BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24594_g5_i4 len=1477 path=[67826:0-54 70225:55-55 54240:56-684
49036:685-723 70732:724-730 70739:731-732 33189:733-756
33213:757-863 33320:864-1476]

Length=1477
                                                                      Score     E

ref|XP_009770677.1|  PREDICTED: proline-rich receptor-like protei...    310   2e-97   
ref|XP_009770679.1|  PREDICTED: proline-rich receptor-like protei...    306   1e-95   
ref|XP_010649767.1|  PREDICTED: putative serine/threonine-protein...    296   8e-92   
ref|XP_010098337.1|  Proline-rich receptor-like protein kinase PE...    291   5e-90   
ref|XP_007223257.1|  hypothetical protein PRUPE_ppa007249mg             291   9e-90   
ref|XP_010649765.1|  PREDICTED: putative serine/threonine-protein...    290   3e-89   
ref|XP_010649769.1|  PREDICTED: proline-rich receptor-like protei...    288   9e-89   
ref|XP_008223124.1|  PREDICTED: proline-rich receptor-like protei...    287   2e-88   
ref|XP_009629093.1|  PREDICTED: protein kinase APK1B, chloroplast...    283   1e-87   
ref|XP_008223123.1|  PREDICTED: proline-rich receptor-like protei...    285   1e-87   
ref|XP_009770680.1|  PREDICTED: protein kinase APK1B, chloroplast...    283   2e-87   
gb|KDO75093.1|  hypothetical protein CISIN_1g016789mg                   284   4e-87   
ref|XP_006419651.1|  hypothetical protein CICLE_v10005161mg             284   4e-87   
emb|CAN74612.1|  hypothetical protein VITISV_043188                     287   6e-87   Vitis vinifera
ref|XP_008340829.1|  PREDICTED: probable receptor-like protein ki...    282   2e-86   
emb|CDO98894.1|  unnamed protein product                                280   2e-85   
ref|XP_010037055.1|  PREDICTED: proline-rich receptor-like protei...    277   2e-85   
ref|XP_006419652.1|  hypothetical protein CICLE_v10005161mg             279   3e-85   
ref|XP_008390720.1|  PREDICTED: proline-rich receptor-like protei...    279   3e-85   
gb|EYU43917.1|  hypothetical protein MIMGU_mgv1a023031mg                278   4e-85   
ref|XP_010037045.1|  PREDICTED: probable LRR receptor-like serine...    277   6e-85   
ref|XP_010036980.1|  PREDICTED: putative serine/threonine-protein...    278   6e-85   
ref|XP_009339839.1|  PREDICTED: proline-rich receptor-like protei...    278   9e-85   
ref|XP_010037037.1|  PREDICTED: probable LRR receptor-like serine...    277   1e-84   
ref|XP_006342759.1|  PREDICTED: serine/threonine-protein kinase-l...    278   1e-84   
ref|XP_009369125.1|  PREDICTED: proline-rich receptor-like protei...    278   1e-84   
ref|XP_008340830.1|  PREDICTED: proline-rich receptor-like protei...    275   7e-84   
ref|XP_010321146.1|  PREDICTED: serine/threonine-protein kinase-l...    273   7e-84   
ref|XP_011090927.1|  PREDICTED: putative serine/threonine-protein...    275   1e-83   
ref|XP_009352231.1|  PREDICTED: proline-rich receptor-like protei...    273   5e-83   
ref|XP_007035517.1|  Kinase superfamily protein isoform 1               273   6e-83   
ref|XP_008802106.1|  PREDICTED: proline-rich receptor-like protei...    269   2e-82   
ref|XP_008796242.1|  PREDICTED: probable serine/threonine-protein...    272   4e-82   
ref|XP_004296813.1|  PREDICTED: receptor-like protein kinase THES...    270   2e-81   
ref|XP_008802108.1|  PREDICTED: receptor-like protein kinase THES...    265   1e-80   
gb|KDP40006.1|  hypothetical protein JCGZ_02004                         267   1e-80   
ref|XP_010921751.1|  PREDICTED: probable serine/threonine-protein...    265   6e-80   
gb|EMS58706.1|  Nodulation receptor kinase                              263   3e-79   
ref|XP_007009417.1|  Kinase superfamily protein isoform 2               263   3e-79   
ref|XP_007009418.1|  Kinase superfamily protein isoform 3               263   5e-79   
dbj|BAJ92598.1|  predicted protein                                      261   2e-78   
gb|EMT16217.1|  Receptor-like protein kinase THESEUS 1                  261   4e-78   
ref|XP_010243555.1|  PREDICTED: proline-rich receptor-like protei...    260   7e-78   
gb|AAT58825.1|  putative protein kinase                                 254   1e-76   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79088.1|  hypothetical protein OsI_19707                          256   1e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_006654321.1|  PREDICTED: probable leucine-rich repeat rece...    256   2e-76   
ref|XP_002516888.1|  serine/threonine protein kinase, putative          256   2e-76   Ricinus communis
ref|XP_010243554.1|  PREDICTED: proline-rich receptor-like protei...    256   3e-76   
gb|EEE63486.1|  hypothetical protein OsJ_18302                          254   1e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962282.1|  PREDICTED: probable leucine-rich repeat rece...    251   2e-75   
ref|XP_010243553.1|  PREDICTED: proline-rich receptor-like protei...    254   3e-75   
ref|XP_007009416.1|  Kinase superfamily protein isoform 1               255   4e-75   
ref|XP_010241786.1|  PREDICTED: proline-rich receptor-like protei...    252   1e-74   
ref|XP_004962281.1|  PREDICTED: probable leucine-rich repeat rece...    251   2e-74   
ref|XP_010231482.1|  PREDICTED: probable receptor-like protein ki...    249   9e-74   
ref|XP_010243552.1|  PREDICTED: putative serine/threonine-protein...    249   1e-73   
ref|XP_010241801.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-73   
ref|XP_010241794.1|  PREDICTED: proline-rich receptor-like protei...    246   2e-73   
ref|XP_006855470.1|  hypothetical protein AMTR_s00057p00187090          248   2e-73   
ref|XP_010649770.1|  PREDICTED: proline-rich receptor-like protei...    244   8e-73   
ref|XP_010241759.1|  PREDICTED: proline-rich receptor-like protei...    247   1e-72   
ref|XP_010241787.1|  PREDICTED: proline-rich receptor-like protei...    246   1e-72   
ref|XP_010911009.1|  PREDICTED: proline-rich receptor-like protei...    241   2e-72   
ref|XP_009411699.1|  PREDICTED: putative serine/threonine-protein...    246   2e-72   
gb|EPS71437.1|  hypothetical protein M569_03323                         243   5e-72   
ref|XP_008647498.1|  PREDICTED: LOC100272541 isoform X1                 241   1e-71   
ref|XP_009382559.1|  PREDICTED: putative serine/threonine-protein...    244   1e-71   
ref|XP_009382558.1|  PREDICTED: putative serine/threonine-protein...    244   1e-71   
ref|XP_006645295.1|  PREDICTED: receptor-like protein kinase ANXU...    243   4e-71   
ref|NP_001140481.1|  LOC100272541                                       242   7e-71   Zea mays [maize]
gb|ACG32823.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...    239   7e-70   Zea mays [maize]
ref|XP_010909097.1|  PREDICTED: serine/threonine-protein kinase C...    234   3e-69   
ref|XP_010909095.1|  PREDICTED: serine/threonine-protein kinase C...    234   3e-69   
gb|EAY77133.1|  hypothetical protein OsI_05098                          237   5e-69   Oryza sativa Indica Group [Indian rice]
gb|EAZ14756.1|  hypothetical protein OsJ_04683                          237   5e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010909092.1|  PREDICTED: putative serine/threonine-protein...    234   4e-68   
ref|XP_004231741.1|  PREDICTED: putative serine/threonine-protein...    234   5e-68   
ref|XP_004971193.1|  PREDICTED: probable leucine-rich repeat rece...    234   7e-68   
dbj|BAK07663.1|  predicted protein                                      232   7e-68   
ref|XP_010090930.1|  Nodulation receptor kinase                         233   2e-67   
ref|XP_008810477.1|  PREDICTED: protein kinase 2A, chloroplastic-...    230   2e-67   
ref|XP_008810478.1|  PREDICTED: protein kinase 2A, chloroplastic-...    230   3e-67   
ref|XP_002459059.1|  hypothetical protein SORBIDRAFT_03g045200          232   3e-67   Sorghum bicolor [broomcorn]
ref|XP_010249313.1|  PREDICTED: putative serine/threonine-protein...    232   4e-67   
ref|XP_009593052.1|  PREDICTED: nodulation receptor kinase              231   5e-67   
ref|XP_010909094.1|  PREDICTED: protein kinase 2A, chloroplastic-...    229   6e-67   
ref|XP_006844647.1|  hypothetical protein AMTR_s00016p00235240          231   6e-67   
ref|XP_008778862.1|  PREDICTED: putative serine/threonine-protein...    231   6e-67   
ref|XP_008778861.1|  PREDICTED: putative serine/threonine-protein...    231   7e-67   
ref|XP_008810476.1|  PREDICTED: serine/threonine-protein kinase A...    230   8e-67   
ref|XP_011024759.1|  PREDICTED: receptor-like protein kinase HERK...    230   2e-66   
ref|XP_008810475.1|  PREDICTED: protein kinase 2A, chloroplastic-...    230   2e-66   
ref|XP_010249305.1|  PREDICTED: putative serine/threonine-protein...    230   2e-66   
ref|XP_009761544.1|  PREDICTED: nodulation receptor kinase              230   2e-66   
ref|XP_009385501.1|  PREDICTED: wall-associated receptor kinase-l...    229   3e-66   
ref|XP_006645278.1|  PREDICTED: serine/threonine-protein kinase-l...    229   3e-66   
ref|XP_009420340.1|  PREDICTED: putative serine/threonine-protein...    229   4e-66   
ref|XP_010909568.1|  PREDICTED: putative serine/threonine-protein...    229   7e-66   
ref|XP_010682892.1|  PREDICTED: proline-rich receptor-like protei...    229   7e-66   
ref|XP_010909569.1|  PREDICTED: putative serine/threonine-protein...    228   7e-66   
dbj|BAB90755.1|  putative disease resistance protein kinase             228   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682893.1|  PREDICTED: putative serine/threonine-protein...    228   2e-65   
ref|XP_006338747.1|  PREDICTED: nodulation receptor kinase-like i...    228   2e-65   
ref|XP_002303015.1|  kinase family protein                              226   4e-65   Populus trichocarpa [western balsam poplar]
emb|CDP16750.1|  unnamed protein product                                226   4e-65   
ref|XP_003564993.1|  PREDICTED: putative leucine-rich repeat rece...    226   5e-65   
ref|XP_007032051.1|  Kinase superfamily protein                         226   7e-65   
ref|XP_011098971.1|  PREDICTED: putative serine/threonine-protein...    226   1e-64   
ref|XP_008656889.1|  PREDICTED: probable leucine-rich repeat rece...    224   4e-64   
ref|XP_011024761.1|  PREDICTED: putative serine/threonine-protein...    224   4e-64   
gb|KDP41870.1|  hypothetical protein JCGZ_26888                         224   5e-64   
ref|XP_009378057.1|  PREDICTED: nodulation receptor kinase-like         223   6e-64   
ref|XP_008656888.1|  PREDICTED: proline-rich receptor-like protei...    224   7e-64   
ref|XP_010249314.1|  PREDICTED: putative serine/threonine-protein...    223   8e-64   
gb|KHG04671.1|  Proline-rich receptor-like protein kinase PERK8         223   8e-64   
ref|XP_011006133.1|  PREDICTED: proline-rich receptor-like protei...    223   8e-64   
ref|XP_002512819.1|  serine/threonine protein kinase, putative          223   9e-64   Ricinus communis
gb|EMS48868.1|  Receptor-like protein kinase ANXUR1                     223   9e-64   
gb|EYU31881.1|  hypothetical protein MIMGU_mgv1a023868mg                223   1e-63   
ref|XP_002459027.1|  hypothetical protein SORBIDRAFT_03g044740          222   2e-63   Sorghum bicolor [broomcorn]
gb|KDO45969.1|  hypothetical protein CISIN_1g016626mg                   219   3e-63   
ref|XP_007161600.1|  hypothetical protein PHAVU_001G083100g             221   3e-63   
ref|XP_007216792.1|  hypothetical protein PRUPE_ppa023700mg             221   3e-63   
ref|XP_006446906.1|  hypothetical protein CICLE_v10015605mg             221   3e-63   
ref|XP_008231229.1|  PREDICTED: nodulation receptor kinase              221   3e-63   
ref|XP_004304571.1|  PREDICTED: nodulation receptor kinase-like         221   4e-63   
ref|XP_010250484.1|  PREDICTED: receptor-like protein kinase THES...    221   6e-63   
ref|XP_004971158.1|  PREDICTED: serine/threonine-protein kinase-l...    220   6e-63   
ref|XP_010250486.1|  PREDICTED: receptor-like protein kinase THES...    221   6e-63   
ref|XP_006468925.1|  PREDICTED: probable leucine-rich repeat rece...    220   1e-62   
gb|KDO45966.1|  hypothetical protein CISIN_1g016626mg                   220   1e-62   
ref|XP_004493092.1|  PREDICTED: probable receptor-like protein ki...    220   1e-62   
emb|CDM85905.1|  unnamed protein product                                219   3e-62   
gb|EMT07740.1|  Receptor-like protein kinase ANXUR1                     219   3e-62   
ref|XP_002320425.2|  hypothetical protein POPTR_0014s14170g             219   4e-62   Populus trichocarpa [western balsam poplar]
gb|EMS46350.1|  Serine/threonine-protein kinase-like protein ACR4       218   4e-62   
ref|XP_002277073.1|  PREDICTED: probable receptor-like protein ki...    219   4e-62   Vitis vinifera
ref|XP_010066397.1|  PREDICTED: putative serine/threonine-protein...    218   4e-62   
ref|XP_009345184.1|  PREDICTED: nodulation receptor kinase-like         218   5e-62   
ref|XP_006468923.1|  PREDICTED: probable leucine-rich repeat rece...    218   1e-61   
gb|AFK35308.1|  unknown                                                 218   1e-61   
gb|KDO45964.1|  hypothetical protein CISIN_1g016626mg                   217   1e-61   
emb|CAN73905.1|  hypothetical protein VITISV_039777                     218   2e-61   Vitis vinifera
ref|XP_010556327.1|  PREDICTED: proline-rich receptor-like protei...    217   2e-61   
ref|XP_009129490.1|  PREDICTED: nodulation receptor kinase-like         216   2e-61   
ref|XP_008465399.1|  PREDICTED: proline-rich receptor-like protei...    216   2e-61   
ref|XP_003553985.1|  PREDICTED: probable receptor-like protein ki...    216   3e-61   
emb|CDY48978.1|  BnaA02g28180D                                          216   5e-61   
ref|XP_004493095.1|  PREDICTED: probable receptor-like protein ki...    216   5e-61   
ref|XP_008379041.1|  PREDICTED: nodulation receptor kinase-like i...    215   1e-60   
ref|XP_008365349.1|  PREDICTED: nodulation receptor kinase-like i...    215   1e-60   
ref|XP_006598688.1|  PREDICTED: protein kinase family protein iso...    214   1e-60   
gb|KHN46840.1|  Putative receptor-like protein kinase                   214   2e-60   
ref|NP_001235374.1|  protein kinase family protein                      214   2e-60   
ref|XP_008365347.1|  PREDICTED: nodulation receptor kinase-like i...    215   2e-60   
ref|XP_008379039.1|  PREDICTED: nodulation receptor kinase-like i...    215   2e-60   
ref|XP_006468924.1|  PREDICTED: probable leucine-rich repeat rece...    214   3e-60   
ref|XP_006395532.1|  hypothetical protein EUTSA_v10004401mg             214   3e-60   
ref|XP_010556328.1|  PREDICTED: proline-rich receptor-like protei...    213   4e-60   
ref|XP_003624519.1|  Nodulation receptor kinase                         213   4e-60   
ref|XP_008341211.1|  PREDICTED: proline-rich receptor-like protei...    213   6e-60   
ref|XP_004143767.1|  PREDICTED: nodulation receptor kinase-like         213   6e-60   
ref|XP_006291298.1|  hypothetical protein CARUB_v10017433mg             212   2e-59   
ref|NP_189304.2|  protein kinase family protein                         212   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66819.1|  hypothetical protein                                   211   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83640.1|  BnaC07g23800D                                          211   2e-59   
emb|CDY28533.1|  BnaC02g36270D                                          211   2e-59   
ref|XP_006468921.1|  PREDICTED: probable leucine-rich repeat rece...    211   3e-59   
dbj|BAC43728.1|  putative protein kinase                                211   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152029.1|  PREDICTED: nodulation receptor kinase isofor...    211   3e-59   
emb|CDY13653.1|  BnaA06g32700D                                          211   4e-59   
ref|XP_009121453.1|  PREDICTED: putative serine/threonine-protein...    211   4e-59   
ref|XP_010425389.1|  PREDICTED: nodulation receptor kinase-like         210   5e-59   
ref|XP_002875333.1|  kinase family protein                              210   6e-59   
ref|XP_010502605.1|  PREDICTED: nodulation receptor kinase-like         209   1e-58   
ref|XP_010514329.1|  PREDICTED: nodulation receptor kinase-like         209   1e-58   
ref|XP_002990160.1|  hypothetical protein SELMODRAFT_131164             209   2e-58   
ref|XP_002992529.1|  hypothetical protein SELMODRAFT_162409             209   2e-58   
ref|XP_010554148.1|  PREDICTED: probable serine/threonine-protein...    208   3e-58   
ref|XP_010554147.1|  PREDICTED: probable serine/threonine-protein...    207   8e-58   
ref|XP_006446905.1|  hypothetical protein CICLE_v10015605mg             205   8e-58   
ref|XP_010554145.1|  PREDICTED: probable serine/threonine-protein...    207   9e-58   
gb|KDO45970.1|  hypothetical protein CISIN_1g016626mg                   204   1e-57   
ref|XP_010554146.1|  PREDICTED: proline-rich receptor-like protei...    207   2e-57   
ref|NP_001169946.1|  uncharacterized LOC100383845                       206   2e-57   Zea mays [maize]
emb|CDY00187.1|  BnaC09g01140D                                          203   1e-55   
emb|CDY63200.1|  BnaA09g52250D                                          207   2e-55   
ref|XP_009152030.1|  PREDICTED: nodulation receptor kinase isofor...    198   5e-55   
dbj|BAF79953.1|  receptor-like kinase                                   203   3e-54   Marchantia polymorpha
ref|XP_010651159.1|  PREDICTED: probable serine/threonine-protein...    201   5e-54   
ref|XP_008225618.1|  PREDICTED: probable serine/threonine-protein...    199   1e-53   
ref|XP_007205462.1|  hypothetical protein PRUPE_ppa007926mg             191   3e-52   
ref|XP_009367080.1|  PREDICTED: probable leucine-rich repeat rece...    192   1e-51   
ref|XP_010909093.1|  PREDICTED: receptor-like protein kinase HERK...    190   1e-51   
ref|XP_009367079.1|  PREDICTED: protein kinase APK1A, chloroplast...    193   3e-51   
ref|XP_009367078.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   5e-51   
ref|XP_008359242.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   6e-51   
ref|XP_009367077.1|  PREDICTED: protein kinase APK1A, chloroplast...    192   9e-51   
ref|XP_008349749.1|  PREDICTED: probable leucine-rich repeat rece...    190   9e-51   
ref|XP_008359234.1|  PREDICTED: protein kinase APK1A, chloroplast...    191   1e-50   
ref|XP_008349748.1|  PREDICTED: protein kinase APK1A, chloroplast...    190   3e-50   
gb|KHG00527.1|  Serine/threonine-protein kinase-like protein ACR4       186   4e-50   
ref|XP_009335090.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    189   5e-50   
ref|XP_009335089.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    189   8e-50   
ref|XP_009335088.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    189   9e-50   
ref|XP_009335087.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    189   9e-50   
ref|XP_009420341.1|  PREDICTED: probable receptor-like protein ki...    180   4e-48   
ref|XP_007016736.1|  Leucine-rich repeat receptor-like protein ki...    181   6e-48   
ref|XP_010528127.1|  PREDICTED: proline-rich receptor-like protei...    178   1e-47   
ref|XP_004293053.1|  PREDICTED: proline-rich receptor-like protei...    183   2e-47   
ref|XP_010528125.1|  PREDICTED: proline-rich receptor-like protei...    178   4e-47   
ref|XP_007016735.1|  Leucine-rich repeat receptor-like protein ki...    181   5e-47   
ref|XP_010253665.1|  PREDICTED: protein kinase APK1A, chloroplast...    181   5e-47   
ref|XP_010528121.1|  PREDICTED: proline-rich receptor-like protei...    178   6e-47   
ref|XP_007016734.1|  Leucine-rich repeat receptor-like protein ki...    180   1e-46   
gb|EMT31170.1|  Serine/threonine-protein kinase-like protein ACR4       173   1e-45   
gb|KHN11203.1|  Proline-rich receptor-like protein kinase PERK15        173   1e-44   
ref|XP_006592693.1|  PREDICTED: probable leucine-rich repeat rece...    173   2e-44   
ref|XP_007150206.1|  hypothetical protein PHAVU_005G135500g             172   5e-44   
ref|XP_010541334.1|  PREDICTED: serine/threonine-protein kinase-l...    167   2e-43   
ref|XP_010541333.1|  PREDICTED: serine/threonine-protein kinase-l...    167   3e-43   
ref|XP_002530283.1|  serine-threonine protein kinase, plant-type,...    171   3e-43   Ricinus communis
gb|KHN21520.1|  Proline-rich receptor-like protein kinase PERK9         169   3e-43   
ref|XP_002440989.1|  hypothetical protein SORBIDRAFT_09g018470          164   3e-43   Sorghum bicolor [broomcorn]
ref|XP_006594983.1|  PREDICTED: probable leucine-rich repeat rece...    168   4e-43   
ref|XP_010541329.1|  PREDICTED: serine/threonine-protein kinase-l...    167   7e-43   
ref|XP_010541331.1|  PREDICTED: serine/threonine-protein kinase-l...    167   7e-43   
ref|XP_010541330.1|  PREDICTED: serine/threonine-protein kinase-l...    167   8e-43   
ref|XP_010541332.1|  PREDICTED: serine/threonine-protein kinase-l...    167   9e-43   
ref|NP_001045282.2|  Os01g0929200                                       159   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006594979.1|  PREDICTED: probable leucine-rich repeat rece...    168   1e-42   
ref|XP_003597233.1|  Receptor-like protein kinase ANXUR2                169   1e-41   
gb|KDO73271.1|  hypothetical protein CISIN_1g009644mg                   164   6e-41   
ref|XP_010098195.1|  Proline-rich receptor-like protein kinase PERK8    163   8e-41   
ref|XP_006424580.1|  hypothetical protein CICLE_v10028221mg             163   1e-40   
ref|XP_006488100.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-40   
ref|XP_006488101.1|  PREDICTED: probable leucine-rich repeat rece...    160   2e-40   
ref|XP_004487115.1|  PREDICTED: probable leucine-rich repeat rece...    159   8e-40   
ref|XP_004487113.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-39   
