDQSH----NQAYSNWN-----QPVTSVADNSV  595

Query  368   ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
             +        + +++ S QI +LLSSI+ Q++S  NTP+++EAIA+TYSL++LF R K SS
Sbjct  596   D-------AVYIRLSSHQIGLLLSSIWAQSLSPANTPDNYEAIANTYSLVLLFCRVKNSS  648

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             H++LIR FQ+A SLR ISL E   +PPSRRRSLF LATSM++F SK ++   LA  AK  
Sbjct  649   HDALIRSFQMAVSLRDISLMEGGPLPPSRRRSLFTLATSMVLFSSKAFNLFSLADFAKVA  708

Query  728   LTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFAS  904
             L   T+DPFL LV++  LK VNP+     +YG +EDD +A  +LS I +S + S  +  S
Sbjct  709   LQVPTLDPFLHLVEDQKLKAVNPDQLQTVAYGCQEDDASALGTLSKIAVSTEHSRGTLVS  768

Query  905   MIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSD------------  1048
              IV+SL+   + +   ++EQLL +F+PD+ CP+GT+ + D +   Q++            
Sbjct  769   EIVKSLENMCSSEMEKMQEQLLTEFMPDDACPLGTRVLEDTQKPFQANFGDVKPQNLAAL  828

Query  1049  -DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPA  1225
                 + E  D T TV D     D        P+LL V++ L+SV+ET  Q+G  S    A
Sbjct  829   FSHEDQEFGDVTETVTD-----DNPVKVAVVPDLLTVDQILESVVETIRQMGLISFNTAA  883

Query  1226  GMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPPSGNPFADNNTaaagq  1405
               ++ ++A  CE  ++ K + + F      E   N S      P   +      T     
Sbjct  884   DASYREMALHCENLKQQKISSL-FNSQLRHESSVNGS------PGQHDEEIKIATFLPMI  936

Query  1406  pvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                      C +E Q +    +LPAS+PYDNFLKAAG
Sbjct  937   NSAFHTETQCYSELQAY----KLPASTPYDNFLKAAG  969



>gb|EEC81712.1| hypothetical protein OsI_25322 [Oryza sativa Indica Group]
Length=1066

 Score =   332 bits (850),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 225/583 (39%), Positives = 310/583 (53%), Gaps = 83/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +    +K+  +QR
Sbjct  488   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVAPSIQASVSGQAKKHDMQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQ--------SSGKDGMDQNTQN----------------  289
             TLSR VSVFSSSAA+FDKL K++        SSG   + + + N                
Sbjct  548   TLSRAVSVFSSSAAIFDKLKKDKHSDNSQGDSSGLHSISEESSNAKRSNLPVSQSRRRSM  607

Query  290   ------------MLNRLTSTYSR----SLSVKPGSEETPN--------NGENPQEHHEGL  397
                         M  R  S   R    SL V   S   P+        +  +P++  E +
Sbjct  608   KIPNFSMKRGPSMAMRAPSVALRAPSISLRVTSMSLRAPSMSIKADHGSSSHPEDEMESV  667

Query  398   SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQL  577
              LK+ SRQI++LLSSI+ QA S  NTP ++EAIAHTYSLL+LFS  K S  E+L + FQ+
Sbjct  668   LLKLSSRQITLLLSSIWAQATSPENTPANYEAIAHTYSLLLLFSGAKASVFEALTQSFQV  727

Query  578   AFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFL  757
             AFSLR  SL+E   +PP RRRSLF LAT+MIIF S+T++ +PL    K +L ++T DPFL
Sbjct  728   AFSLRGYSLTEPDSLPPCRRRSLFTLATAMIIFSSRTFNVLPLIPICKQMLNERTGDPFL  787

Query  758   QLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKS  931
             +LVDEC L+   +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++   
Sbjct  788   RLVDECKLQAVKDSVDDPSKIYGSPEDNTNALKSLSAIELSESQSRECIVSTIMNNITNM  847

Query  932   ITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHS  1111
             +  + N +K QLL DF PD++CP  T       +++      ND    P   + DLG+  
Sbjct  848   LEAELNSVKNQLLSDFSPDDMCPTSTHFFEATGDNSSPGSHDNDH--HPEAVLIDLGNDH  905

Query  1112  D------------PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
             D             NA P    +LL +++ L++V+ T      +  +    M F +++SQ
Sbjct  906   DIFGEASESTAASANAVP--VTDLLSIDQLLETVV-TDPAPHTERVSVSTDMPFKEMSSQ  962

Query  1256  CEAFQEGKGNR----MNFREDGNDEP-----DFNFSEETIWQP-------PSGNPFADNN  1387
             CEA    K  +    M+F +D   +P      F         P       P+ NPF D+N
Sbjct  963   CEALTVRKHQKMASFMSFSQDMTMDPMATNQPFQTDLSLFHDPYPPQVGVPNTNPFVDDN  1022

Query  1388  TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q +N        T  Q    F++LPASSPYDNF +AAG
Sbjct  1023  LYGYPQYMNMNEANPQPTYEQAQQHFLRLPASSPYDNFRRAAG  1065



>ref|NP_001059150.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAC83231.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF21064.1| Os07g0205900 [Oryza sativa Japonica Group]
 dbj|BAG91832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66774.1| hypothetical protein OsJ_23500 [Oryza sativa Japonica Group]
Length=1066

 Score =   332 bits (850),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 225/583 (39%), Positives = 310/583 (53%), Gaps = 83/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +    +K+  +QR
Sbjct  488   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVAPSIQASVSGQAKKHDMQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQ--------SSGKDGMDQNTQN----------------  289
             TLSR VSVFSSSAA+FDKL K++        SSG   + + + N                
Sbjct  548   TLSRAVSVFSSSAAIFDKLKKDKHSDNSQGDSSGLHSISEESSNAKRSNLPVSQSRRRSM  607

Query  290   ------------MLNRLTSTYSR----SLSVKPGSEETPN--------NGENPQEHHEGL  397
                         M  R  S   R    SL V   S   P+        +  +P++  E +
Sbjct  608   KIPNFSMKRGPSMAMRAPSVALRAPSISLRVTSMSLRAPSMSIKADHGSSSHPEDEMESV  667

Query  398   SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQL  577
              LK+ SRQI++LLSSI+ QA S  NTP ++EAIAHTYSLL+LFS  K S  E+L + FQ+
Sbjct  668   LLKLSSRQITLLLSSIWAQATSPENTPANYEAIAHTYSLLLLFSGAKASVFEALTQSFQV  727

Query  578   AFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFL  757
             AFSLR  SL+E   +PP RRRSLF LAT+MIIF S+T++ +PL    K +L ++T DPFL
Sbjct  728   AFSLRGYSLTEPDSLPPCRRRSLFTLATAMIIFSSRTFNVLPLIPICKQMLNERTGDPFL  787

Query  758   QLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKS  931
             +LVDEC L+   +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++   
Sbjct  788   RLVDECKLQAVKDSVDDPSKIYGSPEDNTNALKSLSAIELSESQSRECIVSTIMNNITNM  847

Query  932   ITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHS  1111
             +  + N +K QLL DF PD++CP  T       +++      ND    P   + DLG+  
Sbjct  848   LEAELNSVKNQLLSDFSPDDMCPTSTHFFEATGDNSSPGSHDNDH--HPEAVLIDLGNDH  905

Query  1112  D------------PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
             D             NA P    +LL +++ L++V+ T      +  +    M F +++SQ
Sbjct  906   DIFGEASESTAASANAVP--VTDLLSIDQLLETVV-TDPAPHTERVSVSTDMPFKEMSSQ  962

Query  1256  CEAFQEGKGNR----MNFREDGNDEP-----DFNFSEETIWQP-------PSGNPFADNN  1387
             CEA    K  +    M+F +D   +P      F         P       P+ NPF D+N
Sbjct  963   CEALTVRKHQKMASFMSFSQDMTMDPMATNQPFQTDLSLFHDPYPPQVGVPNTNPFVDDN  1022

Query  1388  TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q +N        T  Q    F++LPASSPYDNF +AAG
Sbjct  1023  LYGYPQYMNMNEANPQPTYEQAQQHFLRLPASSPYDNFRRAAG  1065



>gb|KHG10450.1| Protein EFR3 [Gossypium arboreum]
Length=955

 Score =   329 bits (844),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 232/555 (42%), Positives = 295/555 (53%), Gaps = 137/555 (25%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS-IQRT  184
             +AFPEALFHQ+LLAM + D+ETR+GAHR+FSVVLVPSSVCP   P+    SKR S +Q+T
Sbjct  485   QAFPEALFHQLLLAMANRDHETRVGAHRIFSVVLVPSSVCP-CLPSATPSSKRASNLQKT  543

Query  185   LSRTVSVFSSSAALFDKLG----------------------------------KNQSSGK  262
             LSRTVSVFSSSAALF KLG                                  +N + G 
Sbjct  544   LSRTVSVFSSSAALFQKLGTEGKEKSVDNKVGNINGISMQDRLSSKKHHSTINENGTVGM  603

Query  263   DGMDQNTQNMLNRLTSTYSRSLSVKPGSE--------ETPNNGENPQEHHEGLSLKMKSR  418
             D     + +++NRL S+YSR+ S++   +         T ++ E+P      L L++ S 
Sbjct  604   DSTKPQSPSIVNRLKSSYSRAYSIRINQQSNTVEDEKSTISSVEDP-----ALPLRLSSH  658

Query  419   QISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSI  598
             QI+++LSS++ Q+IS LN PE+FEAIAHTYSL++LF+RTK S ++++IR FQLAFSLRSI
Sbjct  659   QITLMLSSLWAQSISPLNIPENFEAIAHTYSLVLLFARTKNSCNDAMIRSFQLAFSLRSI  718

Query  599   SLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECH  778
             SL E   + PSRRRSLF LATSMIIF SK Y+  PL   AKALLT+KT+DPFL+LVD+C 
Sbjct  719   SL-EGGPLQPSRRRSLFILATSMIIFSSKAYNIPPLFPCAKALLTEKTIDPFLRLVDDCK  777

Query  779   LK-----VNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDK  943
             L+     +NP       YGSKEDDE A +SLS I +++ QS +S A+MIV+ L K     
Sbjct  778   LQTTKDELNPG----KIYGSKEDDEDALKSLSEIHLAENQSKDSLATMIVKFLGK-----  828

Query  944   TNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNA  1123
                     L D  P                              P FTVDD        A
Sbjct  829   --------LSDVEP------------------------------PLFTVDDDTIKGQTGA  850

Query  1124  HPDSTP---NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN  1294
                  P   NLL V+E LD+  E    +  +   P +                G G    
Sbjct  851   ETSLAPETQNLLSVHELLDANREGLVSISTKEGQPRS--------------HAGSG----  892

Query  1295  FREDGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpv-naaapaSCATEYQRHPSFMQ  1471
                         F +     P + NPF D+N  A        A    CA E+Q  P F Q
Sbjct  893   ------------FLKSHTPLPVAENPFLDDNIGAVSLNQPAGANLMLCANEHQHQPCF-Q  939

Query  1472  LPASSPYDNFLKAAG  1516
             LPAS PYDNFLKAAG
Sbjct  940   LPASIPYDNFLKAAG  954



>ref|XP_006858684.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   330 bits (845),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 228/554 (41%), Positives = 314/554 (57%), Gaps = 63/554 (11%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             +K FPEALFHQ+LLAMV PD+ETR+GAHRV SVVL+PSSV    AP  G++S  +S    
Sbjct  479   SKEFPEALFHQLLLAMVHPDHETRVGAHRVLSVVLLPSSV----APQIGSVSS-ESPNGP  533

Query  185   LSRTVSVFSSSAALFDKLGKNQSS-------GK-------DGMDQNTQNM--------LN  298
             LS TV   SS A LF+ + K QSS       GK       DGM +    +        +N
Sbjct  534   LSTTVPGLSSCAGLFEMIVKEQSSKLGALPGGKYKGNMMEDGMKEKLVQLGVDAGNEKVN  593

Query  299   RLTSTY------SRSLSVKPGSEETPNNGENPQEHH---EGLSLKMKSRQISMLLSSIFV  451
                  Y      SRS S+K  S     +G    E     E  SL++ S Q+S++LSS++V
Sbjct  594   NDVKLYTAHPSQSRSYSMKLSSPRLVTDGGTITETEKDAEPTSLRLSSPQMSLMLSSLWV  653

Query  452   QAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPS  631
             QA+   N P +FEAIAHTY+L++L S  K SSHE+L+R FQLA+SLRSISL  +  + PS
Sbjct  654   QAVFPENAPANFEAIAHTYNLILLLSLVKNSSHETLVRAFQLAYSLRSISLEREGGLQPS  713

Query  632   RRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARA  811
             RRRSLF LAT M+I L++ YS I L    KALLTD+T+DP+L LV+E  L V   P  + 
Sbjct  714   RRRSLFTLATCMLISLARIYSVISLIRILKALLTDRTLDPYLHLVEENRL-VAVVPSGKP  772

Query  812   SYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDE  991
              YGSKEDD AA +SLS IEI+++ S ES+ S+I+ +L      +++ I++QLL++F PD+
Sbjct  773   VYGSKEDDSAALKSLSAIEITEEHSKESYVSLIMNNLGSLPEVESSSIRQQLLEEFAPDD  832

Query  992   VCPMGTQRIND----LRNHNQSDDKTNDEVVDPTFTVDDLGS-HSDPNAHPDST----PN  1144
               P+G+Q   +           D K  DE++  +F  DD  S     N   DST      
Sbjct  833   AYPLGSQLFMETPWPYSPSASKDQKPFDEIMSTSFCTDDDASLEMFGNQINDSTQLSDSE  892

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNFREDGND  1315
             +++VN+ ++SVLET+    RQ A+ P  MT   +  +  QCEA   GK  +M+   +G  
Sbjct  893   VINVNQLIESVLETA----RQVASVPVSMTPVPYDQMKEQCEALVMGKQQKMSLLMNGKH  948

Query  1316  EPDFNFSEETIWQPPSG-----NPFADNNTaaagqpvnaaapaS--CATEYQRHPSFMQL  1474
             + D    +   ++   G         D  +      +      S  C++EYQ+  SF +L
Sbjct  949   QEDLVLCDLPQYEERKGLSSPQKKIYDTRSLEETDEIRMVVDCSLFCSSEYQQ--SF-RL  1005

Query  1475  PASSPYDNFLKAAG  1516
             P SSP+D FLKAAG
Sbjct  1006  PPSSPFDKFLKAAG  1019



>ref|XP_009351152.1| PREDICTED: uncharacterized protein LOC103942690, partial [Pyrus 
x bretschneideri]
Length=461

 Score =   308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 190/430 (44%), Positives = 267/430 (62%), Gaps = 65/430 (15%)
 Frame = +2

Query  191   RTVSVFSSSAALFDKLGKN----QSSGKDGMDQ---------------------------  277
             RTVSVFSSSAALF+KL K     +S G++  D+                           
Sbjct  1     RTVSVFSSSAALFEKLNKGSHSQESIGQELKDKVVIQEEAKVPNESMLNRLKSKFSSRRH  60

Query  278   ---------------NTQNMLNRLTSTYSRSLSVKPGSEETPNNGENP---QEHHEGLSL  403
                            +  +++NRL STYSR+ S++     TP+  +      +    +SL
Sbjct  61    PSATSDPVGNEDASVSNHSVMNRLKSTYSRAYSIRRNPSNTPSADQKTTSISDKESTMSL  120

Query  404   KMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAF  583
             ++ +RQI++LLSSI+ Q+IS LNTPE++EAIA+TYSL++L++RTK +S E+LIR FQLAF
Sbjct  121   RLSTRQITLLLSSIWAQSISPLNTPENYEAIANTYSLVLLYARTKNTSDETLIRSFQLAF  180

Query  584   SLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQL  763
             SLRSISL     + PSRRRSLF LATSMIIF +K Y+ + LA  AKA LT++T+DPFL+L
Sbjct  181   SLRSISLG--GGLQPSRRRSLFTLATSMIIFSAKAYNVVALAPCAKAALTNETVDPFLRL  238

Query  764   VDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSIT  937
             VD+  L+ VN  P + R  YGSKEDDE A RSLS IE S+ QS ESFA+MIV++L+ S  
Sbjct  239   VDDHKLQAVNSGPDQVRKVYGSKEDDENALRSLSAIEKSENQSKESFATMIVQTLRNSPA  298

Query  938   DKTNLIKEQLLQDFLPDEVCPMGT----QRINDLRNHNQSDDKTNDEVVDPTFTV-DDLG  1102
             D +++IK+QLL DF+PD+ CP+G     +   ++      DD   D+   P FTV DD+ 
Sbjct  299   D-SSIIKQQLLNDFMPDDACPLGAPLSMETPTEIDQVGVQDDGEPDKAEPPLFTVGDDVL  357

Query  1103  SHSDPN-AHPDS-----TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEA  1264
             + +  N A PD+     + +L+ ++E L SV ET++QVGR S +    M +M++A QCEA
Sbjct  358   ADAYANQADPDTKVAVESLSLISIDELLHSVSETTHQVGRLSVSIATNMPYMEMAGQCEA  417

Query  1265  FQEGKGNRMN  1294
              Q GK  +++
Sbjct  418   LQMGKQQKLS  427



>ref|XP_008673097.1| PREDICTED: uncharacterized protein LOC100381825 isoform X1 [Zea 
mays]
 ref|XP_008673098.1| PREDICTED: uncharacterized protein LOC100381825 isoform X1 [Zea 
mays]
Length=1001

 Score =   317 bits (813),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 204/541 (38%), Positives = 311/541 (57%), Gaps = 62/541 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD  T LGAHR+FSVVLVPS+V P  + +  + +++  ++R
Sbjct  486   QSKAFPEALFHQLLLAMVYPDCGTHLGAHRIFSVVLVPSAVAP-CSFSDTSRTRKIDLRR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG-MDQNTQNM---------------------L  295
             TLSRT SVFSSSAALF KL ++  S ++  +  NT+ +                     +
Sbjct  545   TLSRTTSVFSSSAALFGKLKRDMLSFRESPLHDNTKLLPISEDADEISANDAKLFKSQTI  604

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  + +S+   ++ +  + + P +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  605   QRMAST--KDISLPSSTDASTLSEQTPNQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  662

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  + L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  663   PRNYEAISHTYSLMLLFSRAKGSGADVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  721

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKED  832
             ATSM++F SK ++   L    K +LT+ T+DPFL L+++C L+ ++   ++   YGSKED
Sbjct  722   ATSMLVFFSKAFNVPALIPVVKHVLTESTVDPFLCLIEDCRLQALDSAAQSCKLYGSKED  781

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I++++ QS E+  S+I++SL+     + + I++QL+++F  D++C +G+ 
Sbjct  782   DDQALKSLSNIDMNEHQSKETSVSLILDSLEDLSESELSTIRKQLIEEFSADDIC-LGSH  840

Query  1013  RINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNEF  1165
                        + K +    EV+   F  +D  L   SD    P        ++LDV+  
Sbjct  841   FTETPSKSAAQNGKLHHKSMEVIPFGFVFEDDTLVEASDSLVEPHLRHLPCNSVLDVDRL  900

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNR----MNFREDGNDEPDFNF  1333
             L+SVLETS  VGR S +    + F +VA+QCEA   GK  +    M+ RE  + E     
Sbjct  901   LNSVLETSQHVGRMSVSTDQDLPFKEVANQCEALLIGKQQKLSICMSVREKKDGESSI--  958

Query  1334  SEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
              E++  Q P    F                   C  + Q H +  +LP   PYD FL  +
Sbjct  959   -EKSSQQDPQAYTFL------------------CTADEQWHLNSCKLPVLCPYDRFLATS  999

Query  1514  G  1516
             G
Sbjct  1000  G  1000



>ref|XP_008673100.1| PREDICTED: uncharacterized protein LOC100381825 isoform X3 [Zea 
mays]
Length=993

 Score =   317 bits (812),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 204/542 (38%), Positives = 310/542 (57%), Gaps = 62/542 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD  T LGAHR+FSVVLVPS+V P  + +  + +++  ++R
Sbjct  478   QSKAFPEALFHQLLLAMVYPDCGTHLGAHRIFSVVLVPSAVAP-CSFSDTSRTRKIDLRR  536

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG-MDQNTQNM---------------------L  295
             TLSRT SVFSSSAALF KL ++  S ++  +  NT+ +                     +
Sbjct  537   TLSRTTSVFSSSAALFGKLKRDMLSFRESPLHDNTKLLPISEDADEISANDAKLFKSQTI  596

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  + +S+   ++ +  + + P +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  597   QRMAST--KDISLPSSTDASTLSEQTPNQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  654

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  + L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  655   PRNYEAISHTYSLMLLFSRAKGSGADVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  713

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKED  832
             ATSM++F SK ++   L    K +LT+ T+DPFL L+++C L+ ++   ++   YGSKED
Sbjct  714   ATSMLVFFSKAFNVPALIPVVKHVLTESTVDPFLCLIEDCRLQALDSAAQSCKLYGSKED  773

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I++++ QS E+  S+I++SL+     + + I++QL+++F  D++C +G+ 
Sbjct  774   DDQALKSLSNIDMNEHQSKETSVSLILDSLEDLSESELSTIRKQLIEEFSADDIC-LGSH  832

Query  1013  RINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNEF  1165
                        + K +    EV+   F  +D  L   SD    P        ++LDV+  
Sbjct  833   FTETPSKSAAQNGKLHHKSMEVIPFGFVFEDDTLVEASDSLVEPHLRHLPCNSVLDVDRL  892

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNR----MNFREDGNDEPDFNF  1333
             L+SVLETS  VGR S +    + F +VA+QCEA   GK  +    M+ RE  + E     
Sbjct  893   LNSVLETSQHVGRMSVSTDQDLPFKEVANQCEALLIGKQQKLSICMSVREKKDGESSIEK  952

Query  1334  SEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
             S +   Q P    F                   C  + Q H +  +LP   PYD FL  +
Sbjct  953   SSQ---QDPQAYTFL------------------CTADEQWHLNSCKLPVLCPYDRFLATS  991

Query  1514  GS  1519
             G 
Sbjct  992   GC  993



>ref|XP_008673099.1| PREDICTED: uncharacterized protein LOC100381825 isoform X2 [Zea 
mays]
Length=1001

 Score =   317 bits (812),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 204/542 (38%), Positives = 310/542 (57%), Gaps = 62/542 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD  T LGAHR+FSVVLVPS+V P  + +  + +++  ++R
Sbjct  486   QSKAFPEALFHQLLLAMVYPDCGTHLGAHRIFSVVLVPSAVAP-CSFSDTSRTRKIDLRR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG-MDQNTQNM---------------------L  295
             TLSRT SVFSSSAALF KL ++  S ++  +  NT+ +                     +
Sbjct  545   TLSRTTSVFSSSAALFGKLKRDMLSFRESPLHDNTKLLPISEDADEISANDAKLFKSQTI  604

Query  296   NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNT  475
              R+ ST  + +S+   ++ +  + + P +  + ++L +  RQ ++LLSS++ QA+S  N 
Sbjct  605   QRMAST--KDISLPSSTDASTLSEQTPNQEKDAVTLMLSVRQANLLLSSLWTQALSPENV  662

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             P ++EAI+HTYSL++LFSR K S  + L+  FQLAFSLRS+SL +   +PPSRRRSLF L
Sbjct  663   PRNYEAISHTYSLMLLFSRAKGSGADVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLFTL  721

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKED  832
             ATSM++F SK ++   L    K +LT+ T+DPFL L+++C L+ ++   ++   YGSKED
Sbjct  722   ATSMLVFFSKAFNVPALIPVVKHVLTESTVDPFLCLIEDCRLQALDSAAQSCKLYGSKED  781

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I++++ QS E+  S+I++SL+     + + I++QL+++F  D++C +G+ 
Sbjct  782   DDQALKSLSNIDMNEHQSKETSVSLILDSLEDLSESELSTIRKQLIEEFSADDIC-LGSH  840

Query  1013  RINDLRNHNQSDDKTND---EVVDPTFTVDD--LGSHSDPNAHPD----STPNLLDVNEF  1165
                        + K +    EV+   F  +D  L   SD    P        ++LDV+  
Sbjct  841   FTETPSKSAAQNGKLHHKSMEVIPFGFVFEDDTLVEASDSLVEPHLRHLPCNSVLDVDRL  900

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNR----MNFREDGNDEPDFNF  1333
             L+SVLETS  VGR S +    + F +VA+QCEA   GK  +    M+ RE  + E     
Sbjct  901   LNSVLETSQHVGRMSVSTDQDLPFKEVANQCEALLIGKQQKLSICMSVREKKDGESSIEK  960

Query  1334  SEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
             S +   Q P    F                   C  + Q H +  +LP   PYD FL  +
Sbjct  961   SSQ---QDPQAYTFL------------------CTADEQWHLNSCKLPVLCPYDRFLATS  999

Query  1514  GS  1519
             G 
Sbjct  1000  GC  1001



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   317 bits (811),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 220/541 (41%), Positives = 303/541 (56%), Gaps = 81/541 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AM           H  F +V  P  V          L ++K    
Sbjct  491   QNKAFPEALFHQLLPAM----------CHLQFPLVH-PQPV----------LRQKK----  525

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS-GKDGMDQNTQNMLNRL---------------TST  313
                         AALF+KL K + S  +D      +N++N                 +  
Sbjct  526   ------------AALFEKLRKEKPSIMEDACQDKKENVVNEGEQIRNGMVDNLKFSNSQA  573

Query  314   YSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             YS++ S    + E    G N +   E  SL++ S QIS+LLSSI+ Q+I   NTPE++EA
Sbjct  574   YSKNSSAPLAANENSMGGSNKET--EAGSLRLSSHQISLLLSSIWAQSIYPANTPENYEA  631

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTY L++LFSR K SSHESLIR FQLAFSLR+++L+E+  +PPSRRRSLF LATSMI+
Sbjct  632   IAHTYGLVLLFSRAKNSSHESLIRSFQLAFSLRNVALNERGSLPPSRRRSLFTLATSMIL  691

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARAS-YGSKEDDEAAK  847
             F SK Y   PL V    +L +K +DPFLQLV+   LK VN  P    + YGSKEDD++A 
Sbjct  692   FSSKAYDIAPL-VHCAVVLAEKLVDPFLQLVEHRKLKAVNNRPDHPINIYGSKEDDDSAL  750

Query  848   RSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL  1027
             + LS I+I+ +QS E F + IV+S       + ++++E LL +F+PD+VCP+G Q ++ L
Sbjct  751   KFLSEIDITGEQSREFFVAEIVKSFNFP-DSRLSVVQEHLLNEFVPDDVCPLGGQFMDAL  809

Query  1028  RNHNQSDDKTNDEVVD--PTFTVDDLGSHSDPNAHPDSTP-------NLLDVNEFLDSVL  1180
                +Q D K N  + +  P  T+D+       ++H  S          LL VN+ ++SVL
Sbjct  810   LQADQVDWK-NSSITEGAPIVTIDEDAFLDSLDSHAKSYKESAVQDHKLLSVNQLMESVL  868

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF-------NFSE  1339
             + ++QVGR S   P  + + ++A  CE    GK  +M+   +   + D        N +E
Sbjct  869   DAAHQVGRMSVTAP-DVPYKEMALHCETLLMGKQKKMSNVINAQMKQDILVNITQQNHNE  927

Query  1340  ETIWQPPSGNPFADNN-TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             E +    +GNPF D N TA   +    A P  CATEYQ HP+F +LPASSPYD+FLKAAG
Sbjct  928   EVM---KAGNPFIDQNFTANPQKLSIGAIPIQCATEYQHHPNFFRLPASSPYDHFLKAAG  984

Query  1517  S  1519
              
Sbjct  985   C  985



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   314 bits (804),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 222/548 (41%), Positives = 321/548 (59%), Gaps = 47/548 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AM+ PD ETR+GAH++FSVVLVPSSV P  A      +K   + R
Sbjct  468   QNKAFPEALFHQLLPAMLHPDLETRIGAHQIFSVVLVPSSVSPHVASTVSDSNKNAGVPR  527

Query  182   TLSRTVSVFSSSAALFDKL--GKNQSSGK-----------DGMDQNTQNMLNRLTSTYSR  322
             TLSR+VSVFSSSAALFDKL   +N S G            D   +   + ++++  +++R
Sbjct  528   TLSRSVSVFSSSAALFDKLRNQRNNSKGNLYELNKEKAPSDTEQRQNASGVDQMKPSHTR  587

Query  323   SLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             + S +  P  E  P    + +E    + L++ S QI +LLSSI+ Q++S  N PE++ AI
Sbjct  588   AYSFRSLPEPESDPVTKSSKEE---IVPLRLSSHQICLLLSSIWAQSMSPANMPENYVAI  644

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             AHTYSL++LFSR K S  ++LIR FQLAFSLR++SLS    +PPSR RSLF ++TSMII 
Sbjct  645   AHTYSLVLLFSRAKNSYRDALIRCFQLAFSLRNVSLSAGGTLPPSRCRSLFVMSTSMIIL  704

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKAR--ASYGSKEDDEAAKR  850
              S+ Y+ +PL    KA LT+K +DPFL LV++   ++N         SYGSK+DD +A R
Sbjct  705   SSRAYNILPLIPHVKATLTNKVVDPFLSLVEDSKFQINETGSVHQTISYGSKDDDSSALR  764

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVC----PMGTQRI  1018
              LS +++++ Q+ E+  S+I+++++     + +  +EQLL++F+PD++C    P+   R+
Sbjct  765   CLSELKLNEDQTMEALVSVIIKNMENLSDSEKSTTREQLLKEFVPDDLCSIKSPLFADRL  824

Query  1019  NDLRNHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDST----PNLLDVNEFLDSVL  1180
              D    +  D+K+ D+     F +DD  L    + + H   +    P+LL V++ L SVL
Sbjct  825   EDGHKTDSHDNKSLDKNTS-IFGIDDDHLSDSVEGSKHNSQSSIGNPSLLSVDQLLQSVL  883

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF-----REDGN----------D  1315
             ET++ VGR S +     ++ + A  CEA   GK  +M++     +  GN          +
Sbjct  884   ETAHHVGRMSVSHAPDASYKETADHCEALLMGKQKKMSYLISNNQRQGNSLVTSPQNPGE  943

Query  1316  EPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHP-SFMQLPASSPY  1492
             E       E  +   +GN F D N             A CA E Q H  S  +LPASSPY
Sbjct  944   EDKQMVLHEGSFHKQAGNVFLDLNVPELPMRPFNGPSALCAIELQHHTNSSFRLPASSPY  1003

Query  1493  DNFLKAAG  1516
             DNFLKAAG
Sbjct  1004  DNFLKAAG  1011



>ref|XP_004966105.1| PREDICTED: uncharacterized protein LOC101758656 [Setaria italica]
Length=1034

 Score =   314 bits (804),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 223/587 (38%), Positives = 315/587 (54%), Gaps = 87/587 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCP--RQAPAGGALSKRKSI  175
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P  + +P+G A  K+  +
Sbjct  452   QNKVFPEALFHQLLLTMIHPDHEARIAAHRIFAIVLVPSSVSPSIQASPSGQA--KKHDM  509

Query  176   QRTLSRTVSVFSSSAALFDKLGKN------QSSGKD--------GMDQNTQNML----NR  301
             QRTLSR VSVFSSSAA+F+KL K+      Q   KD        G  Q+   +L    +R
Sbjct  510   QRTLSRAVSVFSSSAAIFEKLKKDKFSDNSQGESKDSSLHNIGEGTGQHKSQILPVSQSR  569

Query  302   LTSTYSRSLSVKPG--------------------------------SEETPNNGENPQEH  385
               S    + S+K G                                 +E  ++     E 
Sbjct  570   KRSMKVPNFSMKRGPSMAIRAPSVSIRAPSISLRGPSMSLRAPSMSVKEDQSSSSKSDEE  629

Query  386   HEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
              E + +K+ +RQI++LLSSI+ QAIS  NTP ++EAIAHTYSLL+LFS +K S+ E+L +
Sbjct  630   TESVLVKLSTRQITLLLSSIWAQAISPENTPANYEAIAHTYSLLLLFSGSKASTFEALTQ  689

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQ+AF+LRS SL+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  
Sbjct  690   SFQVAFALRSHSLTEADSLAPSRRRSLFTLSTTMIIFSSRAYNVLPLIPICKQMINDRAA  749

Query  746   DPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL LVDE  L    +     S  YGS ED+  A RSLS IE+S+ QS E   S I+ +
Sbjct  750   DPFLHLVDESKLMAVKDSSDDPSKIYGSPEDNANALRSLSEIEVSESQSRECIVSTIMNN  809

Query  920   LKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI-----NDLRNHNQSDDKTNDEVVDPTF  1084
             +   +  + + ++ QLL DF PD++CPM TQ       N     +++       ++D   
Sbjct  810   IANMMDAELHNVRSQLLSDFTPDDMCPMSTQFFEAHTDNPSSGSHETGHHQEAMLIDLGN  869

Query  1085  TVDDLGSHSDPN-AHPDSTP--NLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQ  1255
               D  G  S+   A   S P  +LL +++ L++V   +      +      M F D+ S 
Sbjct  870   DHDAFGEASESTEACASSVPASDLLSIDQLLETVGADAAPQAGAAPL-STDMAFKDMTSH  928

Query  1256  CEAFQEGKGNRM--------NFREDGNDEPDFNFSEETIWQPP--------SGNPFADNN  1387
             CEA   GK  +M        + +  G      N  E  ++Q P        S NPFAD+N
Sbjct  929   CEALTIGKQQKMSAFMSFQQSVQAAGLPSSQPNEMELALFQGPQLPQTAARSTNPFADDN  988

Query  1388  TaaagqpvnaaapaS----CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q  NA    +     A ++Q+   F++LPA+SPYDNFL+AAG
Sbjct  989   LQGFPQLTNAPNGENPHPPPAQDFQQ--DFLKLPAASPYDNFLRAAG  1033



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   312 bits (799),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 220/549 (40%), Positives = 321/549 (58%), Gaps = 50/549 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALFHQ+L AM+ PD ETR+GAH++FSVVLVPSSV P  A      +K   + R
Sbjct  468   QNKAFPEALFHQLLPAMLHPDLETRIGAHQIFSVVLVPSSVSPHVASTVSDSNKNAGVPR  527

Query  182   TLSRTVSVFSSSAALFDKL--GKNQSSGK-----------DGMDQNTQNMLNRLTSTYSR  322
             TLSR+VSVFSSSAALFDKL   +N S G            D   +   + ++++  +++R
Sbjct  528   TLSRSVSVFSSSAALFDKLRNQRNNSKGNLYELNKEKAPSDTEQRQNASGVDQMKPSHTR  587

Query  323   SLSVK--PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAI  496
             + S +  P  E  P    + +E    + L++ S QI +LLSSI+ Q++S  N PE++ AI
Sbjct  588   AYSFRSLPEPESDPVTKSSKEE---IVPLRLSSHQICLLLSSIWAQSMSPANMPENYVAI  644

Query  497   AHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIF  676
             AHTYSL++LFSR K S  ++LIR FQLAFSLR++SLS    +PPSR RSLF ++TSMII 
Sbjct  645   AHTYSLVLLFSRAKNSYRDALIRCFQLAFSLRNVSLSAGGTLPPSRCRSLFVMSTSMIIL  704

Query  677   LSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKAR--ASYGSKEDDEAAKR  850
              S+ Y+ +PL    KA LT+K +DPFL LV++   ++N         SYGSK+DD +A R
Sbjct  705   SSRAYNILPLIPHVKATLTNKVVDPFLSLVEDSKFQINETGSVHQTISYGSKDDDSSALR  764

Query  851   SLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVC----PMGTQRI  1018
              LS +++++ Q+ E+  S+I+++++     + +  +EQLL++F+PD++C    P+   R+
Sbjct  765   CLSELKLNEDQTMEALVSVIIKNMENLSDSEKSTTREQLLKEFVPDDLCSIKSPLFADRL  824

Query  1019  NDLRNHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDST----PNLLDVNEFLDSVL  1180
              D    +  D+K+ D+     F +DD  L    + + H   +    P+LL V++ L SVL
Sbjct  825   EDGHKTDSHDNKSLDKNTS-IFGIDDDHLSDSVEGSKHNSQSSIGNPSLLSVDQLLQSVL  883

Query  1181  ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF----------------REDGN  1312
             ET++ VGR S +     ++ + A  CEA   GK  +M++                +  G 
Sbjct  884   ETAHHVGRMSVSHAPDASYKETADHCEALLMGKQKKMSYLISNNQRQGNSLVTSPQNPGE  943

Query  1313  DEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHP-SFMQLPASSP  1489
             ++      E +  +  +GN F D N             A CA E Q H  S  +LPASSP
Sbjct  944   EDKQMVLHEGSFHK--AGNVFLDLNVPELPMRPFNGPSALCAIELQHHTNSSFRLPASSP  1001

Query  1490  YDNFLKAAG  1516
             YDNFLKAAG
Sbjct  1002  YDNFLKAAG  1010



>ref|XP_006657548.1| PREDICTED: uncharacterized protein LOC102712271 [Oryza brachyantha]
Length=1071

 Score =   313 bits (801),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 225/595 (38%), Positives = 315/595 (53%), Gaps = 92/595 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  + +K+  +QR
Sbjct  478   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASVSSQAKKHDMQR  537

Query  182   TLSRTVSVFSSSAALFDKLGKNQ-----------SSGKDGMDQNTQN-------------  289
             TLSR VSVFSSSAA+FDKL K++           S G   ++++T N             
Sbjct  538   TLSRAVSVFSSSAAIFDKLKKDKYSDNSQGEIKDSGGLHSINEDTSNPKCHNLPVSQSRR  597

Query  290   ---------------MLNRLTSTYSRSLSVK-----------------PGSEETPNNGEN  373
                            M  R  S   R+ S+                  P        G +
Sbjct  598   RSMKIPNFSMKRGPSMAMRAPSVAIRAPSISLRAPSMSLRAPSMSLRAPSMSLRAGQGSS  657

Query  374   PQE-HHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSH  550
               E   E + LK+ SRQI++LLSSI+ QAIS  NTP ++EAIAHTYSL++LFS +K S  
Sbjct  658   SHEDEMESVLLKLSSRQITLLLSSIWAQAISPENTPANYEAIAHTYSLVLLFSGSKASVF  717

Query  551   ESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALL  730
             E+L + FQ+AFSLR  SL+E   + PSRRRSLF LAT+MIIF S+T++  PL    K +L
Sbjct  718   EALTQSFQVAFSLRGYSLAEADSLAPSRRRSLFTLATAMIIFSSRTFNVSPLIPICKQML  777

Query  731   TDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFAS  904
              ++T DPFL LVDE  L+   +     S  YGS ED+  A +SLS IE+S+ QS E   S
Sbjct  778   NERTADPFLHLVDESKLQAVKDSLDDPSKIYGSPEDNSNALKSLSEIELSESQSRECIVS  837

Query  905   MIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI-----NDLRNHNQSDDKTNDEV  1069
              I+ ++   +  + + +K QLL DF PD++CPM TQ       N L   +++   +   +
Sbjct  838   TIMNNITNMLDAELHNVKNQLLSDFSPDDMCPMSTQFFEAPGENSLSGSHENGHHSEAAL  897

Query  1070  VDPTFTVDDLGSHSDPN-AHPDSTP--NLLDVNEFLDSVL-ETSNQVGRQSAAPPAGMTF  1237
             +D     D  G  S+   A   + P  +LL ++E L++V+ + +    R S +    M F
Sbjct  898   IDLGNDHDIFGEASESTIASATAVPVTDLLSIDELLETVVTDPTPHTERVSVS--TDMPF  955

Query  1238  MDVASQCEAFQEGKGNR----MNFRE-------DGNDEPDFNFSEETIWQP-----PSGN  1369
              ++ SQCEA   GK  +    M+F++         N      F+      P     P+ N
Sbjct  956   REMTSQCEALTVGKHQKMATFMSFQQIMPVVPTPANQPNQMEFAIFPDPYPPQVGVPNTN  1015

Query  1370  PFADNNTaaagqpvnaaapaSCATEY------QRHPSFMQLPASSPYDNFLKAAG  1516
             PF D+N     Q V+ A P     +       Q    F++LPASSPYDNFL+AAG
Sbjct  1016  PFVDDNMYGYPQHVSGANPQHMNGDNPQPAYDQSQQQFLRLPASSPYDNFLRAAG  1070



>ref|XP_003520520.1| PREDICTED: uncharacterized protein LOC100817296 isoform X1 [Glycine 
max]
Length=1014

 Score =   311 bits (796),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 213/542 (39%), Positives = 309/542 (57%), Gaps = 46/542 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE LFHQ+LLAMV PD+ETR+ +H +FS +LVP+SV P  + +     K  ++ R
Sbjct  481   QNKAFPETLFHQLLLAMVHPDHETRVVSHHIFSSILVPTSVFPHPSLSASD-PKASNVPR  539

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN--------------MLNRLTSTYS  319
             TLSR VSVFSSSA LF+KL   + S  + + Q+ +               ++NRL STY 
Sbjct  540   TLSRAVSVFSSSAVLFEKLRLEKRSSSEKLIQHNKGNISGEIEPVSSNVGIVNRLKSTYG  599

Query  320   RSLSV-----KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
             R  SV     +   +E   N +N   + E  +L++   QI+ LLSSI+ Q++S  N P +
Sbjct  600   RLPSVNNPPLQLELDEIAANKDN--RNSEAAALRLTKLQINRLLSSIWAQSLSPGNMPAN  657

Query  485   FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
             +EAIA++Y+L++L SR K S +E L+R FQLAFSL +ISL E   +PPSRRRSLF LATS
Sbjct  658   YEAIAYSYTLVLLVSREKNSFYEVLVRSFQLAFSLWNISLKE-GPLPPSRRRSLFTLATS  716

Query  665   MIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDE  838
             MI+F SK Y+   L  SAKA+LT+K +DP+LQL+++  L+ V+  P     +YGSKEDD+
Sbjct  717   MIVFSSKEYNIDHLVQSAKAVLTEK-VDPYLQLIEDHKLQAVSFAPDNLSINYGSKEDDD  775

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI  1018
              A   LS +     ++ + FAS I++SL+     + + IKEQLL++F PD +C +G+Q  
Sbjct  776   RALDMLSDLLTYIHKTRDLFASEIIKSLEMFAKAELSSIKEQLLEEFAPDAMCELGSQ--  833

Query  1019  NDLRNHNQSDDKTNDEVVDPTFTVDDLGSH-SDPNAHPDSTPNLLDVNEFLDSVLETSNQ  1195
               L  +  + D +    +D  F  +   S      +     P LL  N+ L+  L+TS+ 
Sbjct  834   --LTMNMAAKDASIVSNIDDDFIFEPFESQIKHSRSFSTEVPGLLTANQLLELALDTSHP  891

Query  1196  VGRQSAAPPAGMTFMDVASQCEA--FQEGKGNRMNFRED-------------GNDEPDFN  1330
              GR S +    M + D+A +CE    ++ K +R+   +              GN+  + +
Sbjct  892   AGRISVSNAFNMPYKDMADKCEVLLLEKQKMSRLMSTQQKQECSVDSLSPNHGNELKNMD  951

Query  1331  FSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKA  1510
              S    +Q     PF +N       P  +  P    TEYQ  P   +LPA+SPYDNF+KA
Sbjct  952   SSSHVDFQKVGNPPFDENAAFDFHGPTFSPLPMVSGTEYQNQPHPFKLPAASPYDNFMKA  1011

Query  1511  AG  1516
             AG
Sbjct  1012  AG  1013



>emb|CDY48767.1| BnaC04g02200D [Brassica napus]
Length=1275

 Score =   313 bits (801),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 212/542 (39%), Positives = 293/542 (54%), Gaps = 54/542 (10%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLS  190
             AFPEALFHQ+L AMV PD++TR+GAHR+FS VLVP+SVCP  +     L K   + R+LS
Sbjct  747   AFPEALFHQLLKAMVHPDHKTRIGAHRIFSAVLVPTSVCPHPSSTITDLKKGMGLPRSLS  806

Query  191   RTVSVFSSSAALFDKLGKNQSSGKDGMDQ------------NTQNMLNRLTSTYSRSLSV  334
             R  SVFSSSAALF+KL K   S     DQ            N+  +L+RLTS+YS++   
Sbjct  807   RNASVFSSSAALFEKLRKENISSVPTSDQRQIKMLEEESGINSGEILDRLTSSYSQAYR-  865

Query  335   KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSL  514
                S   P          + + +++ S QI +LLSSI+ Q+IS  NTP+++EAI +TY L
Sbjct  866   ---SWNQPVTSVADNSELDAVCIRLSSHQIGLLLSSIWAQSISA-NTPDNYEAITNTYRL  921

Query  515   LMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYS  694
             ++LFSR K SS  +LIR FQ+A SLR +SL+E   +PPSRRRSLF +ATSM++F SK ++
Sbjct  922   VLLFSRGKNSSQGALIRSFQMALSLRDVSLTEGGPLPPSRRRSLFTMATSMVLFSSKAFN  981

Query  695   FIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGIEI  871
                LA  AK  L   T+DPFL LV++  LK VNP+     +YG ++DD +A  +LS I +
Sbjct  982   LFSLADFAKVALQGPTLDPFLHLVEDHKLKAVNPDQLQTVAYGCQKDDASALDTLSNIAV  1041

Query  872   SKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSD-  1048
             S + S  +    IV+SL+   +     I+EQLL DF+PD+ CP+GT  + D +   Q+D 
Sbjct  1042  STEHSRGALVYEIVKSLQNICSSGMEKIQEQLLSDFMPDDACPLGTIVLEDTQKPFQADF  1101

Query  1049  DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAG  1228
                  + +   F+ +D  S        D  P  + V    D  L T +Q+ R S A    
Sbjct  1102  GDVKPQNLAALFSHEDQESGDVTETAADDNP--VTVAGIPD--LLTVDQISRISDASYKE  1157

Query  1229  MTFMDVASQCEAFQEGKGNRM--------------NFREDGNDE--------PDFNF-SE  1339
             MTF      CE    GK  ++              N     +DE        P  NF +E
Sbjct  1158  MTF-----HCENLLMGKQQKISNLFNSQLQHESSVNGSPPQHDEEIKIATFHPMINFHAE  1212

Query  1340  ETIWQPPSGNPFADNNT---aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKA  1510
             + +  P          T     + + +       C +E Q  P   +LPAS+PYDNFLKA
Sbjct  1213  DDVPLPWKDFDMKSPRTPMGMKSPRTLMGTIQTQCYSELQNSPHAYKLPASTPYDNFLKA  1272

Query  1511  AG  1516
             AG
Sbjct  1273  AG  1274



>emb|CAJ44368.1| putative cyclin-related protein [Malus domestica]
Length=840

 Score =   306 bits (784),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 269/449 (60%), Gaps = 61/449 (14%)
 Frame = +2

Query  254   SGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNGENPQ---EHHEGLSLKMKSRQI  424
             S +DG   N  +++NR  STYSR+ S++    +TP+  E      +    +SL++ SRQI
Sbjct  424   SNEDGSVSN-HSVMNRFKSTYSRAYSIRRNPSDTPSADEKTTSILDKESTMSLRLSSRQI  482

Query  425   SMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISL  604
             ++LLSSI+ Q+IS  NTPE++EAIA+TYSL++L+SRTK +S+E+LIR FQLAFSLRSISL
Sbjct  483   TLLLSSIWAQSISPSNTPENYEAIANTYSLVLLYSRTKNTSNETLIRSFQLAFSLRSISL  542

Query  605   SEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK  784
                  +  S+RRSLF LATSMIIF +K Y+ + LA  AKA LT++T+DPFL+LVD+  L+
Sbjct  543   G--GGLQSSKRRSLFTLATSMIIFSAKAYNVVSLAPCAKAALTNETVDPFLRLVDDRKLQ  600

Query  785   -VNPNP-KARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIK  958
              VN  P + R  YGSKEDDE A RSLS IE S+ QS ESFA+MIV++L+ S  D +++IK
Sbjct  601   AVNSGPGQLRKVYGSKEDDEDALRSLSAIEKSESQSKESFATMIVQTLRNS-PDDSSIIK  659

Query  959   EQLLQDFLPDEVCPMGT----QRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH  1126
             +QLL DFLPD+ CP+G     +   ++      DD   D+   P  T+   G  + PNA 
Sbjct  660   QQLLNDFLPDDACPLGAPLNMETPREIDQVGVQDDGEPDKAEPPLLTI---GDDALPNAS  716

Query  1127  PDSTP----------NLLDVNEFLDS------VLETSNQVGRQ---SAAPPAGMTFMDVA  1249
              + T           +L+ V++ LDS      V   + QVGR    S +    M +M++A
Sbjct  717   ENQTDPGTKVAVESLSLISVDQLLDSKSDRKYVNIWTYQVGRSARLSVSAATNMPYMEMA  776

Query  1250  SQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapa  1429
              QCEA Q GK  +++          F  S         GN                 +  
Sbjct  777   GQCEAIQMGKQQKLS---------TFIVSHAISLNQSVGN----------------GSSM  811

Query  1430  SCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              CATEYQ +P F QLPASSPYDNFLKAAG
Sbjct  812   LCATEYQPYPHF-QLPASSPYDNFLKAAG  839



>ref|XP_007162228.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34222.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=1021

 Score =   309 bits (792),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 212/544 (39%), Positives = 307/544 (56%), Gaps = 52/544 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRK--SI  175
             QNKAFPE LFH +LL MV PD+ETR  AHR+FSV+LVP++V P       ++S RK  S+
Sbjct  490   QNKAFPETLFHHLLLVMVHPDHETRAVAHRIFSVILVPTTVFPH---PSLSISDRKPSSV  546

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM-------------LNRLTSTY  316
              RTLSRT+SVFSSSA LF+KL   + S  + + Q  +N+             +N+L S +
Sbjct  547   PRTLSRTLSVFSSSAVLFEKLRLEKRSSSEKLIQFKENIPGEIESTNSNGGIVNKLKSMH  606

Query  317   SRSLSVK--PGSEETPNNGENPQEHHEGL-SLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             +R  SV   P   E         + +    +L++   +IS LLSSI+VQ+IS  N P ++
Sbjct  607   NRVSSVNNPPLLLEVDEIAAKHDDKNSVFPALRLNRLKISRLLSSIWVQSISPGNMPANY  666

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             EAIAH+Y+L++L SR K S HE L+R FQLAFSL +ISL E   +PPSRRRSLF LATSM
Sbjct  667   EAIAHSYTLILLVSREKNSFHEVLVRSFQLAFSLWNISLKE-GTLPPSRRRSLFTLATSM  725

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECH--LKVNPNP-KARASYGSKEDDE  838
             I+F SK Y+   L  SA+ +L ++ +DP+L+L+++ +    VN  P      YGSKEDD+
Sbjct  726   IVFSSKEYNIDRLVQSARKVLLERKVDPYLELIEDYNKLQVVNFAPDNLNIMYGSKEDDD  785

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI  1018
              A ++LS +     ++ E FAS I++ L+     + + IKEQLL++F PD +C +G+Q  
Sbjct  786   RATQTLSELLGYINETREIFASEIIKCLENFAKAELSSIKEQLLEEFAPDAMCELGSQLK  845

Query  1019  NDLRNHNQS--DDKTNDEVVDPTFTVDDLGSHS-DPNAHPDSTPNLLDVNEFLDSVLETS  1189
              ++   + S   +  +D + +P    ++   HS D +  P   P+LL  N+ LD   ET 
Sbjct  846   MNMATMDASMASNADDDLIFEP---FENQTKHSRDLSPEP---PSLLSANQLLDLAFETP  899

Query  1190  NQVGRQSAAPPAGMTFMDVASQCEAF-------------QEGKGNRMN--FREDGNDEPD  1324
             N  GR S      M + D+A +CE               Q+ + N ++       N+  +
Sbjct  900   NPAGRISVCNAYNMPYNDMADKCEVLLMEKQKMSRLMSAQQKQDNLVDSLLLNQDNEMKN  959

Query  1325  FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
              + S +  +Q     PF D+N         +      A EY+ HP   +LP +SPYDNFL
Sbjct  960   MDVSNQVDFQKVGIPPF-DDNVCVDLYQPTSGPLPVFANEYENHP--FKLPVASPYDNFL  1016

Query  1505  KAAG  1516
             KAAG
Sbjct  1017  KAAG  1020



>ref|XP_006576825.1| PREDICTED: uncharacterized protein LOC100817296 isoform X2 [Glycine 
max]
Length=1016

 Score =   308 bits (788),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 215/544 (40%), Positives = 311/544 (57%), Gaps = 48/544 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPE LFHQ+LLAMV PD+ETR+ +H +FS +LVP+SV P  + +     K  ++ R
Sbjct  481   QNKAFPETLFHQLLLAMVHPDHETRVVSHHIFSSILVPTSVFPHPSLSASD-PKASNVPR  539

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN--------------MLNRLTSTYS  319
             TLSR VSVFSSSA LF+KL   + S  + + Q+ +               ++NRL STY 
Sbjct  540   TLSRAVSVFSSSAVLFEKLRLEKRSSSEKLIQHNKGNISGEIEPVSSNVGIVNRLKSTYG  599

Query  320   RSLSV-----KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
             R  SV     +   +E   N +N   + E  +L++   QI+ LLSSI+ Q++S  N P +
Sbjct  600   RLPSVNNPPLQLELDEIAANKDN--RNSEAAALRLTKLQINRLLSSIWAQSLSPGNMPAN  657

Query  485   FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
             +EAIA++Y+L++L SR K S +E L+R FQLAFSL +ISL E   +PPSRRRSLF LATS
Sbjct  658   YEAIAYSYTLVLLVSREKNSFYEVLVRSFQLAFSLWNISLKE-GPLPPSRRRSLFTLATS  716

Query  665   MIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDE  838
             MI+F SK Y+   L  SAKA+LT+K +DP+LQL+++  L+ V+  P     +YGSKEDD+
Sbjct  717   MIVFSSKEYNIDHLVQSAKAVLTEK-VDPYLQLIEDHKLQAVSFAPDNLSINYGSKEDDD  775

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI  1018
              A   LS +     ++ + FAS I++SL+     + + IKEQLL++F PD +C +G+Q  
Sbjct  776   RALDMLSDLLTYIHKTRDLFASEIIKSLEMFAKAELSSIKEQLLEEFAPDAMCELGSQ--  833

Query  1019  NDLRNHNQSDDKTNDEVVDPTFTVDDLGSH-SDPNAHPDSTPNLLDVNEFLDSVLETSNQ  1195
               L  +  + D +    +D  F  +   S      +     P LL  N+ L+  L+TS+ 
Sbjct  834   --LTMNMAAKDASIVSNIDDDFIFEPFESQIKHSRSFSTEVPGLLTANQLLELALDTSHP  891

Query  1196  VGRQSAAPPAGMTFMDVASQCEA--FQEGKGNRMNFRED-------------GNDEPDFN  1330
              GR S +    M + D+A +CE    ++ K +R+   +              GN+  + +
Sbjct  892   AGRISVSNAFNMPYKDMADKCEVLLLEKQKMSRLMSTQQKQECSVDSLSPNHGNELKNMD  951

Query  1331  FSEETIWQPPS-GN-PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
              S    +Q    GN PF +N       P  +  P    TEYQ  P   +LPA+SPYDNF+
Sbjct  952   SSSHVDFQKVQVGNPPFDENAAFDFHGPTFSPLPMVSGTEYQNQPHPFKLPAASPYDNFM  1011

Query  1505  KAAG  1516
             KAAG
Sbjct  1012  KAAG  1015



>gb|KDO53677.1| hypothetical protein CISIN_1g0359232mg, partial [Citrus sinensis]
Length=735

 Score =   300 bits (769),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 247/400 (62%), Gaps = 59/400 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNKAFPEALF+Q+L AMV PD+ETR+GAH++FSVVLVPSSVCP  +       K   + R
Sbjct  253   QNKAFPEALFYQLLPAMVHPDHETRVGAHQIFSVVLVPSSVCPNPSTNSAESRKAGDLPR  312

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ-NTQNM-------------LNRLTSTYS  319
              LSRTVSVFSSSAALFDKL ++++  +D   Q N  N+             LNRL S+YS
Sbjct  313   ALSRTVSVFSSSAALFDKLRRDKTMSRDNTHQDNRDNIASEGQPRNSGNGGLNRLKSSYS  372

Query  320   RSLSVK--PGSEETPNN----------------------GENPQEH--------------  385
             R+ S K  P S  T  N                      G N   +              
Sbjct  373   RAYSRKASPASAMTDGNSMSDFKTEPVNKFLVLCHKGANGSNKMIYVYAAKFKSDFYILV  432

Query  386   HEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
                 SL++ SRQI++LLSSI+ Q+IS  N PE++EAIAHTYSL++LFSR K SS+E LIR
Sbjct  433   QAANSLRLSSRQITLLLSSIWAQSISPANMPENYEAIAHTYSLVLLFSRAKNSSNEVLIR  492

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQL+FSLR+ISL+E + +PPSRRRSLF LATSMI+F +K ++   L   +K LLT+K +
Sbjct  493   SFQLSFSLRNISLNEGSPLPPSRRRSLFTLATSMILFSAKAFNIHSLVQPSKLLLTEKKV  552

Query  746   DPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL L ++  L+     +   +  +GSKEDD+ A + LS IE +  Q+ ES  S I++S
Sbjct  553   DPFLHLFEDKKLRAIHTGSDLPKIIFGSKEDDDLALKFLSEIENTDDQTRESLTSEILKS  612

Query  920   LKKSIT-----DKTNLIKEQLLQDFLPDEVCPMGTQRIND  1024
             L+   T      + + +KEQLL +FLPD++CP+G Q +++
Sbjct  613   LENLPTIQLSSSELSSMKEQLLSEFLPDDLCPLGAQFMDN  652



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   305 bits (780),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 214/543 (39%), Positives = 299/543 (55%), Gaps = 59/543 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q KAFPEALFHQ+LLAMV PD+ETR+ AHR+FSV++VP+           + SK   + R
Sbjct  491   QKKAFPEALFHQLLLAMVHPDHETRVVAHRIFSVIVVPT----------ASDSKASGVPR  540

Query  182   TLSRTVSVF---------------SSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTY  316
             +LSR VS F               SSS  L  +  K   +G      +   +++RL S++
Sbjct  541   SLSRAVSFFSSSASLFEKLRLEKRSSSVRLLSQYNKENVTGVIEPANSNVGIIDRLKSSH  600

Query  317   SRSLSV-----KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPE  481
             SR  SV     +   +E   N +N   + E ++L++   QI+ L+SSI+ Q+IS  N P 
Sbjct  601   SRGSSVNNPPLQTKWDELTANSDN--HNLEIVALRLSRHQINRLVSSIWAQSISPENMPA  658

Query  482   HFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALAT  661
             ++EAIAHTYSL +L S+ K S HE ++R FQLAFSL +ISL E   +PPSRRRSLF LA 
Sbjct  659   NYEAIAHTYSLALLVSKAKNSFHEIIVRSFQLAFSLWNISLKE-GPLPPSRRRSLFTLAI  717

Query  662   SMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNP-KARASYGSKEDDE  838
             SMI+F SK Y+ +PL  S KA+LT++ +DPFL L+++    V+  P     SYGSKEDD+
Sbjct  718   SMIMFSSKAYNIVPLVHSTKAVLTERKVDPFLHLIEDKLQTVSCAPDNPTISYGSKEDDD  777

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNL--IKEQLLQDFLPDEVCPMGTQ  1012
              A  +LS +  S  Q+ ESFAS I+ SL   I  K  L  IKE++L++F PD+ C +G+Q
Sbjct  778   RALHTLSELLTSVHQTQESFASEIIRSL--DIFSKAELLSIKEKMLEEFSPDDTCELGSQ  835

Query  1013  RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSN  1192
                   N  + D   ND+  D  + + +     +P    ++ P+LL  N+FL+ V + S+
Sbjct  836   LT---MNITRKDTSANDD--DFIYELFESQLKQNPRLSMEA-PSLLSANQFLELVFDPSH  889

Query  1193  QVGRQSAAPPAGMTFMDVASQCEAFQEGKG--NRMNFREDG------------NDEPDFN  1330
               GR S +      + D+A  CE    GK   +R+   E              +DE    
Sbjct  890   PAGRISVSTAFDTPYEDMADNCEVLMMGKQKMSRLMSTEQKQECSVSSLLPHHSDESKNM  949

Query  1331  FSEETIWQPPSGNP-FADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLK  1507
              S   +       P F D N     +P +   P  C  EYQ HP F QLP +SP+DNFLK
Sbjct  950   VSSSHVDLQKQDKPIFDDENFVELYRPTSGPVPMLCGAEYQNHPHFFQLPTASPFDNFLK  1009

Query  1508  AAG  1516
             AAG
Sbjct  1010  AAG  1012



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   304 bits (779),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 213/542 (39%), Positives = 298/542 (55%), Gaps = 58/542 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q KAFPEALFHQ+LLAMV PD+ETR+ AHR+FSV++VP+           + SK   + R
Sbjct  491   QKKAFPEALFHQLLLAMVHPDHETRVVAHRIFSVIVVPT----------ASDSKASGVPR  540

Query  182   TLSRTVSVF---------------SSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTY  316
             +LSR VS F               SSS  L  +  K   +G      +   +++RL S++
Sbjct  541   SLSRAVSFFSSSASLFEKLRLEKRSSSVRLLSQYNKENVTGVIEPANSNVGIIDRLKSSH  600

Query  317   SRSLSV-----KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPE  481
             SR  SV     +   +E   N +N   + E ++L++   QI+ L+SSI+ Q+IS  N P 
Sbjct  601   SRGSSVNNPPLQTKWDELTANSDN--HNLEIVALRLSRHQINRLVSSIWAQSISPENMPA  658

Query  482   HFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALAT  661
             ++EAIAHTYSL +L S+ K S HE ++R FQLAFSL +ISL E   +PPSRRRSLF LA 
Sbjct  659   NYEAIAHTYSLALLVSKAKNSFHEIIVRSFQLAFSLWNISLKE-GPLPPSRRRSLFTLAI  717

Query  662   SMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNP-KARASYGSKEDDE  838
             SMI+F SK Y+ +PL  S KA+LT++ +DPFL L+++    V+  P     SYGSKEDD+
Sbjct  718   SMIMFSSKAYNIVPLVHSTKAVLTERKVDPFLHLIEDKLQTVSCAPDNPTISYGSKEDDD  777

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNL--IKEQLLQDFLPDEVCPMGTQ  1012
              A  +LS +  S  Q+ ESFAS I+ SL   I  K  L  IKE++L++F PD+ C +G+Q
Sbjct  778   RALHTLSELLTSVHQTQESFASEIIRSL--DIFSKAELLSIKEKMLEEFSPDDTCELGSQ  835

Query  1013  RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSN  1192
                   N  + D   ND+  D  + + +     +P    ++ P+LL  N+FL+ V + S+
Sbjct  836   LT---MNITRKDTSANDD--DFIYELFESQLKQNPRLSMEA-PSLLSANQFLELVFDPSH  889

Query  1193  QVGRQSAAPPAGMTFMDVASQCEAFQEGKG--NRMNFREDG------------NDEPDFN  1330
               GR S +      + D+A  CE    GK   +R+   E              +DE    
Sbjct  890   PAGRISVSTAFDTPYEDMADNCEVLMMGKQKMSRLMSTEQKQECSVSSLLPHHSDESKNM  949

Query  1331  FSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKA  1510
              S   +        F D N     +P +   P  C  EYQ HP F QLP +SP+DNFLKA
Sbjct  950   VSSSHVDLQKDKPIFDDENFVELYRPTSGPVPMLCGAEYQNHPHFFQLPTASPFDNFLKA  1009

Query  1511  AG  1516
             AG
Sbjct  1010  AG  1011



>ref|XP_002457472.1| hypothetical protein SORBIDRAFT_03g007790 [Sorghum bicolor]
 gb|EES02592.1| hypothetical protein SORBIDRAFT_03g007790 [Sorghum bicolor]
Length=974

 Score =   303 bits (777),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 278/472 (59%), Gaps = 57/472 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV P  + AG + +++  ++R
Sbjct  486   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSVAP-CSFAGTSQTRKIDLRR  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
             TLSRT SVFSSSAALF KL ++  S ++   Q+   +L    S            E + N
Sbjct  545   TLSRTTSVFSSSAALFGKLKRDMLSFRESPLQDNTKLLPISES----------ADEISAN  594

Query  362   NGENPQE---------------------------HHEGLSLKMKSRQISMLLSSIFVQAI  460
             + EN  E                             + ++L +  RQ ++LLSS++ QA+
Sbjct  595   DAENADEISANDIQVLQVNQLQIRKSRIKGIIIYMQDAVTLMLSVRQANLLLSSLWTQAL  654

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
                N P ++EAI+HTYSL++LFSR K S  E L+  FQLAFSLRS+SL +   +PPSRRR
Sbjct  655   LPENVPRNYEAISHTYSLMLLFSRAKGSGAEVLVGSFQLAFSLRSVSL-QAGFLPPSRRR  713

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-----VNPNPKA  805
             SLF LATSM++F SK +S   L    K +LT+ T+DPFL L+++C L+       P  K 
Sbjct  714   SLFTLATSMLVFFSKAFSIPALIPVVKHVLTESTVDPFLCLIEDCRLQALDSAAEPCTKL  773

Query  806   RASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLP  985
                YGSKEDD+ A +SLS I+I++ QS E+  S+I++SL+     + + I++QLL++F  
Sbjct  774   ---YGSKEDDDLALKSLSNIDINEDQSKETSVSLILDSLEHLSESELSTIRKQLLEEFSA  830

Query  986   DEVCPMG---TQRINDLRNHNQSDDKTNDEVVDPTFTVDD--LGSHSD----PNAHPDST  1138
             D++C MG   T+  +     N    + + EV+   F  +D  L   SD    P+      
Sbjct  831   DDIC-MGSHFTETPSKSPAQNGKLHQKSMEVIPLGFVFEDDTLVEASDSLVEPHLRHPPC  889

Query  1139  PNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN  1294
              ++LDV+  L+SV ETS  VGR S +    + F +VA+QCEA   GK  +++
Sbjct  890   NSILDVDRLLNSVSETSQHVGRLSVSTNKDLPFKEVANQCEALLIGKQQKLS  941



>gb|AFW69348.1| hypothetical protein ZEAMMB73_015704 [Zea mays]
Length=773

 Score =   297 bits (760),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 212/583 (36%), Positives = 301/583 (52%), Gaps = 84/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  +  K+  +QR
Sbjct  127   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSSRPKKHDMQR  186

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS---------------GKDGMDQNTQN---------  289
             TLSR VSVFSSSAA+FDK+ K+++S               G+      +QN         
Sbjct  187   TLSRAVSVFSSSAAIFDKMKKDKNSENSQGESKDNSMHSVGEGTGQSKSQNLHVSQSRRS  246

Query  290   -------------MLNRLTSTYSR---------SLSVKPGS---EETPNNGENPQEHHEG  394
                          M  R  S   R         S+S++  S   +E  ++     E  E 
Sbjct  247   MKAPNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSLRASSMSVKEDQSSSNKSDEETES  306

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             + +K+ +RQI++LLSSI+ Q+ S  NTP ++EAIAHTYSLL+LFS +K S+ E+L + FQ
Sbjct  307   VLVKLSARQITLLLSSIWAQSTSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQSFQ  366

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             +AFSLRS SL+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  DPF
Sbjct  367   VAFSLRSYSLTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAADPF  426

Query  755   LQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++  
Sbjct  427   LHLVDESRLTAVKDSSNDPSKIYGSPEDNNNALKSLSEIELSESQSRECIVSTIMNNIAN  486

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
              +  + + ++ QLL DF PD++CP  TQ   ++   N S              + DLG+ 
Sbjct  487   MLDAELHNVRSQLLSDFTPDDMCPTSTQFF-EVHADNPSSGSYETGHHQEGLLI-DLGND  544

Query  1109  SDPNAHPDS----------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQ  1255
              D                   +LL +++ L++V  E + Q G  S    A + F D+ S 
Sbjct  545   HDAFGEASESAEASASSIPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTSH  600

Query  1256  CEAFQEGKGNRM--------NFREDGNDEPDFNFSEETIWQPP--------SGNPFADNN  1387
             CEA   GK  +M        + +  G      N  E  + Q P        S NPF D++
Sbjct  601   CEALTIGKQQKMSAFMSFQQSVQAAGLPSSQPNQMELDLSQDPQLPQTGAHSTNPFTDDS  660

Query  1388  TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q        +           ++LPA+SPYDNFL+AAG
Sbjct  661   LQGYPQYTKGPNGDNAQPGQDFQQQSLKLPAASPYDNFLRAAG  703



>ref|XP_008647478.1| PREDICTED: uncharacterized protein LOC100217264 isoform X2 [Zea 
mays]
 gb|AFW75854.1| hypothetical protein ZEAMMB73_198613 [Zea mays]
Length=1047

 Score =   301 bits (771),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 215/585 (37%), Positives = 316/585 (54%), Gaps = 87/585 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCP--RQAPAGGALSKRKSI  175
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P  + +P+G    K+  +
Sbjct  469   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSGQV--KKHDM  526

Query  176   QRTLSRTVSVFSSSAALFDKLGKN------QSSGKDG------------MDQNTQNMLNR  301
             QRTLSR VSVFSSSAA+FDK+ K+      Q   KD              +QN     +R
Sbjct  527   QRTLSRAVSVFSSSAAIFDKMKKDKHSENSQGESKDNSLHSVGEGTGQPKNQNLHVSQSR  586

Query  302   LTSTYSRSLSVKPG--------------------------------SEETPNNGENPQEH  385
              +S    + S+K G                                 +E   + +   E 
Sbjct  587   RSSMRISNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSSRASSVSVKEDQISPKKSDEE  646

Query  386   HEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
              E + +K+ +RQI++LLSSI+ QA S  NTP ++EAIAHTYSLL+LFS +K S+ E+L +
Sbjct  647   TESVLVKLSARQITLLLSSIWAQATSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQ  706

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQ+AFSLRS +L+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  
Sbjct  707   SFQVAFSLRSYALTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAA  766

Query  746   DPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL+LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ +
Sbjct  767   DPFLRLVDESKLTAVKDCSNDPSKIYGSPEDNANALKSLSEIELSESQSRECIVSTIMNN  826

Query  920   LKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ----RINDLRNHNQSDDKTNDEVVDPTFT  1087
             +   +  + + ++ QLL DF PD++CP  TQ     +++    +++       ++D    
Sbjct  827   IANMMDAELHNVRSQLLSDFTPDDMCPTSTQFFEMHVDNPSGFHETGHHEEGLLIDLGND  886

Query  1088  VDDLGSHSD-PNAHPDSTP--NLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQ  1255
              D  G  S+   A   S P  +LL +++ L++V  E + Q G  S    A + F D+ S 
Sbjct  887   HDAFGEASEGAEARTSSVPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTSH  942

Query  1256  CEAFQEGKGNR----MNFREDG------NDEPDFNFSEETIWQ----PPSG----NPFAD  1381
             CEA   GK  +    M+F++          +P+   +E  ++Q    P +G    NPF+D
Sbjct  943   CEALTIGKQQKMSAFMSFQQSVQAAGVPGSQPN-QTTELDLFQDLQLPQAGAQSTNPFSD  1001

Query  1382  NNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              +     Q +N     +           ++LPA+SPYDNFL+AAG
Sbjct  1002  ESVQGYPQYMNGPNGDNAQPGQDFQQQSLKLPAASPYDNFLRAAG  1046



>ref|XP_004951915.1| PREDICTED: uncharacterized protein LOC101783143 isoform X2 [Setaria 
italica]
Length=894

 Score =   299 bits (765),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 219/555 (39%), Positives = 307/555 (55%), Gaps = 61/555 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVL-------VPSSVCPRQAPAGGALS  160
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVV+        P+   P Q        
Sbjct  350   KNKVFPEALFHQLLLAMVHPDHETRVAAHRIFSVVIVPSSVSPFPNLKSPDQ-------R  402

Query  161   KRKSIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----NRLTS-----  310
             ++  +QRTLSR VSVFSSSAALFDKL   ++S ++   + + N +     N+  +     
Sbjct  403   RKHDVQRTLSRAVSVFSSSAALFDKLRWEKNSFRENAHEGSMNRILHGIDNKTAAPNDFQ  462

Query  311   ---TYSRSLSVKPGS--------EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
                +   SL V   S        +E+ N+        E   L++ S Q ++LLSSI+ QA
Sbjct  463   GSRSLRHSLEVSSASRKYSSTSLKESQNSLTESTNDTESTVLRLSSHQATLLLSSIWAQA  522

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             IS  NTP+++EAIAHTYSLL+LF  +K S  E+L   FQ+AFSL S SL   + +PPS R
Sbjct  523   ISPKNTPQNYEAIAHTYSLLLLFLGSKASIFEALSPSFQIAFSLLSYSLGTDS-LPPSCR  581

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPN--PKARA  811
             RSLF LATSMI+F S+T+   PL    K++L D TMDPFL+LV E  L+V  +       
Sbjct  582   RSLFTLATSMIVFASRTFDVAPLLPICKSMLNDGTMDPFLRLVHENKLQVVKDYLEDPSK  641

Query  812   SYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDE  991
             SYGS ED+E A RS+S +E++++ S ES  S IV S+      +   I+ QLL DF PD+
Sbjct  642   SYGSTEDNENALRSISAVELTERNSRESMVSAIVNSIAYIPDAELEDIRSQLLTDFSPDD  701

Query  992   VCPMGTQRINDLRNHNQSD-----DKTNDEVVDPT---FTVDDLGSHSDPNAH--PDSTP  1141
             +CP           +++S      D    E++D T   +T  ++ S + P A   P  T 
Sbjct  702   MCPTSAHFFESPGKNSESRPGDDADYQEAELIDVTNDNYTFAEV-SATKPTATDIPAITT  760

Query  1142  NLLDVNEFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN-FREDGND  1315
             NLL ++E L++V+ +TS++  R SA     + F ++ S CEA   GK ++M+      N+
Sbjct  761   NLLSIDELLETVVNDTSSETQRCSAPAAPDIPFQEMTSHCEALSMGKHHKMSVLMSFKNN  820

Query  1316  EPDFNFSEETIWQPPSG--------NPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQ  1471
             +         I    +G        NPF   +     Q + A      A   Q+H  F++
Sbjct  821   KQAPIVPNNQINHVEAGHTSNNQNTNPFLQQSLDGYPQSMAAGELQDAAGVQQQH--FLR  878

Query  1472  LPASSPYDNFLKAAG  1516
             LPASSPYDNFLKAAG
Sbjct  879   LPASSPYDNFLKAAG  893



>gb|KHN07377.1| hypothetical protein glysoja_012675 [Glycine soja]
Length=930

 Score =   299 bits (766),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 212/548 (39%), Positives = 309/548 (56%), Gaps = 56/548 (10%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             + FPE LFHQ+LLAMV PD+ETR+ +H +FS +LVP+SV P  + +     K  ++ RTL
Sbjct  393   QIFPETLFHQLLLAMVHPDHETRVVSHHIFSSILVPTSVFPHPSLSASD-PKASNVPRTL  451

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN--------------MLNRLTSTYSRS  325
             SR VSVFSSSA LF+KL   + S  + + Q+ +               ++NRL STY R 
Sbjct  452   SRAVSVFSSSAVLFEKLRLEKRSSSEKLIQHNKGNISGEIEPVSSNVGIVNRLKSTYGRL  511