ref|XP_004487114.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-39   
dbj|BAF46308.1|  leucine-rich repeat transmembrane protein kinase       156   4e-39   Ipomoea nil [qian niu]
dbj|BAD87127.1|  receptor protein kinase-like                           152   7e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768306.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-37   
ref|XP_007205469.1|  hypothetical protein PRUPE_ppa008002mg             150   2e-37   
gb|KCW85796.1|  hypothetical protein EUGRSUZ_B02547                     148   3e-37   
gb|KCW85799.1|  hypothetical protein EUGRSUZ_B02547                     147   4e-37   
emb|CAB62020.1|  receptor-like protein kinase homolog                   152   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426068.1|  PREDICTED: receptor-like protein kinase HERK 1     153   7e-37   
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    155   9e-37   
ref|XP_009628064.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-36   
ref|XP_002965380.1|  hypothetical protein SELMODRAFT_24884              147   1e-36   
ref|XP_010326255.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-36   
emb|CDX99115.1|  BnaA06g18060D                                          153   2e-36   
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-36   Vitis vinifera
ref|XP_004247017.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-36   
ref|XP_002977227.1|  hypothetical protein SELMODRAFT_24883              147   2e-36   
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-36   
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-36   
ref|XP_008245810.1|  PREDICTED: probable leucine-rich repeat rece...    149   3e-36   
ref|XP_006418923.1|  hypothetical protein EUTSA_v10002401mg             153   3e-36   
ref|XP_009149977.1|  PREDICTED: receptor-like protein kinase HERK 1     152   4e-36   
emb|CDX86076.1|  BnaC03g55910D                                          152   4e-36   
ref|XP_010514958.1|  PREDICTED: receptor-like protein kinase HERK...    152   4e-36   
ref|XP_010043803.1|  PREDICTED: serine/threonine-protein kinase P...    147   4e-36   
ref|XP_010259987.1|  PREDICTED: receptor-like protein kinase HERK 1     152   4e-36   
ref|XP_010503244.1|  PREDICTED: receptor-like protein kinase HERK 1     152   4e-36   
ref|NP_200778.1|  putative receptor-like protein kinase                 152   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290599.1|  hypothetical protein CARUB_v10016688mg             152   5e-36   
ref|XP_002875777.1|  hypothetical protein ARALYDRAFT_905825             152   5e-36   
ref|NP_190214.1|  receptor-like protein kinase HERK 1                   152   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    152   5e-36   
gb|KCW85797.1|  hypothetical protein EUGRSUZ_B02547                     147   6e-36   
gb|AAQ82660.1|  Pto-like serine/threonine kinase                        147   6e-36   Capsicum chinense [bonnet pepper]
ref|XP_004163829.1|  PREDICTED: probable LRR receptor-like serine...    150   6e-36   
gb|KDO73009.1|  hypothetical protein CISIN_1g003341mg                   152   6e-36   
emb|CBI31162.3|  unnamed protein product                                154   6e-36   
ref|XP_010905238.1|  PREDICTED: receptor-like protein kinase THES...    152   6e-36   
ref|XP_008775443.1|  PREDICTED: receptor-like protein kinase THES...    152   6e-36   
ref|XP_009766353.1|  PREDICTED: receptor-like protein kinase HERK 1     152   7e-36   
ref|XP_009596877.1|  PREDICTED: receptor-like protein kinase HERK 1     152   7e-36   
ref|XP_010682227.1|  PREDICTED: probable leucine-rich repeat rece...    152   8e-36   
ref|XP_009150283.1|  PREDICTED: receptor-like protein kinase HERK 1     152   8e-36   
emb|CDX82981.1|  BnaA01g19810D                                          152   8e-36   
gb|EMT18733.1|  Putative LRR receptor-like serine/threonine-prote...    148   8e-36   
ref|XP_004490733.1|  PREDICTED: probable LRR receptor-like serine...    152   8e-36   
emb|CDX68370.1|  BnaC01g24480D                                          151   9e-36   
ref|XP_002978931.1|  hypothetical protein SELMODRAFT_109804             147   1e-35   
ref|XP_008245239.1|  PREDICTED: probable leucine-rich repeat rece...    148   1e-35   
ref|XP_010535512.1|  PREDICTED: receptor-like protein kinase HERK 1     151   1e-35   
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    152   1e-35   
ref|XP_004490730.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-35   
ref|XP_006344368.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-35   
ref|XP_006424719.1|  hypothetical protein CICLE_v10027823mg             151   1e-35   
gb|KDO73010.1|  hypothetical protein CISIN_1g003341mg                   151   1e-35   
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...    152   1e-35   
gb|ACO25571.1|  protein kinase-coding resistance protein                144   1e-35   
ref|XP_011025559.1|  PREDICTED: serine/threonine-protein kinase PBS1    146   1e-35   
ref|XP_008793424.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-35   
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-35   
ref|XP_007142004.1|  hypothetical protein PHAVU_008G244400g             151   2e-35   
dbj|BAD73350.1|  protein kinase-like                                    147   2e-35   
gb|ACO25565.1|  protein kinase-coding resistance protein                144   2e-35   
gb|KEH43006.1|  malectin/receptor-like kinase family protein            150   2e-35   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             150   2e-35   
ref|XP_007142017.1|  hypothetical protein PHAVU_008G245600g             150   2e-35   
ref|XP_006406269.1|  hypothetical protein EUTSA_v10021237mg             144   2e-35   
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    150   3e-35   
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     150   3e-35   
ref|NP_001045466.1|  Os01g0960400                                       150   3e-35   
ref|XP_002299052.1|  kinase family protein                              150   3e-35   
ref|XP_002962983.1|  hypothetical protein SELMODRAFT_78967              141   3e-35   
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
ref|XP_001759560.1|  predicted protein                                  142   3e-35   
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
ref|XP_002276020.1|  PREDICTED: probable LRR receptor-like serine...    150   3e-35   
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
emb|CBI15799.3|  unnamed protein product                                150   3e-35   
ref|XP_002866343.1|  hypothetical protein ARALYDRAFT_496102             150   3e-35   
ref|XP_007142006.1|  hypothetical protein PHAVU_008G244600g             146   3e-35   
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    150   3e-35   
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    150   4e-35   
gb|KDP41352.1|  hypothetical protein JCGZ_15759                         147   4e-35   
ref|XP_004487043.1|  PREDICTED: receptor-like protein kinase HERK...    150   4e-35   
gb|EEC79410.1|  hypothetical protein OsI_20362                          150   4e-35   
ref|XP_011039809.1|  PREDICTED: probable receptor-like protein ki...    150   4e-35   
ref|XP_010522022.1|  PREDICTED: probable LRR receptor-like serine...    150   4e-35   
gb|ABR25410.1|  phytosulfokine receptor precursor                       139   4e-35   
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    150   4e-35   
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     150   4e-35   
ref|XP_002534744.1|  kinase, putative                                   146   4e-35   
gb|EEC72208.1|  hypothetical protein OsI_05296                          150   4e-35   
ref|XP_010551448.1|  PREDICTED: serine/threonine-protein kinase P...    144   4e-35   
ref|XP_004142673.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    150   4e-35   
ref|NP_001174468.1|  Os05g0481100                                       150   4e-35   
ref|XP_009350739.1|  PREDICTED: receptor-like protein kinase HERK 1     149   4e-35   
gb|KCW83660.1|  hypothetical protein EUGRSUZ_B00543                     149   4e-35   
ref|XP_010522021.1|  PREDICTED: probable LRR receptor-like serine...    150   4e-35   
emb|CDX80236.1|  BnaC09g35060D                                          149   5e-35   
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    150   5e-35   
ref|XP_001757873.1|  predicted protein                                  149   5e-35   
ref|XP_002512045.1|  conserved hypothetical protein                     149   5e-35   
gb|EEE64118.1|  hypothetical protein OsJ_18950                          150   5e-35   
ref|XP_010651080.1|  PREDICTED: receptor-like protein kinase HERK 1     149   6e-35   
ref|XP_008463287.1|  PREDICTED: probable LRR receptor-like serine...    149   6e-35   
ref|XP_010551447.1|  PREDICTED: serine/threonine-protein kinase P...    144   6e-35   
ref|XP_002980407.1|  hypothetical protein SELMODRAFT_12987              142   6e-35   
ref|XP_006842574.1|  hypothetical protein AMTR_s00077p00152440          149   6e-35   
emb|CDP15606.1|  unnamed protein product                                149   6e-35   
ref|XP_002962688.1|  hypothetical protein SELMODRAFT_23147              142   6e-35   
ref|XP_011037761.1|  PREDICTED: probable receptor-like protein ki...    149   7e-35   
ref|XP_007208086.1|  hypothetical protein PRUPE_ppa001409mg             149   7e-35   
ref|XP_008222676.1|  PREDICTED: receptor-like protein kinase HERK 1     149   7e-35   
ref|XP_004302489.1|  PREDICTED: probable leucine-rich repeat rece...    149   7e-35   
ref|XP_008224034.1|  PREDICTED: receptor-like protein kinase HERK 1     149   7e-35   
ref|XP_008463289.1|  PREDICTED: probable LRR receptor-like serine...    149   8e-35   
ref|XP_010496824.1|  PREDICTED: probable LRR receptor-like serine...    147   8e-35   
ref|XP_010644229.1|  PREDICTED: receptor-like protein kinase THES...    149   8e-35   
ref|XP_003616057.1|  Protein kinase-like protein                        149   8e-35   
ref|XP_003634651.1|  PREDICTED: receptor-like protein kinase THES...    149   9e-35   
ref|NP_001240130.1|  probable LRR receptor-like serine/threonine-...    148   9e-35   
ref|XP_006363345.1|  PREDICTED: receptor-like protein kinase HERK...    149   9e-35   
gb|ACQ44243.1|  THESEUS1                                                144   9e-35   
ref|XP_009416069.1|  PREDICTED: receptor-like protein kinase THES...    148   9e-35   
gb|KDP34926.1|  hypothetical protein JCGZ_09214                         148   9e-35   
emb|CDM84748.1|  unnamed protein product                                147   9e-35   
gb|KGN54467.1|  hypothetical protein Csa_4G336750                       149   1e-34   
ref|XP_009358295.1|  PREDICTED: receptor-like protein kinase HERK 1     148   1e-34   
ref|XP_007206541.1|  hypothetical protein PRUPE_ppa018820mg             149   1e-34   
ref|XP_003567524.2|  PREDICTED: receptor-like protein kinase HERK 1     148   1e-34   
gb|EMT20931.1|  Putative LRR receptor-like serine/threonine-prote...    149   1e-34   
ref|XP_008385197.1|  PREDICTED: receptor-like protein kinase HERK 1     148   1e-34   
ref|XP_002519226.1|  ATP binding protein, putative                      148   1e-34   
emb|CAN77769.1|  hypothetical protein VITISV_009237                     148   1e-34   
ref|XP_010905592.1|  PREDICTED: receptor-like protein kinase THES...    148   1e-34   
ref|XP_009120484.1|  PREDICTED: probable receptor-like protein ki...    148   1e-34   
ref|XP_010552811.1|  PREDICTED: probable receptor-like protein ki...    145   1e-34   
ref|XP_004510997.1|  PREDICTED: probable receptor-like protein ki...    148   1e-34   
ref|XP_006360136.1|  PREDICTED: receptor-like protein kinase THES...    148   1e-34   
dbj|BAK03216.1|  predicted protein                                      145   1e-34   
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    148   1e-34   
emb|CDM84746.1|  unnamed protein product                                148   1e-34   
ref|XP_004251295.1|  PREDICTED: receptor-like protein kinase HERK 1     148   1e-34   
ref|XP_003561504.2|  PREDICTED: receptor-like protein kinase HERK 1     148   1e-34   
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     148   1e-34   
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...    148   1e-34   
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    148   1e-34   
gb|EMT31232.1|  Putative LRR receptor-like serine/threonine-prote...    148   2e-34   
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             148   2e-34   
ref|XP_010045589.1|  PREDICTED: probable receptor-like protein ki...    149   2e-34   
ref|XP_001757874.1|  predicted protein                                  148   2e-34   
gb|EPS60654.1|  hypothetical protein M569_14148                         148   2e-34   
dbj|BAF79955.1|  receptor-like kinase                                   144   2e-34   
dbj|BAJ91302.1|  predicted protein                                      145   2e-34   
gb|KHN30615.1|  Putative LRR receptor-like serine/threonine-prote...    148   2e-34   
ref|XP_006595541.1|  PREDICTED: probable LRR receptor-like serine...    148   2e-34   
ref|XP_004244196.1|  PREDICTED: receptor-like protein kinase THES...    147   2e-34   
gb|KDP38931.1|  hypothetical protein JCGZ_00688                         144   2e-34   
ref|XP_009354540.1|  PREDICTED: receptor-like protein kinase HERK 1     147   2e-34   
emb|CAN75549.1|  hypothetical protein VITISV_043541                     147   2e-34   
ref|XP_006843268.1|  hypothetical protein AMTR_s00080p00131040          147   2e-34   
ref|XP_010424012.1|  PREDICTED: probable LRR receptor-like serine...    145   2e-34   
ref|XP_010685859.1|  PREDICTED: receptor-like protein kinase HERK 1     147   2e-34   
ref|XP_004302516.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-34   
ref|XP_010455405.1|  PREDICTED: probable receptor-like protein ki...    147   2e-34   
emb|CDP01074.1|  unnamed protein product                                145   2e-34   
ref|XP_008800166.1|  PREDICTED: receptor-like protein kinase THES...    145   2e-34   
ref|XP_006379812.1|  hypothetical protein POPTR_0008s14520g             142   2e-34   
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    148   2e-34   
ref|XP_009620554.1|  PREDICTED: serine/threonine-protein kinase P...    143   2e-34   
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...    148   2e-34   
ref|XP_002979054.1|  hypothetical protein SELMODRAFT_177353             143   2e-34   
gb|EMT31233.1|  Putative LRR receptor-like serine/threonine-prote...    147   2e-34   
ref|XP_009337807.1|  PREDICTED: probable LRR receptor-like serine...    148   2e-34   
emb|CDM84721.1|  unnamed protein product                                147   2e-34   
dbj|BAJ85679.1|  predicted protein                                      145   2e-34   
ref|XP_010043866.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-34   
tpg|DAA38792.1|  TPA: putative leucine-rich repeat receptor-like ...    145   2e-34   
ref|XP_010043852.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-34   
dbj|BAD82283.1|  putative receptor-like protein kinase 2                148   2e-34   
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-34   
ref|XP_004500393.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-34   
ref|XP_010098559.1|  putative receptor-like protein kinase              147   3e-34   
ref|XP_010675594.1|  PREDICTED: receptor-like protein kinase THES...    147   3e-34   
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...    147   3e-34   
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...    147   3e-34   
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          147   3e-34   
ref|XP_006353008.1|  PREDICTED: probable receptor-like protein ki...    147   3e-34   
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    147   3e-34   
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...    147   3e-34   
gb|KDP21843.1|  hypothetical protein JCGZ_00630                         147   3e-34   
gb|KHN19465.1|  Putative receptor-like protein kinase                   147   3e-34   
ref|XP_002963090.1|  hypothetical protein SELMODRAFT_78793              140   3e-34   
ref|XP_010268798.1|  PREDICTED: receptor-like protein kinase THES...    147   3e-34   
gb|KEH19715.1|  receptor-like kinase, putative                          146   3e-34   
ref|XP_006416035.1|  hypothetical protein EUTSA_v10008007mg             142   3e-34   
gb|EAY76270.1|  hypothetical protein OsI_04206                          147   3e-34   
ref|XP_008244528.1|  PREDICTED: probable LRR receptor-like serine...    147   3e-34   
ref|XP_004966605.1|  PREDICTED: probable receptor-like protein ki...    147   3e-34   
gb|EPS71974.1|  hypothetical protein M569_02784                         143   3e-34   
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    147   4e-34   
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...    147   4e-34   
ref|XP_004233885.1|  PREDICTED: probable receptor-like protein ki...    147   4e-34   
ref|XP_010477726.1|  PREDICTED: protein kinase APK1B, chloroplast...    142   4e-34   
ref|XP_003539634.1|  PREDICTED: probable receptor-like protein ki...    147   4e-34   
ref|XP_004300050.1|  PREDICTED: probable leucine-rich repeat rece...    147   4e-34   
ref|XP_006644909.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-34   
ref|XP_006595442.1|  PREDICTED: receptor-like protein kinase THES...    143   4e-34   
gb|KHN40602.1|  Putative LRR receptor-like serine/threonine-prote...    147   4e-34   
gb|EMT01451.1|  Receptor-like protein kinase HERK 1                     147   4e-34   
ref|XP_010542705.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-34   
ref|XP_003541604.1|  PREDICTED: probable receptor-like protein ki...    147   4e-34   
ref|XP_003552328.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-34   
gb|KEH38803.1|  malectin/receptor-like kinase family protein            146   4e-34   
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     147   4e-34   
ref|XP_010672753.1|  PREDICTED: receptor-like protein kinase HERK 1     146   4e-34   
tpg|DAA57112.1|  TPA: putative transmembrane protein kinase famil...    147   5e-34   
gb|KDP44164.1|  hypothetical protein JCGZ_05631                         146   5e-34   
ref|XP_010093014.1|  Receptor-like protein kinase HERK 1                146   5e-34   
ref|XP_009370883.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-34   
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-34   
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    145   5e-34   
ref|XP_011098356.1|  PREDICTED: receptor-like protein kinase THES...    146   5e-34   
ref|XP_006429976.1|  hypothetical protein CICLE_v100110351mg            145   5e-34   
ref|XP_003561111.2|  PREDICTED: probable receptor-like protein ki...    146   5e-34   
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-34   
gb|EEC79425.1|  hypothetical protein OsI_20397                          147   5e-34   
ref|XP_009765259.1|  PREDICTED: serine/threonine-protein kinase P...    142   5e-34   
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...    147   5e-34   
gb|ACO25569.1|  protein kinase-coding resistance protein                140   6e-34   
gb|ACO25567.1|  protein kinase-coding resistance protein                140   6e-34   
gb|ACO25566.1|  protein kinase-coding resistance protein                140   6e-34   
ref|XP_007140045.1|  hypothetical protein PHAVU_008G079800g             146   6e-34   
ref|XP_003552905.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-34   
emb|CDY67402.1|  BnaCnng54760D                                          145   6e-34   
ref|XP_007208566.1|  hypothetical protein PRUPE_ppa023856mg             145   6e-34   
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     146   6e-34   
emb|CDY61604.1|  BnaC03g71330D                                          146   6e-34   
ref|XP_009795599.1|  PREDICTED: serine/threonine-protein kinase P...    142   6e-34   
ref|XP_008244509.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-34   
ref|XP_008355881.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    143   6e-34   
ref|XP_010477724.1|  PREDICTED: protein kinase APK1B, chloroplast...    141   6e-34   
gb|KHN18646.1|  Putative LRR receptor-like serine/threonine-prote...    146   6e-34   
ref|XP_008357933.1|  PREDICTED: receptor-like protein kinase HERK 1     146   6e-34   
ref|XP_008244520.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-34   
gb|KDP41348.1|  hypothetical protein JCGZ_15755                         140   7e-34   
gb|EEC71706.1|  hypothetical protein OsI_04218                          146   7e-34   
dbj|BAJ93703.1|  predicted protein                                      146   7e-34   
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     146   7e-34   
dbj|BAJ98336.1|  predicted protein                                      146   7e-34   
ref|XP_004296245.1|  PREDICTED: receptor-like protein kinase ANXU...    146   7e-34   
emb|CDP15747.1|  unnamed protein product                                146   7e-34   
ref|XP_006645416.1|  PREDICTED: probable LRR receptor-like serine...    146   7e-34   
ref|XP_002519985.1|  receptor protein kinase, putative                  146   7e-34   
ref|XP_003627741.1|  Kinase-like protein                                146   7e-34   
ref|XP_009130611.1|  PREDICTED: probable LRR receptor-like serine...    146   7e-34   
ref|XP_011041757.1|  PREDICTED: probable LRR receptor-like serine...    146   7e-34   
dbj|BAF79984.1|  receptor-like kinase                                   146   7e-34   
emb|CDY63832.1|  BnaA10g28720D                                          146   7e-34   