Query  326   LSV-----KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFE  490
              SV     +   +E   N +N   + E  +L++   QI+ LLSSI+ Q++S  N P ++E
Sbjct  512   PSVNNPPLQLELDEIAANKDN--RNSEAAALRLTKLQINRLLSSIWAQSLSPGNMPANYE  569

Query  491   AIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMI  670
             AIA++Y+L++L SR K S +E L+R FQLAFSL +ISL E   +PPSRRRSLF LATSMI
Sbjct  570   AIAYSYTLVLLVSREKNSFYEVLVRSFQLAFSLWNISLKE-GPLPPSRRRSLFTLATSMI  628

Query  671   IFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAA  844
             +F SK Y+   L  SAKA+LT+K +DP+LQL+++  L+ V+  P     +YGSKEDD+ A
Sbjct  629   VFSSKEYNIDHLVQSAKAVLTEK-VDPYLQLIEDHKLQAVSFAPDNLSINYGSKEDDDRA  687

Query  845   KRSLSGIEISKKQSTESFASMIVESLK------KSITDKTNLIKEQLLQDFLPDEVCPMG  1006
                LS +     ++ + FAS I++SL+        I  + + IKEQLL++F PD +C +G
Sbjct  688   LDMLSDLLTYIHKTRDLFASEIIKSLEIYYETLSFIQAELSSIKEQLLEEFAPDAMCELG  747

Query  1007  TQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGS---HSDPNAHPDSTPNLLDVNEFLDSV  1177
             +Q    L  +  + D +    +D  F  +   S   HS   +     P LL  N+ L+  
Sbjct  748   SQ----LTMNMAAKDASIVSNIDDDFIFEPFESQIKHS--RSFSTEVPGLLTANQLLELA  801

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEA--FQEGKGNRMNFRED-------------GN  1312
             L+TS+  GR S +    M + D+A +CE    ++ K +R+   +              GN
Sbjct  802   LDTSHPAGRISVSNAFNMPYKDMADKCEVLLLEKQKMSRLMSTQQKQECSVDSLSPNHGN  861

Query  1313  DEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPY  1492
             +  + + S    +Q     PF +N       P  +  P    TEYQ  P   +LPA+SPY
Sbjct  862   ELKNMDSSSHVDFQKVGNPPFDENAAFDFHGPTFSPLPMVSGTEYQNQPHPFKLPAASPY  921

Query  1493  DNFLKAAG  1516
             DNF+KAAG
Sbjct  922   DNFMKAAG  929



>ref|XP_007028782.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY09284.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=680

 Score =   293 bits (751),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 226/325 (70%), Gaps = 19/325 (6%)
 Frame = +2

Query  5    NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
            NKAFPEALFHQ+L AMV PD+ETR+GAHR+FSVVLVPSSVCP+ +       K   I RT
Sbjct  351  NKAFPEALFHQLLPAMVHPDHETRIGAHRIFSVVLVPSSVCPQPSSVSPVTIKGSGIPRT  410

Query  185  LSRTVSVFSSSAALFDKLGKNQSSGKDG--------------MDQNTQNMLNRLTSTYSR  322
            LSRTVSVFSSSAALF+KL K++S  ++               +  +   +LNRL S+YSR
Sbjct  411  LSRTVSVFSSSAALFEKLRKDKSFARENACLENKGNIDSEVELKNSNNGILNRLKSSYSR  470

Query  323  SLSVKPGSEETPNNGE---NPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
            + S +      P +G    N  +  E  SL++ S QIS+LLSSI+ Q+IS  NTP+++EA
Sbjct  471  TYSSRSPPIPLPMDGNPLSNSNKQSEANSLRLSSTQISLLLSSIWAQSISPENTPQNYEA  530

Query  494  IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
            IAHTYSL++LFSR K S +++L+R FQLAFSLRSISL+E   +PPSRRRSLF LATSMI+
Sbjct  531  IAHTYSLVLLFSRAKNSGNKALVRSFQLAFSLRSISLNEGGPLPPSRRRSLFTLATSMIL  590

Query  674  FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAK  847
            F SK +S +P+   AK  LT++ +DPF++LV++  L+ VN    +    YGSKEDD  A 
Sbjct  591  FSSKAFSIVPIVYCAKVALTERMVDPFMRLVEDRKLEAVNAGSDQPTNVYGSKEDDNLAL  650

Query  848  RSLSGIEISKKQSTESFASMIVESL  922
            ++LS I+I+ +Q  E+ AS I++SL
Sbjct  651  KTLSQIQITPEQRRETLASEILKSL  675



>ref|XP_008647477.1| PREDICTED: uncharacterized protein LOC100217264 isoform X1 [Zea 
mays]
 gb|AFW75853.1| hypothetical protein ZEAMMB73_198613 [Zea mays]
Length=1048

 Score =   300 bits (768),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 217/586 (37%), Positives = 313/586 (53%), Gaps = 88/586 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCP--RQAPAGGALSKRKSI  175
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P  + +P+G    K+  +
Sbjct  469   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSGQV--KKHDM  526

Query  176   QRTLSRTVSVFSSSAALFDKLGKN------QSSGKDG------------MDQNTQNMLNR  301
             QRTLSR VSVFSSSAA+FDK+ K+      Q   KD              +QN     +R
Sbjct  527   QRTLSRAVSVFSSSAAIFDKMKKDKHSENSQGESKDNSLHSVGEGTGQPKNQNLHVSQSR  586

Query  302   LTSTYSRSLSVKPG--------------------------------SEETPNNGENPQEH  385
              +S    + S+K G                                 +E   + +   E 
Sbjct  587   RSSMRISNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSSRASSVSVKEDQISPKKSDEE  646

Query  386   HEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
              E + +K+ +RQI++LLSSI+ QA S  NTP ++EAIAHTYSLL+LFS +K S+ E+L +
Sbjct  647   TESVLVKLSARQITLLLSSIWAQATSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQ  706

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQ+AFSLRS +L+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  
Sbjct  707   SFQVAFSLRSYALTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAA  766

Query  746   DPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL+LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ +
Sbjct  767   DPFLRLVDESKLTAVKDCSNDPSKIYGSPEDNANALKSLSEIELSESQSRECIVSTIMNN  826

Query  920   LKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI-----NDLRNHNQSDDKTNDEVVDPTF  1084
             +   +  + + ++ QLL DF PD++CP  TQ       N    H     +    ++D   
Sbjct  827   IANMMDAELHNVRSQLLSDFTPDDMCPTSTQFFEMHVDNPSGFHETGHHEEQGLLIDLGN  886

Query  1085  TVDDLGSHSD-PNAHPDSTP--NLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVAS  1252
               D  G  S+   A   S P  +LL +++ L++V  E + Q G  S    A + F D+ S
Sbjct  887   DHDAFGEASEGAEARTSSVPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTS  942

Query  1253  QCEAFQEGKGNR----MNFREDG------NDEPDFNFSEETIWQ----PPSG----NPFA  1378
              CEA   GK  +    M+F++          +P+   +E  ++Q    P +G    NPF+
Sbjct  943   HCEALTIGKQQKMSAFMSFQQSVQAAGVPGSQPN-QTTELDLFQDLQLPQAGAQSTNPFS  1001

Query  1379  DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             D +     Q +N     +           ++LPA+SPYDNFL+AAG
Sbjct  1002  DESVQGYPQYMNGPNGDNAQPGQDFQQQSLKLPAASPYDNFLRAAG  1047



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   298 bits (764),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 219/555 (39%), Positives = 307/555 (55%), Gaps = 61/555 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVL-------VPSSVCPRQAPAGGALS  160
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVV+        P+   P Q        
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVAAHRIFSVVIVPSSVSPFPNLKSPDQ-------R  540

Query  161   KRKSIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----NRLTS-----  310
             ++  +QRTLSR VSVFSSSAALFDKL   ++S ++   + + N +     N+  +     
Sbjct  541   RKHDVQRTLSRAVSVFSSSAALFDKLRWEKNSFRENAHEGSMNRILHGIDNKTAAPNDFQ  600

Query  311   ---TYSRSLSVKPGS--------EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
                +   SL V   S        +E+ N+        E   L++ S Q ++LLSSI+ QA
Sbjct  601   GSRSLRHSLEVSSASRKYSSTSLKESQNSLTESTNDTESTVLRLSSHQATLLLSSIWAQA  660

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             IS  NTP+++EAIAHTYSLL+LF  +K S  E+L   FQ+AFSL S SL   + +PPS R
Sbjct  661   ISPKNTPQNYEAIAHTYSLLLLFLGSKASIFEALSPSFQIAFSLLSYSLGTDS-LPPSCR  719

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPN--PKARA  811
             RSLF LATSMI+F S+T+   PL    K++L D TMDPFL+LV E  L+V  +       
Sbjct  720   RSLFTLATSMIVFASRTFDVAPLLPICKSMLNDGTMDPFLRLVHENKLQVVKDYLEDPSK  779

Query  812   SYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDE  991
             SYGS ED+E A RS+S +E++++ S ES  S IV S+      +   I+ QLL DF PD+
Sbjct  780   SYGSTEDNENALRSISAVELTERNSRESMVSAIVNSIAYIPDAELEDIRSQLLTDFSPDD  839

Query  992   VCPMGTQRINDLRNHNQSD-----DKTNDEVVDPT---FTVDDLGSHSDPNAH--PDSTP  1141
             +CP           +++S      D    E++D T   +T  ++ S + P A   P  T 
Sbjct  840   MCPTSAHFFESPGKNSESRPGDDADYQEAELIDVTNDNYTFAEV-SATKPTATDIPAITT  898

Query  1142  NLLDVNEFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN-FREDGND  1315
             NLL ++E L++V+ +TS++  R SA     + F ++ S CEA   GK ++M+      N+
Sbjct  899   NLLSIDELLETVVNDTSSETQRCSAPAAPDIPFQEMTSHCEALSMGKHHKMSVLMSFKNN  958

Query  1316  EPDFNFSEETIWQPPSG--------NPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQ  1471
             +         I    +G        NPF   +     Q + A      A   Q+H  F++
Sbjct  959   KQAPIVPNNQINHVEAGHTSNNQNTNPFLQQSLDGYPQSMAAGELQDAAGVQQQH--FLR  1016

Query  1472  LPASSPYDNFLKAAG  1516
             LPASSPYDNFLKAAG
Sbjct  1017  LPASSPYDNFLKAAG  1031



>ref|XP_004954123.1| PREDICTED: protein EFR3 homolog B-like [Setaria italica]
Length=994

 Score =   298 bits (762),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 216/536 (40%), Positives = 304/536 (57%), Gaps = 65/536 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSV--CPRQAPAGGALSKRKSI  175
             Q+KAFPEALFHQ+LLAMV PD ETRLGAHR+FSVVLVPSSV  CP    +  + + +  +
Sbjct  487   QSKAFPEALFHQLLLAMVYPDCETRLGAHRIFSVVLVPSSVSPCPF---SDTSQTSKIDL  543

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGKDG----------MDQNTQNM-----------  292
             +RTLSRT SVFSSSAALF KL ++  S ++           + +N   +           
Sbjct  544   RRTLSRTTSVFSSSAALFGKLKRDVLSSRESPLLDNTKLTPISENADEISANDARLFKSQ  603

Query  293   -LNRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHL  469
              + R+ ST   S    P S +T +    P +  + ++L +  RQ ++LLSS++ QA+S  
Sbjct  604   TIQRMASTKDISF---PSSTDT-STLSVPTQEKDAVTLMLSIRQANLLLSSLWTQALSPE  659

Query  470   NTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLF  649
             N P ++EAI+HTYSL++LFS  K S  E L+  FQLAFSLR +SL +   + PSRRRSLF
Sbjct  660   NVPRNYEAISHTYSLMLLFSGAKGSGVEVLVGSFQLAFSLRGVSL-QAGFLSPSRRRSLF  718

Query  650   ALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKE  829
              LATSM++F SK ++   L    K +LT+ T+DPFL LV++  L+V  +  A+  YGSKE
Sbjct  719   TLATSMLVFFSKAFNIPSLIPVVKHVLTESTVDPFLHLVEDSRLQV-LDSVAKPCYGSKE  777

Query  830   DDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT  1009
             DD+ A +SLS I+++K QS E+  S+I+ SL+     + + I++QLL++F  D+ CP+G 
Sbjct  778   DDDLALKSLSNIDMNKDQSKETSVSLILNSLEDLPESELSTIRKQLLEEFSADDNCPLG-  836

Query  1010  QRINDLRNHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNA------HPDSTPNLLDVNEF  1165
             +  +     N    + + EV+   F  +D  L   SD  A       PDS+  LLDVN+ 
Sbjct  837   ETSSKFAAQNGKMPQKSMEVIPLGFVFEDDTLVEPSDSLAEPQLRHQPDSS--LLDVNQL  894

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET  1345
             LDSV ETS  VGR S +    + F DVA+QCEA   GK  +M+       +     S E 
Sbjct  895   LDSVSETSRHVGRLSVSTNHDLPFKDVANQCEALLIGKQQKMSVCMSVQQKEGGESSTEK  954

Query  1346  IWQPPS---GNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
             +   P    G+ F                   C  + Q   +F +LP  +PYD FL
Sbjct  955   LESSPEDLQGDRFL------------------CLDDGQGDSNFCKLPVLNPYDQFL  992



>ref|XP_008645035.1| PREDICTED: uncharacterized protein LOC103626409 isoform X1 [Zea 
mays]
Length=1046

 Score =   298 bits (763),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 212/583 (36%), Positives = 301/583 (52%), Gaps = 83/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  +  K+  +QR
Sbjct  468   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSSRPKKHDMQR  527

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS---------------GKDGMDQNTQN---------  289
             TLSR VSVFSSSAA+FDK+ K+++S               G+      +QN         
Sbjct  528   TLSRAVSVFSSSAAIFDKMKKDKNSENSQGESKDNSMHSVGEGTGQSKSQNLHVSQSRRS  587

Query  290   -------------MLNRLTSTYSR---------SLSVKPGS---EETPNNGENPQEHHEG  394
                          M  R  S   R         S+S++  S   +E  ++     E  E 
Sbjct  588   MKAPNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSLRASSMSVKEDQSSSNKSDEETES  647

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             + +K+ +RQI++LLSSI+ Q+ S  NTP ++EAIAHTYSLL+LFS +K S+ E+L + FQ
Sbjct  648   VLVKLSARQITLLLSSIWAQSTSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQSFQ  707

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             +AFSLRS SL+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  DPF
Sbjct  708   VAFSLRSYSLTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAADPF  767

Query  755   LQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++  
Sbjct  768   LHLVDESRLTAVKDSSNDPSKIYGSPEDNNNALKSLSEIELSESQSRECIVSTIMNNIAN  827

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
              +  + + ++ QLL DF PD++CP  TQ   ++   N S              + DLG+ 
Sbjct  828   MLDAELHNVRSQLLSDFTPDDMCPTSTQFF-EVHADNPSSGSYETGHHQEQGLLIDLGND  886

Query  1109  SDPNAHPDS----------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQ  1255
              D                   +LL +++ L++V  E + Q G  S    A + F D+ S 
Sbjct  887   HDAFGEASESAEASASSIPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTSH  942

Query  1256  CEAFQEGKGNRM--------NFREDGNDEPDFNFSEETIWQPP--------SGNPFADNN  1387
             CEA   GK  +M        + +  G      N  E  + Q P        S NPF D++
Sbjct  943   CEALTIGKQQKMSAFMSFQQSVQAAGLPSSQPNQMELDLSQDPQLPQTGAHSTNPFTDDS  1002

Query  1388  TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q        +           ++LPA+SPYDNFL+AAG
Sbjct  1003  LQGYPQYTKGPNGDNAQPGQDFQQQSLKLPAASPYDNFLRAAG  1045



>ref|XP_006648007.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Oryza brachyantha]
Length=843

 Score =   295 bits (755),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 212/540 (39%), Positives = 302/540 (56%), Gaps = 63/540 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV P   P G + + +  ++R
Sbjct  331   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSVSPCSFP-GSSQTSKIDLKR  389

Query  182   TLSRTVSVFSSSAALFDKLGK-----------------------NQSSGKDGMDQNTQNM  292
             TLSRT SVFSSSAALF KL +                       +Q SG D     +Q  
Sbjct  390   TLSRTTSVFSSSAALFGKLKREVFSFRENPRLDGTNLIPISEDSDQISGNDPKLFKSQT-  448

Query  293   LNRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
             + R+ ST          S    ++   P +  + ++L +  RQ ++LLSS++ QA+S  N
Sbjct  449   IQRMASTKD----TSLTSSSEISSSSGPTQETDPVTLMLSGRQANLLLSSLWTQALSPEN  504

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
              P ++EAI+HTYSL++LFS  KKS  + L+  FQLAFSL++IS+ +   +PPSRRRSLF 
Sbjct  505   VPRNYEAISHTYSLMLLFSEAKKSCLDLLVSSFQLAFSLQNISI-QAGFLPPSRRRSLFT  563

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKED  832
             LATSM++F SK +S   L    K LLT+ T+DPFL+LV++C L+V  +      YGSK+D
Sbjct  564   LATSMLVFFSKAFSVPSLIPPMKDLLTESTVDPFLRLVEDCKLQVVES--CSIIYGSKDD  621

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I ++  QS ++  S+I+ SLK     + + I++QLL++F  D+ CP+G+ 
Sbjct  622   DDLALKSLSNINMN-DQSQQASISLILSSLKDLPEVELSTIRKQLLEEFSADDACPLGSH  680

Query  1013  RINDLR---NHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDSTP----NLLDVNEF  1165
              +        +N    + + EV+   F  +D  L   +D  A P S      +LLDVN+ 
Sbjct  681   LVESASISPTYNAKLHQKSLEVIPVGFIFEDDTLVEAADSLAEPQSQHSLDNSLLDVNQL  740

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET  1345
             L+S+ ETS  VGR S +    + F +VA+QCEA   GK  +++     +++ D     E 
Sbjct  741   LESIGETSRHVGRLSVSTNHALPFKEVANQCEALSVGKQQKLSVCMSVHEKQDGGSLTEN  800

Query  1346  IWQP---PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  P    +   F   N                  + Q H  F +LP  SPYD FL   G
Sbjct  801   LESPQHISALTGFVSTN------------------DEQCHSDFCKLPVLSPYDKFLAGTG  842



>ref|NP_001048304.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAD19529.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF10218.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAH00340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=997

 Score =   297 bits (760),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 214/542 (39%), Positives = 304/542 (56%), Gaps = 67/542 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV    + +G + + +  I+R
Sbjct  485   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSV-SPCSFSGSSQTSKIGIKR  543

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-------------------NRL  304
             TLSRT SVFSSSAALF KL ++  S ++    +  N++                     +
Sbjct  544   TLSRTTSVFSSSAALFGKLKRDVFSFRENSRLDGTNLIPISENSDQINGNDPKLFKSQTI  603

Query  305   TSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
                YS   S    S E  N     QE  + ++L +  RQ  +LLSS++ QA+S  N P +
Sbjct  604   QRMYSAKDSFVTSSSEISNLSGTTQET-DPVTLMLSGRQAILLLSSLWTQALSPENVPRN  662

Query  485   FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
             +EAI+HTY L++LFS  KKS  E L+  FQLAFSL+SISL +   +PPSRRRSLF +ATS
Sbjct  663   YEAISHTYCLMLLFSEDKKSCLEVLVGSFQLAFSLQSISL-QAGFLPPSRRRSLFTMATS  721

Query  665   MIIFLSKTY---SFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDD  835
             M++F SK +   S IPL    K LLT   +DPFL+LV++C L+V  +      YGSK+DD
Sbjct  722   MLVFFSKAFGIPSLIPL---VKDLLTTSIVDPFLRLVEDCKLQVVES--CLTVYGSKDDD  776

Query  836   EAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT--  1009
             + A +SLS I I+  QS ++  S+I++SLK     + + I++QLL++F  D+ CP+G+  
Sbjct  777   DLALKSLSNININ-DQSKQASVSLILDSLKDLSEAELSTIRKQLLEEFSADDACPLGSHS  835

Query  1010  -QRINDLRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAHPDSTPNLLDVNEFL  1168
              +  +    +N    + + EV+   F  +D        S ++P         L+DVN+ L
Sbjct  836   NESTSQSPAYNAKLHQKSLEVIPVGFIFEDDTLVEPANSLAEPQLQQPLDNGLIDVNQLL  895

Query  1169  DSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF------REDGNDEPDFN  1330
             +SV+ETS  VGR S +    + F +VA++CEA   GK  +++       ++DG    D  
Sbjct  896   ESVVETSRHVGRLSVSTNLDLPFKEVANRCEALLIGKQQKLSVCMSVHQKQDGESPMDKL  955

Query  1331  FSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKA  1510
              S + I  P +G  F   N                  + Q H  F +LP  SPYD FL  
Sbjct  956   GSPQQI-SPTAG--FVSTN------------------DEQCHSDFCKLPVLSPYDKFLAG  994

Query  1511  AG  1516
             +G
Sbjct  995   SG  996



>ref|XP_006648008.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Oryza brachyantha]
Length=901

 Score =   295 bits (755),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 212/540 (39%), Positives = 302/540 (56%), Gaps = 63/540 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV P   P G + + +  ++R
Sbjct  389   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSVSPCSFP-GSSQTSKIDLKR  447

Query  182   TLSRTVSVFSSSAALFDKLGK-----------------------NQSSGKDGMDQNTQNM  292
             TLSRT SVFSSSAALF KL +                       +Q SG D     +Q  
Sbjct  448   TLSRTTSVFSSSAALFGKLKREVFSFRENPRLDGTNLIPISEDSDQISGNDPKLFKSQT-  506

Query  293   LNRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
             + R+ ST          S    ++   P +  + ++L +  RQ ++LLSS++ QA+S  N
Sbjct  507   IQRMASTKD----TSLTSSSEISSSSGPTQETDPVTLMLSGRQANLLLSSLWTQALSPEN  562

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
              P ++EAI+HTYSL++LFS  KKS  + L+  FQLAFSL++IS+ +   +PPSRRRSLF 
Sbjct  563   VPRNYEAISHTYSLMLLFSEAKKSCLDLLVSSFQLAFSLQNISI-QAGFLPPSRRRSLFT  621

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKED  832
             LATSM++F SK +S   L    K LLT+ T+DPFL+LV++C L+V  +      YGSK+D
Sbjct  622   LATSMLVFFSKAFSVPSLIPPMKDLLTESTVDPFLRLVEDCKLQVVES--CSIIYGSKDD  679

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I ++  QS ++  S+I+ SLK     + + I++QLL++F  D+ CP+G+ 
Sbjct  680   DDLALKSLSNINMN-DQSQQASISLILSSLKDLPEVELSTIRKQLLEEFSADDACPLGSH  738

Query  1013  RINDLR---NHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDSTP----NLLDVNEF  1165
              +        +N    + + EV+   F  +D  L   +D  A P S      +LLDVN+ 
Sbjct  739   LVESASISPTYNAKLHQKSLEVIPVGFIFEDDTLVEAADSLAEPQSQHSLDNSLLDVNQL  798

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET  1345
             L+S+ ETS  VGR S +    + F +VA+QCEA   GK  +++     +++ D     E 
Sbjct  799   LESIGETSRHVGRLSVSTNHALPFKEVANQCEALSVGKQQKLSVCMSVHEKQDGGSLTEN  858

Query  1346  IWQP---PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  P    +   F   N                  + Q H  F +LP  SPYD FL   G
Sbjct  859   LESPQHISALTGFVSTN------------------DEQCHSDFCKLPVLSPYDKFLAGTG  900



>ref|XP_008645036.1| PREDICTED: uncharacterized protein LOC103626409 isoform X2 [Zea 
mays]
Length=1045

 Score =   296 bits (759),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 212/583 (36%), Positives = 301/583 (52%), Gaps = 84/583 (14%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  +  K+  +QR
Sbjct  468   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSSRPKKHDMQR  527

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS---------------GKDGMDQNTQN---------  289
             TLSR VSVFSSSAA+FDK+ K+++S               G+      +QN         
Sbjct  528   TLSRAVSVFSSSAAIFDKMKKDKNSENSQGESKDNSMHSVGEGTGQSKSQNLHVSQSRRS  587

Query  290   -------------MLNRLTSTYSR---------SLSVKPGS---EETPNNGENPQEHHEG  394
                          M  R  S   R         S+S++  S   +E  ++     E  E 
Sbjct  588   MKAPNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSLRASSMSVKEDQSSSNKSDEETES  647

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             + +K+ +RQI++LLSSI+ Q+ S  NTP ++EAIAHTYSLL+LFS +K S+ E+L + FQ
Sbjct  648   VLVKLSARQITLLLSSIWAQSTSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQSFQ  707

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             +AFSLRS SL+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  DPF
Sbjct  708   VAFSLRSYSLTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAADPF  767

Query  755   LQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++  
Sbjct  768   LHLVDESRLTAVKDSSNDPSKIYGSPEDNNNALKSLSEIELSESQSRECIVSTIMNNIAN  827

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
              +  + + ++ QLL DF PD++CP  TQ   ++   N S              + DLG+ 
Sbjct  828   MLDAELHNVRSQLLSDFTPDDMCPTSTQFF-EVHADNPSSGSYETGHHQEGLLI-DLGND  885

Query  1109  SDPNAHPDS----------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQ  1255
              D                   +LL +++ L++V  E + Q G  S    A + F D+ S 
Sbjct  886   HDAFGEASESAEASASSIPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTSH  941

Query  1256  CEAFQEGKGNRM--------NFREDGNDEPDFNFSEETIWQPP--------SGNPFADNN  1387
             CEA   GK  +M        + +  G      N  E  + Q P        S NPF D++
Sbjct  942   CEALTIGKQQKMSAFMSFQQSVQAAGLPSSQPNQMELDLSQDPQLPQTGAHSTNPFTDDS  1001

Query  1388  TaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  Q        +           ++LPA+SPYDNFL+AAG
Sbjct  1002  LQGYPQYTKGPNGDNAQPGQDFQQQSLKLPAASPYDNFLRAAG  1044



>gb|EMS53000.1| Protein EFR3-like protein B [Triticum urartu]
Length=1041

 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 212/582 (36%), Positives = 309/582 (53%), Gaps = 107/582 (18%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  + ++ + +QR
Sbjct  489   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPILQASATSQARSRDMQR  548

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS--------------GKDGMDQNTQNM---LNRLTS  310
             TLSR VSVFSSSAA+FDKL K++ S              G++    N Q +    +R +S
Sbjct  549   TLSRAVSVFSSSAAIFDKLKKDKHSDNSQGESKSNSHGVGEETGSANRQKLPVSQSRRSS  608

Query  311   TYSRSLSVKPG---SEETPNNGENPQEHHEG----------------------------L  397
                 + S+K G   +   P++ + P     G                            L
Sbjct  609   MRMPNFSMKKGPSMALRAPSSVKAPSIVLRGPSMALRAPSMSVKEDKKSSSKSDDEMDTL  668

Query  398   SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQL  577
              LK+ SRQI++LL+SI+ QA+S  NTP ++EAIAHTYSLL+LFS  K S  E+L + FQ+
Sbjct  669   LLKLSSRQITLLLTSIWAQAVSPENTPANYEAIAHTYSLLLLFSGCKASIFEALTQSFQV  728

Query  578   AFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFL  757
             AF+LR  SL+E A++PPSRRRSLF LAT+M IF S+ ++  PL    K ++ DKT DPFL
Sbjct  729   AFALRHYSLTE-AELPPSRRRSLFTLATAMTIFSSRAFNVAPLIPICKQMINDKTGDPFL  787

Query  758   QLVDECHL---KVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
              +VD+  L   K +P+  ++  YGS ED+ +A ++L  IE                    
Sbjct  788   HIVDDSKLQAVKDSPDNPSKI-YGSPEDNASALKALEAIEA-------------------  827

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
                 + + ++ QLL DF PD++CPM  Q   +   H+ S    N    +      DLG+ 
Sbjct  828   ----ELHSVRSQLLSDFAPDDMCPMSNQFFEESAEHSVSGSHENGHHEEAMLI--DLGNE  881

Query  1109  SD----------PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQC  1258
             +D           +A    T +L+ +++ L++V         +S    A M +M++ SQC
Sbjct  882   NDIFGEASGSTATSATSVPTADLMSIDQLLETVGADPAHHTEKSFV-SADMPYMEMTSQC  940

Query  1259  EAFQEGKGNR----MNFREDGNDEP----DFNFSEETIWQPP--------SGNPFADNNT  1390
             EA   GK  +    M+F+ +    P      N  E  ++  P        S NPFAD+N 
Sbjct  941   EALTMGKQQKMSTFMSFQTNMQAAPLPSHQPNQMEMALFHDPPLPQAGAQSTNPFADDNF  1000

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              A  +  N + P      +Q+H  F++LPASSPYD+FL+AAG
Sbjct  1001  KAYPEYTNTSNPQPADDPFQQH--FLKLPASSPYDHFLRAAG  1040



>ref|XP_006648006.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Oryza brachyantha]
Length=997

 Score =   295 bits (754),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 212/540 (39%), Positives = 302/540 (56%), Gaps = 63/540 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV P   P G + + +  ++R
Sbjct  485   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSVSPCSFP-GSSQTSKIDLKR  543

Query  182   TLSRTVSVFSSSAALFDKLGK-----------------------NQSSGKDGMDQNTQNM  292
             TLSRT SVFSSSAALF KL +                       +Q SG D     +Q  
Sbjct  544   TLSRTTSVFSSSAALFGKLKREVFSFRENPRLDGTNLIPISEDSDQISGNDPKLFKSQT-  602

Query  293   LNRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
             + R+ ST          S    ++   P +  + ++L +  RQ ++LLSS++ QA+S  N
Sbjct  603   IQRMASTKD----TSLTSSSEISSSSGPTQETDPVTLMLSGRQANLLLSSLWTQALSPEN  658

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
              P ++EAI+HTYSL++LFS  KKS  + L+  FQLAFSL++IS+ +   +PPSRRRSLF 
Sbjct  659   VPRNYEAISHTYSLMLLFSEAKKSCLDLLVSSFQLAFSLQNISI-QAGFLPPSRRRSLFT  717

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKED  832
             LATSM++F SK +S   L    K LLT+ T+DPFL+LV++C L+V  +      YGSK+D
Sbjct  718   LATSMLVFFSKAFSVPSLIPPMKDLLTESTVDPFLRLVEDCKLQVVES--CSIIYGSKDD  775

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D+ A +SLS I ++  QS ++  S+I+ SLK     + + I++QLL++F  D+ CP+G+ 
Sbjct  776   DDLALKSLSNINMN-DQSQQASISLILSSLKDLPEVELSTIRKQLLEEFSADDACPLGSH  834

Query  1013  RINDLR---NHNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDSTP----NLLDVNEF  1165
              +        +N    + + EV+   F  +D  L   +D  A P S      +LLDVN+ 
Sbjct  835   LVESASISPTYNAKLHQKSLEVIPVGFIFEDDTLVEAADSLAEPQSQHSLDNSLLDVNQL  894

Query  1166  LDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEET  1345
             L+S+ ETS  VGR S +    + F +VA+QCEA   GK  +++     +++ D     E 
Sbjct  895   LESIGETSRHVGRLSVSTNHALPFKEVANQCEALSVGKQQKLSVCMSVHEKQDGGSLTEN  954

Query  1346  IWQP---PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +  P    +   F   N                  + Q H  F +LP  SPYD FL   G
Sbjct  955   LESPQHISALTGFVSTN------------------DEQCHSDFCKLPVLSPYDKFLAGTG  996



>ref|NP_001045867.1| Os02g0143200 [Oryza sativa Japonica Group]
 dbj|BAD13233.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF07781.1| Os02g0143200 [Oryza sativa Japonica Group]
Length=1035

 Score =   293 bits (751),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 214/550 (39%), Positives = 303/550 (55%), Gaps = 46/550 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVVLVPSSV P           +  I+R
Sbjct  486   RNKVFPEALFHQLLLAMVHPDHETRVSAHRIFSVVLVPSSVSPFSKSTSPNQLVKHDIKR  545

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNR-----------LTSTYSR--  322
             TLSR VSVFSSSAALFDKL +++ S ++     + N L+            + S+ SR  
Sbjct  546   TLSRAVSVFSSSAALFDKLKRDKESFREKPQDGSMNRLSHAADNDTSTVKDMPSSRSRRH  605

Query  323   -------------SLSVK-PGS-EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
                          SLS+K P S +E  N         E   L++ SRQ ++LLSSI+ QA
Sbjct  606   SFKVPNFSMKRVASLSLKSPMSPKECQNTSAESCSETESTLLRLSSRQATLLLSSIWAQA  665

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             IS  NTP+++EAIAHTYSLL+LFS +K S  E+L   FQ+AFSL S SL     + PSRR
Sbjct  666   ISPKNTPQNYEAIAHTYSLLLLFSGSKASIFEALAPSFQVAFSLMSYSLEGTDSLLPSRR  725

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASY  817
             RSLF LATSMI+F S+ ++  PL    K++L ++TMDPFL LV +  L+   +  +  +Y
Sbjct  726   RSLFTLATSMIMFFSRAFNVAPLIPICKSMLNERTMDPFLHLVQDTKLQAVKDC-SEETY  784

Query  818   GSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVC  997
             GS EDD  A +SLS +E+++ QS ES AS I+ +++     +   I+ QLL DF PD++C
Sbjct  785   GSPEDDNNALKSLSAVELTQSQSRESMASTIMNNIRDLPDSELQTIRSQLLSDFSPDDMC  844

Query  998   PMGTQRIN-DLRNHNQSDDKTNDEVV-----DPTFTVDDLGSHSDPNAHPDSTPNLLDVN  1159
             P         +RN    +D +N E V     +   T  ++  +++       T NLL ++
Sbjct  845   PTSALFFELTVRNPGCDEDSSNQEDVLINMANDNDTFGEVYENTEATTASVPTANLLGID  904

Query  1160  EFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGN----  1312
             E L+SV+ +  +Q  R S +    + F ++ +QCE     K  +M    +F+        
Sbjct  905   ELLESVVTDAPSQTARCSVSTAPNIPFKEMTNQCEVLSMEKQQKMSVLLSFKHKNQSNVL  964

Query  1313  --DEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
               ++ D   +        + NPF   +     + V        A +      F++LPASS
Sbjct  965   PINQADNTGAVHISSDDQNTNPFLQQSLDGYPKYVADGEALQVAADDVFQQQFLKLPASS  1024

Query  1487  PYDNFLKAAG  1516
             PYD FLKAAG
Sbjct  1025  PYDTFLKAAG  1034



>gb|AFW69349.1| hypothetical protein ZEAMMB73_015704 [Zea mays]
Length=1026

 Score =   293 bits (750),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 207/580 (36%), Positives = 303/580 (52%), Gaps = 97/580 (17%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  +  K+  +QR
Sbjct  468   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPSIQASPSSRPKKHDMQR  527

Query  182   TLSRTVSVFSSSAALFDKLGKNQSS---------------GKDGMDQNTQN---------  289
             TLSR VSVFSSSAA+FDK+ K+++S               G+      +QN         
Sbjct  528   TLSRAVSVFSSSAAIFDKMKKDKNSENSQGESKDNSMHSVGEGTGQSKSQNLHVSQSRRS  587

Query  290   -------------MLNRLTSTYSR---------SLSVKPGS---EETPNNGENPQEHHEG  394
                          M  R  S   R         S+S++  S   +E  ++     E  E 
Sbjct  588   MKAPNFSMKRGPSMAMRAPSVAIRAPSISLRGPSMSLRASSMSVKEDQSSSNKSDEETES  647

Query  395   LSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQ  574
             + +K+ +RQI++LLSSI+ Q+ S  NTP ++EAIAHTYSLL+LFS +K S+ E+L + FQ
Sbjct  648   VLVKLSARQITLLLSSIWAQSTSPENTPVNYEAIAHTYSLLLLFSGSKASTFEALTQSFQ  707

Query  575   LAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPF  754
             +AFSLRS SL+E   + PSRRRSLF L+T+MIIF S+ Y+ +PL    K ++ D+  DPF
Sbjct  708   VAFSLRSYSLTEADSLQPSRRRSLFTLSTAMIIFSSRAYNVLPLIPICKQMINDRAADPF  767

Query  755   LQLVDECHLKVNPNPKARAS--YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
             L LVDE  L    +     S  YGS ED+  A +SLS IE+S+ QS E   S I+ ++  
Sbjct  768   LHLVDESRLTAVKDSSNDPSKIYGSPEDNNNALKSLSEIELSESQSRECIVSTIMNNIAN  827

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
              +  + + ++ QLL DF PD++CP  TQ   ++   N S              + DLG+ 
Sbjct  828   MLDAELHNVRSQLLSDFTPDDMCPTSTQFF-EVHADNPSSGSYETGHHQEGLLI-DLGND  885

Query  1109  SDPNAHPDS----------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQ  1255
              D                   +LL +++ L++V  E + Q G  S    A + F D+ S 
Sbjct  886   HDAFGEASESAEASASSIPASDLLSIDQLLETVGAEPAPQAGVVS----ADIGFKDMTSH  941

Query  1256  CEAFQEGKGNR----MNFREDGN---------DEPDFNFSEETIWQPPSGNPFADNNTaa  1396
             CEA   GK  +    M+F++            ++ + + S++      +  P  DN    
Sbjct  942   CEALTIGKQQKMSAFMSFQQSVQAAGLPSSQPNQMELDLSQDPQLPQYTKGPNGDNAQP-  1000

Query  1397  agqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                            ++Q+    ++LPA+SPYDNFL+AAG
Sbjct  1001  -------------GQDFQQQS--LKLPAASPYDNFLRAAG  1025



>ref|XP_006648302.1| PREDICTED: uncharacterized protein LOC102704216 [Oryza brachyantha]
Length=1039

 Score =   293 bits (751),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 217/551 (39%), Positives = 302/551 (55%), Gaps = 49/551 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVVLVPSSV P              I+R
Sbjct  491   RNKVFPEALFHQLLLAMVHPDHETRVAAHRIFSVVLVPSSVSPFSKSTSPNQLMSHDIKR  550

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKD------------GMDQNTQNMLNRLTSTYSR-  322
             TLSR VSVFSSSAALFDKL +++ S ++              D +T   L  L S+ SR 
Sbjct  551   TLSRAVSVFSSSAALFDKLRRDKDSFREIPQDESVKRIWHATDDDTST-LKGLPSSQSRR  609

Query  323   ------SLSVKPGSEETPNNGENPQEHHEGLS----------LKMKSRQISMLLSSIFVQ  454
                   SLS+K  +  +  +  +P+E    L+          L++ SRQ ++LLSSI+ Q
Sbjct  610   HSFKVPSLSMKKVASLSLRSSMSPKECQNTLAESCSETESTLLRLSSRQTTLLLSSIWSQ  669

Query  455   AISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSR  634
             AIS  NTP+++EAIAHTYSLL+LF  +K S  E+L   FQ+AFSL   SL     +PPSR
Sbjct  670   AISPKNTPQNYEAIAHTYSLLLLFLGSKASIFEALAPSFQVAFSLMKHSLEGTDSLPPSR  729

Query  635   RRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS  814
             RRSLF LATSMI+F S+ ++  PL    K++L ++T+DPFL LV +  LK   N  +  +
Sbjct  730   RRSLFTLATSMIVFSSRAFNVAPLIPICKSMLNERTVDPFLHLVHDTKLKAVENC-SEET  788

Query  815   YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEV  994
             YGS EDD+ A +SLS +E+++  S E  AS ++ ++      +   IK QLL DF PD++
Sbjct  789   YGSPEDDDNALKSLSAVELTRSHSREFMASTVMNNITDLTDPELQSIKTQLLSDFSPDDM  848

Query  995   CPMGTQRINDLRNHNQSD-DKTNDEVVDPTFTVD-----DLGSHSDPNAHPDSTPNLLDV  1156
             CP              SD D  N E V      D     ++   + P      T NLL +
Sbjct  849   CPTSAPFFELPFGSPGSDEDSCNQEAVLINMANDNDSFGEVYESTTPTTASVPTGNLLGI  908

Query  1157  NEFLDS-VLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFR---EDGNDEPD  1324
             +E L++ V++TS Q GR S +    + F ++ +QCE     K  +M+     +  N  P 
Sbjct  909   DELLETVVIDTSAQTGRCSVSTAPDIPFKEMTNQCEVLSMEKQQKMSVLLSFKHKNQAPS  968

Query  1325  FNFSEETIWQPP-------SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPAS  1483
              N  +    +         + NPF   N     + V      + A + + H  F++LPAS
Sbjct  969   LNIDQVNNMEAANISSDDQNTNPFLQQNLDGYPKYVAGGEAMAAAGD-EFHQQFLKLPAS  1027

Query  1484  SPYDNFLKAAG  1516
             +PYD FLKAAG
Sbjct  1028  TPYDTFLKAAG  1038



>gb|EEC72466.1| hypothetical protein OsI_05818 [Oryza sativa Indica Group]
Length=1056

 Score =   293 bits (751),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 214/550 (39%), Positives = 303/550 (55%), Gaps = 46/550 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVVLVPSSV P           +  I+R
Sbjct  507   RNKVFPEALFHQLLLAMVHPDHETRVSAHRIFSVVLVPSSVSPFSKSTSPNQLVKHDIKR  566

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNR-----------LTSTYSR--  322
             TLSR VSVFSSSAALFDKL +++ S ++     + N L+            + S+ SR  
Sbjct  567   TLSRAVSVFSSSAALFDKLKRDKESFREKPQDGSMNRLSHAADNDTSTVKDMPSSRSRRH  626

Query  323   -------------SLSVK-PGS-EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
                          SLS+K P S +E  N         E   L++ SRQ ++LLSSI+ QA
Sbjct  627   SFKVPNFSMKRVASLSLKSPMSPKECQNTSAESCSETESTLLRLSSRQATLLLSSIWAQA  686

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             IS  NTP+++EAIAHTYSLL+LFS +K S  E+L   FQ+AFSL S SL     + PSRR
Sbjct  687   ISPKNTPQNYEAIAHTYSLLLLFSGSKASIFEALAPSFQVAFSLMSYSLEGTDSLLPSRR  746

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASY  817
             RSLF LATSMI+F S+ ++  PL    K++L ++TMDPFL LV +  L+   +  +  +Y
Sbjct  747   RSLFTLATSMIMFFSRAFNVAPLIPICKSMLNERTMDPFLHLVQDTKLQAVKDC-SEETY  805

Query  818   GSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVC  997
             GS EDD  A +SLS +E+++ QS ES AS I+ +++     +   I+ QLL DF PD++C
Sbjct  806   GSPEDDNNALKSLSAVELTQSQSRESMASTIMNNIRDLPDSELQTIRSQLLSDFSPDDMC  865

Query  998   PMGTQRIN-DLRNHNQSDDKTNDEVV-----DPTFTVDDLGSHSDPNAHPDSTPNLLDVN  1159
             P         +RN    +D +N E V     +   T  ++  +++       T NLL ++
Sbjct  866   PTSALFFELTVRNPGCDEDSSNQEDVLINMANDNDTFGEVYENTEATTASVPTANLLGID  925

Query  1160  EFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGN----  1312
             E L+SV+ +  +Q  R S +    + F ++ +QCE     K  +M    +F+        
Sbjct  926   ELLESVVTDAPSQTARCSVSTAPNIPFKEMTNQCEVLSMEKQQKMSVLLSFKHKNQSNVL  985

Query  1313  --DEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
               ++ D   +        + NPF   +     + V        A +      F++LPASS
Sbjct  986   PINQADNTGAVHISSDDQNTNPFLQQSLDGYPKYVADGEALQVAADDVFQQQFLKLPASS  1045

Query  1487  PYDNFLKAAG  1516
             PYD FLKAAG
Sbjct  1046  PYDTFLKAAG  1055



>gb|EEE56284.1| hypothetical protein OsJ_05346 [Oryza sativa Japonica Group]
Length=1056

 Score =   293 bits (750),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 214/550 (39%), Positives = 303/550 (55%), Gaps = 46/550 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVVLVPSSV P           +  I+R
Sbjct  507   RNKVFPEALFHQLLLAMVHPDHETRVSAHRIFSVVLVPSSVSPFSKSTSPNQLVKHDIKR  566

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNR-----------LTSTYSR--  322
             TLSR VSVFSSSAALFDKL +++ S ++     + N L+            + S+ SR  
Sbjct  567   TLSRAVSVFSSSAALFDKLKRDKESFREKPQDGSMNRLSHAADNDTSTVKDMPSSRSRRH  626

Query  323   -------------SLSVK-PGS-EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQA  457
                          SLS+K P S +E  N         E   L++ SRQ ++LLSSI+ QA
Sbjct  627   SFKVPNFSMKRVASLSLKSPMSPKECQNTSAESCSETESTLLRLSSRQATLLLSSIWAQA  686

Query  458   ISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRR  637
             IS  NTP+++EAIAHTYSLL+LFS +K S  E+L   FQ+AFSL S SL     + PSRR
Sbjct  687   ISPKNTPQNYEAIAHTYSLLLLFSGSKASIFEALAPSFQVAFSLMSYSLEGTDSLLPSRR  746

Query  638   RSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASY  817
             RSLF LATSMI+F S+ ++  PL    K++L ++TMDPFL LV +  L+   +  +  +Y
Sbjct  747   RSLFTLATSMIMFFSRAFNVAPLIPICKSMLNERTMDPFLHLVQDTKLQAVKDC-SEETY  805

Query  818   GSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVC  997
             GS EDD  A +SLS +E+++ QS ES AS I+ +++     +   I+ QLL DF PD++C
Sbjct  806   GSPEDDNNALKSLSAVELTQSQSRESMASTIMNNIRDLPDSELQTIRSQLLSDFSPDDMC  865

Query  998   PMGTQRIN-DLRNHNQSDDKTNDEVV-----DPTFTVDDLGSHSDPNAHPDSTPNLLDVN  1159
             P         +RN    +D +N E V     +   T  ++  +++       T NLL ++
Sbjct  866   PTSALFFELTVRNPGCDEDSSNQEDVLINMANDNDTFGEVYENTEATTASVPTANLLGID  925

Query  1160  EFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGN----  1312
             E L+SV+ +  +Q  R S +    + F ++ +QCE     K  +M    +F+        
Sbjct  926   ELLESVVTDAPSQTARCSVSTAPNIPFKEMTNQCEVLSMEKQQKMSVLLSFKHKNQSNVL  985

Query  1313  --DEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
               ++ D   +        + NPF   +     + V        A +      F++LPASS
Sbjct  986   PINQADNTGAVHISSDDQNTNPFLQQSLDGYPKYVADGEALQVAADDVFQQQFLKLPASS  1045

Query  1487  PYDNFLKAAG  1516
             PYD FLKAAG
Sbjct  1046  PYDTFLKAAG  1055



>gb|EMT11310.1| hypothetical protein F775_16040 [Aegilops tauschii]
Length=1041

 Score =   291 bits (745),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 210/582 (36%), Positives = 305/582 (52%), Gaps = 107/582 (18%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LL M+ PD+E R+ AHR+F++VLVPSSV P    +  + ++   +QR
Sbjct  489   QNKVFPEALFHQLLLTMIHPDHEARVAAHRIFAIVLVPSSVSPILQASATSQARAHDMQR  548

Query  182   TLSRTVSVFSSSAALFDKLGKNQ---------SSGKDGMDQNTQNM--------LNRLTS  310
             TLSR VSVFSSSAA+FDKL K++          S   G+ + T +          +R +S
Sbjct  549   TLSRAVSVFSSSAAIFDKLKKDKHSDNSQGESKSNSHGVSEETGSANRQKLPVSQSRRSS  608

Query  311   TYSRSLSVKPG---SEETPNNGENPQEHHEG----------------------------L  397
                 + S+K G   +   P++ + P     G                            L
Sbjct  609   MRMPNFSMKKGPSMALRAPSSVKAPSIVLRGPSMALRAPSMSVKEEKKSSSKSDDEMDTL  668

Query  398   SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQL  577
              LK+ SRQI++LL+SI+ QA+S  NTP ++EAIAHTYSLL+LFS  K S  E+L + FQ+
Sbjct  669   LLKLSSRQITLLLTSIWAQAVSPENTPANYEAIAHTYSLLLLFSGCKASILEALTQSFQV  728

Query  578   AFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFL  757
             AF+LR  SL+E A++PPSRRRSLF LAT+M IF S+ ++  PL    K ++ DKT DPFL
Sbjct  729   AFALRHYSLTE-AELPPSRRRSLFTLATAMTIFSSRAFNVAPLIPICKQMINDKTGDPFL  787

Query  758   QLVDECHL---KVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKK  928
              +VD+  L   K +P+  ++  YGS ED+ +A ++L  IE                    
Sbjct  788   HIVDDSKLQAVKDSPDNPSKI-YGSPEDNASALKALEAIEA-------------------  827

Query  929   SITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDLGSH  1108
                 + + ++ QLL DF PD++CPM  Q   +   H+ S    N    +      DLG+ 
Sbjct  828   ----ELHSVRSQLLSDFAPDDMCPMSNQFFEESAEHSVSGSHENGHHEEAMLI--DLGNE  881

Query  1109  SD----------PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQC  1258
             +D           +A    T +L+ +++ L++V         +S    A M +M++ SQC
Sbjct  882   NDIFGEASGSTAASATSVPTADLMSIDQLLETVGADPAHHTEKSFV-SADMPYMEMTSQC  940

Query  1259  EAFQEGKGNR----MNFREDGNDEPDFNFS----EETIWQPP--------SGNPFADNNT  1390
             EA   GK  +    M+F+ +    P  +      E  ++  P        S NPFAD+N 
Sbjct  941   EALTMGKQQKMSTFMSFQTNMQAAPLPSHQPSQMEMALFHDPPLPQAGAQSTNPFADDNF  1000

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 +  N   P      +Q+H  F++LPASSPYDNFL+AAG
Sbjct  1001  KGYPEYTNTGNPQPADDPFQQH--FLKLPASSPYDNFLRAAG  1040



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   288 bits (736),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 220/534 (41%), Positives = 297/534 (56%), Gaps = 50/534 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q KAFPEALFHQ+LLAMV PD+ETR+ AHR+FSV+LVP++  P          K   + R
Sbjct  477   QKKAFPEALFHQLLLAMVHPDHETRVVAHRIFSVILVPTAADP----------KALGVPR  526

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ----------NTQNMLNRLTSTYSRSLS  331
             TLS+ VS FSSSA++F KL   + S    + Q          N   ++NRL S++SR  S
Sbjct  527   TLSKAVSFFSSSASIFQKLRSQKRSSSVRLSQYNKENVTPANNNVGIINRLKSSHSRVYS  586

Query  332   VKPGSEETPNNGENPQEHH-EGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             V   +   PN  +N    + E ++LK+   QIS L+SSI+ Q+ S  N P ++EAIA+TY
Sbjct  587   V--NNPPLPNKMDNSDNQNLEVVTLKLSRHQISRLVSSIWAQSTSPENMPANYEAIAYTY  644

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             SL++L SRTKKS  E +IR FQLAFSL +ISL E   +PPSRRRSLF LA SMI+F SK 
Sbjct  645   SLVLLVSRTKKSFKELIIRSFQLAFSLWNISLKE-GPLPPSRRRSLFILAISMIMFSSKA  703

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARA-SYGSKEDDEAAKRSLSGI  865
             Y+ +PL  S K +LT+  +DPFL LV++    V+      A +YGSKEDDE A ++LS +
Sbjct  704   YNIVPLVHSTKEVLTEIKVDPFLHLVEDKLQAVSFALDNLAINYGSKEDDERALQTLSEL  763

Query  866   EISKKQSTESFASMIVESLKKSITDKTNL--IKEQLLQDFLPDEVCPMGTQRINDLRNHN  1039
               S  Q+ ESFAS I+ SL   I  K  L  IKE+LL++F PD    +G+Q      N  
Sbjct  764   LTSAHQTQESFASEILRSL--DIFSKVELLSIKEKLLEEFSPDATSELGSQLT---LNVP  818

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSN-QVGRQSAA  1216
             + D  T D+  D  + + +      P    +  P+LL  N+ L+ V + S    GR S +
Sbjct  819   RKDASTIDD--DFIYELFESQLKQSPRLSTE-VPSLLSANQLLELVFDPSQPAAGRISVS  875

Query  1217  PPAGMTFMDVASQCEAFQEGKG------NRMNFREDGNDEPDFNFSEETIWQPPSGN---  1369
                   +  +A  CE    GK       + +  +E   + P  N + E+     S +   
Sbjct  876   TAFDTPYEHMADNCEVLMMGKREMSRLMSNVQKQECSTNPPLPNHNNESKNMDSSSHVDN  935

Query  1370  -----PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                  P  D+N     QP +   P  C  EYQ  P   QLP SSP+DNFLKAAG
Sbjct  936   QKVETPLFDDNFVELYQPTSVPVPNLCGVEYQDQPHLFQLPTSSPFDNFLKAAG  989



>ref|XP_002451526.1| hypothetical protein SORBIDRAFT_04g003310 [Sorghum bicolor]
 gb|EES04502.1| hypothetical protein SORBIDRAFT_04g003310 [Sorghum bicolor]
Length=1007

 Score =   288 bits (736),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 222/550 (40%), Positives = 313/550 (57%), Gaps = 58/550 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             QNK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  470   QNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  529

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYS---  319
             TLSR VSVFSSSAALFDKL ++++S ++   + + N +           N L  + S   
Sbjct  530   TLSRAVSVFSSSAALFDKLRRDKNSFREYFHEGSMNRILHGIDDETATPNDLLGSQSLRE  589

Query  320   --RSLSV-KPGSEETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
               R  SV +  S  +   G++P        E   L++ S+Q ++LLSSI+ QA+S  NTP
Sbjct  590   NLRFPSVSRKYSSASLKEGQSPVTESINEMEMTVLRLSSQQATLLLSSIWRQALSPKNTP  649

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K S  E+L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  650   QNYEAIAHTYSLLLLFLGSKTSIFEALAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  709

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKED  832
             TSMI+F S+ ++   L    K++L D+TMDPFL LV E  L+   +     S  YGS ED
Sbjct  710   TSMIVFSSRAFNVATLLPICKSMLNDRTMDPFLHLVHENKLQAVKDYTEDPSTFYGSAED  769

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNL----IKEQLLQDFLPDEVCP  1000
             ++ A +SLS +E++   S ES    +V ++  SITD  +L    I+ QLL+DF PDE+CP
Sbjct  770   NQNALKSLSAVELTNSCSRES----MVFAIMNSITDLPDLELENIRSQLLRDFSPDEMCP  825

Query  1001  MGTQRI-----------NDLRNHNQSD--DKTNDEVVDPTFTVDDLGSHSDPNAHPDSTP  1141
                  +           +D  ++ +++  D  ND      F+   L +     A P  T 
Sbjct  826   ASAHFLESPGKIARPSSDDDTDYQEAELIDLRNDNNTFAEFSATTLTA----TAIPVPTT  881

Query  1142  NLLDVNEFLDSVL-ETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMN----FRED  1306
             NLL ++E L++V+ +TS+Q   QS A    + F ++ S CEA   GK ++M+    F+++
Sbjct  882   NLLSIDELLETVMNDTSSQTRAQSMA--GDIPFQEMTSHCEALSMGKHHKMSLLMSFKQN  939

Query  1307  GNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
                       E  + +  + +     NT    +    A  A  A   Q+   F++LPASS
Sbjct  940   KQAATAV-VPENQVNRDEAAHTSNKQNTNPFLRHSIGAEVAQVAGVVQQ--PFLRLPASS  996

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  997   PYDNFLKAAG  1006



>ref|XP_008387298.1| PREDICTED: uncharacterized protein LOC103449747 isoform X2 [Malus 
domestica]
Length=378

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 230/378 (61%), Gaps = 33/378 (9%)
 Frame = +2

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFAL  655
             PE++EAIAHT+SL++LFS  K S  E L+R FQLAFSLR+ISL+E   +PPSRRRSLF L
Sbjct  2     PENYEAIAHTHSLVVLFSWAKNSRIEVLVRSFQLAFSLRNISLNEGGVLPPSRRRSLFTL  61

Query  656   ATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL---KVNPNPKARASYGSK  826
             ATSMI+FLSK Y+ + L   A A+L DK +DPFL+LV++  L   K  P+   R  YGS+
Sbjct  62    ATSMILFLSKAYNIVSLVRRANAVLVDKIVDPFLRLVEDRKLQAVKTGPD-HPRHLYGSE  120

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             EDD  A +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+VCP+G
Sbjct  121   EDDRLALKSLSEINITEEQTKEFFASEVVKSLERLLDAELSTIREELLSEFLPDDVCPLG  180

Query  1007  TQRIND----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPNLLDV  1156
              Q   D    L   +  D K+  E   P F++DD    GS      + D    +PNLL V
Sbjct  181   AQLCMDAPQKLYQVDSRDSKSMKEDA-PIFSLDDDSFPGSFDSQKNNLDFSADSPNLLSV  239

Query  1157  NEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDF---  1327
             N+F++SVLET++QVGR S +    + + ++A  CEA   GK  +M+       + ++   
Sbjct  240   NQFIESVLETAHQVGRLSVSNAPDVPYKEMAGHCEALLIGKQQKMSNLMSSQQKQEYLMN  299

Query  1328  ----NFSEETIWQPP----------SGNPFADNN-TaaagqpvnaaapaSCATEYQRHPS  1462
                 N +++  W             SGNPF D+  T+    P    A   C  EYQ HP 
Sbjct  300   QSLQNHNDDAKWITSGFHADFGSYRSGNPFXDDTATSYNPPPTAGHASVMCVNEYQHHPH  359

Query  1463  FMQLPASSPYDNFLKAAG  1516
               +LPASSPYDNFLKAAG
Sbjct  360   SFRLPASSPYDNFLKAAG  377



>gb|KHN32414.1| Protein EFR3 like B [Glycine soja]
Length=959

 Score =   286 bits (731),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 212/550 (39%), Positives = 299/550 (54%), Gaps = 81/550 (15%)
 Frame = +2

Query  2     QNKA---FPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKS  172
             QNKA   FPEALFHQ+LLAMV  D+ETR+GAHR+FSVVLVPSSVCP+ + +G  ++K   
Sbjct  445   QNKARLAFPEALFHQLLLAMVHADHETRVGAHRIFSVVLVPSSVCPQPSSSGTPMTKAAG  504

Query  173   IQRTLSRTVSVFSSSAALFDKLGKNQSS-----GKDGMDQNTQNMLNRLTSTYSRSLSVK  337
             IQR LSR VSVFSSS+ALF+KL + Q+S       DG + N  ++LNRL STYSR+ S +
Sbjct  505   IQRMLSRNVSVFSSSSALFEKLERKQNSLSEDSHTDG-NVNDNSILNRLKSTYSRTTSTR  563

Query  338   PG---SEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
                  S E  +N +N + H+  +  ++KS          + +A S    P+    I  T 
Sbjct  564   KSAMISAEYTDN-KNSKVHNSSMMNRLKSS---------YSRATSA-KKPQ----IPTTV  608

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
                   +  K+      +   Q+   L SI    Q+  P +   +  A+A         T
Sbjct  609   EENTTNTSNKQQVLPIRLSSHQINLLLSSIW--AQSIYPLNTSENFEAIA--------HT  658

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK--VNPNPKARASYGSKEDDEAAKRSLSG  862
             YS + L   +K       +DPFLQLV++  L+  ++ + +    YGSKEDDE A ++LS 
Sbjct  659   YSLVLLVARSK-------VDPFLQLVNDSKLQAVIDTDRQPSKVYGSKEDDEDALKALSA  711

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ----RINDLR  1030
             I +++ QS ESFA+MIV+SL KS ++++++++EQLL DF PD+ CP+G Q       ++ 
Sbjct  712   IRLTENQSKESFATMIVQSLGKS-SNESSILREQLLNDFSPDDACPLGAQLSAETTGNMY  770

Query  1031  NHNQSDDKTNDEVVDPTFTVDD----LG----SHSDPNAHPDSTPNLLDVNEFLDSVLET  1186
                  +DK  D V    FT+DD     G    ++SDP   P    +LL V++ L SV ET
Sbjct  771   QSGLKEDKLPDMVDISLFTIDDDIPPCGLESQANSDPQQQPSQNLSLLSVDDILGSVSET  830

Query  1187  SNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRM-------------NFR------EDG  1309
             ++QVGR S + P  M + ++A  CEA   GK  +M             +FR         
Sbjct  831   THQVGRISISTPFDMPYKEMALHCEALLMGKQQKMSTFMGTHPMQGYFSFRIPAPEYNQQ  890

Query  1310  NDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaS-CATEYQRHPSFMQLPASS  1486
              DE   +  ++T+  P SGNPF D+N  +             CAT YQ   +F QLPAS 
Sbjct  891   KDESSNSSVQQTL--PSSGNPFLDSNFDSNSYHTLPDTSPRLCATAYQHQAAFFQLPASR  948

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  949   PYDNFLKAAG  958



>ref|XP_007162229.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34223.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=978

 Score =   285 bits (729),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 201/541 (37%), Positives = 286/541 (53%), Gaps = 89/541 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRK--SI  175
             QNKAFPE LFH +LL MV PD+ETR  AHR+FSV+LVP++V P  +    ++S RK  S+
Sbjct  490   QNKAFPETLFHHLLLVMVHPDHETRAVAHRIFSVILVPTTVFPHPS---LSISDRKPSSV  546

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM-------------LNRLTSTY  316
              RTLSRT+SVFSSSA LF+KL   + S  + + Q  +N+             +N+L S +
Sbjct  547   PRTLSRTLSVFSSSAVLFEKLRLEKRSSSEKLIQFKENIPGEIESTNSNGGIVNKLKSMH  606

Query  317   SRSLSVK--PGSEETPNNGENPQEHHEGL-SLKMKSRQISMLLSSIFVQAISHLNTPEHF  487
             +R  SV   P   E         + +    +L++   +IS LLSSI+VQ+IS  N P ++
Sbjct  607   NRVSSVNNPPLLLEVDEIAAKHDDKNSVFPALRLNRLKISRLLSSIWVQSISPGNMPANY  666

Query  488   EAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSM  667
             EAIAH+Y+L++L SR K S HE L+R FQLAFSL +ISL E   +PPSRRRSLF LATSM
Sbjct  667   EAIAHSYTLILLVSREKNSFHEVLVRSFQLAFSLWNISLKE-GTLPPSRRRSLFTLATSM  725

Query  668   IIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECH--LKVNPNP-KARASYGSKEDDE  838
             I+F SK Y+   L  SA+ +L ++ +DP+L+L+++ +    VN  P      YGSKEDD+
Sbjct  726   IVFSSKEYNIDRLVQSARKVLLERKVDPYLELIEDYNKLQVVNFAPDNLNIMYGSKEDDD  785

Query  839   AAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRI  1018
              A ++LS +     ++ E FAS I++ L+     + + IKEQLL++F PD +C +G+Q  
Sbjct  786   RATQTLSELLGYINETREIFASEIIKCLENFAKAELSSIKEQLLEEFAPDAMCELGSQ--  843

Query  1019  NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQV  1198
                                                        L +N       ET N  
Sbjct  844   -------------------------------------------LKMN-MATMAFETPNPA  859

Query  1199  GRQSAAPPAGMTFMDVASQCEAF-------------QEGKGNRMN--FREDGNDEPDFNF  1333
             GR S      M + D+A +CE               Q+ + N ++       N+  + + 
Sbjct  860   GRISVCNAYNMPYNDMADKCEVLLMEKQKMSRLMSAQQKQDNLVDSLLLNQDNEMKNMDV  919

Query  1334  SEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
             S +  +Q     PF D+N         +      A EY+ HP   +LP +SPYDNFLKAA
Sbjct  920   SNQVDFQKVGIPPF-DDNVCVDLYQPTSGPLPVFANEYENHP--FKLPVASPYDNFLKAA  976

Query  1514  G  1516
             G
Sbjct  977   G  977



>ref|XP_010233799.1| PREDICTED: uncharacterized protein LOC100821314 isoform X2 [Brachypodium 
distachyon]
Length=918

 Score =   284 bits (726),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 216/582 (37%), Positives = 304/582 (52%), Gaps = 93/582 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVL-------VPSSVCPRQAPAGGALS  160
             +NK FPEALFHQ+LL+MV PD+ETR+ AHR+FSVVL        P+S  P Q        
Sbjct  352   KNKVFPEALFHQLLLSMVHPDHETRVAAHRIFSVVLVPSSVSPFPNSPSPDQ-------H  404

Query  161   KRKSIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLN---------RLTST  313
             K+  ++RTLSR VSVFSSSAALF+KL + + S K+     ++N+++         R+ + 
Sbjct  405   KKHEVRRTLSRAVSVFSSSAALFEKLRREKGSFKENTHDGSRNVVSHGLGNESAKRIGNE  464

Query  314   YSRSL---SVK----PGSE------ETPN-------------------NGENPQEHHEGL  397
              S+ +   S K    PGS+        PN                    G+N        
Sbjct  465   SSKRIGNESAKRKDLPGSQSRRHSFRVPNLSFKKNSSSSRQSSSMSRKEGQNSSTESSSE  524

Query  398   S----LKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
                  L++   Q ++LLSSI+ QAIS  N P+++EAIAHTYSLL+LFS +K S  E+L  
Sbjct  525   MEPTFLRLSCHQATLLLSSIWDQAISPKNYPQNYEAIAHTYSLLLLFSGSKTSIFEALAP  584

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQLAF L + SL     + PSRRRSLF LATSMII  SK ++  PL    K++  ++T+
Sbjct  585   TFQLAFCLMTRSLGGTDSLSPSRRRSLFTLATSMIILASKAFNVAPLVPICKSMFNERTV  644

Query  746   DPFLQLVDECHLKVNPN--PKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL LV+E  L+   +       +YGS EDDE A + LS +++++  S ES  S I+ S
Sbjct  645   DPFLHLVEETKLQAVKDCLEDPSKTYGSPEDDENALKYLSAVKLTESHSRESMISTIMNS  704

Query  920   LKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDL  1099
             +      + + I+ QLL DF PDE+CP   Q   D   +  S   +ND+ V    T+DD+
Sbjct  705   VTDLPDVELHCIRSQLLSDFSPDEMCPTSAQYFEDPSKNTPS--VSNDDFVHQEDTLDDM  762

Query  1100  GSHSDPNAH---PDS------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVA  1249
                +    H   P S      T ++L ++E L +V    S+QVGR S +    + F +++
Sbjct  763   ADETSAEVHGTTPTSTDISVPTTDVLGIDELLQTVDAGASSQVGRFSVSKAPDIPFKEMS  822

Query  1250  SQCEAFQEGKGNRM--------NFREDGNDEPDFNFSEET-----IWQPPSGNPFADNNT  1390
             SQCEA   GK  +M        N +    +    N +E T        P + NPF   N 
Sbjct  823   SQCEARCMGKQQKMSVFMSFQCNMQVAVPENNQINHTEATHTSDEQQAPENTNPFLHENN  882

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                   +        A + Q+    ++LPASSPYDNFLKAAG
Sbjct  883   PGVSGGLQF------ADDLQQQ-YLLKLPASSPYDNFLKAAG  917



>ref|XP_003570918.1| PREDICTED: uncharacterized protein LOC100821314 isoform X1 [Brachypodium 
distachyon]
Length=1059

 Score =   283 bits (724),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 216/582 (37%), Positives = 304/582 (52%), Gaps = 93/582 (16%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVL-------VPSSVCPRQAPAGGALS  160
             +NK FPEALFHQ+LL+MV PD+ETR+ AHR+FSVVL        P+S  P Q        
Sbjct  493   KNKVFPEALFHQLLLSMVHPDHETRVAAHRIFSVVLVPSSVSPFPNSPSPDQ-------H  545

Query  161   KRKSIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLN---------RLTST  313
             K+  ++RTLSR VSVFSSSAALF+KL + + S K+     ++N+++         R+ + 
Sbjct  546   KKHEVRRTLSRAVSVFSSSAALFEKLRREKGSFKENTHDGSRNVVSHGLGNESAKRIGNE  605

Query  314   YSRSL---SVK----PGSE------ETPN-------------------NGENPQEHHEGL  397
              S+ +   S K    PGS+        PN                    G+N        
Sbjct  606   SSKRIGNESAKRKDLPGSQSRRHSFRVPNLSFKKNSSSSRQSSSMSRKEGQNSSTESSSE  665

Query  398   S----LKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIR  565
                  L++   Q ++LLSSI+ QAIS  N P+++EAIAHTYSLL+LFS +K S  E+L  
Sbjct  666   MEPTFLRLSCHQATLLLSSIWDQAISPKNYPQNYEAIAHTYSLLLLFSGSKTSIFEALAP  725

Query  566   GFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTM  745
              FQLAF L + SL     + PSRRRSLF LATSMII  SK ++  PL    K++  ++T+
Sbjct  726   TFQLAFCLMTRSLGGTDSLSPSRRRSLFTLATSMIILASKAFNVAPLVPICKSMFNERTV  785

Query  746   DPFLQLVDECHLKVNPN--PKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVES  919
             DPFL LV+E  L+   +       +YGS EDDE A + LS +++++  S ES  S I+ S
Sbjct  786   DPFLHLVEETKLQAVKDCLEDPSKTYGSPEDDENALKYLSAVKLTESHSRESMISTIMNS  845

Query  920   LKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTFTVDDL  1099
             +      + + I+ QLL DF PDE+CP   Q   D   +  S   +ND+ V    T+DD+
Sbjct  846   VTDLPDVELHCIRSQLLSDFSPDEMCPTSAQYFEDPSKNTPS--VSNDDFVHQEDTLDDM  903

Query  1100  GSHSDPNAH---PDS------TPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVA  1249
                +    H   P S      T ++L ++E L +V    S+QVGR S +    + F +++
Sbjct  904   ADETSAEVHGTTPTSTDISVPTTDVLGIDELLQTVDAGASSQVGRFSVSKAPDIPFKEMS  963

Query  1250  SQCEAFQEGKGNRM--------NFREDGNDEPDFNFSEET-----IWQPPSGNPFADNNT  1390
             SQCEA   GK  +M        N +    +    N +E T        P + NPF   N 
Sbjct  964   SQCEARCMGKQQKMSVFMSFQCNMQVAVPENNQINHTEATHTSDEQQAPENTNPFLHENN  1023

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                   +        A + Q+    ++LPASSPYDNFLKAAG
Sbjct  1024  PGVSGGLQF------ADDLQQQ-YLLKLPASSPYDNFLKAAG  1058



>ref|XP_008387296.1| PREDICTED: uncharacterized protein LOC103449747 isoform X1 [Malus 
domestica]
 ref|XP_008387297.1| PREDICTED: uncharacterized protein LOC103449747 isoform X1 [Malus 
domestica]
Length=382

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 167/382 (44%), Positives = 232/382 (61%), Gaps = 37/382 (10%)
 Frame = +2

Query  476   PEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSE----QAKMPPSRRRS  643
             PE++EAIAHT+SL++LFS  K S  E L+R FQLAFSLR+ISL+E    ++ +PPSRRRS
Sbjct  2     PENYEAIAHTHSLVVLFSWAKNSRIEVLVRSFQLAFSLRNISLNEGGEPRSVLPPSRRRS  61

Query  644   LFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL---KVNPNPKARAS  814
             LF LATSMI+FLSK Y+ + L   A A+L DK +DPFL+LV++  L   K  P+   R  
Sbjct  62    LFTLATSMILFLSKAYNIVSLVRRANAVLVDKIVDPFLRLVEDRKLQAVKTGPD-HPRHL  120

Query  815   YGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEV  994
             YGS+EDD  A +SLS I I+++Q+ E FAS +V+SL++ +  + + I+E+LL +FLPD+V
Sbjct  121   YGSEEDDRLALKSLSEINITEEQTKEFFASEVVKSLERLLDAELSTIREELLSEFLPDDV  180

Query  995   CPMGTQRIND----LRNHNQSDDKTNDEVVDPTFTVDD---LGSHSDPNAHPD---STPN  1144
             CP+G Q   D    L   +  D K+  E   P F++DD    GS      + D    +PN
Sbjct  181   CPLGAQLCMDAPQKLYQVDSRDSKSMKEDA-PIFSLDDDSFPGSFDSQKNNLDFSADSPN  239

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPD  1324
             LL VN+F++SVLET++QVGR S +    + + ++A  CEA   GK  +M+       + +
Sbjct  240   LLSVNQFIESVLETAHQVGRLSVSNAPDVPYKEMAGHCEALLIGKQQKMSNLMSSQQKQE  299

Query  1325  F-------NFSEETIWQPP----------SGNPFADNN-TaaagqpvnaaapaSCATEYQ  1450
             +       N +++  W             SGNPF D+  T+    P    A   C  EYQ
Sbjct  300   YLMNQSLQNHNDDAKWITSGFHADFGSYRSGNPFXDDTATSYNPPPTAGHASVMCVNEYQ  359

Query  1451  RHPSFMQLPASSPYDNFLKAAG  1516
              HP   +LPASSPYDNFLKAAG
Sbjct  360   HHPHSFRLPASSPYDNFLKAAG  381



>ref|XP_010236037.1| PREDICTED: uncharacterized protein LOC100837488 [Brachypodium 
distachyon]
Length=963

 Score =   280 bits (715),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 222/551 (40%), Positives = 315/551 (57%), Gaps = 81/551 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSV--CPRQAPAGGALSKRKSI  175
             Q+KAFPEALFHQ+LLAMV PD ET LGAHR+FSVVLVPSSV  C   + +G + + + ++
Sbjct  447   QSKAFPEALFHQLLLAMVYPDCETHLGAHRIFSVVLVPSSVSPC---SFSGTSQTSKINL  503

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNM---------------------  292
             QRTLSRT SVFSSSAALF KL ++  S +     +  N+                     
Sbjct  504   QRTLSRTSSVFSSSAALFGKLKRDTFSFRGSPRLDNTNLIPIREDSDQASDDEPKLFKSQ  563

Query  293   -LNRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHL  469
              L R+TST   SL   P + E  N   + QE  + ++L + +RQ  +LLSS++ QA+S  
Sbjct  564   TLQRMTSTKETSL---PSATEISNPSGHTQEA-DPVTLMLSARQADLLLSSLWTQALSPE  619

Query  470   NTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLF  649
             N P  +EAI+HTYSL++LFS  + S  E L+  FQLAFSLRS+SL +   +PPSRRRSLF
Sbjct  620   NIPRSYEAISHTYSLMLLFSGAQNSRLEVLVGSFQLAFSLRSVSL-QAGFLPPSRRRSLF  678

Query  650   ALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPN---PKARASYG  820
              LATSM++F SK ++   L    K LLT+ T+DPFL+LV++  L+   N   P  RA YG
Sbjct  679   TLATSMLVFFSKAFNVPSLIPVVKDLLTESTVDPFLRLVEDLRLQAIDNAVDPCLRA-YG  737

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             SKEDD+ A +SLS I ++  QS +   S+I++SL+ S ++    I+ QLL+DF  D+VCP
Sbjct  738   SKEDDDLALKSLSNINMN-DQSRQIGVSLILDSLELSESELCT-IRNQLLEDFSADDVCP  795

Query  1001  MGTQRI--------NDLRNHNQSDDKT-------NDEVVDPTFTVDDLGSHSDPNAHPDS  1135
              G+  I         + + H++S +         +D +++PT       S ++P++    
Sbjct  796   AGSHFIASPSKSSGRNAKMHHKSLEVIPMGFVFEDDTIIEPT------DSLAEPSSRHPL  849

Query  1136  TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGND  1315
               +LLDVN+ L+SV ETS+ +GR S +    ++F +VA+QCEA   GK  +++     + 
Sbjct  850   DNSLLDVNQLLESVSETSHHIGRLSVSMNHDLSFKEVANQCEALLIGKREKLSVCMSAHQ  909