>ref|XP_009770677.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770678.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Nicotiana sylvestris]
Length=374

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 179/234 (76%), Gaps = 11/234 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CFC F   + SN+NSD ASSDPSA V         ++ L RGG     + FRM+ELE+AT
Sbjct  26   CFCAFRNWKNSNKNSDGASSDPSAVV---------TMELKRGGPSPSFKQFRMEELEKAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            +NFDESNLIGCGSFGLVFKG L DGT+VAIK RS  P+Q+F+EEVA LS  QHRNLVNLL
Sbjct  77   RNFDESNLIGCGSFGLVFKGLLCDGTVVAIKRRSGTPKQEFNEEVAHLSRIQHRNLVNLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ++GY +LV EYLPNG+MCNHLY  G+DS+TKLEFKQRLSIA GTAKGL HLHGQ P
Sbjct  137  GYCLDSGYSMLVFEYLPNGSMCNHLYDTGKDSATKLEFKQRLSIAIGTAKGLSHLHGQRP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++HGNFKT NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE
Sbjct  197  SIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSVNAFRDPE  248



>ref|XP_009770679.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Nicotiana sylvestris]
Length=372

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 179/234 (76%), Gaps = 13/234 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CFC F   + SN+NSD ASSDPSA V         ++ L RGG     + FRM+ELE+AT
Sbjct  26   CFCAFRNWKNSNKNSDGASSDPSAVV---------TMELKRGGPSPSFKQFRMEELEKAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            +NFDESNLIGCGSFGLVFKG L DGT+VAIK RS  P+Q+F+EEVA LS  QHRNLVNLL
Sbjct  77   RNFDESNLIGCGSFGLVFKGLLCDGTVVAIKRRSGTPKQEFNEEVAHLSRIQHRNLVNLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ++GY +LV EYLPNG+MCNHLY  G+DS+TKLEFKQRLSIA GTAKGL HLHGQ P
Sbjct  137  GYCLDSGYSMLVFEYLPNGSMCNHLY--GKDSATKLEFKQRLSIAIGTAKGLSHLHGQRP  194

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++HGNFKT NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE
Sbjct  195  SIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSVNAFRDPE  246



>ref|XP_010649767.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Vitis vinifera]
 emb|CBI26094.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 176/235 (75%), Gaps = 4/235 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQ-KTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             FC    K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQA
Sbjct  27   WFCKLQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV L
Sbjct  86   TKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTL  145

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            LGYCQE+G Q+LV EYLPNG+MCNHLY  G D++TKLEFK+RLSIA G AKGL HLH   
Sbjct  146  LGYCQESGSQMLVFEYLPNGSMCNHLYDTGLDATTKLEFKRRLSIALGAAKGLRHLHTLK  205

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  PE
Sbjct  206  PPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQHPE  258



>ref|XP_010098337.1| Proline-rich receptor-like protein kinase PERK15 [Morus notabilis]
 gb|EXB74841.1| Proline-rich receptor-like protein kinase PERK15 [Morus notabilis]
Length=382

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 175/234 (75%), Gaps = 3/234 (1%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
              C FH ++ SN+NS+T SSDPSA  E   GGP SS        P GAR FRM+ELE+AT
Sbjct  27   WLCKFHCRKLSNKNSETGSSDPSALAEWNRGGPSSSGVAQPPFGPVGARQFRMEELEKAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F+ESNLIG GSFG V+KGFL DGT VA+K R+  P Q+F+EEVA +S   HRNLV LL
Sbjct  87   KHFNESNLIGYGSFGSVYKGFLHDGT-VAVKRRAGAPGQEFAEEVASVSEIHHRNLVTLL  145