Query  1316  -EPDFNFS---EETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPAS  1483
              E D +F+   E T    P+       N                  + Q   SF +LP  
Sbjct  910   REVDESFTGKLESTQPDSPTARLILHTN------------------DDQFQSSFCKLPVL  951

Query  1484  SPYDNFLKAAG  1516
             SPYD FL  AG
Sbjct  952   SPYDKFLTPAG  962



>dbj|BAK04246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1037

 Score =   278 bits (711),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 216/558 (39%), Positives = 294/558 (53%), Gaps = 81/558 (15%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVL-------VPSSVCPRQAPAGGALS  160
             +NK FPEALFHQ+LLAMV PD+ETR+ AHR+FSVVL        P S  P Q        
Sbjct  507   KNKVFPEALFHQLLLAMVHPDHETRVAAHRIFSVVLVPSSVSPFPHSTSPDQ-------H  559

Query  161   KRKSIQRTLSRTVSVFSSSAALFDKLGKNQSS-GKDGMDQNTQNML----------NRLT  307
              +  IQRTLSR VSVFSSSAALFDKL +++SS G++  D +   +L            L+
Sbjct  560   NKHEIQRTLSRAVSVFSSSAALFDKLRRDKSSFGENTQDGSRNRILYSIGDETALPKDLS  619

Query  308   STYSR-------SLSVKPGS-----------EETPNNGENPQEHHEGLSLKMKSRQISML  433
              + S         LSVK  S            E  N+        E   L++ S Q ++L
Sbjct  620   GSQSHRHSFRVPKLSVKRVSSSSLRSPSTSLREGQNSSTESCNEMERTFLRLSSHQTTLL  679

Query  434   LSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQ  613
             LSSI+VQA+S  N+P+++EAIAHTYSLL+LFS +K +  E+L + FQ+AFSL + SL E 
Sbjct  680   LSSIWVQAVSPQNSPQNYEAIAHTYSLLLLFSGSKIAIFEALAQSFQVAFSLMTHSLRET  739

Query  614   AKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--  787
               +PPSRRRSLF LATSM IF S+ ++  PL    K++L +KT+DPFL LV E  L+   
Sbjct  740   GSLPPSRRRSLFTLATSMTIFSSRAFNVAPLIPICKSMLNEKTVDPFLHLVHETKLQAVN  799

Query  788   NPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNL----I  955
             + +     +YGS  DD  A +SLS + +    S E   S I+     SITD  ++    I
Sbjct  800   DCSEDPSKTYGSPADDADALKSLSAVILIGGHSREFMTSTIM----NSITDLPDMELESI  855

Query  956   KEQLLQDFLPDEVCPMGTQ--RINDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHP  1129
             + QLL DF PDE+CP   Q   +      + SDD    +   P      + + + P    
Sbjct  856   RSQLLSDFSPDEMCPTSAQFFEVPSKNPLSVSDDDFFHQEATPI----SMANGATP----  907

Query  1130  DSTPNLLDVNEFLDSV-LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF---  1297
               T NLL ++E L +V    S+Q  R S +    + F ++ SQCEA   GK  +M+    
Sbjct  908   --TGNLLGIDELLQTVDAGASSQTERYSVSRAPDLPFKEMTSQCEALCMGKHQKMSVFMS  965

Query  1298  ----REDGNDEPDFNFSEET-IWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPS  1462
                 R+  +       +E   I    + NPF   N    G  +        A +  +   
Sbjct  966   FSGSRQAADPGNKIGHTEAIHISNEQNTNPFLQENYPDDGGKLQ-------AADGSQQQH  1018

Query  1463  FMQLPASSPYDNFLKAAG  1516
              ++LPASSPYDNFLKAAG
Sbjct  1019  LLKLPASSPYDNFLKAAG  1036



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   277 bits (708),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 203/530 (38%), Positives = 293/530 (55%), Gaps = 43/530 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
               KAFPEALFHQ+LLAM  PD+ETR+GAH +FS VL+P  V P        L+K  S+  
Sbjct  487   HKKAFPEALFHQLLLAMAHPDHETRVGAHHIFSAVLMPQLVYP-----CSDLNKSTSVDL  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
             +  ++   FS      D++     +  +G +Q + + L R T   S S   +P S +   
Sbjct  542   SQVKS-GRFSMQGEGQDEVDYKDEALSEGGEQLSVD-LKRHTVCPSLS---QPHSFKLSP  596

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
             +    +   E  SL++ S Q+ +LLSSI+VQA S  NTPE+FEA++HTYSL +LFS++K 
Sbjct  597   SFTITKGKEEPTSLRLSSHQVGLLLSSIWVQATSAENTPENFEAMSHTYSLALLFSQSKT  656

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SSH +L+R FQLAFSLRSISL ++  + PSRRRSLF LA+SM+IF +K  +   L    K
Sbjct  657   SSHVALVRCFQLAFSLRSISLEQEGGLQPSRRRSLFTLASSMLIFSAKAGNLPQLVPLVK  716

Query  722   ALLTDKTMDPFLQLVDECHLKVNP-NPKARASYGSKEDDEAAKRSLSGIEISKKQSTESF  898
             A LTD T+DP+L LV++  L  +  +      YGS+ED+ AA +SLS IE    +  E+ 
Sbjct  717   ATLTDDTVDPYLHLVEDTSLVADGISANQTIMYGSQEDEVAALKSLSAIEADDGRLKETI  776

Query  899   ASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDE  1066
              S +V++  K   D+ + IK+QLL+ F PD+ CP+G     +         Q D +  DE
Sbjct  777   LSHLVKTFDKLSEDELSAIKKQLLEGFSPDDACPLGVPLFMETPQPCSPLAQIDFQAFDE  836

Query  1067  VVDPTFTVDDLG---SHSDPNAHPDS----TPNLLDVNEFLDSVLETSNQVGRQSAAPPA  1225
             ++ P    D+     +    + H  S    T ++L VN+ L+SVLET+    R+ A+ P 
Sbjct  837   IIPPAALTDEEAFPEASGSQSGHKTSVSVNTFDILSVNQLLESVLETA----REVASLPV  892

Query  1226  GMT---FMDVASQCEAFQEGKGNRMN-FREDGNDEPDFNFSEETIWQPPSGNPFAD----  1381
               T   +  + +QCEA   GK  +M+      N + D     E   + P+   F+D    
Sbjct  893   STTPIPYDQMKNQCEALVIGKQKKMSVLLSFKNQQEDMGIGAEVEKKGPT---FSDMKME  949

Query  1382  ----NNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
                 + T  A + V       C +E ++H SF +LP SSPYD FLKAAG 
Sbjct  950   LPDVDLTPMALEKVQRQDKLCCLSEQEQH-SF-RLPPSSPYDKFLKAAGC  997



>gb|EEE57911.1| hypothetical protein OsJ_08605 [Oryza sativa Japonica Group]
Length=902

 Score =   274 bits (701),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 199/542 (37%), Positives = 283/542 (52%), Gaps = 93/542 (17%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q+KAFPEALFHQ+LLAMV PD                    C  Q    G       I+R
Sbjct  416   QSKAFPEALFHQLLLAMVYPD--------------------CSSQTSKIG-------IKR  448

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-------------------NRL  304
             TLSRT SVFSSSAALF KL ++  S ++    +  N++                     +
Sbjct  449   TLSRTTSVFSSSAALFGKLKRDVFSFRENSRLDGTNLIPISENSDQINGNDPKLFKSQTI  508

Query  305   TSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
                YS   S    S E  N     QE  + ++L +  RQ  +LLSS++ QA+S  N P +
Sbjct  509   QRMYSAKDSFVTSSSEISNLSGTTQET-DPVTLMLSGRQAILLLSSLWTQALSPENVPRN  567

Query  485   FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
             +EAI+HTY L++LFS  KKS  E L+  FQLAFSL+SISL +   +PPSRRRSLF +ATS
Sbjct  568   YEAISHTYCLMLLFSEDKKSCLEVLVGSFQLAFSLQSISL-QAGFLPPSRRRSLFTMATS  626

Query  665   MIIFLSKTY---SFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDD  835
             M++F SK +   S IPL    K LLT   +DPFL+LV++C L+V  +      YGSK+DD
Sbjct  627   MLVFFSKAFGIPSLIPL---VKDLLTTSIVDPFLRLVEDCKLQVVES--CLTVYGSKDDD  681

Query  836   EAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGT--  1009
             + A +SLS I I+  QS ++  S+I++SLK     + + I++QLL++F  D+ CP+G+  
Sbjct  682   DLALKSLSNININ-DQSKQASVSLILDSLKDLSEAELSTIRKQLLEEFSADDACPLGSHS  740

Query  1010  -QRINDLRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAHPDSTPNLLDVNEFL  1168
              +  +    +N    + + EV+   F  +D        S ++P         L+DVN+ L
Sbjct  741   NESTSQSPAYNAKLHQKSLEVIPVGFIFEDDTLVEPANSLAEPQLQQPLDNGLIDVNQLL  800

Query  1169  DSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNF------REDGNDEPDFN  1330
             +SV+ETS  VGR S +    + F +VA++CEA   GK  +++       ++DG    D  
Sbjct  801   ESVVETSRHVGRLSVSTNLDLPFKEVANRCEALLIGKQQKLSVCMSVHQKQDGESPMDKL  860

Query  1331  FSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKA  1510
              S + I  P +G  F   N                  + Q H  F +LP  SPYD FL  
Sbjct  861   GSPQQI-SPTAG--FVSTN------------------DEQCHSDFCKLPVLSPYDKFLAG  899

Query  1511  AG  1516
             +G
Sbjct  900   SG  901



>gb|EMT12879.1| hypothetical protein F775_15212 [Aegilops tauschii]
Length=940

 Score =   274 bits (701),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 206/544 (38%), Positives = 304/544 (56%), Gaps = 61/544 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             ++KAFPEALFHQ+++AMV PD ET LGAH++FSVVLVPSSV P    +G + + + ++Q+
Sbjct  418   KSKAFPEALFHQLIMAMVYPDCETHLGAHQIFSVVLVPSSVAPCSF-SGTSQTSKVNLQK  476

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTS----------------T  313
             TLSRT SVFSSSAALF KL +N SS +    + + N++  +T                 T
Sbjct  477   TLSRTSSVFSSSAALFGKLKRNVSSFRGSPRRESSNLMPIITEDTEQGSANEPQLFKSQT  536

Query  314   YSRSLSVK----PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPE  481
               R  SV+    P + E  +    P    E + L + +RQ ++LLSS++ QA+S  N P 
Sbjct  537   IQRMTSVRDPSLPSATEI-SKSSGPAPETEPVILILSARQANILLSSLWTQALSPENVPR  595

Query  482   HFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALAT  661
             ++EAI+HTYSL++LFS  K S  E L+  FQL+FSLR++SL +   +PPSRRRSLF LAT
Sbjct  596   NYEAISHTYSLMLLFSGDKNSHLEILVGSFQLSFSLRNMSL-QAGFLPPSRRRSLFTLAT  654

Query  662   SMIIFLSKTYSFIPLAVSAKALLTDKT-----------MDPFLQLVDECHLKV--NPNPK  802
             SMI+F SK +S   L    K LL + T           +DPFL+LVD+  L+   +    
Sbjct  655   SMIVFFSKAFSVPTLIPVVKDLLIESTFVLIFDNYVYQVDPFLRLVDDLRLQALDSGIES  714

Query  803   ARASYGSKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFL  982
                 YGSKED++ A +SLS I+++  QS +   S+I+++LK S   + + ++ QL +DF 
Sbjct  715   VFRDYGSKEDNDFATKSLSNIKLN-DQSKQIAVSLILDNLKLS-DPELSTVRNQLFEDFS  772

Query  983   PDEVCPMGTQRINDLRN---HNQSDDKTNDEVVDPTFTVDD--LGSHSDPNAHPDSTPN-  1144
              ++VCP+G+  I        +N    + + EV+   F  +D  +   +D  A    + N 
Sbjct  773   AEDVCPIGSHFIASPSKSPAYNAKLHQKSLEVIPMGFIFEDDTIPEPTDTLAERQPSDNS  832

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPD  1324
             LLDV++ L SV ETS  VGR S +   G+ F +VASQCEA   GK  +++          
Sbjct  833   LLDVDQLLQSVSETSQIVGRLSVSTNQGLPFKEVASQCEALLIGKEKKLS----------  882

Query  1325  FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFL  1504
               F    + +  +G P +    +     +       C      + +F +LP  +PYD FL
Sbjct  883   -AFMSAHLQEVGTGMPKSSEPDSPIAGIILNTDDDQC------YSNFCKLPVLNPYDKFL  935

Query  1505  KAAG  1516
              +AG
Sbjct  936   PSAG  939



>ref|XP_002308951.2| cyclin-related family protein [Populus trichocarpa]
 gb|EEE92474.2| cyclin-related family protein [Populus trichocarpa]
Length=901

 Score =   273 bits (698),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 170/414 (41%), Positives = 235/414 (57%), Gaps = 64/414 (15%)
 Frame = +2

Query  332   VKPGSEETPNNGENPQ------EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEA  493
             +K  + E P N  N +      +  E  SL++ SRQIS+LLSSI+ Q+IS  NTP+++EA
Sbjct  534   LKSSTNENPVNILNKETSSIWVKFQEVGSLRLSSRQISLLLSSIWTQSISPANTPQNYEA  593

Query  494   IAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMII  673
             IAHTYSL++LFSRTK SS E+LIR FQLAFSLR+I+L ++  + PSRRRSLF LATSMI+
Sbjct  594   IAHTYSLVLLFSRTKNSSDEALIRSFQLAFSLRNIALKQEESLSPSRRRSLFTLATSMIL  653

Query  674   FLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARAS--YGSKEDDEAAK  847
             F SK ++ IPL    K +LT+K +DP+L+LV++  L+         +  YGSK+DD +A 
Sbjct  654   FSSKAFNIIPLIYCTKVVLTEKMVDPYLRLVEDRKLEAVATDSGHPAIVYGSKDDDSSAL  713

Query  848   RSLSGI--EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIN  1021
             +SLS I  E+S K                         +E+LL +FLPD+VCP+G Q   
Sbjct  714   KSLSEIDSEVSAK-------------------------REKLLDEFLPDDVCPLGAQLFM  748

Query  1022  DLRNHNQSDDKTNDEVVD--PTFTVDDL------GSHSDPNAHPDSTPNLLDVNEFLDSV  1177
             D  N     D  ++ +V+  P FTVDD+      G  +          NLL VN+ L+SV
Sbjct  749   DTPNQIDQVDSKDNSLVEGTPLFTVDDVFLDSLEGQTTQTTEIVFQATNLLSVNQLLESV  808

Query  1178  LETSNQVGRQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPDFNFSEETIWQP  1357
             LET++QVGR S   P  +++ ++A  CE  Q GK  +M      +        +E++   
Sbjct  809   LETTHQVGRLSVTAP-DVSYKEMAHHCETLQMGKQQKM------SHVMSVQLRQESLMNV  861

Query  1358  PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
             P    + D                 CAT YQ  P+F +LPASSP+DNFLKAAG 
Sbjct  862   P-FQKYDDK-------------ARKCATVYQHQPNFFRLPASSPFDNFLKAAGC  901



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   272 bits (696),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 203/531 (38%), Positives = 293/531 (55%), Gaps = 44/531 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
               KAFPEALFHQ+LLAM  PD+ETR+GAH +FS VL+P  V P        L+K  S+  
Sbjct  487   HKKAFPEALFHQLLLAMAHPDHETRVGAHHIFSAVLMPQLVYP-----CSDLNKSTSVDL  541

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
             +  ++   FS      D++     +  +G +Q + + L R T   S S   +P S +   
Sbjct  542   SQVKS-GRFSMQGEGQDEVDYKDEALSEGGEQLSVD-LKRHTVCPSLS---QPHSFKLSP  596

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
             +    +   E  SL++ S Q+ +LLSSI+VQA S  NTPE+FEA++HTYSL +LFS++K 
Sbjct  597   SFTITKGKEEPTSLRLSSHQVGLLLSSIWVQATSAENTPENFEAMSHTYSLALLFSQSKT  656

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SSH +L+R FQLAFSLRSISL ++  + PSRRRSLF LA+SM+IF +K  +   L    K
Sbjct  657   SSHVALVRCFQLAFSLRSISLEQEGGLQPSRRRSLFTLASSMLIFSAKAGNLPQLVPLVK  716

Query  722   ALLTDKTMDPFLQLVDECHLKVNP-NPKARASYGSKEDDEAAKRSLSGIEISKKQSTESF  898
             A LTD T+DP+L LV++  L  +  +      YGS+ED+ AA +SLS IE    +  E+ 
Sbjct  717   ATLTDDTVDPYLHLVEDTSLVADGISANQTIMYGSQEDEVAALKSLSAIEADDGRLKETI  776

Query  899   ASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDE  1066
              S +V++  K   D+ + IK+QLL+ F PD+ CP+G     +         Q D +  DE
Sbjct  777   LSHLVKTFDKLSEDELSAIKKQLLEGFSPDDACPLGVPLFMETPQPCSPLAQIDFQAFDE  836

Query  1067  VVDPTFTVDDLG---SHSDPNAHPDS----TPNLLDVNEFLDS-VLETSNQVGRQSAAPP  1222
             ++ P    D+     +    + H  S    T ++L VN+ L+S VLET+    R+ A+ P
Sbjct  837   IIPPAALTDEEAFPEASGSQSGHKTSVSVNTFDILSVNQLLESQVLETA----REVASLP  892

Query  1223  AGMT---FMDVASQCEAFQEGKGNRMN-FREDGNDEPDFNFSEETIWQPPSGNPFAD---  1381
                T   +  + +QCEA   GK  +M+      N + D     E   + P+   F+D   
Sbjct  893   VSTTPIPYDQMKNQCEALVIGKQKKMSVLLSFKNQQEDMGIGAEVEKKGPT---FSDMKM  949

Query  1382  -----NNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
                  + T  A + V       C +E ++H SF +LP SSPYD FLKAAG 
Sbjct  950   ELPDVDLTPMALEKVQRQDKLCCLSEQEQH-SF-RLPPSSPYDKFLKAAGC  998



>ref|XP_008790620.1| PREDICTED: uncharacterized protein LOC103707766 isoform X3 [Phoenix 
dactylifera]
Length=1018

 Score =   271 bits (694),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 197/551 (36%), Positives = 286/551 (52%), Gaps = 67/551 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             + KAFPEALFHQ+LLAM  PD+ETR+G+HRVFS +L PS +CP          K    Q 
Sbjct  490   RKKAFPEALFHQLLLAMAHPDHETRVGSHRVFSAILGPSIICPWLISCIPVTLKGYDPQG  549

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ--------------NTQNM---LNRLTS  310
             TL   +S F SS A+  KLGK  +   + +++                Q M   +++ T 
Sbjct  550   TLLVALSGFCSSRAILQKLGKETTVKNERLEKMGKMNAAVERTLKDRYQQMNADISQCTV  609

Query  311   ----------TYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAI  460
                        +S SLS+  G   T    E P        +++++ Q+ +LLSSI+ QA 
Sbjct  610   YPSQNDPHSINFSPSLSLSNGRAVTKTRQEEPT------FMRLRNHQVGLLLSSIWAQAT  663

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
             S  N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  + ++ PSRRR
Sbjct  664   SQYNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHENRLQPSRRR  723

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYG  820
             SL  LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+   +P  +A YG
Sbjct  724   SLCTLASSMLLFSAKACDLAVLVPSMKATITEKMVDPHLHLIDDSRLQ--ESPINKAVYG  781

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             S+ED+ AA + L  IE   KQ  E+  S +++  +    +K   IKEQLLQ+F PD+  P
Sbjct  782   SEEDEVAALKFLVVIENDDKQLKETVISHLLKKFENLPEEKLMDIKEQLLQEFSPDDAFP  841

Query  1001  MGTQRINDL--------RNHNQSDDKTNDEVV---DPTFTVDDLGSHSD-PNAHPDSTPN  1144
             +G     +         +   QS D  ND      +    +D  GS SD   +   +  +
Sbjct  842   LGGPLFMETPHPCSPFEQWECQSFDMVNDASALSDEENLLLDTCGSQSDRKTSESINAYD  901

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRM----NFRED  1306
             +L VN+ ++SVLET+ QV   +  P     + +  +  QCEA   GK  +M    +F+  
Sbjct  902   VLSVNQLIESVLETARQV---TIVPVTSTPVPYDQMKRQCEALVMGKQQKMSVLQSFKHQ  958

Query  1307  GNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
                  D    E  +   P G    +  +    Q     + +S + E  R      LP SS
Sbjct  959   QEGSKDL-IEENELVHYPEG----ETKSIGKEQIWGGDSASSGSKESLR------LPPSS  1007

Query  1487  PYDNFLKAAGS  1519
             PYD FLKAAGS
Sbjct  1008  PYDKFLKAAGS  1018



>ref|XP_010650558.1| PREDICTED: uncharacterized protein LOC100264644 isoform X2 [Vitis 
vinifera]
Length=892

 Score =   270 bits (690),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 196/535 (37%), Positives = 292/535 (55%), Gaps = 56/535 (10%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPR------QAPAGGALSKRK  169
             KAFPEALFHQ+LLAM  PD+ETR+GAH VFS VL+PS  CP        + A    S   
Sbjct  381   KAFPEALFHQLLLAMAHPDHETRVGAHHVFSTVLMPSLACPWVDQNGISSEAFSGFSAVN  440

Query  170   SIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----NRLTSTYSRSLSV  334
             ++Q+  S++ S+         ++GKN +   DG  +  ++ +     + L+ +Y++S S 
Sbjct  441   TLQKVSSQSFSI---------QVGKNDTESTDGELREERSQIADVKQSTLSPSYAQSYSF  491

Query  335   KPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSL  514
             K        +G+      E  SL++ S Q+S+LLSSI+VQA S  NTP +FEA+AHTY++
Sbjct  492   K----HAMTDGK-----MEYTSLRLSSHQVSLLLSSIWVQATSPENTPANFEAMAHTYNI  542

Query  515   LMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYS  694
              +LF+R+K SSH +L+R FQLAFSLRSISL ++  +  SRRRSLF LA+ M+IF ++  +
Sbjct  543   ALLFTRSKTSSHVALVRCFQLAFSLRSISLDQEGGLHASRRRSLFTLASYMLIFSARAGN  602

Query  695   FIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGIEI  871
                L    KA LT+  +DP+L+LV +  LK V      +  YGS++D+ +A +SLS IE+
Sbjct  603   LPELIPIVKASLTETIVDPYLELVKDIRLKAVCIESNEKVVYGSQQDELSALKSLSAIEL  662

Query  872   SKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHN  1039
               +Q  E+  S  +    K   D+ + +K+QLLQ F PD+  P G     +         
Sbjct  663   DDRQLKETVISHFMTKYGKLSEDELSGMKKQLLQGFSPDDAYPFGAPLFMETPRPCSPLA  722

Query  1040  QSDDKTNDEVVDPTFTVDDL------GSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQV  1198
             Q + +   E + P    D+       GS SD   +   +T ++L VN+ L+SVLET+   
Sbjct  723   QIEFQPFREAIAPDALTDEEAFPEIDGSQSDRKTSLSINTLDILSVNQLLESVLETA---  779

Query  1199  GRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNF-----REDGNDEPDFNFSEETIWQ  1354
              RQ A+ P   T   +  + SQCEA   GK  +M+      ++D      +  +E++I  
Sbjct  780   -RQVASFPVSSTPIPYDQMKSQCEALVTGKQQKMSVLQSFKQQDTKAIVVYGENEQSIPS  838

Query  1355  PPSGNPFADN-NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               S +   D+                 C+ EY +  SF +LP SSPYD F+KAAG
Sbjct  839   TKSLDFLEDDLKLVNKEHVRGRDQLLLCSHEYGQQ-SF-RLPPSSPYDKFMKAAG  891



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   270 bits (689),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 196/537 (36%), Positives = 292/537 (54%), Gaps = 56/537 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPR------QAPAGGALSK  163
               KAFPEALFHQ+LLAM  PD+ETR+GAH VFS VL+PS  CP        + A    S 
Sbjct  487   HKKAFPEALFHQLLLAMAHPDHETRVGAHHVFSTVLMPSLACPWVDQNGISSEAFSGFSA  546

Query  164   RKSIQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----NRLTSTYSRSL  328
               ++Q+  S++ S+         ++GKN +   DG  +  ++ +     + L+ +Y++S 
Sbjct  547   VNTLQKVSSQSFSI---------QVGKNDTESTDGELREERSQIADVKQSTLSPSYAQSY  597

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             S K        +G+      E  SL++ S Q+S+LLSSI+VQA S  NTP +FEA+AHTY
Sbjct  598   SFK----HAMTDGK-----MEYTSLRLSSHQVSLLLSSIWVQATSPENTPANFEAMAHTY  648

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             ++ +LF+R+K SSH +L+R FQLAFSLRSISL ++  +  SRRRSLF LA+ M+IF ++ 
Sbjct  649   NIALLFTRSKTSSHVALVRCFQLAFSLRSISLDQEGGLHASRRRSLFTLASYMLIFSARA  708

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNPKARASYGSKEDDEAAKRSLSGI  865
              +   L    KA LT+  +DP+L+LV +  LK V      +  YGS++D+ +A +SLS I
Sbjct  709   GNLPELIPIVKASLTETIVDPYLELVKDIRLKAVCIESNEKVVYGSQQDELSALKSLSAI  768

Query  866   EISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRN  1033
             E+  +Q  E+  S  +    K   D+ + +K+QLLQ F PD+  P G     +       
Sbjct  769   ELDDRQLKETVISHFMTKYGKLSEDELSGMKKQLLQGFSPDDAYPFGAPLFMETPRPCSP  828

Query  1034  HNQSDDKTNDEVVDPTFTVDDL------GSHSD-PNAHPDSTPNLLDVNEFLDSVLETSN  1192
               Q + +   E + P    D+       GS SD   +   +T ++L VN+ L+SVLET+ 
Sbjct  829   LAQIEFQPFREAIAPDALTDEEAFPEIDGSQSDRKTSLSINTLDILSVNQLLESVLETA-  887

Query  1193  QVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNF-----REDGNDEPDFNFSEETI  1348
                RQ A+ P   T   +  + SQCEA   GK  +M+      ++D      +  +E++I
Sbjct  888   ---RQVASFPVSSTPIPYDQMKSQCEALVTGKQQKMSVLQSFKQQDTKAIVVYGENEQSI  944

Query  1349  WQPPSGNPFADN-NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                 S +   D+                 C+ EY +  SF +LP SSPYD F+KAAG
Sbjct  945   PSTKSLDFLEDDLKLVNKEHVRGRDQLLLCSHEYGQQ-SF-RLPPSSPYDKFMKAAG  999



>ref|XP_008790621.1| PREDICTED: uncharacterized protein LOC103707766 isoform X4 [Phoenix 
dactylifera]
Length=913

 Score =   268 bits (685),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 197/558 (35%), Positives = 286/558 (51%), Gaps = 73/558 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             + KAFPEALFHQ+LLAM  PD+ETR+G+HRVFS +L PS +CP          K    Q 
Sbjct  377   RKKAFPEALFHQLLLAMAHPDHETRVGSHRVFSAILGPSIICPWLISCIPVTLKGYDPQG  436

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ--------------NTQNM---LNRLTS  310
             TL   +S F SS A+  KLGK  +   + +++                Q M   +++ T 
Sbjct  437   TLLVALSGFCSSRAILQKLGKETTVKNERLEKMGKMNAAVERTLKDRYQQMNADISQCTV  496

Query  311   ----------TYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAI  460
                        +S SLS+  G   T    E P        +++++ Q+ +LLSSI+ QA 
Sbjct  497   YPSQNDPHSINFSPSLSLSNGRAVTKTRQEEPT------FMRLRNHQVGLLLSSIWAQAT  550

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
             S  N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  + ++ PSRRR
Sbjct  551   SQYNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHENRLQPSRRR  610

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYG  820
             SL  LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+   +P  +A YG
Sbjct  611   SLCTLASSMLLFSAKACDLAVLVPSMKATITEKMVDPHLHLIDDSRLQ--ESPINKAVYG  668

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             S+ED+ AA + L  IE   KQ  E+  S +++  +    +K   IKEQLLQ+F PD+  P
Sbjct  669   SEEDEVAALKFLVVIENDDKQLKETVISHLLKKFENLPEEKLMDIKEQLLQEFSPDDAFP  728

Query  1001  MGTQRINDL--------RNHNQSDDKTNDEVV---DPTFTVDDLGSHSD-PNAHPDSTPN  1144
             +G     +         +   QS D  ND      +    +D  GS SD   +   +  +
Sbjct  729   LGGPLFMETPHPCSPFEQWECQSFDMVNDASALSDEENLLLDTCGSQSDRKTSESINAYD  788

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRM----NFRED  1306
             +L VN+ ++SVLET+ QV   +  P     + +  +  QCEA   GK  +M    +F+  
Sbjct  789   VLSVNQLIESVLETARQV---TIVPVTSTPVPYDQMKRQCEALVMGKQQKMSVLQSFKHQ  845

Query  1307  GNDEPDFNFSEET-------IWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF  1465
                  D     E        +   P G    +  +    Q     + +S + E  R    
Sbjct  846   QEGSKDLIEENEVNSLDSYKLVHYPEG----ETKSIGKEQIWGGDSASSGSKESLR----  897

Query  1466  MQLPASSPYDNFLKAAGS  1519
               LP SSPYD FLKAAGS
Sbjct  898   --LPPSSPYDKFLKAAGS  913



>gb|KDP42800.1| hypothetical protein JCGZ_23742 [Jatropha curcas]
Length=982

 Score =   268 bits (686),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 195/536 (36%), Positives = 294/536 (55%), Gaps = 65/536 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVC----PRQAPAGGALSKRKSI  175
             KAFP+ALFHQ+L+AM  PD+ETR+GAH V SVVL+PS +       Q  +    S   +I
Sbjct  478   KAFPDALFHQLLIAMTHPDHETRVGAHSVLSVVLMPSLLSLWSDENQKTSYAISSLLSAI  537

Query  176   QRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEET  355
              +T S + S        F + GK+++   DG  Q+  + ++R+            G  +T
Sbjct  538   HKTNSGSFS--------FQEEGKDKAEAIDGGSQDEDSGVSRVGRKEFGKSDTTDGKTQT  589

Query  356   PNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRT  535
                           SL++ S QIS+LLSSI+VQA S  N P +FEA+AHTY++ +LF+R 
Sbjct  590   --------------SLRLSSHQISLLLSSIWVQATSTENMPANFEAMAHTYNIALLFTRA  635

Query  536   KKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVS  715
             K S+H +L+R FQLAFSLRSISL ++  +PPSRRRSLF LA+ MIIF ++  +   L   
Sbjct  636   KASNHLALVRCFQLAFSLRSISLDQERGLPPSRRRSLFMLASYMIIFSARAGNLPELIPI  695

Query  716   AKALLTDKTMDPFLQLVDECHLKVN--PNPKARASYGSKEDDEAAKRSLSGIEISKKQST  889
              KA LT+KT DP+L+ V++  L+     +   +  YGS+EDD AA +SLS +E++     
Sbjct  696   VKASLTEKTADPYLESVEDIRLQAAHLVSDGGKKIYGSEEDDIAASKSLSAVELNDHHLK  755

Query  890   ESFASMIVESLKKSIT-DKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQ----SDDK  1054
             E+  +  ++   K++T D+ + IK QLLQ+FLPD+  P+G     +    +      + +
Sbjct  756   ETAVTQFIKKFAKNLTEDELSSIKSQLLQEFLPDDAYPLGAPLFMETPRPSSPLALVEFR  815

Query  1055  TNDEVV-------DPTFTVDDLGSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVG-RQ  1207
               +E++       D TFT  + GS SD   +   +  ++L VN+ L+SVLET+ QV   Q
Sbjct  816   AFEEIIPAASLTDDETFTDANNGSQSDRKTSLSGNVVDILSVNDLLESVLETARQVASSQ  875

Query  1208  SAAPPAGMTFMDVASQCEAFQEGKGNRMNFRE---DGNDEPDF----------NFSEETI  1348
              ++ P  + +  + +QCEA   GK  +M+  +   + ND   F           F +  +
Sbjct  876   LSSTP--VPYDQMKNQCEALVTGKQQKMSMLQSFKNQNDSKVFPSEDEKKGTSAFIQNEV  933

Query  1349  WQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +   S    +DNN   A   +       C+ E+ +  S  +LP SSPYD FLKAAG
Sbjct  934   FS-QSDLILSDNNQVQASDQLAI-----CSVEHGQ--SSFRLPPSSPYDKFLKAAG  981



>ref|XP_010907682.1| PREDICTED: uncharacterized protein LOC105034293 isoform X2 [Elaeis 
guineensis]
Length=1021

 Score =   268 bits (686),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 195/552 (35%), Positives = 286/552 (52%), Gaps = 65/552 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFPEALFHQ+LLAM   D+ETR+G+HRVFS +L PS +CP          K    Q TL
Sbjct  487   KAFPEALFHQLLLAMAHRDHETRVGSHRVFSAILGPSIICPWSISCIPVTLKGYDPQGTL  546

Query  188   SRTVSVFSSSAALFDKLGKN------------------QSSGKDGMDQNTQNML------  295
                +S FSSS A+ +KLGK                   + + KDG  Q   ++       
Sbjct  547   LVALSGFSSSRAILEKLGKESTDKNECLEKMEKINAALEGTLKDGYQQLNADISQCTVYP  606

Query  296   ---NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISH  466
                +  +  +S SLS+  G   T +  E      E   +++ + ++ +LLSSI+ QA S 
Sbjct  607   FQSDPYSINFSPSLSLSNGRAVTKSRQE------ELTFMRLSNHEVGLLLSSIWAQATSQ  660

Query  467   LNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSL  646
              N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  ++ + PSRRRSL
Sbjct  661   YNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHESCLQPSRRRSL  720

Query  647   FALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSK  826
             ++LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+ +P  K  A YGS+
Sbjct  721   YSLASSMLLFSAKACGLPVLVPSMKATITEKLVDPHLHLIDDSRLQESPGNK--AVYGSE  778

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             ED+ AA + L  +E   KQ  E+  S +++  +K   +K   IKEQLLQ+F PD+  P+G
Sbjct  779   EDEIAALKFLGVVEYDDKQLKETVISHLLKKFEKLPEEKLMDIKEQLLQEFSPDDAFPLG  838

Query  1007  TQRINDL--------RNHNQSDDKTNDE---VVDPTFTVDDLGSHSD-PNAHPDSTPNLL  1150
                  +         +   QS D  ND      D    +D  GS SD   +      ++L
Sbjct  839   GPLFMETPHPCSPLEQMECQSFDMVNDAPGLSDDENLPLDTCGSQSDRKTSESVHACDIL  898

Query  1151  DVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRMNFREDGNDEPD  1324
              VN+ ++SV+ET+ QV   +  P A   + +  +  QCEA   GK  +M+  +       
Sbjct  899   SVNQLIESVVETARQV---TTLPVASNPVPYDQMKRQCEALVMGKQQKMSVLQ------S  949

Query  1325  FNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF-------MQLPAS  1483
             F   +E +      N     +        N    +    + +R  S         +LP S
Sbjct  950   FKHQQEGLKDQIEENEVNSWDCYQLVHCPNEETRSIGKEQIRRCDSVSSGSEQSFRLPPS  1009

Query  1484  SPYDNFLKAAGS  1519
             SPYD FL+AAGS
Sbjct  1010  SPYDKFLQAAGS  1021



>ref|XP_011026408.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026409.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026410.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
Length=988

 Score =   268 bits (684),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 196/532 (37%), Positives = 288/532 (54%), Gaps = 47/532 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+L+AM  PD+ETR+GAH VFS++L+PS            LS      +
Sbjct  476   HNKAFPDALFHQLLVAMAHPDHETRVGAHSVFSILLMPS-----------LLSPWSDQNK  524

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               S  VS F  S+A      + +S      D++  N+ +    ++     V   S +  +
Sbjct  525   KTSEAVSGFFGSSA-----SQKRSKSFSFQDESNDNVDSMDGQSWEEGNPVSDNSGKHDS  579

Query  362   NGENPQEHHEGL------SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
             +  +    H  +      SL++ S Q+S+LLSSI+VQA S  N P +FEA+ HTY++ +L
Sbjct  580   HDRSNSFKHAVVDGKTLTSLRLSSHQVSLLLSSIWVQATSAENMPANFEAMGHTYNIALL  639

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             F+R+K SSH +L+R FQLAFSLRSISL ++A + PSRRRSLF LAT M+IF ++  +   
Sbjct  640   FTRSKTSSHVALVRCFQLAFSLRSISLDQEAGLQPSRRRSLFTLATFMLIFAARAGNLPE  699

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    K  LT+KT DP+L+LV++  L+     + + + +YGS++DD AA +SLS +E+  
Sbjct  700   LIPFVKVFLTEKTADPYLELVEDIKLQAIYVESDEGKIAYGSEDDDVAALKSLSCVEVDD  759

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL--------RN  1033
                 E+  S  +    K   D+ + IK+QLLQDF PD+V P+G     D         R 
Sbjct  760   SHLKETLISRFMTKFVKLSEDELSGIKQQLLQDFSPDDVYPLGAPLFMDTPRPCSPLARM  819

Query  1034  HNQSDDK---TNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVG-  1201
               Q+ ++     D   D TFT  +        +    T ++L VNE L+SVLET+ QV  
Sbjct  820   EFQAFEEIMPAADLTDDETFTELNGSQSGRKTSISVHTLDILSVNELLESVLETARQVAS  879

Query  1202  RQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPD---FNFSEE----TIWQPP  1360
              Q ++ P  + +  + SQCEA   GK  +M+       +P+   F  ++E    ++    
Sbjct  880   SQVSSTP--VPYDQMKSQCEALVTGKQQKMSILHSFKHQPEAKVFPSTDEKKDTSVHDVK  937

Query  1361  SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                P  D   A   Q       A C+ EY ++ SF +LP SSPYD FLKAAG
Sbjct  938   VELPQCDLTLATKDQIRAPDQLALCSLEYGQN-SF-RLPPSSPYDKFLKAAG  987



>ref|XP_008790619.1| PREDICTED: uncharacterized protein LOC103707766 isoform X2 [Phoenix 
dactylifera]
Length=1021

 Score =   267 bits (683),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 197/558 (35%), Positives = 286/558 (51%), Gaps = 73/558 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             + KAFPEALFHQ+LLAM  PD+ETR+G+HRVFS +L PS +CP          K    Q 
Sbjct  485   RKKAFPEALFHQLLLAMAHPDHETRVGSHRVFSAILGPSIICPWLISCIPVTLKGYDPQG  544

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ--------------NTQNM---LNRLTS  310
             TL   +S F SS A+  KLGK  +   + +++                Q M   +++ T 
Sbjct  545   TLLVALSGFCSSRAILQKLGKETTVKNERLEKMGKMNAAVERTLKDRYQQMNADISQCTV  604

Query  311   ----------TYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAI  460
                        +S SLS+  G   T    E P        +++++ Q+ +LLSSI+ QA 
Sbjct  605   YPSQNDPHSINFSPSLSLSNGRAVTKTRQEEPT------FMRLRNHQVGLLLSSIWAQAT  658

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
             S  N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  + ++ PSRRR
Sbjct  659   SQYNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHENRLQPSRRR  718

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYG  820
             SL  LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+   +P  +A YG
Sbjct  719   SLCTLASSMLLFSAKACDLAVLVPSMKATITEKMVDPHLHLIDDSRLQ--ESPINKAVYG  776

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             S+ED+ AA + L  IE   KQ  E+  S +++  +    +K   IKEQLLQ+F PD+  P
Sbjct  777   SEEDEVAALKFLVVIENDDKQLKETVISHLLKKFENLPEEKLMDIKEQLLQEFSPDDAFP  836

Query  1001  MGTQRINDL--------RNHNQSDDKTNDEVV---DPTFTVDDLGSHSD-PNAHPDSTPN  1144
             +G     +         +   QS D  ND      +    +D  GS SD   +   +  +
Sbjct  837   LGGPLFMETPHPCSPFEQWECQSFDMVNDASALSDEENLLLDTCGSQSDRKTSESINAYD  896

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRM----NFRED  1306
             +L VN+ ++SVLET+ QV   +  P     + +  +  QCEA   GK  +M    +F+  
Sbjct  897   VLSVNQLIESVLETARQV---TIVPVTSTPVPYDQMKRQCEALVMGKQQKMSVLQSFKHQ  953

Query  1307  GNDEPDFNFSEET-------IWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF  1465
                  D     E        +   P G    +  +    Q     + +S + E  R    
Sbjct  954   QEGSKDLIEENEVNSLDSYKLVHYPEG----ETKSIGKEQIWGGDSASSGSKESLR----  1005

Query  1466  MQLPASSPYDNFLKAAGS  1519
               LP SSPYD FLKAAGS
Sbjct  1006  --LPPSSPYDKFLKAAGS  1021



>ref|XP_008790616.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008790617.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008790618.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
Length=1026

 Score =   267 bits (683),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 197/558 (35%), Positives = 288/558 (52%), Gaps = 73/558 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             + KAFPEALFHQ+LLAM  PD+ETR+G+HRVFS +L PS +CP          K    Q 
Sbjct  490   RKKAFPEALFHQLLLAMAHPDHETRVGSHRVFSAILGPSIICPWLISCIPVTLKGYDPQG  549

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQ--------------NTQNM---LNRLTS  310
             TL   +S F SS A+  KLGK  +   + +++                Q M   +++ T 
Sbjct  550   TLLVALSGFCSSRAILQKLGKETTVKNERLEKMGKMNAAVERTLKDRYQQMNADISQCTV  609

Query  311   ----------TYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAI  460
                        +S SLS+  G   T    E P        +++++ Q+ +LLSSI+ QA 
Sbjct  610   YPSQNDPHSINFSPSLSLSNGRAVTKTRQEEPT------FMRLRNHQVGLLLSSIWAQAT  663

Query  461   SHLNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRR  640
             S  N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  + ++ PSRRR
Sbjct  664   SQYNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHENRLQPSRRR  723

Query  641   SLFALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYG  820
             SL  LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+   +P  +A YG
Sbjct  724   SLCTLASSMLLFSAKACDLAVLVPSMKATITEKMVDPHLHLIDDSRLQ--ESPINKAVYG  781

Query  821   SKEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCP  1000
             S+ED+ AA + L  IE   KQ  E+  S +++  +    +K   IKEQLLQ+F PD+  P
Sbjct  782   SEEDEVAALKFLVVIENDDKQLKETVISHLLKKFENLPEEKLMDIKEQLLQEFSPDDAFP  841

Query  1001  MGTQRINDL--------RNHNQSDDKTNDEVV---DPTFTVDDLGSHSD-PNAHPDSTPN  1144
             +G     +         +   QS D  ND      +    +D  GS SD   +   +  +
Sbjct  842   LGGPLFMETPHPCSPFEQWECQSFDMVNDASALSDEENLLLDTCGSQSDRKTSESINAYD  901

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRMNFRE-----  1303
             +L VN+ ++SVLET+ QV   +  P     + +  +  QCEA   GK  +M+  +     
Sbjct  902   VLSVNQLIESVLETARQV---TIVPVTSTPVPYDQMKRQCEALVMGKQQKMSVLQSFKHQ  958

Query  1304  -----DGNDEPDFN-FSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF  1465
                  D  +E + N      +   P G    +  +    Q     + +S + E  R    
Sbjct  959   QEGSKDLIEENEVNSLDSYKLVHYPEG----ETKSIGKEQIWGGDSASSGSKESLR----  1010

Query  1466  MQLPASSPYDNFLKAAGS  1519
               LP SSPYD FLKAAGS
Sbjct  1011  --LPPSSPYDKFLKAAGS  1026



>ref|XP_010672160.1| PREDICTED: uncharacterized protein LOC104888784 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=894

 Score =   266 bits (679),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 203/539 (38%), Positives = 290/539 (54%), Gaps = 63/539 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             K FP+ALFHQ+L+AM  PD ETR+ AH + S VL+PS +CP             S Q+ L
Sbjct  382   KTFPDALFHQLLIAMGHPDYETRICAHCILSTVLIPSLICPW------------SDQKEL  429

Query  188   SRTVSVFSSSAALFDKLGKNQSSGK-------------DGMDQNTQNMLNRLTSTYSRSL  328
             +   S+  SS  +F  L +N  SG+              G  + +Q   +   S   RS 
Sbjct  430   ASLNSLGQSS--IFSSLKEN--SGRFSIPEEDEETVQPTGTMEESQRWNDVKQSLVCRSH  485

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             S     +    NG+      E  SL++ S Q+S+LLSSI+VQAIS  NTP +FEA+AHTY
Sbjct  486   SKSYSFKSALTNGK-----MELSSLRLSSHQVSLLLSSIWVQAISRENTPSNFEAMAHTY  540

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             ++ +L +RTK SSH +L+R FQLAFSLRSISL ++  + PSRRRSLF +A+ M+IF ++ 
Sbjct  541   NIALLLTRTKTSSHMALVRCFQLAFSLRSISLDQEGGLQPSRRRSLFTMASCMLIFSARA  600

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSG  862
              S   L    K+ LTD T+DP+L+LVD   L+ V  NP      YGS EDD AA +SLS 
Sbjct  601   GSLPELIPIVKSSLTDITVDPYLELVDNIRLQAVIRNPVDGGKMYGSDEDDLAALKSLSA  660

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LR  1030
             +E  ++Q  E+  S ++   +K   D+ + IK+QLLQ F PDE  P+G     +      
Sbjct  661   MESDEQQLKETVISHLMSKFEKLSEDELSGIKKQLLQGFSPDESYPLGAPLFMETPQPCS  720

Query  1031  NHNQSDDKTNDEVVDPTF----TVDDLGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQ  1195
                Q D ++ DEV D T       D  GS S       S + ++L+VN+ L+SVLET+ Q
Sbjct  721   PLAQLDFQSFDEVEDTTLFDEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQ  780

Query  1196  VGRQSAAPPAG---MTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQ  1354
             V    A+ PA    +++  V  QCEA   GK  +M    +F++    +     S+ ++  
Sbjct  781   V----ASLPASTSLISYDQVKDQCEALVTGKHQKMSVLQSFKQQQEAKAIVLASDTSLKT  836

Query  1355  PP-SGNPFADN----NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +  P  ++    ++              C+ EY  + SF +LP +SPYD FLKAAG
Sbjct  837   AANTDTPMRESEPNLDSIGKELIQRHDHLYPCSLEY-GYQSF-RLPPASPYDKFLKAAG  893



>ref|XP_010907681.1| PREDICTED: uncharacterized protein LOC105034293 isoform X1 [Elaeis 
guineensis]
Length=1023

 Score =   266 bits (679),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 195/554 (35%), Positives = 286/554 (52%), Gaps = 67/554 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFPEALFHQ+LLAM   D+ETR+G+HRVFS +L PS +CP          K    Q TL
Sbjct  487   KAFPEALFHQLLLAMAHRDHETRVGSHRVFSAILGPSIICPWSISCIPVTLKGYDPQGTL  546

Query  188   SRTVSVFSSSAALFDKLGKN------------------QSSGKDGMDQNTQNML------  295
                +S FSSS A+ +KLGK                   + + KDG  Q   ++       
Sbjct  547   LVALSGFSSSRAILEKLGKESTDKNECLEKMEKINAALEGTLKDGYQQLNADISQCTVYP  606

Query  296   ---NRLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISH  466
                +  +  +S SLS+  G   T +  E      E   +++ + ++ +LLSSI+ QA S 
Sbjct  607   FQSDPYSINFSPSLSLSNGRAVTKSRQE------ELTFMRLSNHEVGLLLSSIWAQATSQ  660

Query  467   LNTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSL  646
              N P ++EA+AH+Y+L +LFS++K SSH +L+RGFQLAFSLR ISL  ++ + PSRRRSL
Sbjct  661   YNMPANYEAMAHSYNLALLFSQSKNSSHVALVRGFQLAFSLRRISLDHESCLQPSRRRSL  720

Query  647   FALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSK  826
             ++LA+SM++F +K      L  S KA +T+K +DP L L+D+  L+ +P  K  A YGS+
Sbjct  721   YSLASSMLLFSAKACGLPVLVPSMKATITEKLVDPHLHLIDDSRLQESPGNK--AVYGSE  778

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKK--SITDKTNLIKEQLLQDFLPDEVCP  1000
             ED+ AA + L  +E   KQ  E+  S +++  +K     +K   IKEQLLQ+F PD+  P
Sbjct  779   EDEIAALKFLGVVEYDDKQLKETVISHLLKKFEKLPEFQEKLMDIKEQLLQEFSPDDAFP  838

Query  1001  MGTQRINDL--------RNHNQSDDKTNDE---VVDPTFTVDDLGSHSD-PNAHPDSTPN  1144
             +G     +         +   QS D  ND      D    +D  GS SD   +      +
Sbjct  839   LGGPLFMETPHPCSPLEQMECQSFDMVNDAPGLSDDENLPLDTCGSQSDRKTSESVHACD  898

Query  1145  LLDVNEFLDSVLETSNQVGRQSAAPPAG--MTFMDVASQCEAFQEGKGNRMNFREDGNDE  1318
             +L VN+ ++SV+ET+ QV   +  P A   + +  +  QCEA   GK  +M+  +     
Sbjct  899   ILSVNQLIESVVETARQV---TTLPVASNPVPYDQMKRQCEALVMGKQQKMSVLQ-----  950

Query  1319  PDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF-------MQLP  1477
               F   +E +      N     +        N    +    + +R  S         +LP
Sbjct  951   -SFKHQQEGLKDQIEENEVNSWDCYQLVHCPNEETRSIGKEQIRRCDSVSSGSEQSFRLP  1009

Query  1478  ASSPYDNFLKAAGS  1519
              SSPYD FL+AAGS
Sbjct  1010  PSSPYDKFLQAAGS  1023



>gb|AFW70124.1| hypothetical protein ZEAMMB73_889435 [Zea mays]
Length=915

 Score =   264 bits (675),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 215/552 (39%), Positives = 305/552 (55%), Gaps = 57/552 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  373   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  432

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  433   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  492

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  493   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  552

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  553   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  612

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  613   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  672

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  673   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  732

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVN  1159
              +           +D  +++  + +  D   D    ++   +     A P  T NLL ++
Sbjct  733   FLESPGKIAPPCSDDDTDYDYQEAELIDLRNDNNTYLEASATTLAAIAIPVPTTNLLSID  792

Query  1160  EFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR----MNFREDGNDE-  1318
             E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++    M+F+++     
Sbjct  793   ELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFKQNKQAAM  852

Query  1319  ---PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
                PD   S           S NPF             +A  A  A + Q+   F++LP 
Sbjct  853   VVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVAGDVQQ--PFLRLPP  902

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  903   SSPYDNFLKAAG  914



>ref|XP_010672158.1| PREDICTED: uncharacterized protein LOC104888784 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1002

 Score =   265 bits (678),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 203/539 (38%), Positives = 290/539 (54%), Gaps = 63/539 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             K FP+ALFHQ+L+AM  PD ETR+ AH + S VL+PS +CP             S Q+ L
Sbjct  490   KTFPDALFHQLLIAMGHPDYETRICAHCILSTVLIPSLICPW------------SDQKEL  537

Query  188   SRTVSVFSSSAALFDKLGKNQSSGK-------------DGMDQNTQNMLNRLTSTYSRSL  328
             +   S+  SS  +F  L +N  SG+              G  + +Q   +   S   RS 
Sbjct  538   ASLNSLGQSS--IFSSLKEN--SGRFSIPEEDEETVQPTGTMEESQRWNDVKQSLVCRSH  593

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             S     +    NG+      E  SL++ S Q+S+LLSSI+VQAIS  NTP +FEA+AHTY
Sbjct  594   SKSYSFKSALTNGK-----MELSSLRLSSHQVSLLLSSIWVQAISRENTPSNFEAMAHTY  648

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             ++ +L +RTK SSH +L+R FQLAFSLRSISL ++  + PSRRRSLF +A+ M+IF ++ 
Sbjct  649   NIALLLTRTKTSSHMALVRCFQLAFSLRSISLDQEGGLQPSRRRSLFTMASCMLIFSARA  708

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSG  862
              S   L    K+ LTD T+DP+L+LVD   L+ V  NP      YGS EDD AA +SLS 
Sbjct  709   GSLPELIPIVKSSLTDITVDPYLELVDNIRLQAVIRNPVDGGKMYGSDEDDLAALKSLSA  768

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LR  1030
             +E  ++Q  E+  S ++   +K   D+ + IK+QLLQ F PDE  P+G     +      
Sbjct  769   MESDEQQLKETVISHLMSKFEKLSEDELSGIKKQLLQGFSPDESYPLGAPLFMETPQPCS  828

Query  1031  NHNQSDDKTNDEVVDPTF----TVDDLGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQ  1195
                Q D ++ DEV D T       D  GS S       S + ++L+VN+ L+SVLET+ Q
Sbjct  829   PLAQLDFQSFDEVEDTTLFDEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQ  888

Query  1196  VGRQSAAPPAG---MTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQ  1354
             V    A+ PA    +++  V  QCEA   GK  +M    +F++    +     S+ ++  
Sbjct  889   V----ASLPASTSLISYDQVKDQCEALVTGKHQKMSVLQSFKQQQEAKAIVLASDTSLKT  944

Query  1355  PP-SGNPFADN----NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +  P  ++    ++              C+ EY  + SF +LP +SPYD FLKAAG
Sbjct  945   AANTDTPMRESEPNLDSIGKELIQRHDHLYPCSLEYG-YQSF-RLPPASPYDKFLKAAG  1001



>ref|XP_006590941.1| PREDICTED: uncharacterized protein LOC100817330 isoform X3 [Glycine 
max]
Length=878

 Score =   264 bits (674),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 187/529 (35%), Positives = 283/529 (53%), Gaps = 50/529 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSI-Q  178
               KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS   P+       L ++ +I Q
Sbjct  375   HKKAFPDALFHQLLLAMAHPDHETRVGAHSIFSLVLMPSPFSPQ-------LDQKTNISQ  427

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETP  358
             +  S + S+   S      LG  Q +GK        +M  +   + S   +V P      
Sbjct  428   KVPSESFSIQHESF-----LGAEQINGK--------SMEGKAVFSVSGKYAVHPYHGHIL  474

Query  359   NNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTK  538
             + G      HE  S ++ S Q+S+LLSSI+VQA S  + P +FEA+AHTYS+ +LF+R+K
Sbjct  475   S-GALTDGQHELSSFRLSSHQVSLLLSSIWVQATSLDSGPANFEAMAHTYSIALLFTRSK  533

Query  539   KSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSA  718
              SS+ +L+R FQLAFSL S+SL ++  + PSRRRSLF +A+ M+IF ++  +F  L    
Sbjct  534   TSSYMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTMASYMLIFSARAGNFPELIQKV  593

Query  719   KALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESF  898
             KA LT+ T+DPFL+L+D+  L+          YGS+EDD +A ++LS +++  KQ  E+ 
Sbjct  594   KAFLTETTVDPFLELIDDVRLQAVYREPENIIYGSQEDDVSAMKTLSAVKLDDKQLKETV  653

Query  899   ASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDE  1066
              S  +    K   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE
Sbjct  654   ISCFLTKFSKLSEDELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDE  713

Query  1067  VVDPTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGRQSAAPPA  1225
             +V P   +D+       GS SD  +   S +P++L VN+ L SVLET+    RQ A+ P 
Sbjct  714   IVAPLALMDEETQPEPSGSQSDRKSSLSSNSPDILSVNQLLQSVLETA----RQVASFPI  769

Query  1226  GMT---FMDVASQCEAFQEGKGNRMNFREDGNDEPD-----FNFSEETIWQPPSGNPF--  1375
               T   +  + +QCEA   GK  +M+       + +      +   ET   P        
Sbjct  770   SSTPVPYDQMKNQCEALVTGKQQKMSILHSFKHQQETRALVLSSENETKVSPLPIKTLDY  829

Query  1376  --ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                D    +            C+ ++ +  S ++LP +SP+D FLKAAG
Sbjct  830   SEGDLKLVSQQPIQAQYQVRLCSYDFGQQHS-LKLPPASPFDKFLKAAG  877



>gb|AFW70122.1| hypothetical protein ZEAMMB73_889435 [Zea mays]
Length=909

 Score =   263 bits (673),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 214/550 (39%), Positives = 304/550 (55%), Gaps = 59/550 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  373   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  432

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  433   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  492

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  493   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  552

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  553   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  612

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  613   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  672

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  673   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  732

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH-------PDST  1138
              +           +D  +++  +   N E  +     +D  ++ + +A        P  T
Sbjct  733   FLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAAIAIPVPT  792

Query  1139  PNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNRMNFREDGN  1312
              NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++M+      
Sbjct  793   TNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFK  852

Query  1313  DEPDFNFSEETIWQP--PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
                  N     +  P   S NPF             +A  A  A + Q+   F++LP SS
Sbjct  853   Q----NKQAAMVVVPDNQSTNPF--------LLQSISAGEAQVAGDVQQ--PFLRLPPSS  898

Query  1487  PYDNFLKAAG  1516
             PYDNFLKAAG
Sbjct  899   PYDNFLKAAG  908



>gb|AFW70123.1| hypothetical protein ZEAMMB73_889435 [Zea mays]
Length=922

 Score =   263 bits (673),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 216/559 (39%), Positives = 308/559 (55%), Gaps = 64/559 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  373   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  432

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  433   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  492

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  493   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  552

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  553   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  612

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  613   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  672

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  673   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  732

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH-------PDST  1138
              +           +D  +++  +   N E  +     +D  ++ + +A        P  T
Sbjct  733   FLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAAIAIPVPT  792

Query  1139  PNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR----MNFR  1300
              NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++    M+F+
Sbjct  793   TNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFK  852

Query  1301  EDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCATEYQRHP  1459
             ++        PD   S           S NPF             +A  A  A + Q+  
Sbjct  853   QNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVAGDVQQ--  902

Query  1460  SFMQLPASSPYDNFLKAAG  1516
              F++LP SSPYDNFLKAAG
Sbjct  903   PFLRLPPSSPYDNFLKAAG  921



>ref|XP_008644199.1| PREDICTED: uncharacterized protein LOC100501399 isoform X5 [Zea 
mays]
Length=1030

 Score =   264 bits (675),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 215/552 (39%), Positives = 305/552 (55%), Gaps = 57/552 (10%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  847

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVN  1159
              +           +D  +++  + +  D   D    ++   +     A P  T NLL ++
Sbjct  848   FLESPGKIAPPCSDDDTDYDYQEAELIDLRNDNNTYLEASATTLAAIAIPVPTTNLLSID  907

Query  1160  EFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR----MNFREDGNDE-  1318
             E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++    M+F+++     
Sbjct  908   ELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFKQNKQAAM  967

Query  1319  ---PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPA  1480
                PD   S           S NPF             +A  A  A + Q+   F++LP 
Sbjct  968   VVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVAGDVQQ--PFLRLPP  1017

Query  1481  SSPYDNFLKAAG  1516
             SSPYDNFLKAAG
Sbjct  1018  SSPYDNFLKAAG  1029



>ref|XP_003539042.1| PREDICTED: uncharacterized protein LOC100817330 isoform X1 [Glycine 
max]
 ref|XP_006590940.1| PREDICTED: uncharacterized protein LOC100817330 isoform X2 [Glycine 
max]
Length=986

 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 187/528 (35%), Positives = 283/528 (54%), Gaps = 50/528 (9%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSI-QR  181
              KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS   P+       L ++ +I Q+
Sbjct  484   KKAFPDALFHQLLLAMAHPDHETRVGAHSIFSLVLMPSPFSPQ-------LDQKTNISQK  536

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               S + S+   S      LG  Q +GK        +M  +   + S   +V P      +
Sbjct  537   VPSESFSIQHESF-----LGAEQINGK--------SMEGKAVFSVSGKYAVHPYHGHILS  583

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
              G      HE  S ++ S Q+S+LLSSI+VQA S  + P +FEA+AHTYS+ +LF+R+K 
Sbjct  584   -GALTDGQHELSSFRLSSHQVSLLLSSIWVQATSLDSGPANFEAMAHTYSIALLFTRSKT  642

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SS+ +L+R FQLAFSL S+SL ++  + PSRRRSLF +A+ M+IF ++  +F  L    K
Sbjct  643   SSYMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTMASYMLIFSARAGNFPELIQKVK  702

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             A LT+ T+DPFL+L+D+  L+          YGS+EDD +A ++LS +++  KQ  E+  
Sbjct  703   AFLTETTVDPFLELIDDVRLQAVYREPENIIYGSQEDDVSAMKTLSAVKLDDKQLKETVI  762

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDEV  1069
             S  +    K   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE+
Sbjct  763   SCFLTKFSKLSEDELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEI  822

Query  1070  VDPTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGRQSAAPPAG  1228
             V P   +D+       GS SD  +   S +P++L VN+ L SVLET+    RQ A+ P  
Sbjct  823   VAPLALMDEETQPEPSGSQSDRKSSLSSNSPDILSVNQLLQSVLETA----RQVASFPIS  878

Query  1229  MT---FMDVASQCEAFQEGKGNRMNFREDGNDEPD-----FNFSEETIWQPPSGNPF---  1375
              T   +  + +QCEA   GK  +M+       + +      +   ET   P         
Sbjct  879   STPVPYDQMKNQCEALVTGKQQKMSILHSFKHQQETRALVLSSENETKVSPLPIKTLDYS  938

Query  1376  -ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               D    +            C+ ++ +  S ++LP +SP+D FLKAAG
Sbjct  939   EGDLKLVSQQPIQAQYQVRLCSYDFGQQHS-LKLPPASPFDKFLKAAG  985



>ref|XP_008644200.1| PREDICTED: uncharacterized protein LOC100501399 isoform X6 [Zea 
mays]
Length=1024

 Score =   263 bits (672),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 214/551 (39%), Positives = 304/551 (55%), Gaps = 59/551 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  847

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH-------PDST  1138
              +           +D  +++  +   N E  +     +D  ++ + +A        P  T
Sbjct  848   FLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAAIAIPVPT  907

Query  1139  PNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNRMNFREDGN  1312
              NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++M+      
Sbjct  908   TNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFK  967

Query  1313  DEPDFNFSEETIWQP--PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
                  N     +  P   S NPF             +A  A  A + Q+   F++LP SS
Sbjct  968   Q----NKQAAMVVVPDNQSTNPF--------LLQSISAGEAQVAGDVQQ--PFLRLPPSS  1013

Query  1487  PYDNFLKAAGS  1519
             PYDNFLKAAG 
Sbjct  1014  PYDNFLKAAGC  1024



>ref|XP_011026411.1| PREDICTED: uncharacterized protein LOC105127024 isoform X2 [Populus 
euphratica]
Length=987

 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 196/532 (37%), Positives = 287/532 (54%), Gaps = 48/532 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+L+AM  PD+ETR+GAH VFS++L+PS            LS      +
Sbjct  476   HNKAFPDALFHQLLVAMAHPDHETRVGAHSVFSILLMPS-----------LLSPWSDQNK  524

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               S  VS F  S+A      + +S      D++  N+ +    ++     V   S +  +
Sbjct  525   KTSEAVSGFFGSSA-----SQKRSKSFSFQDESNDNVDSMDGQSWEEGNPVSDNSGKHDS  579

Query  362   NGENPQEHHEGL------SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
             +  +    H  +      SL++ S Q+S+LLSSI+VQA S  N P +FEA+ HTY++ +L
Sbjct  580   HDRSNSFKHAVVDGKTLTSLRLSSHQVSLLLSSIWVQATSAENMPANFEAMGHTYNIALL  639

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             F+R+K SSH +L+R FQLAFSLRSISL +Q  + PSRRRSLF LAT M+IF ++  +   
Sbjct  640   FTRSKTSSHVALVRCFQLAFSLRSISL-DQEGLQPSRRRSLFTLATFMLIFAARAGNLPE  698

Query  704   LAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKEDDEAAKRSLSGIEISK  877
             L    K  LT+KT DP+L+LV++  L+     + + + +YGS++DD AA +SLS +E+  
Sbjct  699   LIPFVKVFLTEKTADPYLELVEDIKLQAIYVESDEGKIAYGSEDDDVAALKSLSCVEVDD  758

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDL--------RN  1033
                 E+  S  +    K   D+ + IK+QLLQDF PD+V P+G     D         R 
Sbjct  759   SHLKETLISRFMTKFVKLSEDELSGIKQQLLQDFSPDDVYPLGAPLFMDTPRPCSPLARM  818

Query  1034  HNQSDDK---TNDEVVDPTFTVDDLGSHSDPNAHPDSTPNLLDVNEFLDSVLETSNQVG-  1201
               Q+ ++     D   D TFT  +        +    T ++L VNE L+SVLET+ QV  
Sbjct  819   EFQAFEEIMPAADLTDDETFTELNGSQSGRKTSISVHTLDILSVNELLESVLETARQVAS  878

Query  1202  RQSAAPPAGMTFMDVASQCEAFQEGKGNRMNFREDGNDEPD---FNFSEE----TIWQPP  1360
              Q ++ P  + +  + SQCEA   GK  +M+       +P+   F  ++E    ++    
Sbjct  879   SQVSSTP--VPYDQMKSQCEALVTGKQQKMSILHSFKHQPEAKVFPSTDEKKDTSVHDVK  936

Query  1361  SGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                P  D   A   Q       A C+ EY ++ SF +LP SSPYD FLKAAG
Sbjct  937   VELPQCDLTLATKDQIRAPDQLALCSLEYGQN-SF-RLPPSSPYDKFLKAAG  986



>ref|XP_008644196.1| PREDICTED: uncharacterized protein LOC100501399 isoform X2 [Zea 
mays]
Length=1037

 Score =   263 bits (671),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 216/559 (39%), Positives = 308/559 (55%), Gaps = 64/559 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             ++ A +SLS +E++   S ES    I+ S++     +   I+ QLL+DF PD+VCP    
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDLELENIRSQLLRDFSPDDVCPSSAH  847

Query  1013  RI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH-------PDST  1138
              +           +D  +++  +   N E  +     +D  ++ + +A        P  T
Sbjct  848   FLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAAIAIPVPT  907

Query  1139  PNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR----MNFR  1300
              NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++    M+F+
Sbjct  908   TNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFK  967

Query  1301  EDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCATEYQRHP  1459
             ++        PD   S           S NPF             +A  A  A + Q+  
Sbjct  968   QNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVAGDVQQ--  1017

Query  1460  SFMQLPASSPYDNFLKAAG  1516
              F++LP SSPYDNFLKAAG
Sbjct  1018  PFLRLPPSSPYDNFLKAAG  1036



>ref|XP_006595062.1| PREDICTED: uncharacterized protein LOC100806860 isoform X3 [Glycine 
max]
Length=813

 Score =   260 bits (664),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 194/528 (37%), Positives = 277/528 (52%), Gaps = 50/528 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+LLAM  PD+ET++GAH VFS+VL+PS   P   P      K K  Q 
Sbjct  312   HNKAFPDALFHQLLLAMAHPDSETQIGAHSVFSMVLMPSMCSPWLDP------KTKIAQN  365

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKP--GSEET  355
                     FS+    F   G   S+GK  +++        + S   +   + P  G   T
Sbjct  366   ------DNFSTQHETFS--GAENSNGK--LEEG-----KAIASVNGKKYVIHPYRGYSFT  410

Query  356   P--NNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFS  529
             P   +GE+ Q      SL + S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LFS
Sbjct  411   PKLTDGEDDQS-----SLWLSSHQVSLLLSSIWVQATSVENGPANYEAMAHTYSIALLFS  465

Query  530   RTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLA  709
             R+K S++ +L R FQLAFSLRSISL ++  + PS RRSLF LA+ M+IF ++  +   L 
Sbjct  466   RSKASNYMALARCFQLAFSLRSISLDQEGGLQPSHRRSLFTLASYMLIFSARAGNVPGLI  525

Query  710   VSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQST  889
                KA LT+ T+DPFL+LVD+  L+       +  YGS+ED+ AA +SLS +E+  KQ  
Sbjct  526   PEVKASLTEPTVDPFLELVDDIRLQAVCIESEKIIYGSQEDEVAAAKSLSDVELDDKQLK  585

Query  890   ESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG------TQR----INDLRNHN  1039
             E+  S  +    K   D+ + IK QLLQ F PD+  P G      T R    +  +   N
Sbjct  586   ETIISYFMTKFSKLSEDELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPCSPLAQIEFPN  645

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAA  1216
               +    D++++     +  GS SD   +   + P++L+VN+ LDSVLET+ QV   S +
Sbjct  646   FDEIMVPDDLMEEETGPEHSGSQSDHKTSLSTNYPDVLNVNQLLDSVLETARQVASFSTS  705

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPFADN  1384
                 + +  + +QCEA   GK  +M    +F+     +     SE  +   P      + 
Sbjct  706   -STPLPYDQMKNQCEALVTGKQQKMSVIHSFKHQQESKAIILSSENEVKVSPLPAKALEY  764

Query  1385  NTaaagqpvnaaapaSCATEYQRHPSFMQ----LPASSPYDNFLKAAG  1516
             +                   ++ H S  Q    LP SSPYD FLKAAG
Sbjct  765   SNGDLKLVTQQQFEVQDQARHRSHDSGHQHSLRLPPSSPYDKFLKAAG  812



>ref|XP_010672159.1| PREDICTED: uncharacterized protein LOC104888784 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1001

 Score =   261 bits (668),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 204/539 (38%), Positives = 290/539 (54%), Gaps = 64/539 (12%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             K FP+ALFHQ+L+AM  PD ETR+ AH + S VL+PS +CP             S Q+ L
Sbjct  490   KTFPDALFHQLLIAMGHPDYETRICAHCILSTVLIPSLICPW------------SDQKEL  537

Query  188   SRTVSVFSSSAALFDKLGKNQSSGK-------------DGMDQNTQNMLNRLTSTYSRSL  328
             +   S+  SS  +F  L +N  SG+              G  + +Q   +   S   RS 
Sbjct  538   ASLNSLGQSS--IFSSLKEN--SGRFSIPEEDEETVQPTGTMEESQRWNDVKQSLVCRSH  593

Query  329   SVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTY  508
             S     +    NG+      E  SL++ S Q+S+LLSSI+VQAIS  NTP +FEA+AHTY
Sbjct  594   SKSYSFKSALTNGK-----MELSSLRLSSHQVSLLLSSIWVQAISRENTPSNFEAMAHTY  648

Query  509   SLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKT  688
             ++ +L +RTK SSH +L+R FQLAFSLRSISL +Q  + PSRRRSLF +A+ M+IF ++ 
Sbjct  649   NIALLLTRTKTSSHMALVRCFQLAFSLRSISL-DQEGLQPSRRRSLFTMASCMLIFSARA  707

Query  689   YSFIPLAVSAKALLTDKTMDPFLQLVDECHLK-VNPNP-KARASYGSKEDDEAAKRSLSG  862
              S   L    K+ LTD T+DP+L+LVD   L+ V  NP      YGS EDD AA +SLS 
Sbjct  708   GSLPELIPIVKSSLTDITVDPYLELVDNIRLQAVIRNPVDGGKMYGSDEDDLAALKSLSA  767

Query  863   IEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LR  1030
             +E  ++Q  E+  S ++   +K   D+ + IK+QLLQ F PDE  P+G     +      
Sbjct  768   MESDEQQLKETVISHLMSKFEKLSEDELSGIKKQLLQGFSPDESYPLGAPLFMETPQPCS  827

Query  1031  NHNQSDDKTNDEVVDPTF----TVDDLGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQ  1195
                Q D ++ DEV D T       D  GS S       S + ++L+VN+ L+SVLET+ Q
Sbjct  828   PLAQLDFQSFDEVEDTTLFDEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQ  887

Query  1196  VGRQSAAPPAG---MTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQ  1354
             V    A+ PA    +++  V  QCEA   GK  +M    +F++    +     S+ ++  
Sbjct  888   V----ASLPASTSLISYDQVKDQCEALVTGKHQKMSVLQSFKQQQEAKAIVLASDTSLKT  943

Query  1355  PP-SGNPFADN----NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +  P  ++    ++              C+ EY  + SF +LP +SPYD FLKAAG
Sbjct  944   AANTDTPMRESEPNLDSIGKELIQRHDHLYPCSLEYG-YQSF-RLPPASPYDKFLKAAG  1000



>ref|XP_007033976.1| ARM repeat superfamily protein isoform 6 [Theobroma cacao]
 gb|EOY04902.1| ARM repeat superfamily protein isoform 6 [Theobroma cacao]
Length=780

 Score =   258 bits (660),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 290/530 (55%), Gaps = 43/530 (8%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LLAM  PD+ETR+GA+ +FS+VL+P  +    +      S+  S   + 
Sbjct  266   KAFPDALFHQLLLAMAHPDHETRVGANNIFSIVLMPL-LLSSWSDQDKITSEAVSCDLSF  324

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLT-------STYSRSLSVKPGS  346
             + +  V S S A  D+  K+Q+   DG  +   N  + +         ++ RS S K   
Sbjct  325   AASKKVRSQSFAFQDE-SKDQAEHIDGRLKENGNQASDMAVKKSIMYQSHVRSYSFK---  380

Query  347   EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLF  526
              +   +G+    H     L++ S Q+S+LLSSI+VQA S  N P +FEA+A TY++ +LF
Sbjct  381   -DALGDGKMQLSH-----LRLSSHQVSLLLSSIWVQANSAENIPANFEAMARTYNIAVLF  434

Query  527   SRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPL  706
             +R+K SSH +L+R FQLAFSLR ISL ++  + PSRRRSLF LA+ M+IF ++  +   L
Sbjct  435   TRSKTSSHMALVRSFQLAFSLRGISLDQEGGLQPSRRRSLFTLASYMLIFSARAGNLPEL  494

Query  707   AVSAKALLTDKTMDPFLQLVDECHLK---VNPNPKARASYGSKEDDEAAKRSLSGIEISK  877
                 KA LTDKT+DP+L+LV++  L+   V  +    A YGSKEDD AA +SL  IE   
Sbjct  495   IPIVKASLTDKTVDPYLKLVEDIQLQAVCVKSDVDGVA-YGSKEDDLAASKSLLSIE-PD  552

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQS  1045
                 E+  S ++   +K   D+ + I++QLLQ F PD+  P+G     +         Q 
Sbjct  553   PHLKETVISHLMTRFEKLSEDELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQM  612

Query  1046  DDKTNDEVVDPTFTVDDL------GSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +  +E++      D+       GS SD   +   ST ++L VNE LDSVLET+ QV  
Sbjct  613   GFQAFEEILPLAAMTDEEAFPEANGSQSDRKTSLSISTLDVLSVNELLDSVLETARQVAS  672

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSE-ETIWQPPSGN  1369
              S + P  + +  + SQCEA   GK  +M    +F+   + +     +E E ++ P    
Sbjct  673   FSVS-PTPIPYDQMKSQCEALVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKM  731

Query  1370  PFA-DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              F+ D       Q       A C+ E+ +H SF +LP SSPYD FLKAAG
Sbjct  732   EFSEDRKLIIREQGHVRGQLALCSQEFGQH-SF-RLPPSSPYDKFLKAAG  779



>ref|XP_008644202.1| PREDICTED: uncharacterized protein LOC100501399 isoform X8 [Zea 
mays]
Length=906

 Score =   260 bits (665),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 219/566 (39%), Positives = 310/566 (55%), Gaps = 71/566 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  350   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  409

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  410   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  469

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  470   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  529

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  530   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  589

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  590   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  649