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+GYQ+LV EYLPNG++CNHLY   +D  TKLEFKQR+SIA G AKGLCHLHG  P
Sbjct  146  GYCQESGYQMLVFEYLPNGSVCNHLYDTRKDPPTKLEFKQRISIALGAAKGLCHLHGLKP  205

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDE FI KVADAG+S LL++I  + AGPS +   + F DPE
Sbjct  206  PMVHRNFKTANVLVDEEFIAKVADAGVSKLLEKI--EEAGPSRASSVNVFQDPE  257



>ref|XP_007223257.1| hypothetical protein PRUPE_ppa007249mg [Prunus persica]
 gb|EMJ24456.1| hypothetical protein PRUPE_ppa007249mg [Prunus persica]
Length=376

 Score =   291 bits (744),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 174/234 (74%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QAT
Sbjct  27   WFYKIHCKNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +L
Sbjct  80   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G+Q+LV EY+PNG++CNHLY    +SSTKLEFKQRLSIA G AKGLCHLHG  P
Sbjct  140  GYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPE
Sbjct  200  PMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPE  251



>ref|XP_010649765.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
 ref|XP_010649766.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
Length=390

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 176/240 (73%), Gaps = 9/240 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQ-KTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             FC    K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQA
Sbjct  27   WFCKLQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV L
Sbjct  86   TKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTL  145

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            LGYCQE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G AKGL H
Sbjct  146  LGYCQESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALGAAKGLRH  205

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            LH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  PE
Sbjct  206  LHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQHPE  263



>ref|XP_010649769.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 isoform 
X3 [Vitis vinifera]
Length=375

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 176/240 (73%), Gaps = 9/240 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQ-KTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             FC    K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQA
Sbjct  27   WFCKLQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV L
Sbjct  86   TKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTL  145

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            LGYCQE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G AKGL H
Sbjct  146  LGYCQESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALGAAKGLRH  205

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            LH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  P+
Sbjct  206  LHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQHPD  263



>ref|XP_008223124.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Prunus mume]
Length=376

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 174/234 (74%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QAT
Sbjct  27   WFYKTHCKNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +L
Sbjct  80   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G+Q+LV E++PNG++CNHLY    +SSTKLEFKQRLSIA G AKGLCHLHG  P
Sbjct  140  GYCQESGFQVLVFEHIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPE
Sbjct  200  PMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPE  251



>ref|XP_009629093.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -1

Query  649  LALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAP  470
            + L RGG     + FRM+ELE+AT+NFDE NLIGCGSFGLVFKG L DGT+VAIK RS  
Sbjct  1    MELKRGGPSPSFKQFRMEELEKATRNFDEGNLIGCGSFGLVFKGLLCDGTVVAIKRRSGN  60

Query  469  PRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKL  290
            P+Q+F+EEVA LS  QHRNLVNLLGYCQ++GY +LV EYLPNG+MCNHLY  G+DS+TKL
Sbjct  61   PKQEFNEEVAYLSTIQHRNLVNLLGYCQDSGYSMLVFEYLPNGSMCNHLYDTGKDSATKL  120

Query  289  EFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINH  110
            EFKQRLSIA GTAKGL HLHGQ P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  
Sbjct  121  EFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--  178

Query  109  DAAGPSHSIQPSPFIDPE  56
            D AGPS     + F DPE
Sbjct  179  DDAGPSGLSSVNAFRDPE  196



>ref|XP_008223123.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Prunus mume]
Length=378

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 175/236 (74%), Gaps = 11/236 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QAT
Sbjct  27   WFYKTHCKNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +L
Sbjct  80   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYG--MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            GYCQE+G+Q+LV E++PNG++CNHLYG     +SSTKLEFKQRLSIA G AKGLCHLHG 
Sbjct  140  GYCQESGFQVLVFEHIPNGSVCNHLYGNDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGL  199

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP+VH NFKT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPE
Sbjct  200  KPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPE  253



>ref|XP_009770680.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
 ref|XP_009770681.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
 ref|XP_009770682.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
Length=322

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -1

Query  649  LALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAP  470
            + L RGG     + FRM+ELE+AT+NFDESNLIGCGSFGLVFKG L DGT+VAIK RS  
Sbjct  1    MELKRGGPSPSFKQFRMEELEKATRNFDESNLIGCGSFGLVFKGLLCDGTVVAIKRRSGT  60

Query  469  PRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKL  290
            P+Q+F+EEVA LS  QHRNLVNLLGYC ++GY +LV EYLPNG+MCNHLY  G+DS+TKL
Sbjct  61   PKQEFNEEVAHLSRIQHRNLVNLLGYCLDSGYSMLVFEYLPNGSMCNHLYDTGKDSATKL  120

Query  289  EFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINH  110
            EFKQRLSIA GTAKGL HLHGQ P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  
Sbjct  121  EFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--  178

Query  109  DAAGPSHSIQPSPFIDPE  56
            D AGPS     + F DPE
Sbjct  179  DDAGPSGLSSVNAFRDPE  196



>gb|KDO75093.1| hypothetical protein CISIN_1g016789mg [Citrus sinensis]
Length=382

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 169/235 (72%), Gaps = 5/235 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQA  581
              C    K Y N+NS+T SSDPSA VE   G GP S+      G P+GAR F M+ELEQA
Sbjct  27   WLCKSQSKNYQNKNSETGSSDPSALVEWNRGAGPSSATGQPSFG-PQGARQFSMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F E++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV L
Sbjct  86   TKQFSETSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTL  144

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            LGYCQ+NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   
Sbjct  145  LGYCQQNGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLK  204

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP+VH NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPE
Sbjct  205  PPLVHKNFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPE  257



>ref|XP_006419651.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
 ref|XP_006489140.1| PREDICTED: probable receptor-like protein kinase At5g38990-like 
[Citrus sinensis]
 gb|ESR32891.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
Length=382

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 169/235 (72%), Gaps = 5/235 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQA  581
              C    K Y N+NS+T SSDPSA VE   G GP S+      G P+GAR F M+ELEQA
Sbjct  27   WLCKSQSKNYQNKNSETGSSDPSALVEWNRGAGPSSATGQPSFG-PQGARQFSMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F E++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV L
Sbjct  86   TKQFSETSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTL  144

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            LGYCQ+NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   
Sbjct  145  LGYCQQNGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLK  204

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP+VH NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPE
Sbjct  205  PPLVHKNFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPE  257



>emb|CAN74612.1| hypothetical protein VITISV_043188 [Vitis vinifera]
Length=496

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 176/246 (72%), Gaps = 15/246 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQ-KTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             FC    K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQA
Sbjct  127  WFCKLQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQA  185

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV L
Sbjct  186  TKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTL  245

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYG-----------MGRDSSTKLEFKQRLSIASGT  254
            LGYCQE+G Q+LV EYLPNG+MCNHLY             G D++TKLEFK+RLSIA G 
Sbjct  246  LGYCQESGSQMLVFEYLPNGSMCNHLYARHVTVVHCLTDTGLDATTKLEFKRRLSIALGA  305

Query  253  AKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS  74
            AKGL HLH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   +
Sbjct  306  AKGLRHLHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVN  363

Query  73   PFIDPE  56
             F  PE
Sbjct  364  VFQHPE  369



>ref|XP_008340829.1| PREDICTED: probable receptor-like protein kinase At2g39360 isoform 
X1 [Malus domestica]
Length=376

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 170/234 (73%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC  H K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QAT
Sbjct  27   WFCRAHCKSFSNRTSETGSSDPSALVEWNRGGPSS-------GARQGPRVFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDESNL+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS  +HR+LV +L
Sbjct  80   KHFDESNLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIRHRHLVTIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+GYQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  P
Sbjct  140  GYCQESGYQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAGIS LL++I  + AGPS +   + F DPE
Sbjct  200  PIVHKNFKTANVLVDENFIAKVADAGISKLLEKI--EEAGPSSTSSVNFFEDPE  251



>emb|CDO98894.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAP--VEQKTGGPVSSLALARGGVPEGARVFRMQELEQA  581
            FC+ H ++ SN+NS+T SSDPSA   +E K GG  SS +    G P+ AR FR++ELEQA
Sbjct  28   FCISHCQKPSNKNSETGSSDPSAVGNLELKRGGASSSTSPPLAG-PQEARQFRLEELEQA  86

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T+NFDE NLIGCGS GLV+KG L DGT+VA+K  +  PR++F EEV  LS   HRNLV L
Sbjct  87   TRNFDEGNLIGCGSLGLVYKGLLCDGTVVAVKRLTGAPRREFVEEVIGLSRIHHRNLVTL  146

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            LGY Q+  YQ+L+ EYLPNG++CNHLY  G++   KLEF+QRLSIA G AKGLC+LHGQ 
Sbjct  147  LGYFQDGSYQMLIFEYLPNGSICNHLYDTGKEGMPKLEFRQRLSIALGAAKGLCYLHGQI  206

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP+VHGNFKT NVLVDENF  KVADAG+S LL +  +  AGPS S   + F DPE
Sbjct  207  PPLVHGNFKTANVLVDENFTAKVADAGLSILLGKFEY--AGPS-STSANAFRDPE  258



>ref|XP_010037055.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Eucalyptus grandis]
 ref|XP_010037064.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Eucalyptus grandis]
Length=317

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FCM      +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT
Sbjct  27   WFCMSKLNTSANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            + FDESNLIG GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LL
Sbjct  87   RQFDESNLIGHGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLL  146

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ENG Q+LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   P
Sbjct  147  GYCLENGCQMLVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRP  206

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE
Sbjct  207  PLVHKNFKTANVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPE  259



>ref|XP_006419652.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
 gb|ESR32892.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
Length=382

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 168/235 (71%), Gaps = 5/235 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQA  581
              C    K Y N+NS+T SSDPSA  +   G GP S+      G P+GAR F M+ELEQA
Sbjct  27   WLCKSQSKNYQNKNSETGSSDPSALGKWNRGAGPSSATGQPSFG-PQGARQFSMEELEQA  85

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TK F E++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV L
Sbjct  86   TKQFSETSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTL  144

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            LGYCQ+NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   
Sbjct  145  LGYCQQNGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLK  204

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP+VH NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPE
Sbjct  205  PPLVHKNFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPE  257



>ref|XP_008390720.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=377

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 169/233 (73%), Gaps = 9/233 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC  H K +SN+NS+T SS+PSA VE   GGP S       G   G R+F ++EL QAT
Sbjct  28   WFCRNHCKSFSNKNSETGSSNPSAIVELNRGGPDS-------GARHGPRLFTLEELNQAT  80

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK RS  PR+ F  EV  LS   HR+LV +L
Sbjct  81   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRSGAPRRDFVSEVTYLSEIHHRHLVTIL  140

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G+Q+LV EYLP+G++CNHLY    + STKLEFKQRLSIA G AKGL HLHG  P
Sbjct  141  GYCQESGFQVLVYEYLPSGSICNHLYDTRSEPSTKLEFKQRLSIALGAAKGLSHLHGLKP  200

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP  59
            P+VH NFKT NVLVDENF  KVADAGIS LL++I  + AGPSH+     F DP
Sbjct  201  PIVHKNFKTANVLVDENFTAKVADAGISKLLEKI--EEAGPSHTPSVKFFEDP  251



>gb|EYU43917.1| hypothetical protein MIMGU_mgv1a023031mg, partial [Erythranthe 
guttata]
Length=343

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 171/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            F +F ++   N++S+TASSDPSA    K GG          G P  A+ FR++ELEQAT+
Sbjct  31   FFVFRFRNVPNKDSETASSDPSAAETAKRGG----------GGPHEAKQFRIEELEQATR  80

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            +F+ESNLIGCG FGLVFKG L DGT+VAIK R+ PPRQ+F EEVA LS  +HRNLV LLG
Sbjct  81   HFNESNLIGCGIFGLVFKGLLSDGTVVAIKRRNGPPRQEFVEEVANLSEIRHRNLVALLG  140

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQE G Q+LV EYLPNG+MC+HLY  G+ S TKLEFKQR+SIA G AKGL HLHG  PP
Sbjct  141  YCQERGCQMLVFEYLPNGSMCSHLYDTGKSSITKLEFKQRMSIAIGAAKGLSHLHGLRPP  200

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++HGNF+T NVLVDENFI KVADAG+  LL+ I  + A  S +   + F DPE
Sbjct  201  LIHGNFRTANVLVDENFIAKVADAGVLKLLERI--EDASSSSTSSFNAFKDPE  251



>ref|XP_010037045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Eucalyptus grandis]
Length=328

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FCM      +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT
Sbjct  27   WFCMSKLNTSANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            + FDESNLIG GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LL
Sbjct  87   RQFDESNLIGHGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLL  146

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ENG Q+LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   P
Sbjct  147  GYCLENGCQMLVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRP  206

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE
Sbjct  207  PLVHKNFKTANVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPE  259



>ref|XP_010036980.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010036987.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010036997.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037004.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037013.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037021.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037028.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 gb|KCW84434.1| hypothetical protein EUGRSUZ_B01279 [Eucalyptus grandis]
Length=384

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FCM      +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT
Sbjct  27   WFCMSKLNTSANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            + FDESNLIG GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LL
Sbjct  87   RQFDESNLIGHGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLL  146

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ENG Q+LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   P
Sbjct  147  GYCLENGCQMLVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRP  206

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE
Sbjct  207  PLVHKNFKTANVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPE  259



>ref|XP_009339839.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=376

 Score =   278 bits (711),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 169/234 (72%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC  H K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QAT
Sbjct  27   WFCRAHCKSFSNRTSETGSSDPSAIVEWNRGGPSS-------GARQGPRVFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS   HR+LV++L
Sbjct  80   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIHHRHLVSIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+GYQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  P
Sbjct  140  GYCQESGYQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+ H NFKT NVLVDENFI +VADAGIS LL++I  + AGPS +   + F DPE
Sbjct  200  PIAHKNFKTANVLVDENFIARVADAGISKLLEKI--EEAGPSRTSSVNFFEDPE  251



>ref|XP_010037037.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
Length=348

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 167/234 (71%), Gaps = 1/234 (0%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FCM      +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT
Sbjct  27   WFCMSKLNTSANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            + FDESNLIG GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LL
Sbjct  87   RQFDESNLIGHGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLL  146

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC ENG Q+LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   P
Sbjct  147  GYCLENGCQMLVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRP  206

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE
Sbjct  207  PLVHKNFKTANVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPE  259



>ref|XP_006342759.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342760.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X2 [Solanum tuberosum]
Length=373

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 182/240 (76%), Gaps = 13/240 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CF  F  ++YSNRNSD+ASSDPSA VE           L RGG    +R+FRM+ELE++T
Sbjct  27   CFRSFRGRKYSNRNSDSASSDPSAVVE-----------LKRGGSFGPSRLFRMEELEKST  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDE++LIGCGSFGLVFKG L DGT+VAIK R   P+Q+F+EEVARLS  QHRNLV+LL
Sbjct  76   KHFDENSLIGCGSFGLVFKGLLCDGTVVAIKRRLGTPKQEFTEEVARLSRIQHRNLVSLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQ++GY +LV EYLPNG+M NHLY  G++ +TKLEFKQRLSIA G AKGL HLH Q P
Sbjct  136  GYCQDSGYSMLVFEYLPNGSMHNHLYDTGKEFATKLEFKQRLSIAIGAAKGLSHLHSQHP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPI  38
             ++HGNFKT NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE + + I
Sbjct  196  SIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSFNAFKDPEISQIGI  253



>ref|XP_009369125.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=376

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 169/234 (72%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC  H K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QAT
Sbjct  27   WFCRAHCKSFSNRTSETGSSDPSAIVEWNRGGPSS-------GARQGPRVFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS   HR+LV++L
Sbjct  80   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIHHRHLVSIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+GYQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  P
Sbjct  140  GYCQESGYQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+ H NFKT NVLVDENFI +VADAGIS LL++I  + AGPS +   + F DPE
Sbjct  200  PIAHKNFKTANVLVDENFIARVADAGISKLLEKI--EEAGPSRTSSVNFFEDPE  251



>ref|XP_008340830.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Malus domestica]
Length=369

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 160/219 (73%), Gaps = 7/219 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC  H K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QAT
Sbjct  27   WFCRAHCKSFSNRTSETGSSDPSALVEWNRGGPSS-------GARQGPRVFTLEELDQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDESNL+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS  +HR+LV +L
Sbjct  80   KHFDESNLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIRHRHLVTIL  139

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+GYQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  P
Sbjct  140  GYCQESGYQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKP  199

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAA  101
            P+VH NFKT NVLVDENFI KVADAGIS LL++I    A
Sbjct  200  PIVHKNFKTANVLVDENFIAKVADAGISKLLEKIEEAEA  238



>ref|XP_010321146.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Solanum lycopersicum]
Length=320

 Score =   273 bits (699),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  643  LARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPR  464
            + RGG    +R+FRM+ELE+ATK+FDE++LIGCGSFGLVFKG L DGT+VAIK R   P+
Sbjct  1    MKRGGSFGQSRLFRMEELEKATKHFDENSLIGCGSFGLVFKGLLCDGTVVAIKRRLGTPK  60

Query  463  QQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEF  284
            Q+F+EEVARLS  QHRNLV+LLGYCQ++GY +LV EYLPNG+M NHLY  G++S+TKLEF
Sbjct  61   QEFTEEVARLSRIQHRNLVSLLGYCQDSGYSMLVFEYLPNGSMHNHLYDTGKESATKLEF  120

Query  283  KQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDA  104
            KQRLSIA GTAKGL HLH Q P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  D 
Sbjct  121  KQRLSIAIGTAKGLSHLHSQHPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--DD  178

Query  103  AGPSHSIQPSPFIDPE  56
            AGPS     + F DPE
Sbjct  179  AGPSGLSSFNAFKDPE  194



>ref|XP_011090927.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
Length=380

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 172/234 (74%), Gaps = 5/234 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F M   ++ SN++S+T SSDPSA VE K G P +   L   G    AR FR++ELEQA+
Sbjct  27   WFFMLRCRKLSNKDSETGSSDPSAVVELKRG-PTAVPPLP--GPYNKAREFRIEELEQAS  83

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            + F+E+NLIG G+FGLVFKG L DGT+VAIK RS  PRQ+F+EEVA LS  QHRNLV LL
Sbjct  84   RQFNENNLIGFGTFGLVFKGLLNDGTVVAIKRRSGHPRQEFTEEVAYLSAIQHRNLVKLL  143

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            G CQE G QILV EYLPNG+MC+HLY  G+DS TKLEFKQRLSIA G AKGL HLH   P
Sbjct  144  GSCQEKGSQILVFEYLPNGSMCSHLYDTGKDSITKLEFKQRLSIAIGAAKGLRHLHSLQP  203

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PVVH NFKT NVLVDENFI KVADAG+  LL++I  + AG S S   + F DPE
Sbjct  204  PVVHSNFKTANVLVDENFIAKVADAGVLKLLEKI--EDAGSSSSSSFNAFRDPE  255



>ref|XP_009352231.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=377

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 170/234 (73%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H K +SN+NS+T SSDPSA VE   GGP S    AR     G R+F ++EL+QAT
Sbjct  28   WFYRNHCKSFSNKNSETGSSDPSAIVEWNRGGPGSE---AR----HGPRLFTLEELDQAT  80

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDES+L+G GSFGLV+KG L DGT+VAIK RS  PRQ F  +V  LS   HR+LV +L
Sbjct  81   KHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRSGAPRQDFVSQVTYLSEIHHRHLVRIL  140

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G+Q+LV EYLP+G++CNHLY    + ST+ EFKQRLSIA G AKGL HLHG  P
Sbjct  141  GYCQESGFQVLVYEYLPSGSICNHLYDTRSEPSTEFEFKQRLSIALGAAKGLSHLHGLKP  200

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENF  KVADAGIS LL++I  + AGPS +   + F DPE
Sbjct  201  PIVHKNFKTANVLVDENFTAKVADAGISKLLEKI--EEAGPSRTSSVNFFKDPE  252



>ref|XP_007035517.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007035518.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06443.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06444.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=382

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 169/228 (74%), Gaps = 5/228 (2%)
 Frame = -1

Query  736  KRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDES  560
            K +SNR S+T SSDPSA +E   G GP SS   +  G P+GAR F ++ELEQATK F +S
Sbjct  32   KNFSNRTSETGSSDPSALMEWNKGSGPSSSAGQSLFG-PQGARQFILEELEQATKQFSDS  90

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            NLIGCGSFG V+KG L D  +VAIK     PRQ+F   V  LS  +HRNLV LLGYCQE+
Sbjct  91   NLIGCGSFGPVYKGLLRD-IVVAIKRHPGAPRQEFVAGVIYLSEIRHRNLVTLLGYCQES  149

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
            G Q+LV EYLPNG+MCNHLY  GR++ T+LEFKQRLSIA G A+GLCHLHG  PP++H N
Sbjct  150  GSQMLVYEYLPNGSMCNHLYDTGREAPTRLEFKQRLSIALGVARGLCHLHGLKPPLIHKN  209

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            FKT NVLVDE+FI KVADAG S LL++I  + AGPSH+   + F DPE
Sbjct  210  FKTANVLVDEDFIAKVADAGFSMLLEKI--EEAGPSHTSSVNVFQDPE  255



>ref|XP_008802106.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X1 [Phoenix dactylifera]
Length=304

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 163/234 (70%), Gaps = 2/234 (1%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H +  +NR+S+T SSDP   VE   GG ++S         +GAR F  +EL QAT
Sbjct  27   WFCILHRRTCANRSSETGSSDPPTIVEWTRGGRITSAGGGHATEHQGARQFTFEELSQAT  86

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF+ESNL+G GSFGLV+KG L DGTIVAIK R   P Q+F EEV RLS   HRNLV L+
Sbjct  87   KNFNESNLVGSGSFGLVYKGLLLDGTIVAIKRRRGAPLQEFVEEVKRLSEICHRNLVTLI  146

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE G Q+LV E+LPNG++  HLY + R   T+LEFKQRLS+A G AKGL HLH   P
Sbjct  147  GYCQEGGLQMLVFEHLPNGSISRHLYDIARGPVTRLEFKQRLSVAIGAAKGLAHLHNLVP  206

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             VVH +FK+ NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPE
Sbjct  207  QVVHKDFKSSNVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSSGGNVFQDPE  258



>ref|XP_008796242.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Phoenix dactylifera]
Length=414

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H +  SNRNS+T SSDP   VE    G +S          +GAR F ++EL QAT
Sbjct  56   WFCILHRRFPSNRNSETGSSDPPTIVEWSRRGRISFAGGGHATEHQGARQFTLEELSQAT  115

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+FDE NL+G GSFGLV+KG L DGTIVAIK R   P+ +F EEV +LS   HRNLV L+
Sbjct  116  KSFDECNLVGSGSFGLVYKGLLLDGTIVAIKMRRGSPQPEFVEEVKKLSEICHRNLVTLI  175

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE G Q+LV EYLPNG++ +HLY  GRD + +LEFKQRLS+A GTAKGL HLH   P
Sbjct  176  GYCQEGGLQMLVFEYLPNGSISHHLYDTGRDIAMRLEFKQRLSVAIGTAKGLNHLHSLVP  235

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             VVH +FK+ NVLVDENFI KVADAGI+ LL+ +  D AGPS S   + F DPE
Sbjct  236  QVVHKDFKSSNVLVDENFIAKVADAGIAKLLQRL--DNAGPSRSSDGNVFQDPE  287



>ref|XP_004296813.1| PREDICTED: receptor-like protein kinase THESEUS 1-like [Fragaria 
vesca subsp. vesca]
Length=377

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 165/227 (73%), Gaps = 11/227 (5%)
 Frame = -1

Query  736  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  557
            K   N+NS+T SSDPSA          +   L RGG P  AR F M+ELEQATK+FDES+
Sbjct  36   KHLFNKNSETGSSDPSAGK--------NLFELNRGG-PSSARHFTMEELEQATKHFDESS  86

Query  556  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  377
            L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +LGYCQE+G
Sbjct  87   LLGFGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVKILGYCQESG  146

Query  376  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  197
            +Q+L+ EYLPNG++ NHLY    D S KLEFKQRLS+A G AKGLCHLHG  PP++H NF
Sbjct  147  FQMLIFEYLPNGSISNHLYDTKHDPSIKLEFKQRLSVALGAAKGLCHLHGLRPPIIHKNF  206

Query  196  KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            +T NVLVDENFI KV+DAGI+ LL++I  + AGPSH+   + F DPE
Sbjct  207  QTSNVLVDENFIAKVSDAGIAKLLEKI--EEAGPSHTSSVNFFQDPE  251



>ref|XP_008802108.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X2 
[Phoenix dactylifera]
Length=303

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 163/234 (70%), Gaps = 3/234 (1%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H +  +NR+S+T SSDP   +E   GG ++S         +GAR F  +EL QAT
Sbjct  27   WFCILHRRTCANRSSETGSSDPPT-IEWTRGGRITSAGGGHATEHQGARQFTFEELSQAT  85

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF+ESNL+G GSFGLV+KG L DGTIVAIK R   P Q+F EEV RLS   HRNLV L+
Sbjct  86   KNFNESNLVGSGSFGLVYKGLLLDGTIVAIKRRRGAPLQEFVEEVKRLSEICHRNLVTLI  145

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE G Q+LV E+LPNG++  HLY + R   T+LEFKQRLS+A G AKGL HLH   P
Sbjct  146  GYCQEGGLQMLVFEHLPNGSISRHLYDIARGPVTRLEFKQRLSVAIGAAKGLAHLHNLVP  205

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             VVH +FK+ NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPE
Sbjct  206  QVVHKDFKSSNVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSSGGNVFQDPE  257



>gb|KDP40006.1| hypothetical protein JCGZ_02004 [Jatropha curcas]
Length=382

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 167/238 (70%), Gaps = 11/238 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP----EGARVFRMQEL  590
             FC  H K +SN+NS+T SSDP A VE   GG  SS      G P    +GAR F M EL
Sbjct  25   WFCKSHCKNFSNKNSETGSSDPYAVVEWNRGGQCSSAP----GRPLFGSQGARAFTMDEL  80

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
            EQATK F ESNLIG GSFG V+KG L D T VAIK R + PR+ F  EV  LS  +HRNL
Sbjct  81   EQATKQFSESNLIGYGSFGSVYKGLLQD-TTVAIKRRPSAPREDFVAEVFYLSEIRHRNL  139

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQE   Q+LV EY+PN ++ NHLY  G  SSTKLEFKQRLSIA G AKGLCHLH
Sbjct  140  VSLLGYCQERDSQMLVFEYVPNDSIGNHLYDTGLTSSTKLEFKQRLSIALGAAKGLCHLH  199

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            G  PP+VH NFKT NVLVDENF+ KVADAGIS LL++I  + AGPS++   + F DPE
Sbjct  200  GLNPPLVHKNFKTTNVLVDENFLVKVADAGISKLLEKI--EEAGPSYTSGVNVFWDPE  255



>ref|XP_010921751.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Elaeis guineensis]
 ref|XP_010921753.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Elaeis guineensis]
Length=384

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 162/234 (69%), Gaps = 3/234 (1%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+FH +  +NR+S+T SSDP   +E   GG +SS         +GAR F  +EL QAT
Sbjct  27   WFCIFHRRILANRSSETGSSDPPT-IEWSRGGRMSSAGGGHATEHQGARQFTFEELSQAT  85

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
             NFDE NL+G GSFGLV+ G L DGTIVAIK R + PRQ+F EEV +LS   HRNLV L+
Sbjct  86   NNFDECNLVGSGSFGLVYNGLLLDGTIVAIKRRQSAPRQEFIEEVKKLSEICHRNLVALI  145

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE G Q++V E+LPNG++  HLY   RD   +LEFKQRLS+A G AKGL HLH   P
Sbjct  146  GYCQEGGLQMIVFEHLPNGSISRHLYDSARDRVARLEFKQRLSVAIGAAKGLAHLHNLVP  205

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             VVH +FK+ NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPE
Sbjct  206  QVVHKDFKSSNVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSFGGNVFQDPE  257



>gb|EMS58706.1| Nodulation receptor kinase [Triticum urartu]
Length=378

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 162/235 (69%), Gaps = 13/235 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            +C    +R  NR S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QA
Sbjct  29   WCRARARR--NRTSETGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQA  79

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T NF E+NL+G GSFGLV+KG LFDG++VAIK R+  PR +FS+EV RLS   HRN+V L
Sbjct  80   TNNFSEANLVGAGSFGLVYKGLLFDGSVVAIKRRTGAPRLEFSDEVRRLSEICHRNIVTL  139

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQE G Q+LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   
Sbjct  140  IGYCQEGGLQMLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLM  199

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NFKT NVLVDENFI KVADAG+  LL+   H+  G SH    S + DPE
Sbjct  200  PPLIHKNFKTSNVLVDENFIAKVADAGLFRLLR--GHEDVGSSHGFSSSVYQDPE  252



>ref|XP_007009417.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18227.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=383

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 162/234 (69%), Gaps = 6/234 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQAT  578
            FC    K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQAT
Sbjct  27   FCKSQNKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQAT  84

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K FD SNL+G GSFG V+KG L D T+VAIK R   P+Q+F  E   LS  QHRNLV L 
Sbjct  85   KQFDASNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEAIYLSEIQHRNLVTLQ  143

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G AKGLCHLHG  P
Sbjct  144  GYCQESGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALGAAKGLCHLHGLKP  203

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   + F DPE
Sbjct  204  PLVHRNFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASVTVFQDPE  255



>ref|XP_007009418.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY18228.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
Length=389

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 162/234 (69%), Gaps = 6/234 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQAT  578
            FC    K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQAT
Sbjct  33   FCKSQNKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQAT  90

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K FD SNL+G GSFG V+KG L D T+VAIK R   P+Q+F  E   LS  QHRNLV L 
Sbjct  91   KQFDASNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEAIYLSEIQHRNLVTLQ  149

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G AKGLCHLHG  P
Sbjct  150  GYCQESGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALGAAKGLCHLHGLKP  209

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   + F DPE
Sbjct  210  PLVHRNFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASVTVFQDPE  261



>dbj|BAJ92598.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 161/235 (69%), Gaps = 13/235 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            +C  H +R  NR S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QA
Sbjct  29   WCRAHARR--NRTSETGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQA  79

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T NF E+NL+G GSFGLV+KG LFDG++VAIK R   PR +F++EV RLS   HRN+V L
Sbjct  80   TNNFSEANLVGAGSFGLVYKGLLFDGSVVAIKRRMGAPRLEFADEVRRLSEICHRNIVTL  139

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQE G Q+LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   
Sbjct  140  IGYCQEGGLQMLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLM  199

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NFKT NVLVDENFI KVADAG+  L +   H+  G SH    S + DPE
Sbjct  200  PPLIHKNFKTSNVLVDENFIAKVADAGLVRLFR--GHEDIGSSHGFSSSVYQDPE  252