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLK---KSITDKTNL----IKEQLLQDFLPDE  991
             ++ A +SLS +E++   S ES    I+ S++     I D   L    I+ QLL+DF PD+
Sbjct  650   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDVIFDPFFLELENIRSQLLRDFSPDD  709

Query  992   VCPMGTQRI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH----  1126
             VCP     +           +D  +++  +   N E  +     +D  ++ + +A     
Sbjct  710   VCPSSAHFLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAA  769

Query  1127  ---PDSTPNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR-  1288
                P  T NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++ 
Sbjct  770   IAIPVPTTNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKM  829

Query  1289  ---MNFREDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCA  1438
                M+F+++        PD   S           S NPF             +A  A  A
Sbjct  830   SLLMSFKQNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVA  881

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + Q+   F++LP SSPYDNFLKAAG
Sbjct  882   GDVQQ--PFLRLPPSSPYDNFLKAAG  905



>ref|XP_008644197.1| PREDICTED: uncharacterized protein LOC100501399 isoform X3 [Zea 
mays]
Length=1037

 Score =   261 bits (668),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 218/559 (39%), Positives = 307/559 (55%), Gaps = 64/559 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLK---KSITDKTNL----IKEQLLQDFLPDE  991
             ++ A +SLS +E++   S ES    I+ S++     I D   L    I+ QLL+DF PD+
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDVIFDPFFLELENIRSQLLRDFSPDD  847

Query  992   VCPMGTQRI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPDST  1138
             VCP     +           +D  +++  + +  D   D    ++   +     A P  T
Sbjct  848   VCPSSAHFLESPGKIAPPCSDDDTDYDYQEAELIDLRNDNNTYLEASATTLAAIAIPVPT  907

Query  1139  PNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR----MNFR  1300
              NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++    M+F+
Sbjct  908   TNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKMSLLMSFK  967

Query  1301  EDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCATEYQRHP  1459
             ++        PD   S           S NPF             +A  A  A + Q+  
Sbjct  968   QNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVAGDVQQ--  1017

Query  1460  SFMQLPASSPYDNFLKAAG  1516
              F++LP SSPYDNFLKAAG
Sbjct  1018  PFLRLPPSSPYDNFLKAAG  1036



>gb|KHN06209.1| Protein EFR3 like B [Glycine soja]
Length=988

 Score =   261 bits (667),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 282/526 (54%), Gaps = 50/526 (10%)
 Frame = +2

Query  11    AFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSI-QRTL  187
             AFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS   P+       L ++ +I Q+  
Sbjct  488   AFPDALFHQLLLAMAHPDHETRVGAHSIFSLVLMPSPFSPQ-------LDQKTNISQKVP  540

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNG  367
             S + S+   S      LG  Q +GK        +M  +   + S   +V P      + G
Sbjct  541   SESFSIQHESF-----LGAEQINGK--------SMEGKAVFSVSGKYAVHPYHGHILS-G  586

Query  368   ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
                   HE  S ++ S Q+S+LLSSI+VQA S  + P +FEA+AHTYS+ +LF+R+K SS
Sbjct  587   ALTDGQHELSSFRLSSHQVSLLLSSIWVQATSLDSGPANFEAMAHTYSIALLFTRSKTSS  646

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             + +L+R FQLAFSL S+SL ++  + PSRRRSLF +A+ M+IF ++  +F  L    KA 
Sbjct  647   YMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTMASYMLIFSARAGNFPELIQKVKAF  706

Query  728   LTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASM  907
             LT+ T+DPFL+L+D+  L+          YGS+EDD +A ++LS +++  KQ  E+  S 
Sbjct  707   LTETTVDPFLELIDDVRLQAVYREPENIIYGSQEDDVSAMKTLSAVKLDDKQLKETVISC  766

Query  908   IVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDEVVD  1075
              +    K   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE+V 
Sbjct  767   FLTKFSKLSEDELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVA  826

Query  1076  PTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMT  1234
             P   +D+       GS SD  +   S +P++L VN+ L SVLET+    RQ A+ P   T
Sbjct  827   PLALMDEETQPEPSGSQSDRKSSLSSNSPDILSVNQLLQSVLETA----RQVASFPISST  882

Query  1235  ---FMDVASQCEAFQEGKGNRMNFREDGNDEPD-----FNFSEETIWQPPSGNPF----A  1378
                +  + +QCEA   GK  +M+       + +      +   ET   P           
Sbjct  883   PVPYDQMKNQCEALVTGKQQKMSILHSFKHQQETRALVLSSENETKVSPLPIKTLDYSEG  942

Query  1379  DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             D    +            C+ ++ +  S ++LP +SP+D FLKAAG
Sbjct  943   DLKLVSQQPIQAQYQVRLCSYDFGQQHS-LKLPPASPFDKFLKAAG  987



>ref|XP_008644198.1| PREDICTED: uncharacterized protein LOC100501399 isoform X4 [Zea 
mays]
Length=1031

 Score =   261 bits (667),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 217/558 (39%), Positives = 306/558 (55%), Gaps = 66/558 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLK---KSITDKTNL----IKEQLLQDFLPDE  991
             ++ A +SLS +E++   S ES    I+ S++     I D   L    I+ QLL+DF PD+
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDVIFDPFFLELENIRSQLLRDFSPDD  847

Query  992   VCPMGTQRI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH----  1126
             VCP     +           +D  +++  +   N E  +     +D  ++ + +A     
Sbjct  848   VCPSSAHFLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAA  907

Query  1127  ---PDSTPNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNRM  1291
                P  T NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++M
Sbjct  908   IAIPVPTTNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKM  967

Query  1292  NFREDGNDEPDFNFSEETIWQP--PSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSF  1465
             +           N     +  P   S NPF             +A  A  A + Q+   F
Sbjct  968   SLLMSFKQ----NKQAAMVVVPDNQSTNPF--------LLQSISAGEAQVAGDVQQ--PF  1013

Query  1466  MQLPASSPYDNFLKAAGS  1519
             ++LP SSPYDNFLKAAG 
Sbjct  1014  LRLPPSSPYDNFLKAAGC  1031



>gb|KEH39475.1| cyclin-like protein [Medicago truncatula]
Length=949

 Score =   260 bits (664),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 186/522 (36%), Positives = 266/522 (51%), Gaps = 68/522 (13%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFP+ALFHQ+LLAM  PD ET++GAH + S+VL+PS V P               Q+ 
Sbjct  477   NKAFPDALFHQLLLAMAHPDRETQIGAHSILSMVLMPSVVSPWLD------------QKK  524

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNN  364
             +S+ V                     DG+    +++                 S E P N
Sbjct  525   ISKKVE-------------------SDGLSIQHESL-----------------SGEDPLN  548

Query  365   GENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKS  544
             G+ P E  +  SL++ S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LF+R+K S
Sbjct  549   GK-PVEEKDLRSLRLSSHQVSLLLSSIWVQATSAENGPANYEAMAHTYSIALLFTRSKTS  607

Query  545   SHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKA  724
             S+ +L+R FQLAFSLRSISL ++  +PPSRRRSL  LA+ M+IF ++   F  L    KA
Sbjct  608   SYMALVRCFQLAFSLRSISLDQEGGLPPSRRRSLLTLASHMLIFSARAADFSDLIPKVKA  667

Query  725   LLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFAS  904
              LT+  +DPFL+LVD+  L+       +  +GS ED+ AA +SLS +++  +Q  E+  S
Sbjct  668   SLTEAPVDPFLELVDDNLLRAVCIKSDKVVFGSVEDEVAAMKSLSAVQLDDRQLKETVIS  727

Query  905   MIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTF  1084
               +    K   D+ + IK QLLQ F PD+  P G     +         +     VD   
Sbjct  728   YFMTKFSKLPEDELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPGSPLAQIEFPDVDEIM  787

Query  1085  TVDDL----------GSHSDPNAHPDST-PNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
               DDL          GS SD      +  P++L VN+ L+SVLET+ QV   S +    +
Sbjct  788   AADDLIDEGSGTELSGSQSDRRTSLSTNRPDVLGVNQLLESVLETARQVASISTS-STPL  846

Query  1232  TFMDVASQCEAFQEGKGNRM-NFREDGNDEPDFNF-----SEETIWQPPSGNPFADNNTa  1393
              +  + +QCEA + GK  +M   R   N +          +EE   QP     ++  +  
Sbjct  847   PYDQMKNQCEALETGKQQKMLTIRSFKNQQETKAIVLSSENEEVSRQPVKALEYSKGDLK  906

Query  1394  aagqpv-naaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                Q    A       ++  R    ++LP SSPYD FLKAAG
Sbjct  907   LVTQEQFQAQDQIRFRSQDTRKQHSLRLPPSSPYDKFLKAAG  948



>ref|XP_008800011.1| PREDICTED: uncharacterized protein LOC103714504 isoform X2 [Phoenix 
dactylifera]
Length=916

 Score =   259 bits (663),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 195/550 (35%), Positives = 283/550 (51%), Gaps = 61/550 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKR-KSIQ  178
              NKAFPEALFHQ+L+ M  PD+ETR+G+HRVF  VL  S+V P   P    L K+    Q
Sbjct  382   HNKAFPEALFHQLLMLMTHPDHETRVGSHRVFCSVLAASAVTPWPFPFIPFLPKKGYDPQ  441

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSS--------------GKDGMDQNTQNMLN------  298
              TL  ++S F+S+ A+ +K+GKN  S              G +GM +    ++N      
Sbjct  442   STLFVSLSGFASTEAILEKMGKNDYSIQNLYSGRSDTSDAGVEGMKEEECQLVNDDIKWD  501

Query  299   --RLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
                 + +  RS+ + P             E  E  SL++ S Q+ +LLSSI+ QA    N
Sbjct  502   VVHPSRSERRSIKLAPPCAVFGGRVVTESEKEEMTSLRLSSHQVDLLLSSIWAQATLEEN  561

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
             TP ++EA+A +++L +LFSR K SSH +L+R FQLAFSLRSISL +++ + PSRRRSL  
Sbjct  562   TPGNYEAMAQSFNLALLFSRKKTSSHVALVRCFQLAFSLRSISLDKESCLQPSRRRSLHT  621

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVN--PNPKARASYGSK  826
             LA+SM+IF +K      L    KAL++DK +DPFL LV++  L+ N   +   +A +GS+
Sbjct  622   LASSMLIFSAKAGDLPQLIPVVKALISDKAVDPFLHLVEDSMLQANYVASSVGKAIFGSE  681

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             ED+ AA + L+ I++   Q  E+    +V   +K    +   IKEQLLQ F PD+  P G
Sbjct  682   EDEIAALKFLAAIDVDDMQLKETVIFHLVNKFEKLPEKELLSIKEQLLQGFSPDDAFPFG  741

Query  1007  TQRINDLRN----HNQSDDKTNDEVVDPTFTVD------DLGSHSDPNAHPDSTP-NLLD  1153
                  +  N      Q + +T DE   P    D        GS S+      +   ++L 
Sbjct  742   VPLFAETPNLCSPFAQKEFQTLDEFWPPDVLEDIDPISETCGSQSESRVSESTNDHDILG  801

Query  1154  VNEFLDSVLETSNQVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNF------RED  1306
             VN+ ++SVL+T+    RQ A  P   T   +  + SQCEA   GK  +M+       R++
Sbjct  802   VNQLMESVLDTA----RQVADLPFLTTTVPYDKMKSQCEALVMGKQKKMSVLLSFKHRQE  857

Query  1307  GNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
             G +      +E     PP           A     +     S   E ++    ++LP SS
Sbjct  858   GLETESSKENENDSVLPPES---------AHCPVESIRCYDSIINECEKS---VRLPPSS  905

Query  1487  PYDNFLKAAG  1516
             PYD FL AAG
Sbjct  906   PYDKFLIAAG  915



>ref|XP_008644201.1| PREDICTED: uncharacterized protein LOC100501399 isoform X7 [Zea 
mays]
Length=1008

 Score =   259 bits (663),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 219/567 (39%), Positives = 311/567 (55%), Gaps = 71/567 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  452   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  511

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  512   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  571

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  572   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  631

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  632   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  691

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  692   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  751

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLK---KSITDKTNL----IKEQLLQDFLPDE  991
             ++ A +SLS +E++   S ES    I+ S++     I D   L    I+ QLL+DF PD+
Sbjct  752   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDVIFDPFFLELENIRSQLLRDFSPDD  811

Query  992   VCPMGTQRI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH----  1126
             VCP     +           +D  +++  +   N E  +     +D  ++ + +A     
Sbjct  812   VCPSSAHFLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAA  871

Query  1127  ---PDSTPNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR-  1288
                P  T NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++ 
Sbjct  872   IAIPVPTTNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKM  931

Query  1289  ---MNFREDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCA  1438
                M+F+++        PD   S           S NPF   +         +A  A  A
Sbjct  932   SLLMSFKQNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPFLLQSI--------SAGEAQVA  983

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAGS  1519
              + Q+   F++LP SSPYDNFLKAAG 
Sbjct  984   GDVQQ--PFLRLPPSSPYDNFLKAAGC  1008



>ref|XP_008644195.1| PREDICTED: uncharacterized protein LOC100501399 isoform X1 [Zea 
mays]
Length=1044

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 219/566 (39%), Positives = 310/566 (55%), Gaps = 71/566 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             +NK FPEALFHQ+LLAMV PD+ETR+GAHR+FSVVLVPSSV P          ++  +QR
Sbjct  488   KNKVFPEALFHQLLLAMVHPDHETRVGAHRIFSVVLVPSSVSPFPNLKSLDQCRKHDVQR  547

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----------NRLTSTYSRSL  328
             TLSR VSVFSSSAALFDKL ++++S ++ + + + N +           N L  + S   
Sbjct  548   TLSRVVSVFSSSAALFDKLRRDRNSFREYLHEGSMNRILHGIDDEIATPNDLPGSQSLRQ  607

Query  329   SVKPGS------EETPNNGENPQ----EHHEGLSLKMKSRQISMLLSSIFVQAISHLNTP  478
             S++  S        +   G++P        E + L++ S+Q ++LLSSI+ QA+S  N P
Sbjct  608   SLRLSSVSHKHSYTSLKEGQSPLTESINEMETIVLRLSSQQATLLLSSIWRQALSPKNAP  667

Query  479   EHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALA  658
             +++EAIAHTYSLL+LF  +K    E L   FQ+AFSL S SL     +PPSRRRSLF LA
Sbjct  668   QNYEAIAHTYSLLLLFLGSKTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLA  727

Query  659   TSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKV--NPNPKARASYGSKED  832
             TSMI+F S+ ++  PL    K +L D TMDPFL LV E  L+   +       SYGS ED
Sbjct  728   TSMIVFASRAFNVAPLLPICKLMLNDGTMDPFLHLVHENKLQAVKDYTEDPSTSYGSPED  787

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLK---KSITDKTNL----IKEQLLQDFLPDE  991
             ++ A +SLS +E++   S ES    I+ S++     I D   L    I+ QLL+DF PD+
Sbjct  788   NQNALKSLSVVELTNSCSRESMILTIMNSIRDLPDVIFDPFFLELENIRSQLLRDFSPDD  847

Query  992   VCPMGTQRI-----------NDLRNHNQSDDKTNDEVVDPTFTVDDLGSHSDPNAH----  1126
             VCP     +           +D  +++  +   N E  +     +D  ++ + +A     
Sbjct  848   VCPSSAHFLESPGKIAPPCSDDDTDYDYQEVHGNFEQAELIDLRNDNNTYLEASATTLAA  907

Query  1127  ---PDSTPNLLDVNEFLDSVL-ETSNQVGRQSAAPPAG-MTFMDVASQCEAFQEGKGNR-  1288
                P  T NLL ++E L++V+ + S+Q G Q     AG + F ++ S CEAF  GK ++ 
Sbjct  908   IAIPVPTTNLLSIDELLETVVNDVSSQTGGQCLVSMAGDIPFQEMTSHCEAFSMGKHHKM  967

Query  1289  ---MNFREDGNDE----PDFNFSEETIWQPP---SGNPFADNNTaaagqpvnaaapaSCA  1438
                M+F+++        PD   S           S NPF             +A  A  A
Sbjct  968   SLLMSFKQNKQAAMVVVPDNQVSHAEAAHTSDKQSTNPF--------LLQSISAGEAQVA  1019

Query  1439  TEYQRHPSFMQLPASSPYDNFLKAAG  1516
              + Q+   F++LP SSPYDNFLKAAG
Sbjct  1020  GDVQQ--PFLRLPPSSPYDNFLKAAG  1043



>ref|XP_008799995.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008800004.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score =   259 bits (663),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 195/551 (35%), Positives = 283/551 (51%), Gaps = 61/551 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKR-KSIQ  178
              NKAFPEALFHQ+L+ M  PD+ETR+G+HRVF  VL  S+V P   P    L K+    Q
Sbjct  481   HNKAFPEALFHQLLMLMTHPDHETRVGSHRVFCSVLAASAVTPWPFPFIPFLPKKGYDPQ  540

Query  179   RTLSRTVSVFSSSAALFDKLGKNQSS--------------GKDGMDQNTQNMLN------  298
              TL  ++S F+S+ A+ +K+GKN  S              G +GM +    ++N      
Sbjct  541   STLFVSLSGFASTEAILEKMGKNDYSIQNLYSGRSDTSDAGVEGMKEEECQLVNDDIKWD  600

Query  299   --RLTSTYSRSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
                 + +  RS+ + P             E  E  SL++ S Q+ +LLSSI+ QA    N
Sbjct  601   VVHPSRSERRSIKLAPPCAVFGGRVVTESEKEEMTSLRLSSHQVDLLLSSIWAQATLEEN  660

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
             TP ++EA+A +++L +LFSR K SSH +L+R FQLAFSLRSISL +++ + PSRRRSL  
Sbjct  661   TPGNYEAMAQSFNLALLFSRKKTSSHVALVRCFQLAFSLRSISLDKESCLQPSRRRSLHT  720

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVN--PNPKARASYGSK  826
             LA+SM+IF +K      L    KAL++DK +DPFL LV++  L+ N   +   +A +GS+
Sbjct  721   LASSMLIFSAKAGDLPQLIPVVKALISDKAVDPFLHLVEDSMLQANYVASSVGKAIFGSE  780

Query  827   EDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG  1006
             ED+ AA + L+ I++   Q  E+    +V   +K    +   IKEQLLQ F PD+  P G
Sbjct  781   EDEIAALKFLAAIDVDDMQLKETVIFHLVNKFEKLPEKELLSIKEQLLQGFSPDDAFPFG  840

Query  1007  TQRINDLRN----HNQSDDKTNDEVVDPTFTVD------DLGSHSDPNAHPDSTP-NLLD  1153
                  +  N      Q + +T DE   P    D        GS S+      +   ++L 
Sbjct  841   VPLFAETPNLCSPFAQKEFQTLDEFWPPDVLEDIDPISETCGSQSESRVSESTNDHDILG  900

Query  1154  VNEFLDSVLETSNQVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNF------RED  1306
             VN+ ++SVL+T+    RQ A  P   T   +  + SQCEA   GK  +M+       R++
Sbjct  901   VNQLMESVLDTA----RQVADLPFLTTTVPYDKMKSQCEALVMGKQKKMSVLLSFKHRQE  956

Query  1307  GNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASS  1486
             G +      +E     PP           A     +     S   E ++    ++LP SS
Sbjct  957   GLETESSKENENDSVLPPES---------AHCPVESIRCYDSIINECEKS---VRLPPSS  1004

Query  1487  PYDNFLKAAGS  1519
             PYD FL AAG 
Sbjct  1005  PYDKFLIAAGC  1015



>gb|KHN25286.1| Protein EFR3 like B [Glycine soja]
Length=1015

 Score =   259 bits (662),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 189/529 (36%), Positives = 277/529 (52%), Gaps = 50/529 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
               KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS   P+         K K  Q+
Sbjct  512   HKKAFPDALFHQLLLAMAHPDHETRVGAHSIFSLVLMPSPFSPQLD------QKTKGYQK  565

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               S + S+   S      LG  Q +GK         M  +     S   +V P       
Sbjct  566   VPSESFSIQHESF-----LGAEQINGKP--------MEGKAVVGVSGKYAVHPYHGHI-F  611

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
             +G      HE  S ++ S Q+S LLSSI+VQA S  + P +FEA+AHTYS+ +LF+R+K 
Sbjct  612   SGALTDGKHELSSFRLSSHQVSFLLSSIWVQATSVESGPANFEAMAHTYSIALLFTRSKT  671

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SS+ +L+R FQLAFSL S+SL ++  + PSRRRSLF LA+ M+IF ++  +F  L    K
Sbjct  672   SSYMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTLASYMLIFSARAGNFPELIQKVK  731

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
               LT+ T+DPFL+L+D+  L+          YGS+EDD +A + +S +++  KQ  E+  
Sbjct  732   TSLTETTVDPFLELIDDVRLQAVSRESENIIYGSQEDDVSAMKIMSAVKLDDKQLKETVI  791

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDEV  1069
             S  +    K   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE+
Sbjct  792   SCFLTKFSKLSEDELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEI  851

Query  1070  VDPTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGR--QSAAPP  1222
             V P   +D+       GS SD  +   S +P++L VN+ L SVLET+ QV     S+ P 
Sbjct  852   VAPLALMDEETWPKSSGSQSDHKSSLSSNSPDILSVNQLLQSVLETARQVASFPISSTP-  910

Query  1223  AGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPF-----  1375
               +++  + +QCEA   GK  +M    +F+           SE  I   P   P      
Sbjct  911   --VSYDQMKNQCEALVTGKQQKMSILHSFKHQQETGAIVLSSENEIKVSPL--PIKTLEY  966

Query  1376  --ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                D       Q         C+ ++ +  S ++LP +SP+D FLKAAG
Sbjct  967   SEGDLKLVHHEQFQAQYQVRLCSYDFGQQHS-LKLPPASPFDKFLKAAG  1014



>gb|KEH30318.1| cyclin-like protein [Medicago truncatula]
Length=973

 Score =   259 bits (661),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 185/524 (35%), Positives = 275/524 (52%), Gaps = 43/524 (8%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LL M  PD+ETR+GAH VFS VL+PS   P+         K    ++  
Sbjct  471   KAFPDALFHQLLLVMAHPDHETRIGAHSVFSTVLMPSLFSPQLD------HKTMMAEKVP  524

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNG  367
             S ++S+   S    +++ +    G   +D +++         YS S ++  G +E     
Sbjct  525   SESLSIQQESFLGAEQINRKPVEGGAVVDVSSRKYRVLPYRVYSFSDALNLGKDELS---  581

Query  368   ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
                       S ++ S Q+S+LLSSI+VQA S  N P +FEA+AHT+S+ +LF+R+K SS
Sbjct  582   ----------SFRLSSHQVSLLLSSIWVQATSMDNGPANFEAMAHTFSIALLFTRSKTSS  631

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             + +L+R FQLAFSL SISL ++  + PSRRRSLF LA+ M+IF +KT +F  L    KA 
Sbjct  632   YLALVRCFQLAFSLMSISLDQEGGLQPSRRRSLFTLASYMLIFSAKTGNFSELIPIVKAS  691

Query  728   LTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASM  907
             L   T+DPFL+LVD+  L+       +  YGS+EDD AA +SLS +E+  K+  E+  S 
Sbjct  692   LIYSTVDPFLELVDDVRLQAVNIESEKIIYGSQEDDVAAIKSLSAVELDDKKLKETVLSY  751

Query  908   IVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNH----NQSDDKTNDEVVD  1075
              +    K   D+ + IK+QL Q F PD+  PMG Q   +         Q +    DE+V 
Sbjct  752   FLTKYSKLPEDELSSIKKQLAQGFSPDDAYPMGPQLFMETSRTCSPVAQIEYPDFDEIVA  811

Query  1076  PTFTVDDLGSHSDPNAHPDSTPNL--------LDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
                 +D+  +  +P+ +      L        L VN+ L+SVLET+ QV      P   +
Sbjct  812   SAALMDE-ETGPEPSGNLSDCKQLLSFNNLTILSVNQLLESVLETARQVA-SFPIPANPV  869

Query  1232  TFMDVASQCEAFQEGKGNRMNFREDGNDEPD-----FNFSEETIWQPPSGNPF----ADN  1384
              +  + +QCEA   GK  +M+       + +      + + ET   P           D 
Sbjct  870   PYDQMKNQCEALVSGKQQKMSVLHSFKHQQETRALVLSSAIETKVSPLPIKTLEYSEGDL  929

Query  1385  NTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                +  Q         C+ +Y++H S ++LP +SPYD FLKAAG
Sbjct  930   KLVSQEQLQTLYEVRPCSYDYRQHHS-LRLPPASPYDKFLKAAG  972



>ref|XP_006592150.1| PREDICTED: uncharacterized protein LOC100799047 isoform X1 [Glycine 
max]
 ref|XP_006592151.1| PREDICTED: uncharacterized protein LOC100799047 isoform X2 [Glycine 
max]
 ref|XP_006592152.1| PREDICTED: uncharacterized protein LOC100799047 isoform X3 [Glycine 
max]
 ref|XP_006592153.1| PREDICTED: uncharacterized protein LOC100799047 isoform X4 [Glycine 
max]
 ref|XP_006592154.1| PREDICTED: uncharacterized protein LOC100799047 isoform X5 [Glycine 
max]
Length=986

 Score =   259 bits (661),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 188/529 (36%), Positives = 277/529 (52%), Gaps = 50/529 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
               KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS   P+         K K  Q+
Sbjct  483   HKKAFPDALFHQLLLAMAHPDHETRVGAHSIFSLVLMPSPFSPQLD------QKTKGYQK  536

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               S + S+   S      LG  Q +GK         M  +     S   +V P       
Sbjct  537   VPSESFSIQHESF-----LGAEQINGKP--------MEGKAVVGVSGKYAVHPYHGHI-F  582

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
             +G      HE  S ++ S Q+S LLSSI+VQA S  + P +FEA+AHTYS+ +LF+R+K 
Sbjct  583   SGALTDGKHELSSFRLSSHQVSFLLSSIWVQATSVESGPANFEAMAHTYSIALLFTRSKT  642

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SS+ +L+R FQLAFSL S+SL ++  + PSRRRSLF LA+ M+IF ++  +F  L    K
Sbjct  643   SSYMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTLASYMLIFSARAGNFPELIQKVK  702

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
               LT+ T+DPFL+L+D+  L+          YGS+EDD +A + +S +++  KQ  E+  
Sbjct  703   TSLTETTVDPFLELIDDVRLQAVSRESENIIYGSQEDDVSAMKIMSAVKLDDKQLKETVI  762

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDEV  1069
             S  +    K   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE+
Sbjct  763   SCFLTKFSKLSEDELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEI  822

Query  1070  VDPTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGR--QSAAPP  1222
             V P   +D+       GS SD  +   S +P++L VN+ + SVLET+ QV     S+ P 
Sbjct  823   VAPLALMDEETWPKSSGSQSDHKSSLSSNSPDILSVNQLIQSVLETARQVASFPISSTP-  881

Query  1223  AGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPF-----  1375
               +++  + +QCEA   GK  +M    +F+           SE  I   P   P      
Sbjct  882   --VSYDQMKNQCEALVTGKQQKMSILHSFKHQQETGAIVLSSENEIKVSPL--PIKTLEY  937

Query  1376  --ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                D       Q         C+ ++ +  S ++LP +SP+D FLKAAG
Sbjct  938   SEGDLKLVHHEQFQAQYQVRLCSYDFGQQHS-LKLPPASPFDKFLKAAG  985



>ref|XP_010932402.1| PREDICTED: uncharacterized protein LOC105053077 isoform X2 [Elaeis 
guineensis]
Length=699

 Score =   254 bits (650),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 191/279 (68%), Gaps = 20/279 (7%)
 Frame = +2

Query  2    QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
            QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCP  + A     K + +QR
Sbjct  387  QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPHPSSASMGSYKIQDLQR  446

Query  182  TLSRTVSVFSSSAALFDKLGK-----NQSSGKDGMD---------QNTQN--MLNRLTST  313
            TLSRTVSVFSSSAALF KL +      +S+ +D +D         QN+ N   L +L S+
Sbjct  447  TLSRTVSVFSSSAALFGKLRREMFSLRESTCQDNVDKVSNSDDGQQNSGNDAKLYKLQSS  506

Query  314  YSRSLSVKPGS---EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
             SR  S+K  S       N+  NP    + +SL++ SRQI++LLSS+  QA+S  NTPE+
Sbjct  507  QSRMRSIKGTSLPSISEENSSSNPYREMDPISLRLSSRQITLLLSSLRAQAMSPENTPEN  566

Query  485  FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
            +EAIAHTY L +LFSR K S +E L+R FQLAFSLR+ISL  +  MPPSRRRSLF LATS
Sbjct  567  YEAIAHTYCLALLFSRAKNSFNEVLVRSFQLAFSLRNISLRGEGIMPPSRRRSLFTLATS  626

Query  665  MIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL  781
            MI+F +K ++ IPL   AK+ LT+KT+  F   V  C++
Sbjct  627  MIVFSAKAFNIIPLIPIAKSSLTEKTVSNFFG-VGSCNI  664



>ref|XP_006595061.1| PREDICTED: uncharacterized protein LOC100806860 isoform X2 [Glycine 
max]
 ref|XP_003542058.2| PREDICTED: uncharacterized protein LOC100806860 isoform X1 [Glycine 
max]
Length=965

 Score =   258 bits (660),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 194/528 (37%), Positives = 277/528 (52%), Gaps = 50/528 (9%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+LLAM  PD+ET++GAH VFS+VL+PS   P   P      K K  Q 
Sbjct  464   HNKAFPDALFHQLLLAMAHPDSETQIGAHSVFSMVLMPSMCSPWLDP------KTKIAQN  517

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKP--GSEET  355
                     FS+    F   G   S+GK  +++        + S   +   + P  G   T
Sbjct  518   ------DNFSTQHETFS--GAENSNGK--LEEG-----KAIASVNGKKYVIHPYRGYSFT  562

Query  356   P--NNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFS  529
             P   +GE+ Q      SL + S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LFS
Sbjct  563   PKLTDGEDDQS-----SLWLSSHQVSLLLSSIWVQATSVENGPANYEAMAHTYSIALLFS  617

Query  530   RTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLA  709
             R+K S++ +L R FQLAFSLRSISL ++  + PS RRSLF LA+ M+IF ++  +   L 
Sbjct  618   RSKASNYMALARCFQLAFSLRSISLDQEGGLQPSHRRSLFTLASYMLIFSARAGNVPGLI  677

Query  710   VSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQST  889
                KA LT+ T+DPFL+LVD+  L+       +  YGS+ED+ AA +SLS +E+  KQ  
Sbjct  678   PEVKASLTEPTVDPFLELVDDIRLQAVCIESEKIIYGSQEDEVAAAKSLSDVELDDKQLK  737

Query  890   ESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG------TQR----INDLRNHN  1039
             E+  S  +    K   D+ + IK QLLQ F PD+  P G      T R    +  +   N
Sbjct  738   ETIISYFMTKFSKLSEDELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPCSPLAQIEFPN  797

Query  1040  QSDDKTNDEVVDPTFTVDDLGSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGRQSAA  1216
               +    D++++     +  GS SD   +   + P++L+VN+ LDSVLET+ QV   S +
Sbjct  798   FDEIMVPDDLMEEETGPEHSGSQSDHKTSLSTNYPDVLNVNQLLDSVLETARQVASFSTS  857

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPFADN  1384
                 + +  + +QCEA   GK  +M    +F+     +     SE  +   P      + 
Sbjct  858   -STPLPYDQMKNQCEALVTGKQQKMSVIHSFKHQQESKAIILSSENEVKVSPLPAKALEY  916

Query  1385  NTaaagqpvnaaapaSCATEYQRHPSFMQ----LPASSPYDNFLKAAG  1516
             +                   ++ H S  Q    LP SSPYD FLKAAG
Sbjct  917   SNGDLKLVTQQQFEVQDQARHRSHDSGHQHSLRLPPSSPYDKFLKAAG  964



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   259 bits (661),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 190/556 (34%), Positives = 286/556 (51%), Gaps = 70/556 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKR-KSIQ  178
               KAFPEALFHQ+L+ M  PD+ETR+G+HRVFS VL  S V     P    LSK     Q
Sbjct  481   HKKAFPEALFHQLLILMTHPDHETRVGSHRVFSAVLAASVVTSWPFPFIPFLSKEGYDPQ  540

Query  179   RTLSRTVSVFSSSAALFDKLGKNQS---------------SGKDGMDQNTQNMLNRLTST  313
              TL  ++S FSS+ A+ +K+GKN                 +G +GM +    ++N     
Sbjct  541   STLLVSLSGFSSTGAILEKMGKNGCCSIQNLYSGRSHTSDAGVEGMKEEECQLVNGDIKR  600

Query  314   YS--------RSLSVKPGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHL  469
             Y+         S+ + P          +  E  E  SL++ S Q+ +LLSSI+ QA    
Sbjct  601   YAVHPSRSEQHSIKLAPSCAVFGGRVVSESEKEEMTSLRLSSHQVDLLLSSIWAQATLEE  660

Query  470   NTPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLF  649
             NTP ++EA+A +++L +LFSR K SSH +L+R FQLAFSLRSISL +++ + PSRRRSL 
Sbjct  661   NTPANYEAMAQSFNLTLLFSRKKTSSHVALVRCFQLAFSLRSISLDKESCLQPSRRRSLH  720

Query  650   ALATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVN--PNPKARASYGS  823
              LA+SM+IF +K      L    KAL++DK +DPFL LV++  L+ N   +   +  +GS
Sbjct  721   TLASSMLIFSAKAGDLPQLIPVVKALISDKVVDPFLHLVEDSMLQANYVASSVGKPIFGS  780

Query  824   KEDDEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPM  1003
             +ED+ AA + L+ I++   Q  ++    +V   ++   ++   IKEQLLQ F PD+  P+
Sbjct  781   EEDEIAALKFLAAIDVDDVQLKKTVIFHLVNKFEELPENELLSIKEQLLQGFSPDDAFPL  840

Query  1004  G----TQRINDLRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAHPDSTP-NLL  1150
             G     +  N      Q + +T DE+  P    D+       GS S+      +   ++L
Sbjct  841   GFPLFAETPNPCSPFAQKECQTFDELWPPDVLEDEDPISETCGSRSECRLSESTNDHDIL  900

Query  1151  DVNEFLDSVLETSNQVGRQSAAPPAGMTFMDV-------ASQCEAFQEGKGNRMNF----  1297
              VN+ ++SVL+T+ QV        A + F+ +        SQCEA   GK  +M+     
Sbjct  901   GVNQLMESVLDTARQV--------ADLPFLTIPVPYDQMKSQCEALVMGKQQKMSVLLSF  952

Query  1298  --REDGNDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQ  1471
               +++G++      +E     PP    +   N              S  +E++     ++
Sbjct  953   KHQQEGSEMESSKENEYGSVLPPERVHYPVENI---------QCYDSTTSEFENS---VR  1000

Query  1472  LPASSPYDNFLKAAGS  1519
             LP SSPYD FL AAG 
Sbjct  1001  LPPSSPYDKFLIAAGC  1016



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score =   258 bits (658),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 290/530 (55%), Gaps = 43/530 (8%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LLAM  PD+ETR+GA+ +FS+VL+P  +    +      S+  S   + 
Sbjct  471   KAFPDALFHQLLLAMAHPDHETRVGANNIFSIVLMPL-LLSSWSDQDKITSEAVSCDLSF  529

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLT-------STYSRSLSVKPGS  346
             + +  V S S A  D+  K+Q+   DG  +   N  + +         ++ RS S K   
Sbjct  530   AASKKVRSQSFAFQDE-SKDQAEHIDGRLKENGNQASDMAVKKSIMYQSHVRSYSFK---  585

Query  347   EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLF  526
              +   +G+    H     L++ S Q+S+LLSSI+VQA S  N P +FEA+A TY++ +LF
Sbjct  586   -DALGDGKMQLSH-----LRLSSHQVSLLLSSIWVQANSAENIPANFEAMARTYNIAVLF  639

Query  527   SRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPL  706
             +R+K SSH +L+R FQLAFSLR ISL ++  + PSRRRSLF LA+ M+IF ++  +   L
Sbjct  640   TRSKTSSHMALVRSFQLAFSLRGISLDQEGGLQPSRRRSLFTLASYMLIFSARAGNLPEL  699

Query  707   AVSAKALLTDKTMDPFLQLVDECHLK---VNPNPKARASYGSKEDDEAAKRSLSGIEISK  877
                 KA LTDKT+DP+L+LV++  L+   V  +    A YGSKEDD AA +SL  IE   
Sbjct  700   IPIVKASLTDKTVDPYLKLVEDIQLQAVCVKSDVDGVA-YGSKEDDLAASKSLLSIE-PD  757

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQS  1045
                 E+  S ++   +K   D+ + I++QLLQ F PD+  P+G     +         Q 
Sbjct  758   PHLKETVISHLMTRFEKLSEDELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQM  817

Query  1046  DDKTNDEVVDPTFTVDDL------GSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +  +E++      D+       GS SD   +   ST ++L VNE LDSVLET+ QV  
Sbjct  818   GFQAFEEILPLAAMTDEEAFPEANGSQSDRKTSLSISTLDVLSVNELLDSVLETARQVAS  877

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSE-ETIWQPPSGN  1369
              S + P  + +  + SQCEA   GK  +M    +F+   + +     +E E ++ P    
Sbjct  878   FSVS-PTPIPYDQMKSQCEALVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKM  936

Query  1370  PFA-DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              F+ D       Q       A C+ E+ +H SF +LP SSPYD FLKAAG
Sbjct  937   EFSEDRKLIIREQGHVRGQLALCSQEFGQH-SF-RLPPSSPYDKFLKAAG  984



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 [Fragaria vesca 
subsp. vesca]
Length=998