>gb|EMT16217.1| Receptor-like protein kinase THESEUS 1 [Aegilops tauschii]
Length=404

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 161/235 (69%), Gaps = 13/235 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            +C    +R  NR SDT SSDPS  VE   GG  SS        PE  GAR F ++EL QA
Sbjct  29   WCRARARR--NRTSDTGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQA  79

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T NF E+NL+G GSFGLV+KG LFDG++VAIK R   PR +FS+EV RLS   HRN+V L
Sbjct  80   TNNFSEANLVGAGSFGLVYKGLLFDGSVVAIKRRMGAPRLEFSDEVRRLSEICHRNIVTL  139

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQE G Q+LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   
Sbjct  140  IGYCQEGGLQMLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLM  199

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NFKT NVLVDENFI KVADAG+  LL+   H+  G SH    S + DPE
Sbjct  200  PPLIHKNFKTSNVLVDENFIAKVADAGLFRLLR--GHEDVGSSHGFSSSVYQDPE  252



>ref|XP_010243555.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X4 [Nelumbo nucifera]
Length=385

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 164/235 (70%), Gaps = 6/235 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            FC    K++ NRNS+T+SSDPSA VE       SS         +G + F ++ELEQATK
Sbjct  28   FCRSQCKKHRNRNSETSSSDPSAVVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATK  87

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            +F + NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG
Sbjct  88   HFSKGNLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLG  147

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            +CQE+G Q+LV EY+PNG++ +H+Y  G++S T LEFKQRLSIA G AKGLCHLH   PP
Sbjct  148  FCQEDGSQMLVFEYVPNGSLSSHIYDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIPP  207

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPE  56
            VVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPE
Sbjct  208  VVHKNFRMSNVLVDENFIAKVADAGISKLLERIED----PSSSSQTGGNVFQDPE  258



>gb|AAT58825.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV31240.1| putative protein kinase [Oryza sativa Japonica Group]
Length=303

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 156/224 (70%), Gaps = 12/224 (5%)
 Frame = -1

Query  718  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  548
            NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39   NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  547  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  368
             GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92   LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  367  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  188
            LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152  LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  187  NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            NVLVDENFI KVADAG+  LL+   ++   PSH    S + DPE
Sbjct  212  NVLVDENFIAKVADAGLVRLLR--GYEDVSPSHGFSSSVYQDPE  253



>gb|EEC79088.1| hypothetical protein OsI_19707 [Oryza sativa Indica Group]
Length=378

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 157/224 (70%), Gaps = 12/224 (5%)
 Frame = -1

Query  718  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  548
            NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39   NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  547  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  368
             GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92   LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  367  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  188
            LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152  LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  187  NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            NVLVDENFI KVADAG+  LL+   ++  GPSH    S + DPE
Sbjct  212  NVLVDENFIAKVADAGLVRLLR--GYEDVGPSHGFSSSVYQDPE  253



>ref|XP_006654321.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=379

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 164/235 (70%), Gaps = 11/235 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            +C    +   NR+S+T SSDPS  VE   GG  SSLA      PE  GAR F + EL QA
Sbjct  29   WCAARLRARRNRSSETGSSDPSTLVEWGKGGR-SSLA------PEHQGARQFSLDELAQA  81

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TKNF E+NL+G GSFGLV+KG L DG++VAIK R    RQ F+EEV +LS   HRN+V L
Sbjct  82   TKNFSEANLVGVGSFGLVYKGLLLDGSVVAIKKRIGAQRQDFAEEVRKLSEITHRNIVTL  141

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQE G Q+LV EY+PNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   
Sbjct  142  VGYCQEGGLQMLVSEYVPNGSVSGHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLV  201

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H +FKT NVLVDENFI KVADAG++ LL+   ++ AGPSH    S + DPE
Sbjct  202  PPLIHKDFKTSNVLVDENFIAKVADAGLARLLR--GYEDAGPSHGFSSSVYQDPE  254



>ref|XP_002516888.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF45502.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=375

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 162/234 (69%), Gaps = 8/234 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H K +SN+NS+T SSDPSA      GG  SS         +GAR F M ELEQAT
Sbjct  25   WFFKSHCKNFSNKNSETGSSDPSA-----LGGRSSSAPSRYIFGSQGARQFTMDELEQAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F +SNLIG GSFG V+KG L D ++VAIK R    R  F  EV  LS  +HRNLV+LL
Sbjct  80   KQFSDSNLIGYGSFGSVYKGLLHD-SVVAIKRRPNVARDDFVAEVIYLSEIRHRNLVSLL  138

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC+E G Q+LV EY+PNG+MCNHLY  G +SSTKLEFKQRLSIA G AKGLCHLH   P
Sbjct  139  GYCKERGSQMLVFEYVPNGSMCNHLYDRGLESSTKLEFKQRLSIALGAAKGLCHLHSLNP  198

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH NF+  NVLVDENFI KVADAGIS LL++I  + AGPS +   + F DPE
Sbjct  199  PLVHKNFRMANVLVDENFIVKVADAGISKLLEKI--EEAGPSFTSGVNVFQDPE  250



>ref|XP_010243554.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X3 [Nelumbo nucifera]
Length=386

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 164/236 (69%), Gaps = 7/236 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSA-PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            FC    K++ NRNS+T+SSDPSA  VE       SS         +G + F ++ELEQAT
Sbjct  28   FCRSQCKKHRNRNSETSSSDPSAVAVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQAT  87

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LL
Sbjct  88   KHFSKGNLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLL  147

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            G+CQE+G Q+LV EY+PNG++ +H+Y  G++S T LEFKQRLSIA G AKGLCHLH   P
Sbjct  148  GFCQEDGSQMLVFEYVPNGSLSSHIYDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIP  207

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPE  56
            PVVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPE
Sbjct  208  PVVHKNFRMSNVLVDENFIAKVADAGISKLLERIED----PSSSSQTGGNVFQDPE  259



>gb|EEE63486.1| hypothetical protein OsJ_18302 [Oryza sativa Japonica Group]
Length=378

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 156/224 (70%), Gaps = 12/224 (5%)
 Frame = -1

Query  718  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  548
            NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39   NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  547  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  368
             GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92   LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  367  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  188
            LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152  LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  187  NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            NVLVDENFI KVADAG+  LL+   ++   PSH    S + DPE
Sbjct  212  NVLVDENFIAKVADAGLVRLLR--GYEDVSPSHGFSSSVYQDPE  253



>ref|XP_004962282.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Setaria italica]
Length=306

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = -1

Query  715  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  536
            SDT SSDPS  VE   GG  SSLA       + AR F ++EL QATKNF ++N++G GSF
Sbjct  42   SDTGSSDPSTLVEWGKGGR-SSLAPEPETEHQVARQFSLEELVQATKNFSDANIVGAGSF  100

Query  535  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  356
            GLV+ G L DGTIVAIK R    RQ+F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  101  GLVYMGLLLDGTIVAIKRRVGAARQEFADEVRWLSEIRHRNVVTLIGYCQEGGLQMLVYE  160

Query  355  YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  176
            YLPNG++C HLYG G  S+ +LEFKQRLSIA G AKGL HLH +  P++H NFKT NVLV
Sbjct  161  YLPNGSVCGHLYGKG--STARLEFKQRLSIAIGAAKGLNHLHSRDVPLIHKNFKTNNVLV  218

Query  175  DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            DENFI KVADAG+  LL+    D AGPSH    S + DPE
Sbjct  219  DENFIAKVADAGLVRLLR--GSDEAGPSHGFSSSVYQDPE  256



>ref|XP_010243553.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Nelumbo nucifera]
Length=391

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 164/241 (68%), Gaps = 12/241 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            FC    K++ NRNS+T+SSDPSA VE       SS         +G + F ++ELEQATK
Sbjct  28   FCRSQCKKHRNRNSETSSSDPSAVVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATK  87

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            +F + NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG
Sbjct  88   HFSKGNLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLG  147

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGM------GRDSSTKLEFKQRLSIASGTAKGLCHL  233
            +CQE+G Q+LV EY+PNG++ +H+Y        G++S T LEFKQRLSIA G AKGLCHL
Sbjct  148  FCQEDGSQMLVFEYVPNGSLSSHIYVFCCLSDNGQESITTLEFKQRLSIALGAAKGLCHL  207

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDP  59
            H   PPVVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DP
Sbjct  208  HSLIPPVVHKNFRMSNVLVDENFIAKVADAGISKLLERIED----PSSSSQTGGNVFQDP  263

Query  58   E  56
            E
Sbjct  264  E  264



>ref|XP_007009416.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18226.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 166/247 (67%), Gaps = 19/247 (8%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQAT  578
            FC    K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQAT
Sbjct  84   FCKSQNKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQAT  141

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQF-SEEVAR------------  437
            K FD SNL+G GSFG V+KG L D T+VAIK R   P+Q+F +E++ R            
Sbjct  142  KQFDASNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEDLDRKLISIYVKQAIY  200

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            LS  QHRNLV L GYCQE+G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G
Sbjct  201  LSEIQHRNLVTLQGYCQESGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALG  260

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             AKGLCHLHG  PP+VH NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   
Sbjct  261  AAKGLCHLHGLKPPLVHRNFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASV  318

Query  76   SPFIDPE  56
            + F DPE
Sbjct  319  TVFQDPE  325



>ref|XP_010241786.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X2 [Nelumbo nucifera]
Length=386

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 165/235 (70%), Gaps = 4/235 (2%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F    +K   N+NS+T SSDPSA VE   GG  +S   +  G P+G + F ++ELEQAT
Sbjct  27   WFYRSQFKNLLNKNSETGSSDPSAQVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQAT  85

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LL
Sbjct  86   KHFSKSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLL  145

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            G+CQE+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  P
Sbjct  146  GFCQEDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVP  205

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPE  56
            P+ H NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPE
Sbjct  206  PLAHKNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPE  258



>ref|XP_004962281.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Setaria italica]
Length=382

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = -1

Query  715  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  536
            SDT SSDPS  VE   GG  SSLA       + AR F ++EL QATKNF ++N++G GSF
Sbjct  42   SDTGSSDPSTLVEWGKGGR-SSLAPEPETEHQVARQFSLEELVQATKNFSDANIVGAGSF  100

Query  535  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  356
            GLV+ G L DGTIVAIK R    RQ+F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  101  GLVYMGLLLDGTIVAIKRRVGAARQEFADEVRWLSEIRHRNVVTLIGYCQEGGLQMLVYE  160

Query  355  YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  176
            YLPNG++C HLYG G  S+ +LEFKQRLSIA G AKGL HLH +  P++H NFKT NVLV
Sbjct  161  YLPNGSVCGHLYGKG--STARLEFKQRLSIAIGAAKGLNHLHSRDVPLIHKNFKTNNVLV  218

Query  175  DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            DENFI KVADAG+  LL+    D AGPSH    S + DPE
Sbjct  219  DENFIAKVADAGLVRLLR--GSDEAGPSHGFSSSVYQDPE  256



>ref|XP_010231482.1| PREDICTED: probable receptor-like protein kinase At2g39360 [Brachypodium 
distachyon]
Length=380

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 157/235 (67%), Gaps = 11/235 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            +C    +   NR S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QA
Sbjct  29   WCRARLRARRNRTSETGSSDPSTLVEWGKGGRSSS-------APEHQGARHFPLEELAQA  81

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T NF E+NL+G GSFGLV+KG L DG++VAIK R   PR +F+EEV RLS   HRN+V L
Sbjct  82   TNNFSEANLVGAGSFGLVYKGLLLDGSVVAIKRRMGAPRHEFAEEVRRLSEISHRNIVTL  141

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQE G Q+LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   
Sbjct  142  IGYCQEGGLQMLVYEYSPNGNVCSHLYDTGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLV  201

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             P++H NFKT NVLVDENFI KVAD G+  LL+   +D  GPS     S + DPE
Sbjct  202  HPLIHKNFKTSNVLVDENFIAKVADYGLVGLLR--GYDDVGPSQGFTSSVYQDPE  254



>ref|XP_010243552.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
Length=392

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 164/242 (68%), Gaps = 13/242 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSA-PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            FC    K++ NRNS+T+SSDPSA  VE       SS         +G + F ++ELEQAT
Sbjct  28   FCRSQCKKHRNRNSETSSSDPSAVAVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQAT  87

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LL
Sbjct  88   KHFSKGNLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLL  147

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM------GRDSSTKLEFKQRLSIASGTAKGLCH  236
            G+CQE+G Q+LV EY+PNG++ +H+Y        G++S T LEFKQRLSIA G AKGLCH
Sbjct  148  GFCQEDGSQMLVFEYVPNGSLSSHIYVFCCLSDNGQESITTLEFKQRLSIALGAAKGLCH  207

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFID  62
            LH   PPVVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F D
Sbjct  208  LHSLIPPVVHKNFRMSNVLVDENFIAKVADAGISKLLERIED----PSSSSQTGGNVFQD  263

Query  61   PE  56
            PE
Sbjct  264  PE  265



>ref|XP_010241801.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X5 [Nelumbo nucifera]
Length=304

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 165/238 (69%), Gaps = 7/238 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELE  587
             F    +K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELE
Sbjct  27   WFYRSQFKNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELE  85

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QATK+F +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV
Sbjct  86   QATKHFSKSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLV  145

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             LLG+CQE+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG
Sbjct  146  TLLGFCQEDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHG  205

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPE  56
              PP+ H NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPE
Sbjct  206  LVPPLAHKNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPE  261



>ref|XP_010241794.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Nelumbo nucifera]
Length=318

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 165/238 (69%), Gaps = 7/238 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELE  587
             F    +K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELE
Sbjct  27   WFYRSQFKNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELE  85

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QATK+F +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV
Sbjct  86   QATKHFSKSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLV  145

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             LLG+CQE+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG
Sbjct  146  TLLGFCQEDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHG  205

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPE  56
              PP+ H NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPE
Sbjct  206  LVPPLAHKNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPE  261



>ref|XP_006855470.1| hypothetical protein AMTR_s00057p00187090 [Amborella trichopoda]
 gb|ERN16937.1| hypothetical protein AMTR_s00057p00187090 [Amborella trichopoda]
Length=373

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 158/236 (67%), Gaps = 20/236 (8%)
 Frame = -1

Query  757  CFCMF--HYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQ  584
            CF  F  H K  +NRNS+T SSDPSA  ++   G +              R F ++EL Q
Sbjct  25   CFWFFFLHRKSSANRNSETGSSDPSA--QEWNKGTM--------------RQFTLEELGQ  68

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            ATK+F ESNLIG G FGLVFKG L DGT+VAIK RS+  R +F EEV  LS  +HRNLV+
Sbjct  69   ATKHFSESNLIGEGRFGLVFKGLLRDGTVVAIKRRSSAARPEFVEEVHYLSEIRHRNLVS  128

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            LLGYCQE   Q+LV EYLPNG++ +HLY  G D +TKLEFK RL IA G AKGL HLHG 
Sbjct  129  LLGYCQEYDQQMLVYEYLPNGSVSSHLYDTGLDPTTKLEFKYRLFIALGAAKGLSHLHGM  188

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP+VH +FKT NVLVDENFI KVAD G+S LL+ I  D A  S   +   F+DPE
Sbjct  189  APPLVHKDFKTSNVLVDENFIAKVADVGLSRLLERI--DEASSSRVTRGDVFLDPE  242



>ref|XP_010649770.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X4 [Vitis vinifera]
Length=312

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = -1

Query  601  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  422
            M+ELEQATK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  Q
Sbjct  1    MEELEQATKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQ  60

Query  421  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASG  257
            HRNLV LLGYCQE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G
Sbjct  61   HRNLVTLLGYCQESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALG  120

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             AKGL HLH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   
Sbjct  121  AAKGLRHLHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSV  178

Query  76   SPFIDPE  56
            + F  PE
Sbjct  179  NVFQHPE  185



>ref|XP_010241759.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241768.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241775.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241781.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
Length=389

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 165/238 (69%), Gaps = 7/238 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELE  587
             F    +K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELE
Sbjct  27   WFYRSQFKNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELE  85

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QATK+F +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV
Sbjct  86   QATKHFSKSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLV  145

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             LLG+CQE+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG
Sbjct  146  TLLGFCQEDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHG  205

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPE  56
              PP+ H NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPE
Sbjct  206  LVPPLAHKNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPE  261



>ref|XP_010241787.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X3 [Nelumbo nucifera]
Length=355

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 165/238 (69%), Gaps = 7/238 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELE  587
             F    +K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELE
Sbjct  27   WFYRSQFKNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELE  85

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QATK+F +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV
Sbjct  86   QATKHFSKSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLV  145

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             LLG+CQE+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG
Sbjct  146  TLLGFCQEDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHG  205

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPE  56
              PP+ H NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPE
Sbjct  206  LVPPLAHKNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPE  261



>ref|XP_010911009.1| PREDICTED: proline-rich receptor-like protein kinase PERK13, 
partial [Elaeis guineensis]
Length=241

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR F ++EL QATK+FDE NL+G GSFGLV+KG L DGTIVAIK R   P+ +F EEV
Sbjct  11   QGARQFTLEELSQATKSFDECNLVGSGSFGLVYKGLLLDGTIVAIKMRRGAPQPEFVEEV  70

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
             +LS   HRNLV+L+GYCQE G Q+LV EYLPNG++  HLY  GRD   +LEFKQRLSIA
Sbjct  71   KKLSEICHRNLVSLIGYCQEGGLQMLVFEYLPNGSISRHLYDTGRDQVIRLEFKQRLSIA  130

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             GTAKGL HLH   P VVH +FK+ NVLVDENFI KVADAG++ LL+ +  D AG S S 
Sbjct  131  IGTAKGLAHLHSLVPQVVHKDFKSSNVLVDENFIAKVADAGVAKLLQRL--DDAGRSWSS  188

Query  82   QPSPFIDPE  56
              + F DPE
Sbjct  189  GGNVFQDPE  197



>ref|XP_009411699.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411700.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=383

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  727  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  548
            +N++S+T SSDPS PVE      +S          +GAR F ++ELE+ATKNF ESN++G
Sbjct  37   ANKSSETGSSDPSNPVEWGRRDRISCAGCGLASEHQGARQFTLEELEEATKNFSESNIVG  96

Query  547  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  368
             GSFGLV+KG L DGTIVAIK R + PRQ F E+V  LS  +HRNLV L+GYCQE G Q+
Sbjct  97   TGSFGLVYKGLLLDGTIVAIKRRVSVPRQAFIEQVKILSEIRHRNLVTLIGYCQEGGLQM  156

Query  367  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  188
            LV EYLPNG++ NHLY   + S T+LEFKQRL++A G AKGL HLH   PP+VH +FKT 
Sbjct  157  LVFEYLPNGSVSNHLYDSEQHSLTRLEFKQRLAVAIGAAKGLAHLHSLSPPLVHQDFKTS  216

Query  187  NVLVDENFIPKVADAGISSLLK  122
            NVLVDENFI KVADAG   LL+
Sbjct  217  NVLVDENFIAKVADAGFFKLLQ  238



>gb|EPS71437.1| hypothetical protein M569_03323 [Genlisea aurea]
Length=320

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
            AR F+M+ELEQ+T++FDESNLIG G+FGLVFKGFL DGTIVAIK R+ PP+++FSEEVA 
Sbjct  24   ARRFKMEELEQSTRHFDESNLIGYGTFGLVFKGFLSDGTIVAIKRRNGPPQREFSEEVAY  83

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            LS  +HRNLV L+GYCQ+ G  +LV EYLPNG++ +HL+    DS TKLEFKQRLSI+ G
Sbjct  84   LSRIRHRNLVTLIGYCQDRGSLMLVFEYLPNGSIRSHLH----DSKTKLEFKQRLSISIG  139

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             AKGL HLHG  PPVVHGNF+TGNVLVDENFI KVAD G+S L+ +I  D +  S S   
Sbjct  140  AAKGLSHLHGLQPPVVHGNFQTGNVLVDENFIAKVADTGVSKLIAKI--DGSSSSPSSSH  197

Query  76   SPFIDPE  56
              F DPE
Sbjct  198  DVFRDPE  204



>ref|XP_008647498.1| PREDICTED: LOC100272541 isoform X1 [Zea mays]
 gb|AFW77616.1| putative transmembrane protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW77617.1| putative transmembrane protein kinase family protein isoform 
2 [Zea mays]
Length=305

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 158/233 (68%), Gaps = 5/233 (2%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            +C    +   NRNSDT SSDPS  VE   GG  S   LA     + AR F +++L QATK
Sbjct  28   WCAARMRARRNRNSDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATK  84

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF ++N+IG GSFGLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+G
Sbjct  85   NFSDTNIIGAGSFGLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIG  144

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQE G Q+LV EYLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP
Sbjct  145  YCQEGGLQMLVYEYLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPP  204

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVADAG+  L++    D AGPS     S + DPE
Sbjct  205  LIHKDFKTNNVLVDENFIAKVADAGLVRLIR--GSDDAGPSRGFSNSVYQDPE  255



>ref|XP_009382559.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 157/234 (67%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H +  +N++S+T SSDPS  VE      +SS      G    AR F ++ELE+AT
Sbjct  26   WFYFLHCRTPANKSSETGSSDPSTLVEWNRRDRISS-----SGCGRSARQFTLEELEEAT  80

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF ESNL+G GSFGLV+KG L DGT+VAIK R + PRQ+F EEV  LS  +HRNLV L+
Sbjct  81   KNFSESNLVGTGSFGLVYKGLLLDGTLVAIKRRVSVPRQKFVEEVEILSEIRHRNLVTLI  140

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC+E G Q+LV EYLPNG +  HLY   + S ++LEFKQRL+IA G AKGL HLH   P
Sbjct  141  GYCEEGGLQMLVFEYLPNGGVSRHLYDGEQHSLSRLEFKQRLAIAIGAAKGLAHLHSLAP  200

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH +FKT NVLVDENFI KVADAG+  L++       GP  S   S F DPE
Sbjct  201  PLVHKDFKTNNVLVDENFIAKVADAGLHKLVQ--GSGEIGPQGS--SSIFQDPE  250



>ref|XP_009382558.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=379

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 157/234 (67%), Gaps = 9/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             F   H +  +N++S+T SSDPS  VE      +SS      G    AR F ++ELE+AT
Sbjct  28   WFYFLHCRTPANKSSETGSSDPSTLVEWNRRDRISS-----SGCGRSARQFTLEELEEAT  82

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF ESNL+G GSFGLV+KG L DGT+VAIK R + PRQ+F EEV  LS  +HRNLV L+
Sbjct  83   KNFSESNLVGTGSFGLVYKGLLLDGTLVAIKRRVSVPRQKFVEEVEILSEIRHRNLVTLI  142

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYC+E G Q+LV EYLPNG +  HLY   + S ++LEFKQRL+IA G AKGL HLH   P
Sbjct  143  GYCEEGGLQMLVFEYLPNGGVSRHLYDGEQHSLSRLEFKQRLAIAIGAAKGLAHLHSLAP  202

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P+VH +FKT NVLVDENFI KVADAG+  L++       GP  S   S F DPE
Sbjct  203  PLVHKDFKTNNVLVDENFIAKVADAGLHKLVQ--GSGEIGPQGS--SSIFQDPE  252



>ref|XP_006645295.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Oryza brachyantha]
Length=380

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 150/221 (68%), Gaps = 9/221 (4%)
 Frame = -1

Query  712  DTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIGCGS  539
            DT SS+ + P   + G    +L+      PE  GAR F ++EL  ATKNF E+NL+G GS
Sbjct  41   DTGSSETTPPALVEWGRCGRTLS-----APEYQGARQFSLEELAHATKNFGEANLVGAGS  95

Query  538  FGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVL  359
            FG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G Q+LV 
Sbjct  96   FGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGGLQMLVF  155

Query  358  EYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVL  179
            EYLPNG++C HLY  G++S T+LEFKQRLSIA G AKGL HLH   PP++H  FKT NVL
Sbjct  156  EYLPNGSVCGHLYDTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKGFKTSNVL  215

Query  178  VDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            VDENFI KVADAGI  LL+    D  G   S   S + DPE
Sbjct  216  VDENFIAKVADAGIDRLLR--GFDGGGAPSSCSSSIYQDPE  254



>ref|NP_001140481.1| LOC100272541 [Zea mays]
 gb|ACF83917.1| unknown [Zea mays]
 gb|AFW77618.1| putative transmembrane protein kinase family protein [Zea mays]
Length=381

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 158/233 (68%), Gaps = 5/233 (2%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            +C    +   NRNSDT SSDPS  VE   GG  S   LA     + AR F +++L QATK
Sbjct  28   WCAARMRARRNRNSDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATK  84

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF ++N+IG GSFGLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+G
Sbjct  85   NFSDTNIIGAGSFGLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIG  144

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQE G Q+LV EYLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP
Sbjct  145  YCQEGGLQMLVYEYLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPP  204

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVADAG+  L++    D AGPS     S + DPE
Sbjct  205  LIHKDFKTNNVLVDENFIAKVADAGLVRLIR--GSDDAGPSRGFSNSVYQDPE  255



>gb|ACG32823.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
Length=381

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 157/233 (67%), Gaps = 5/233 (2%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            +C    +   NRNSDT SSDPS  VE   GG  S   LA     + AR F +++L QATK
Sbjct  28   WCAARMRARRNRNSDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATK  84

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF ++N+IG GSFGLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+G
Sbjct  85   NFSDTNIIGAGSFGLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIG  144

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQE G Q+LV EYLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP
Sbjct  145  YCQEGGLQMLVYEYLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPP  204

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVAD G+  L++    D AGPS     S + DPE
Sbjct  205  LIHKDFKTNNVLVDENFIAKVADPGLVRLIR--GSDDAGPSRGFSNSVYQDPE  255



>ref|XP_010909097.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X5 [Elaeis guineensis]
Length=275

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 157/239 (66%), Gaps = 17/239 (7%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEG---ARVFRMQEL  590
             +F +     R S T SS+PS     +E   GG VS         P G   AR F ++EL
Sbjct  21   IIFVWYCLLRRRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEEL  72

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATKNF   NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNL
Sbjct  73   NVATKNFGNINLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNL  132

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH
Sbjct  133  VSLLGYCQENDLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLH  192

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
               PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  193  SLNPPLVHMNFKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPE  249



>ref|XP_010909095.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X4 [Elaeis guineensis]
 ref|XP_010909096.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X4 [Elaeis guineensis]
Length=292

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 154/229 (67%), Gaps = 17/229 (7%)
 Frame = -1

Query  721  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  560
            R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31   RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83   NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
              Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH   PP+VH N
Sbjct  143  DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLHSLNPPLVHMN  202

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
            FKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  203  FKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPE  249



>gb|EAY77133.1| hypothetical protein OsI_05098 [Oryza sativa Indica Group]
Length=384

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = -1

Query  727  SNRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESN  557
            S RNSDT SS+ P   VE    G   S        PE  GAR F ++EL  ATKNF ++N
Sbjct  36   SRRNSDTGSSETPPTLVEWGRCGRTLS-------APEYQGARQFSLEELAHATKNFSDAN  88

Query  556  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  377
            L+G GSFG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G
Sbjct  89   LVGAGSFGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGG  148

Query  376  YQILVLEYLPNGTMCNHLYG-MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
             Q+LV EYLPNG++C HLY   G++S T+LEFKQRLSIA G AKGL HLH   PP++H  
Sbjct  149  LQMLVFEYLPNGSVCGHLYADTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKG  208

Query  199  FKTGNVLVDENFIPKVADAGISSLLK  122
            FKT NVLVDENFI KVADAGI  LL+
Sbjct  209  FKTSNVLVDENFIAKVADAGIDRLLR  234



>gb|EAZ14756.1| hypothetical protein OsJ_04683 [Oryza sativa Japonica Group]
Length=384

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = -1

Query  727  SNRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESN  557
            S RNSDT SS+ P   VE    G   S        PE  GAR F ++EL  ATKNF ++N
Sbjct  36   SRRNSDTGSSETPPTLVEWGRCGRTLS-------APEYQGARQFSLEELAHATKNFSDAN  88

Query  556  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  377
            L+G GSFG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G
Sbjct  89   LVGAGSFGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGG  148

Query  376  YQILVLEYLPNGTMCNHLYG-MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
             Q+LV EYLPNG++C HLY   G++S T+LEFKQRLSIA G AKGL HLH   PP++H  
Sbjct  149  LQMLVFEYLPNGSVCGHLYANTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKG  208

Query  199  FKTGNVLVDENFIPKVADAGISSLLK  122
            FKT NVLVDENFI KVADAGI  LL+
Sbjct  209  FKTSNVLVDENFIAKVADAGIDRLLR  234



>ref|XP_010909092.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=373

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 154/229 (67%), Gaps = 17/229 (7%)
 Frame = -1

Query  721  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  560
            R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31   RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83   NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
              Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH   PP+VH N
Sbjct  143  DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLHSLNPPLVHMN  202

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
            FKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  203  FKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPE  249



>ref|XP_004231741.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=380

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 152/235 (65%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CFC+F  KR+ +  SDT SSDPS  V +  G  ++S         + AR F ++EL  AT
Sbjct  27   CFCIFR-KRFISTTSDTGSSDPSVQVGKNAGVELTS---------QDARRFHIEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F + +LIG G FG V+KG L DG +VAIK RSA P Q+F +EV  LS  QHRNLV LL
Sbjct  77   KGFSDKSLIGQGKFGEVYKGLLHDGMLVAIKRRSAVPSQEFVDEVRYLSSIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  QILV EY+PNG++  HLYG    +  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENDQQILVYEYIPNGSVSIHLYGGDHVTQEKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PE
Sbjct  197  RLIHKDFKTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPE  249



>ref|XP_004971193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=379

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 155/225 (69%), Gaps = 16/225 (7%)
 Frame = -1

Query  718  NSDTASSDPSAPVEQKTG--GPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLI  551
            +SDT SS  + P   + G  G  SS        PE  GAR F ++EL  ATKNF E+NL+
Sbjct  41   SSDTGSSSEAPPTLAEWGRCGRTSS-------APEFHGARQFSLEELAHATKNFAEANLV  93

Query  550  GCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQ  371
            G GSFGLV+KG L DGT+VA+K R+   RQ F++E+ RLS   HRN+V L+GYCQE G Q
Sbjct  94   GAGSFGLVYKGLLLDGTVVAVKRRTGAARQDFADEIRRLSEIWHRNVVTLIGYCQEGGLQ  153

Query  370  ILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKT  191
            +LV EYLPNG++  HLY  G++S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT
Sbjct  154  MLVFEYLPNGSVNGHLYDTGKESMTRLEFKQRLSIAIGAAKGLNHLHTLAPPLIHRDFKT  213

Query  190  GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             NVLVDENFI KV+DAGI  L++ +  + A PS+    S + DP+
Sbjct  214  SNVLVDENFIAKVSDAGIDRLMRGL--EGATPSNG---SVYQDPQ  253