 Score =   258 bits (658),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 199/546 (36%), Positives = 291/546 (53%), Gaps = 73/546 (13%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCP---RQAPAGGALSKRKS  172
               KAFP+ALFHQ+LLAM   D+ETR+GAH +FS+VLVPS + P   R+  +  A+S   S
Sbjct  484   HKKAFPDALFHQLLLAMTHLDHETRIGAHSIFSIVLVPSVLVPSLQRKMNSVQAVSGFSS  543

Query  173   IQRTLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNML-----NRLTSTYSRSLSVK  337
             +    SR+  V   S ++ DK GK+  +  +G  +  ++ +     N+   +YS   ++ 
Sbjct  544   V----SRSDFVKDGSFSIKDK-GKDTGAPANGELREEESQISDVCENQSGKSYSFKSALT  598

Query  338   PGSEETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLL  517
              G  E P             SL++ S Q+S+LLSSI+VQA S  NTP +FEA+AH+Y++ 
Sbjct  599   GGRAELP-------------SLRLSSHQVSLLLSSIWVQATSAENTPANFEAMAHSYNVA  645

Query  518   MLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSF  697
             +LF+R+K SSH +L+R FQLAFS+R++SL     +  SRRRSL+ LA+ M+IF ++  +F
Sbjct  646   LLFTRSKASSHMALVRCFQLAFSIRTLSLDRDGGLQESRRRSLYTLASYMLIFSARAGNF  705

Query  698   IPLAVSAKALLTDKTMDPFLQLVDECHLK---VNPNPKARASYGSKEDDEAAKRSLSGIE  868
               L    KALLTD+ +DP LQLVD+  L+   ++ N + + S GS ED+ AA +S S  E
Sbjct  706   PELIPIVKALLTDQMVDPCLQLVDDILLQAVSIDSNME-KLSSGSHEDEVAALKSHSAAE  764

Query  869   ISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNH  1036
             +  +   E+  S  +        D+ + IK+QLL  F PD+  P+G     +        
Sbjct  765   LDDQLLKENVISHFMTKFAILSEDELSSIKKQLLLGFSPDDAFPLGAPLFMETPRPCSPL  824

Query  1037  NQSDDKTNDEVVDPTFTVDDLGSHSDPNAHPD--------------STPNLLDVNEFLDS  1174
              Q D    DEV+ P       GS +D  A P+              +T ++L+VN+ LDS
Sbjct  825   AQIDFADFDEVMPP-------GSLTDEEAFPEPSGSQSERKTSLSINTLDILNVNQLLDS  877

Query  1175  VLETSNQVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNFREDGNDEPD---FNFS  1336
             VLET+ QV    A+ P   T   +  + SQCEA   GK  +M        + +      S
Sbjct  878   VLETAQQV----ASFPVSTTPVPYDQMKSQCEALVTGKQQKMAVLHSFKHQQETKALVLS  933

Query  1337  EETIWQPPSGNPFA------DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDN  1498
              E+  +  +  P A      D+      Q         C+ EY +H SF +LP SSPYD 
Sbjct  934   SESENKSHASLPMALESSEGDSKVKDEEQIQAKNQLLVCSREYGQH-SF-KLPPSSPYDK  991

Query  1499  FLKAAG  1516
             FLKAAG
Sbjct  992   FLKAAG  997



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   254 bits (650),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 191/279 (68%), Gaps = 20/279 (7%)
 Frame = +2

Query  2    QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
            QNKAFPE+LFHQ+LLAMV PD ET +GAHRVFSVVLVPSSVCP  + A     K + +QR
Sbjct  485  QNKAFPESLFHQLLLAMVHPDRETHVGAHRVFSVVLVPSSVCPHPSSASMGSYKIQDLQR  544

Query  182  TLSRTVSVFSSSAALFDKLGK-----NQSSGKDGMD---------QNTQN--MLNRLTST  313
            TLSRTVSVFSSSAALF KL +      +S+ +D +D         QN+ N   L +L S+
Sbjct  545  TLSRTVSVFSSSAALFGKLRREMFSLRESTCQDNVDKVSNSDDGQQNSGNDAKLYKLQSS  604

Query  314  YSRSLSVKPGS---EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEH  484
             SR  S+K  S       N+  NP    + +SL++ SRQI++LLSS+  QA+S  NTPE+
Sbjct  605  QSRMRSIKGTSLPSISEENSSSNPYREMDPISLRLSSRQITLLLSSLRAQAMSPENTPEN  664

Query  485  FEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATS  664
            +EAIAHTY L +LFSR K S +E L+R FQLAFSLR+ISL  +  MPPSRRRSLF LATS
Sbjct  665  YEAIAHTYCLALLFSRAKNSFNEVLVRSFQLAFSLRNISLRGEGIMPPSRRRSLFTLATS  724

Query  665  MIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHL  781
            MI+F +K ++ IPL   AK+ LT+KT+  F   V  C++
Sbjct  725  MIVFSAKAFNIIPLIPIAKSSLTEKTVSNFFG-VGSCNI  762



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   257 bits (656),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 196/541 (36%), Positives = 277/541 (51%), Gaps = 64/541 (12%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
               KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS V P        L ++ +  +
Sbjct  484   HKKAFPDALFHQLLLAMGHPDHETRVGAHSIFSLVLMPSLVAPW-------LEQKMNPLQ  536

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDG---MDQNTQNMLNRLTSTYSRSLSVKPGSEE  352
              +S +VS         D     Q  GKD    ++   +   + L+  Y + L    G + 
Sbjct  537   AVSASVSTLQKVK---DGSFSIQDEGKDTGVPLNGELEKEGSELSDVYEKQLDQSYGFKS  593

Query  353   TPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSR  532
                 G       E  SL++ S Q+S+LLSSI+VQA S  NTPE+FEA+AHTY++ +LF+R
Sbjct  594   ALTCGRT-----ELTSLRLSSHQVSLLLSSIWVQATSATNTPENFEAMAHTYNVALLFTR  648

Query  533   TKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAV  712
             +K SSH +L R FQLAFS+R+ISL     + PSRRRSLF LA+ M++F ++      L  
Sbjct  649   SKASSHMALARCFQLAFSIRAISLDLDGGLHPSRRRSLFTLASYMLVFSARAGDLPELIP  708

Query  713   SAKALLTDKTMDPFLQLVDECHLKVNP--NPKARASYGSKEDDEAAK-RSLSGIEISKKQ  883
               KA L DK +DP LQLVD+  L+     + K + SYGS ++DE A   SLS +E+  + 
Sbjct  709   IFKASLEDKMVDPCLQLVDDTWLQAVSIESYKEKISYGSLQEDEVATFNSLSAVELDDQL  768

Query  884   STESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDD  1051
               E+  S  +    K   D+ + IK++LLQ F PD+  P+G     +         Q D 
Sbjct  769   LKETVISHFMTKFAKLSEDELSSIKKELLQGFSPDDAFPLGAPLFMETPRPCSPLAQIDF  828

Query  1052  KTNDEVVDPTFTVDDLGSHSDPNAHPD--------------STPNLLDVNEFLDSVLETS  1189
                DEV+ P       GS +D  A P+              +T ++L VN+ LDSVLET+
Sbjct  829   PDFDEVMPP-------GSLTDEEAFPEPSGSQSDRKTSLSINTLDILSVNQLLDSVLETA  881

Query  1190  NQVGRQSAAPPAGMT---FMDVASQCEAFQEGKGNRMNFREDGNDEPDFN-------FSE  1339
                 RQ A+ P   T   +  + SQCEA   GK  +M        + D         F  
Sbjct  882   ----RQVASFPVSTTPIPYDQMKSQCEALVTGKQQKMAVLHSFKHQVDAKAIVLSSEFDN  937

Query  1340  ETIWQPPSGNPFADNNTaaagqpvnaa--apaSCATEYQRHPSFMQLPASSPYDNFLKAA  1513
                  P +    ++ +     +           C+ E  +H SF +LP SSPYD FLKAA
Sbjct  938   TCPTLPTTAMELSEGDLKLKNKEQVRVQNQLILCSREIGQH-SF-KLPPSSPYDKFLKAA  995

Query  1514  G  1516
             G
Sbjct  996   G  996



>gb|AAX94774.1| cyclin-related protein 1 [Cucumis sativus]
Length=489

 Score =   247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 193/534 (36%), Positives = 278/534 (52%), Gaps = 83/534 (16%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
              KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS  CP        + ++K+I   
Sbjct  8     KKAFPDALFHQLLLAMAHPDHETRIGAHDIFSIVLMPSIKCP--------MMEQKTIS--  57

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNN  364
              S TVS    S+    KL     S KD  +  ++++  +L S                  
Sbjct  58    -SDTVSWLPFSSPT-QKLTSGGFSFKDDDNHVSESINGKLNS------------------  97

Query  365   GENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKS  544
                         L++ S Q+ +LLSSI+VQA S  NTP +FEA+A TYS+ +LF+R+K S
Sbjct  98    ------------LRLSSHQVRLLLSSIWVQATSADNTPANFEAMAQTYSIALLFTRSKTS  145

Query  545   SHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKA  724
             SH +L+R FQLAFSLRSI++ ++  + PSRRRS+F LA+ M++F ++      L    KA
Sbjct  146   SHMALVRCFQLAFSLRSIAVDQEGGLLPSRRRSIFTLASFMLLFSARVGDLPDLTTVIKA  205

Query  725   LLTDKTMDPFLQLVDECHL---KVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTES  895
              L +K +DP LQLV++  L   +V  + K    +GS+ED+ AA + LS +E+ ++Q  E+
Sbjct  206   SLDNKMVDPHLQLVNDIRLLAVRVK-SEKDSVPFGSEEDEVAALKFLSILELDEQQLKET  264

Query  896   FASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKT----ND  1063
               S            + + I+EQLL  FLPDE  P+G     +         K      D
Sbjct  265   VVSHFTIKYANLSEAELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYD  324

Query  1064  EVVDPTFTVDD------LGSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGR--QSAA  1216
             E + P    DD       GS SD   +   S  ++L+VN+ L+SVLET+ QV     S+A
Sbjct  325   EGMPPAALTDDEAFLEPSGSQSDRKTSLSISNLDILNVNQLLESVLETARQVASFPVSSA  384

Query  1217  PPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSE-ETIWQPPSGN----  1369
             P   + +  + SQCEA    K  +M    +F+    ++     SE ET++ P   N    
Sbjct  385   P---VPYDQMKSQCEALVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEI  441

Query  1370  -----PFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                   F +N T              C+ EY RH   ++LP SSPYD FLKAAG
Sbjct  442   VQGDLKFYNNETNRGQDQPLL-----CSHEYGRHS--LRLPPSSPYDKFLKAAG  488



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score =   256 bits (654),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 288/530 (54%), Gaps = 44/530 (8%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LLAM  PD+ETR+GA+ +FS+VL+P  +    +      S+  S   + 
Sbjct  471   KAFPDALFHQLLLAMAHPDHETRVGANNIFSIVLMPL-LLSSWSDQDKITSEAVSCDLSF  529

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLT-------STYSRSLSVKPGS  346
             + +  V S S A  D+  K+Q+   DG  +   N  + +         ++ RS S K   
Sbjct  530   AASKKVRSQSFAFQDE-SKDQAEHIDGRLKENGNQASDMAVKKSIMYQSHVRSYSFKDAL  588

Query  347   EETPNNGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLF  526
                   G+     H    L++ S Q+S+LLSSI+VQA S  N P +FEA+A TY++ +LF
Sbjct  589   ------GDGKMLSH----LRLSSHQVSLLLSSIWVQANSAENIPANFEAMARTYNIAVLF  638

Query  527   SRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPL  706
             +R+K SSH +L+R FQLAFSLR ISL ++  + PSRRRSLF LA+ M+IF ++  +   L
Sbjct  639   TRSKTSSHMALVRSFQLAFSLRGISLDQEGGLQPSRRRSLFTLASYMLIFSARAGNLPEL  698

Query  707   AVSAKALLTDKTMDPFLQLVDECHLK---VNPNPKARASYGSKEDDEAAKRSLSGIEISK  877
                 KA LTDKT+DP+L+LV++  L+   V  +    A YGSKEDD AA +SL  IE   
Sbjct  699   IPIVKASLTDKTVDPYLKLVEDIQLQAVCVKSDVDGVA-YGSKEDDLAASKSLLSIE-PD  756

Query  878   KQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQS  1045
                 E+  S ++   +K   D+ + I++QLLQ F PD+  P+G     +         Q 
Sbjct  757   PHLKETVISHLMTRFEKLSEDELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQM  816

Query  1046  DDKTNDEVVDPTFTVDDL------GSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVGR  1204
               +  +E++      D+       GS SD   +   ST ++L VNE LDSVLET+ QV  
Sbjct  817   GFQAFEEILPLAAMTDEEAFPEANGSQSDRKTSLSISTLDVLSVNELLDSVLETARQVAS  876

Query  1205  QSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSE-ETIWQPPSGN  1369
              S + P  + +  + SQCEA   GK  +M    +F+   + +     +E E ++ P    
Sbjct  877   FSVS-PTPIPYDQMKSQCEALVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKM  935

Query  1370  PFA-DNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
              F+ D       Q       A C+ E+ +H SF +LP SSPYD FLKAAG
Sbjct  936   EFSEDRKLIIREQGHVRGQLALCSQEFGQH-SF-RLPPSSPYDKFLKAAG  983



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   256 bits (653),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 190/549 (35%), Positives = 287/549 (52%), Gaps = 58/549 (11%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
             Q KAFPEALFHQ+LLAM  PD+ETR+G+HR+FS +LVP+ VCP   P           + 
Sbjct  486   QKKAFPEALFHQLLLAMTHPDHETRVGSHRIFSAILVPTIVCPWSIPIIPLAFNGYDPEG  545

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQN----MLNRL-------TSTYSRSL  328
             T+   +S F+ S  + +K     S G   +D NT+     M NR+       ++++ ++L
Sbjct  546   TILVALSGFAPSGIIMEKFTHKSSFGNGSLD-NTKELGDAMRNRMEDRSQKSSASFKQNL  604

Query  329   SVKPGSEETP----------NNGENPQE--HHEGLSLKMKSRQISMLLSSIFVQAISHLN  472
              V P   ++           N+G+        E + +++ S Q+ +LLSSI+VQA S  N
Sbjct  605   -VHPSQSDSQSTVFSHLSAVNDGKAVSRSGEEELIFMRLSSHQVGLLLSSIWVQATSPEN  663

Query  473   TPEHFEAIAHTYSLLMLFSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFA  652
              P ++EA+AHTYSL +LFSR K SSH +L+R FQLAFSLR +++  +  + PSRRR L+ 
Sbjct  664   APSNYEALAHTYSLALLFSRAKNSSHVALVRCFQLAFSLRRMAVDHENSLQPSRRRCLYT  723

Query  653   LATSMIIFLSKTYSFIPLAVSAKALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKED  832
             LA+SM+IF +K      +  S K  L  + +DP L L+++  L+      +   YGS+ED
Sbjct  724   LASSMLIFSAKAGDLPEVVTSVK--LMGRMVDPHLHLIEDSWLQATYFGSSSNVYGSEED  781

Query  833   DEAAKRSLSGIEISKKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQ  1012
             D AA   L  +E   +Q  +S  S I++  +K   +K   ++EQLLQ+F PD+  P+G  
Sbjct  782   DVAAMEFLEKLEKDDEQLKQSVISHIMKKFEKLPEEKLLSLREQLLQEFSPDDALPLGAP  841

Query  1013  RIND----LRNHNQSDDKTNDEVVDPTFTVDD------LGSHSDPNAHPDSTPN--LLDV  1156
                +         Q   ++ DEV+ PTF  D         S SD     +S  N  +L V
Sbjct  842   LFMETPYPCSPLAQKGCQSCDEVMTPTFLEDGDNLSDAFRSQSD-RKMSESMNNFDVLSV  900

Query  1157  NEFLDSVLETSNQVGR--QSAAPPAGMTFMDVASQCEAFQEGKGNRMNFRE-------DG  1309
             N+ ++SV+ET+ QV     S  P   + +  + SQCEA   GK  +M+  +       D 
Sbjct  901   NQLIESVIETARQVASLPTSTIP---VPYDQMKSQCEALVIGKQQKMSVLQSFKHQQVDW  957

Query  1310  NDEPDFNFSEETIWQPPSGNPFADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSP  1489
                P+ NF +          P       +  +  +     S ++E ++  SF +LP +SP
Sbjct  958   RVVPEENFVDSV---DAHQTPHLPEAVLSLDEKEHVRRSNSLSSESEQ--SF-RLPPASP  1011

Query  1490  YDNFLKAAG  1516
             YD FLKAAG
Sbjct  1012  YDKFLKAAG  1020



>ref|XP_003597513.1| EFR3-like protein [Medicago truncatula]
 gb|AES67764.1| cyclin-like protein [Medicago truncatula]
Length=969

 Score =   255 bits (652),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 184/522 (35%), Positives = 275/522 (53%), Gaps = 48/522 (9%)
 Frame = +2

Query  5     NKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRT  184
             NKAFP+ALFHQ+LLAM  PD ET++GAH + S+VL+PS V P        L ++K  ++ 
Sbjct  477   NKAFPDALFHQLLLAMAHPDRETQIGAHSILSMVLMPSVVSP-------WLDQKKISKKV  529

Query  185   LSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNN  364
              S  +S+   S +     G++  +GK   ++    +  +   T++ +            +
Sbjct  530   ESDGLSIQHESLS-----GEDPLNGKPVEEKVKAGLSGKKFFTHALA------------D  572

Query  365   GENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKS  544
             G++        SL++ S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LF+R+K S
Sbjct  573   GKDDLR-----SLRLSSHQVSLLLSSIWVQATSAENGPANYEAMAHTYSIALLFTRSKTS  627

Query  545   SHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKA  724
             S+ +L+R FQLAFSLRSISL ++  +PPSRRRSL  LA+ M+IF ++   F  L    KA
Sbjct  628   SYMALVRCFQLAFSLRSISLDQEGGLPPSRRRSLLTLASHMLIFSARAADFSDLIPKVKA  687

Query  725   LLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFAS  904
              LT+  +DPFL+LVD+  L+       +  +GS ED+ AA +SLS +++  +Q  E+  S
Sbjct  688   SLTEAPVDPFLELVDDNLLRAVCIKSDKVVFGSVEDEVAAMKSLSAVQLDDRQLKETVIS  747

Query  905   MIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDKTNDEVVDPTF  1084
               +    K   D+ + IK QLLQ F PD+  P G     +         +     VD   
Sbjct  748   YFMTKFSKLPEDELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPGSPLAQIEFPDVDEIM  807

Query  1085  TVDDL----------GSHSDPNAHPDST-PNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
               DDL          GS SD      +  P++L VN+ L+SVLET+ QV   S +    +
Sbjct  808   AADDLIDEGSGTELSGSQSDRRTSLSTNRPDVLGVNQLLESVLETARQVASISTS-STPL  866

Query  1232  TFMDVASQCEAFQEGKGNRM-NFREDGNDEPDFNF-----SEETIWQPPSGNPFADNNTa  1393
              +  + +QCEA + GK  +M   R   N +          +EE   QP     ++  +  
Sbjct  867   PYDQMKNQCEALETGKQQKMLTIRSFKNQQETKAIVLSSENEEVSRQPVKALEYSKGDLK  926

Query  1394  aagqpv-naaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
                Q    A       ++  R    ++LP SSPYD FLKAAG
Sbjct  927   LVTQEQFQAQDQIRFRSQDTRKQHSLRLPPSSPYDKFLKAAG  968



>ref|XP_006597231.1| PREDICTED: uncharacterized protein LOC100811354 isoform X4 [Glycine 
max]
 ref|XP_006597232.1| PREDICTED: uncharacterized protein LOC100811354 isoform X5 [Glycine 
max]
Length=815

 Score =   253 bits (647),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 269/526 (51%), Gaps = 43/526 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+LLAM  PD ET++GAH VFS+VL+PS   P          K K  Q+
Sbjct  311   HNKAFPDALFHQLLLAMAHPDCETQIGAHSVFSMVLMPSMFSPWLD------HKTKIAQK  364

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               + + S    + +  + L      GK     N +  +      YS S  +  G ++   
Sbjct  365   AQNDSFSTQHETFSGAENLNGKLEEGKAIASVNGKKYVIHPYHRYSFSPKLTDGKDDRS-  423

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
                         SL++ S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LFSR+K 
Sbjct  424   ------------SLRLSSHQVSLLLSSIWVQATSVENGPANYEAMAHTYSIALLFSRSKV  471

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             S++ +L R FQLAFSLRSISL ++  + PSRRRSLF LA+ M+IF ++  +   L    K
Sbjct  472   SNYMALARCFQLAFSLRSISLDQEGGLQPSRRRSLFTLASYMLIFSARAGNVPDLIPKVK  531

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             A LT+ T+DPFL+LVD+  L+       +  YGS+ED+  A +SLS +E+  K   E+  
Sbjct  532   ASLTEATVDPFLELVDDIRLQAVCIESEKIIYGSQEDEFTAVKSLSAVELDDKLLKETVI  591

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG------TQRINDLRNHNQSDDKTND  1063
             S  +    K   D+ + +K QLLQ F PD+  P G      T R+       Q +    D
Sbjct  592   SYFMTKFTKLSEDELSSVKNQLLQGFSPDDAYPSGPPLFMETPRL--CPPLAQIEFPYYD  649

Query  1064  EVVDPTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPP  1222
             E++ P   +++        + PD       + P++L+VN+ LDSVLET+ QV   S +  
Sbjct  650   EIMVPDDLIEEETEPEHSGSQPDRKTSISANYPDVLNVNQLLDSVLETARQVASFSTS-S  708

Query  1223  AGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPFADNNT  1390
               + +  + +QCEA   GK  +M    +F+     +     SE  +          + + 
Sbjct  709   TPLPYDQMKNQCEALVTGKQQKMSVIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSN  768

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQ----LPASSPYDNFLKAAG  1516
                         A     +Q H S  Q    LP SSPYD FLKAAG
Sbjct  769   GDLKLVTQQQFQAQDQARHQSHESGQQHSLRLPPSSPYDKFLKAAG  814



>ref|XP_007131956.1| hypothetical protein PHAVU_011G054800g [Phaseolus vulgaris]
 gb|ESW03950.1| hypothetical protein PHAVU_011G054800g [Phaseolus vulgaris]
Length=986

 Score =   255 bits (651),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 183/526 (35%), Positives = 282/526 (54%), Gaps = 48/526 (9%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LLAM   D+ETR+GAHR+FSVVL+PS   P+         K K  ++  
Sbjct  485   KAFPDALFHQLLLAMAHSDHETRVGAHRIFSVVLMPSLFSPQLD------QKTKMSEKVP  538

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNG  367
             S + S+   S      LG    +GK        ++  +         ++ P       +G
Sbjct  539   SESFSIQHESL-----LGAEYMNGK--------HLEGKAVVGVREKYAIHPYHVHI-FSG  584

Query  368   ENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSS  547
                   H+  S ++ S Q+S+LLSSI++QA S    P +FEA+AHTYS+ +LF+R+K SS
Sbjct  585   ALTDGKHDLSSFRLSSHQVSLLLSSIWIQATSMEGGPANFEAMAHTYSIALLFTRSKTSS  644

Query  548   HESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKAL  727
             + +L+R FQLAFSL S+SL ++  + PSRRRSLF LA+ M+IF ++  +F+ L    KA 
Sbjct  645   YMALVRCFQLAFSLMSLSLDQEGGLQPSRRRSLFTLASYMLIFSARAGNFLELIPKVKAS  704

Query  728   LTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFASM  907
             LT+ T+DPFL+LVD+  L        +  YGS+EDD +A ++LS +++  K+  E+  S 
Sbjct  705   LTNTTVDPFLELVDDVRLCAVYKESEKIVYGSQEDDVSAMKTLSAVKLDDKELKETVISF  764

Query  908   IVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHN----QSDDKTNDEVVD  1075
              +    +   D+ + IK+QL+Q F PD+  P+G     +    +    Q +    DE+V+
Sbjct  765   FLAKFSELSEDELSTIKKQLVQGFSPDDAYPLGPPLFMETPGQSSPLAQIEFPDFDEIVN  824

Query  1076  PTFTVDD------LGSHSDPNAHPDS-TPNLLDVNEFLDSVLETSNQVGRQSAAPPAGMT  1234
             P   +D+       GS SD  +   S  P++L VN+ L SVLET+    RQ A+ P   T
Sbjct  825   PEALMDEETRPELSGSLSDRKSSLSSNNPDILSVNQLLQSVLETA----RQVASFPTSST  880

Query  1235  ---FMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQ---PPSGNPFADN  1384
                +  + +QCEA   GK  +M    +FR           SE  +     P     ++++
Sbjct  881   PVPYDQMKNQCEALVTGKQKKMSVLHSFRHQQETRAIVLSSENELKVSSLPIQTLEYSED  940

Query  1385  NTaaagqpvnaaapaS--CATEYQRHPSFMQLPASSPYDNFLKAAG  1516
             +     Q    A      C+ ++ +  S ++LP +SP+D FL+AAG
Sbjct  941   DLKLVSQQQFQAQYQVRPCSYDFGQQHS-LKLPPASPFDKFLRAAG  985



>ref|XP_006597230.1| PREDICTED: uncharacterized protein LOC100811354 isoform X3 [Glycine 
max]
Length=859

 Score =   253 bits (646),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 186/526 (35%), Positives = 269/526 (51%), Gaps = 43/526 (8%)
 Frame = +2

Query  2     QNKAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQR  181
              NKAFP+ALFHQ+LLAM  PD ET++GAH VFS+VL+PS   P          K K  Q+
Sbjct  355   HNKAFPDALFHQLLLAMAHPDCETQIGAHSVFSMVLMPSMFSPWLD------HKTKIAQK  408

Query  182   TLSRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
               + + S    + +  + L      GK     N +  +      YS S  +  G ++   
Sbjct  409   AQNDSFSTQHETFSGAENLNGKLEEGKAIASVNGKKYVIHPYHRYSFSPKLTDGKDDRS-  467

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
                         SL++ S Q+S+LLSSI+VQA S  N P ++EA+AHTYS+ +LFSR+K 
Sbjct  468   ------------SLRLSSHQVSLLLSSIWVQATSVENGPANYEAMAHTYSIALLFSRSKV  515

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             S++ +L R FQLAFSLRSISL ++  + PSRRRSLF LA+ M+IF ++  +   L    K
Sbjct  516   SNYMALARCFQLAFSLRSISLDQEGGLQPSRRRSLFTLASYMLIFSARAGNVPDLIPKVK  575

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             A LT+ T+DPFL+LVD+  L+       +  YGS+ED+  A +SLS +E+  K   E+  
Sbjct  576   ASLTEATVDPFLELVDDIRLQAVCIESEKIIYGSQEDEFTAVKSLSAVELDDKLLKETVI  635

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMG------TQRINDLRNHNQSDDKTND  1063
             S  +    K   D+ + +K QLLQ F PD+  P G      T R+       Q +    D
Sbjct  636   SYFMTKFTKLSEDELSSVKNQLLQGFSPDDAYPSGPPLFMETPRL--CPPLAQIEFPYYD  693

Query  1064  EVVDPTFTVDDLGSHSDPNAHPD-------STPNLLDVNEFLDSVLETSNQVGRQSAAPP  1222
             E++ P   +++        + PD       + P++L+VN+ LDSVLET+ QV   S +  
Sbjct  694   EIMVPDDLIEEETEPEHSGSQPDRKTSISANYPDVLNVNQLLDSVLETARQVASFSTS-S  752

Query  1223  AGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSEETIWQPPSGNPFADNNT  1390
               + +  + +QCEA   GK  +M    +F+     +     SE  +          + + 
Sbjct  753   TPLPYDQMKNQCEALVTGKQQKMSVIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSN  812

Query  1391  aaagqpvnaaapaSCATEYQRHPSFMQ----LPASSPYDNFLKAAG  1516
                         A     +Q H S  Q    LP SSPYD FLKAAG
Sbjct  813   GDLKLVTQQQFQAQDQARHQSHESGQQHSLRLPPSSPYDKFLKAAG  858



>ref|XP_008445731.1| PREDICTED: uncharacterized protein LOC103488670 isoform X1 [Cucumis 
melo]
Length=991

 Score =   254 bits (648),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 197/536 (37%), Positives = 285/536 (53%), Gaps = 52/536 (10%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS  CP        + ++K+I    
Sbjct  474   KAFPDALFHQLLLAMAHPDHETRIGAHDIFSIVLMPSIKCP--------MMEQKAIS---  522

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLN--RLTST-----YSRSLSVKPGS  346
             S TVS     +     +G   S   D  D++    +N  RL  +      S + +  P  
Sbjct  523   SETVSWLPFGSPTQKLIGGGFSFKDD--DKHASESINGVRLEESQAADLVSENYTTHPSR  580

Query  347   EETPNNGENPQEHHEGL-SLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLML  523
              E+ +   +  E    L SL++ S Q+ +LLSSI+VQA S  NTP +FEA+A TYS+ +L
Sbjct  581   HESSSFNHSLNESKTKLTSLRLSSHQVRLLLSSIWVQATSADNTPANFEAMAQTYSIALL  640

Query  524   FSRTKKSSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIP  703
             F+R+K SSH +L+R FQLAFSLRSI++ ++  + PSR+RS+F LA+ M++F ++      
Sbjct  641   FTRSKTSSHMALVRCFQLAFSLRSIAVDQEGGLLPSRKRSIFTLASFMLLFSARAGDLPD  700

Query  704   LAVSAKALLTDKTMDPFLQLVDECHL---KVNPNPKARASYGSKEDDEAAKRSLSGIEIS  874
             L    KA L +K +DP LQLV++  L   +V  + K R  +GS+ED+ AA + LS +E+ 
Sbjct  701   LTTVIKASLDNKMVDPHLQLVNDTRLLAVRVK-SEKDRVPFGSEEDEVAASKFLSILELD  759

Query  875   KKQSTESFASMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRINDLRNHNQSDDK  1054
             ++Q  E+  S            + + I+EQLL  FLPDE  P+G     +         K
Sbjct  760   EQQLKETVVSHFTIKYANLSEAELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAK  819

Query  1055  T----NDEVVDPTFTVDD------LGSHSD-PNAHPDSTPNLLDVNEFLDSVLETSNQVG  1201
                   DE + P    DD       GS SD   +   S  ++L VN+ L+SVLET+ QV 
Sbjct  820   LAFPDYDEGMPPAALTDDEAFLEPSGSQSDRKTSLSISNLDILSVNQLLESVLETARQVA  879

Query  1202  R--QSAAPPAGMTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFSE-ETIWQPP  1360
                 S+AP   + +  + SQCEA    K  +M    +F+    ++     SE ET++ P 
Sbjct  880   SFPVSSAP---VPYDQMKSQCEALVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPL  936

Query  1361  SGNPF----ADNNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAG  1516
               N       D              P  C+ EY RH   ++LP SSPYD FLKAAG
Sbjct  937   PLNTMEIVQGDLKFYNKETNRGQDQPLLCSHEYGRHS--LRLPPSSPYDKFLKAAG  990



>gb|KHG30683.1| Protein EFR3 cmp44E [Gossypium arboreum]
Length=964

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 193/514 (38%), Positives = 287/514 (56%), Gaps = 39/514 (8%)
 Frame = +2

Query  14    FPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTLSR  193
             FP+ALFHQ+LLAM  PD+ETR+GAH +FS+VL+PS + P  +     +++  S   ++S 
Sbjct  462   FPDALFHQLLLAMSHPDHETRVGAHSIFSIVLMPSLLSP-SSEQNKKIAETVSSDLSVSA  520

Query  194   TVSVFSSSAALFDKLGKNQSSGKDGMDQNTQNMLNRLTSTYSRSLSVKPGSEETPNNGEN  373
             +V V S S A  D+ GK Q+   + + +N  N  + +  ++  S S K    +       
Sbjct  521   SVKVRSHSFAFQDE-GKEQT---ERLKENG-NEGSIIYQSHGNSFSFKHALGD-------  568

Query  374   PQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKKSSHE  553
                  +  SL++ S Q+S+LLSSI+VQA S  NTP +FEA+AH++ L +LF+R+K SSH 
Sbjct  569   --RKMQLTSLRLSSHQVSLLLSSIWVQANSTDNTPANFEAMAHSFYLAVLFTRSKTSSHI  626

Query  554   SLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAKALLT  733
             +L+RGFQLAFSLRS+SL ++  + PSRRRSLF LA+ M+IF ++      L    KA LT
Sbjct  627   ALVRGFQLAFSLRSLSLDQEGGLQPSRRRSLFTLASYMLIFSARAGDLPELIPIVKASLT  686

Query  734   DKTMDPFLQLVDECHL---KVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFAS  904
             DK +DP+L+LV++  L   +V  +  + A YGSKEDD AA ++L  IE+      E+  S
Sbjct  687   DKIVDPYLKLVEDVRLQAVRVKSDVDSVA-YGSKEDDAAASKALLAIELDDLHLKETVIS  745

Query  905   MIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDEVV  1072
               +  ++K   D+ + IK+Q+L+ F PD+  P G     +         Q + +  +E++
Sbjct  746   HFMIKIEKLSEDELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFQAFEEIM  805

Query  1073  DPTFTVDDL------GSHSDPNAHPD-STPNLLDVNEFLDSVLETSNQVGRQSAAPPAGM  1231
                   DD       GS S   A    ST ++L VNE LDSVLET+ QV   S + P  +
Sbjct  806   PLAAITDDEAFPEGNGSQSGRKASLSLSTLDVLSVNELLDSVLETARQVASFSVS-PTPI  864

Query  1232  TFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFS-EETIWQPPSGNPFA-DNNTa  1393
              +  + SQCEA   GK  +M    +F+     +  F  + +E +  P     F+ D    
Sbjct  865   PYEQMRSQCEALIIGKQQKMSVIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLI  924

Query  1394  aagqpvnaaapaSCATEYQRHPSFMQLPASSPYD  1495
             +  Q       A C+ EY +H SF +LP SSPYD
Sbjct  925   SNEQVHARGQLALCSLEYGQH-SF-KLPPSSPYD  956



>ref|XP_004507331.1| PREDICTED: uncharacterized protein LOC101496023 isoform X1 [Cicer 
arietinum]
 ref|XP_004507332.1| PREDICTED: uncharacterized protein LOC101496023 isoform X2 [Cicer 
arietinum]
Length=987

 Score =   253 bits (646),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 189/526 (36%), Positives = 271/526 (52%), Gaps = 46/526 (9%)
 Frame = +2

Query  8     KAFPEALFHQILLAMVSPDNETRLGAHRVFSVVLVPSSVCPRQAPAGGALSKRKSIQRTL  187
             KAFP+ALFHQ+LL M  PD ETR+GAH VFS VL+PS   P+         K    Q+  
Sbjct  486   KAFPDALFHQLLLVMAHPDQETRIGAHSVFSTVLMPSLYSPQFN------HKTMMAQKVP  539

Query  188   SRTVSVFSSSAALFDKLGKNQSSGKD--GMDQNTQNMLNRLTSTYSRSLSVKPGSEETPN  361
             S + S+        + + +    G +  G+ +    +  R    YS S ++  G +E   
Sbjct  540   SESSSIQHERFLGAEHINRKPVEGGEVVGVSRKYTVLPYR---GYSFSGALNDGKDELS-  595

Query  362   NGENPQEHHEGLSLKMKSRQISMLLSSIFVQAISHLNTPEHFEAIAHTYSLLMLFSRTKK  541
                         S ++ S Q+S+LLSSI+VQA S  N PE+FEA+AHT+S+ +LF+R+K 
Sbjct  596   ------------SFRLSSHQVSLLLSSIWVQATSMDNGPENFEAMAHTFSIALLFTRSKT  643

Query  542   SSHESLIRGFQLAFSLRSISLSEQAKMPPSRRRSLFALATSMIIFLSKTYSFIPLAVSAK  721
             SS+ +L+R FQLAFSL SISL ++  + PSRRRSLF LA+ M IF ++  +F  L    K
Sbjct  644   SSYMALVRCFQLAFSLMSISLDQEGGLQPSRRRSLFTLASYMFIFSARAGNFPELLRIIK  703

Query  722   ALLTDKTMDPFLQLVDECHLKVNPNPKARASYGSKEDDEAAKRSLSGIEISKKQSTESFA  901
             A L D T+DPFL+LVD+  L+       +  YGS+EDD AA  SLS +E+  K   E+  
Sbjct  704   ASLMDSTVDPFLELVDDVRLQAVNIKSEKIIYGSQEDDVAAMTSLSAVELDDKHLKETVI  763

Query  902   SMIVESLKKSITDKTNLIKEQLLQDFLPDEVCPMGTQRIND----LRNHNQSDDKTNDEV  1069
             S  +    K   D+ + IK+QL Q F PD+  P+G     +         Q +    DE+
Sbjct  764   SHFLTKFSKLPEDELSSIKKQLAQGFSPDDAYPLGPPLFMETPRPCSPLAQIEFPDFDEI  823

Query  1070  VDPTFTVDD------LGSHSDPNAHPD-STPNLLDVNEFLDSVLETSNQVGRQSAAPPAG  1228
               P   +D+       G   D  + P  +   +L VN+ L+SVLET+ QV     +  A 
Sbjct  824   EAPVALMDEEIGPEPSGIQLDCKSSPSFNNLTILSVNQLLESVLETARQVASFPISATA-  882

Query  1229  MTFMDVASQCEAFQEGKGNRM----NFREDGNDEPDFNFS-EETIWQPPSGNPF----AD  1381
             + +  + +QCEA   GK  +M    +F+          FS  ET   PP         +D
Sbjct  883   VPYDQMKNQCEALVSGKQQKMSVLHSFKHQQETRALVLFSANETKVSPPPIKTLEYAESD  942

Query  1382  NNTaaagqpvnaaapaSCATEYQRHPSFMQLPASSPYDNFLKAAGS  1519
                 +  Q         C+ EY++  S ++LP +SPYD FLKAAG 
Sbjct  943   LKLVSQEQIPALYQVRPCSYEYRQQHS-LRLPPASPYDKFLKAAGC  987



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5415623577640