>dbj|BAK07663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 152/235 (65%), Gaps = 11/235 (5%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQA  581
            C +      +R SDTAS + P    E    G  SS        P+  GAR F ++E+  A
Sbjct  28   CWWRLGARRSRTSDTASDETPPTLAEWGRCGRTSS-------APDYQGARRFTLEEMSHA  80

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            TKNF ++NL+G G+FG V+ G L DGT+VAIK R  PPRQ F +EV R S   HRN+V L
Sbjct  81   TKNFSDANLVGAGTFGKVYMGLLLDGTVVAIKRRVGPPRQDFVDEVRRQSEIWHRNVVTL  140

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYCQ+ G ++LV E+LPNG++C HLY  G++S T+LEFKQRLSIA G AKGL HLH   
Sbjct  141  IGYCQDGGLEMLVFEHLPNGSVCGHLYDTGKESMTRLEFKQRLSIAIGAAKGLDHLHSLA  200

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H  FKT NVLVDENFI KV+DAG+  LL+ +  D   P +  +   + DPE
Sbjct  201  PPLIHKGFKTSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLNGFRSGVYQDPE  254



>ref|XP_010090930.1| Nodulation receptor kinase [Morus notabilis]
 gb|EXB41415.1| Nodulation receptor kinase [Morus notabilis]
Length=401

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 152/235 (65%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CFC+ H++  S R S+T SSDPS    +  G  +         +    R F+M+EL  AT
Sbjct  27   CFCLSHHRSLS-RTSETGSSDPSIQAGRHAGVEL---------LIRETRRFQMEELSHAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK RS  P Q+F +EV  LS  QHRNLV LL
Sbjct  77   KNFSDKNLIGQGKFGEVYKGLLHDGMLVAIKKRSGAPTQEFIDEVHYLSPIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL  LH Q P
Sbjct  137  GYCQENNLQFLVYEYIPNGSVSSHLYGAGQHSRERLEFKHRLSIALGAAKGLAFLHSQSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L  ++   AGPS  +     F+ PE
Sbjct  197  RLLHKDFKTANVLVDENFIAKVADAGLRNFLGRVS--IAGPSSQVTADEIFLAPE  249



>ref|XP_008810477.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X3 [Phoenix 
dactylifera]
Length=308

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 156/241 (65%), Gaps = 18/241 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQ  596
             +C+   KR  +R S T SS+PS     +E    G VS         P G   AR F ++
Sbjct  27   WYCLLR-KRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLE  77

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL  ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HR
Sbjct  78   ELNVATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHR  137

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            NLV+LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  
Sbjct  138  NLVSLLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGF  197

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  59
            LH   PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DP
Sbjct  198  LHSMNPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDP  255

Query  58   E  56
            E
Sbjct  256  E  256



>ref|XP_008810478.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X4 [Phoenix 
dactylifera]
Length=303

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 156/241 (65%), Gaps = 18/241 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQ  596
             +C+   KR  +R S T SS+PS     +E    G VS         P G   AR F ++
Sbjct  27   WYCLLR-KRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLE  77

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL  ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HR
Sbjct  78   ELNVATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHR  137

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            NLV+LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  
Sbjct  138  NLVSLLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGF  197

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  59
            LH   PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DP
Sbjct  198  LHSMNPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDP  255

Query  58   E  56
            E
Sbjct  256  E  256



>ref|XP_002459059.1| hypothetical protein SORBIDRAFT_03g045200 [Sorghum bicolor]
 gb|EES04179.1| hypothetical protein SORBIDRAFT_03g045200 [Sorghum bicolor]
Length=379

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 3/188 (2%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  440
            GAR F ++EL  AT NF E+NL+G G FGLV+KG L DGT+VAIK R+  PRQ FS+E+ 
Sbjct  69   GARQFSLEELAHATHNFAEANLVGAGGFGLVYKGLLLDGTVVAIKRRAGAPRQDFSDEIR  128

Query  439  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  260
            RLS   HRN+V L+GYCQ+ G Q+LV EYLPNG++  HLY  G++S T+LEFKQRLSIA 
Sbjct  129  RLSEIWHRNVVTLIGYCQDGGLQMLVFEYLPNGSVSGHLYDTGKESMTRLEFKQRLSIAI  188

Query  259  GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  80
            G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+  N  AA P  +  
Sbjct  189  GAAKGLNHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIDRLLRGFN-GAATP--AAN  245

Query  79   PSPFIDPE  56
               F DPE
Sbjct  246  GGVFQDPE  253



>ref|XP_010249313.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Nelumbo nucifera]
Length=387

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 156/238 (66%), Gaps = 12/238 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELE  587
             FC+   +  S R S+T SSD S  V     G  S + L+   +P     AR F M+EL 
Sbjct  27   WFCLSQNRSIS-RPSETGSSDQSVQV-----GRTSRVELSLRPLPPDSREARRFLMEELA  80

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATK+F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV
Sbjct  81   LATKDFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLV  140

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
            +LLGYCQEN  Q+L+ EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL HLH 
Sbjct  141  SLLGYCQENDQQMLIYEYIPNGSVSSHLYGTGQVSGERLEFKHRLSIAMGAAKGLAHLHS  200

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
              P ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PE
Sbjct  201  LSPRLIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPE  256



>ref|XP_009593052.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
 ref|XP_009593053.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
 ref|XP_009593054.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
Length=380

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 153/235 (65%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+FH KR  +R S+T SSDPS  V  KT G   +L          AR F+++EL  AT
Sbjct  27   WFCIFH-KRSISRTSETGSSDPSIQV-GKTAGIELTL--------RDARRFQIEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F + +LIG G FG V+KG L DG +VAIK RSA P Q+F +EV  LS  QHRNLV LL
Sbjct  77   KGFSDKSLIGQGKFGEVYKGLLHDGMLVAIKRRSAVPSQEFIDEVRYLSSIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+  QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQEHDQQILVYEYIPNGSVSIHLYGDGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PE
Sbjct  197  RLIHKDFKTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPE  249



>ref|XP_010909094.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X3 [Elaeis 
guineensis]
Length=325

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
            AR F ++EL  ATKNF   NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  
Sbjct  16   ARRFTLEELNVATKNFGNINLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHY  75

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            LS  +HRNLV+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G
Sbjct  76   LSSIRHRNLVSLLGYCQENDLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHG  135

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             AKGL  LH   PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +  
Sbjct  136  AAKGLGFLHSLNPPLVHMNFKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTT  193

Query  76   -SPFIDPE  56
              PF+DPE
Sbjct  194  DDPFLDPE  201



>ref|XP_006844647.1| hypothetical protein AMTR_s00016p00235240 [Amborella trichopoda]
 gb|ERN06322.1| hypothetical protein AMTR_s00016p00235240 [Amborella trichopoda]
Length=388

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 156/238 (66%), Gaps = 13/238 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQEL  590
            FC+F  +   +  S+  SSD S  V       +    L  G  P     + AR FR++EL
Sbjct  28   FCIFRKRNIPSNTSENGSSDTSVQVSHDRSIEI----LLTGHTPLASDSQEARHFRLEEL  83

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
            + ATKNF+E NLIG G FGLV+KG L DGT+VAIK R APP+Q+F +EV +L   +HRNL
Sbjct  84   DLATKNFNEKNLIGEGRFGLVYKGLLHDGTVVAIKRRHAPPKQKFIDEVRQLCSIRHRNL  143

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLG CQE G Q+L+ EY+PNG++  HLY   +   TKLEFK RL IA G A+GL HLH
Sbjct  144  VSLLGCCQERGQQMLIYEYIPNGSVSRHLY--EQHPQTKLEFKHRLLIALGAARGLDHLH  201

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
               PP+VH +FKT NVLVDENFI KVAD G+S +L+ +N   AGPS  +    F+DPE
Sbjct  202  AMNPPMVHKDFKTHNVLVDENFIAKVADFGVSDMLERVND--AGPSQMMGVDTFMDPE  257



>ref|XP_008778862.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Phoenix dactylifera]
Length=379

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 161/241 (67%), Gaps = 19/241 (8%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALA-RGGVP-----EGARVFRMQ  596
             +C+    R  +R S+T SS+PS   +        S+ L  RGGV      +GAR F+++
Sbjct  27   WYCLLR-NRGVSRTSETNSSEPSLQGQ--------SIELPFRGGVSYPPDFQGARCFKLE  77

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL  ATKNF   NLIG G FG V+KG L DG +VAIK R + P Q+F EEV  LS  +HR
Sbjct  78   ELSVATKNFSNINLIGYGMFGEVYKGLLHDG-MVAIKRRPSAPSQEFIEEVHFLSSIRHR  136

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            NLV+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  
Sbjct  137  NLVSLLGYCQENNMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGV  196

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  59
            LH   PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DP
Sbjct  197  LHSLNPPLVHTNFKTANVLVDEDFIPKVADAGLRSLLDRI--DEAGPSSRMTTDDPFLDP  254

Query  58   E  56
            E
Sbjct  255  E  255



>ref|XP_008778861.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Phoenix dactylifera]
Length=390

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 162/245 (66%), Gaps = 16/245 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPS-----APVEQKTGGPVSSLALARGGVP-----EGARV  608
             +C+    R  +R S+T SS+PS     + +   + G    L   RGGV      +GAR 
Sbjct  27   WYCLLR-NRGVSRTSETNSSEPSLQDQYSALLNFSAGQSIELPF-RGGVSYPPDFQGARC  84

Query  607  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  428
            F+++EL  ATKNF   NLIG G FG V+KG L DG +VAIK R + P Q+F EEV  LS 
Sbjct  85   FKLEELSVATKNFSNINLIGYGMFGEVYKGLLHDG-MVAIKRRPSAPSQEFIEEVHFLSS  143

Query  427  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  248
             +HRNLV+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AK
Sbjct  144  IRHRNLVSLLGYCQENNMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAK  203

Query  247  GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SP  71
            GL  LH   PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    P
Sbjct  204  GLGVLHSLNPPLVHTNFKTANVLVDEDFIPKVADAGLRSLLDRI--DEAGPSSRMTTDDP  261

Query  70   FIDPE  56
            F+DPE
Sbjct  262  FLDPE  266



>ref|XP_008810476.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Phoenix dactylifera]
Length=350

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 156/241 (65%), Gaps = 18/241 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQ  596
             +C+   KR  +R S T SS+PS     +E    G VS         P G   AR F ++
Sbjct  27   WYCLLR-KRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLE  77

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL  ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HR
Sbjct  78   ELNVATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHR  137

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            NLV+LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  
Sbjct  138  NLVSLLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGF  197

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  59
            LH   PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DP
Sbjct  198  LHSMNPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDP  255

Query  58   E  56
            E
Sbjct  256  E  256



>ref|XP_011024759.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X1 [Populus 
euphratica]
 ref|XP_011024760.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X1 [Populus 
euphratica]
Length=378

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 150/235 (64%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C++H K  S R S+T SS+ S  V +  G  +SS         + AR F M+EL  AT
Sbjct  26   LWCLYHKKTVS-RTSETGSSETSVQVGRHAGIELSS---------QEARRFEMEELGLAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  QHRNLV LL
Sbjct  76   KGFSEKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ NHLYG+G+    KLEFK RLSIA G AKGL HLH Q P
Sbjct  136  GYCQENNMQFLVYEYISSGSVSNHLYGVGQTLDGKLEFKHRLSIALGAAKGLAHLHSQTP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PE
Sbjct  196  RLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSTQVTADEIFLAPE  248



>ref|XP_008810475.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
Length=380

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 156/241 (65%), Gaps = 18/241 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQ  596
             +C+   KR  +R S T SS+PS     +E    G VS         P G   AR F ++
Sbjct  27   WYCLLR-KRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLE  77

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL  ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HR
Sbjct  78   ELNVATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHR  137

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            NLV+LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  
Sbjct  138  NLVSLLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGF  197

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  59
            LH   PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DP
Sbjct  198  LHSMNPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDP  255

Query  58   E  56
            E
Sbjct  256  E  256



>ref|XP_010249305.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249306.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249307.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249308.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249310.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249311.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249312.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
Length=388

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 156/238 (66%), Gaps = 11/238 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELE  587
             FC+   +  S R S+T SSD S     +  G  S + L+   +P     AR F M+EL 
Sbjct  27   WFCLSQNRSIS-RPSETGSSDQSV----QAVGRTSRVELSLRPLPPDSREARRFLMEELA  81

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATK+F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV
Sbjct  82   LATKDFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLV  141

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
            +LLGYCQEN  Q+L+ EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL HLH 
Sbjct  142  SLLGYCQENDQQMLIYEYIPNGSVSSHLYGTGQVSGERLEFKHRLSIAMGAAKGLAHLHS  201

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
              P ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PE
Sbjct  202  LSPRLIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPE  257



>ref|XP_009761544.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761545.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761546.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761547.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
Length=380

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 151/235 (64%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+FH KR  +R S+T SSDPS  V  KT G   +L          AR F+++EL  AT
Sbjct  27   WFCIFH-KRSISRTSETGSSDPSIQV-GKTAGIELTL--------RDARRFQIEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F + +LIG G FG V+KG L DG +VAIK RS  P Q+F +EV  LS  QHRNLV LL
Sbjct  77   KGFSDKSLIGQGKFGEVYKGLLHDGMLVAIKRRSVVPSQEFIDEVRYLSSIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE   QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQERDQQILVYEYIPNGSVSVHLYGDGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PE
Sbjct  197  RLIHKDFKTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSQVAADEIFLAPE  249



>ref|XP_009385501.1| PREDICTED: wall-associated receptor kinase-like 20 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 154/239 (64%), Gaps = 16/239 (7%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKT----GGPVSSLALARGGVPE--GARVFRMQE  593
            +C+F  +  S   S+T SSDPS  V Q      GG VS         PE  GAR F ++E
Sbjct  28   YCLFRNRSISR--SETNSSDPSLQVGQTVEPSLGGGVSY-------APEFQGARCFTLEE  78

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L  ATKNF   NLIG G+FG V KG L DG +VAIK RS P  Q+F EEV  +S  +HRN
Sbjct  79   LNVATKNFSNINLIGYGTFGEVSKGLLHDGMVVAIKRRSCPRSQEFIEEVRYVSSIRHRN  138

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV+LLGYCQE+  Q+L+ EY+PNG++  HLYG  + SS KLEFK RLSIA G AKG+ HL
Sbjct  139  LVSLLGYCQEDHIQMLIYEYIPNGSVSTHLYGAIQASSVKLEFKHRLSIAHGAAKGMVHL  198

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            H   PP+VH NFKT NVLVD +  PKV DAGI SLL  I+  AA  S   +  PF+DP+
Sbjct  199  HSLNPPLVHMNFKTRNVLVDGDLTPKVGDAGIHSLLDRID-GAASSSRITEDDPFLDPD  256



>ref|XP_006645278.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Oryza brachyantha]
Length=364

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT+NF   NLIG G FG V+KG L DGTIVAIK R +PP  +F  EV
Sbjct  53   QGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEV  112

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
              LS  +HRNLVNLLGYCQE+G Q+LV EY+PNG++  HL+G       KLEFKQRLSIA
Sbjct  113  NYLSSIRHRNLVNLLGYCQEDGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIA  172

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             G AKGL HLH   PP +H NFKT NVLVDE+FIPKVADAGI  LL  +    AGPS   
Sbjct  173  HGAAKGLSHLHSLTPPAIHMNFKTANVLVDEDFIPKVADAGIRGLLDRLG--GAGPSSRT  230

Query  82   QPSPFIDP  59
               PF+DP
Sbjct  231  SNDPFLDP  238



>ref|XP_009420340.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 149/223 (67%), Gaps = 14/223 (6%)
 Frame = -1

Query  721  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  542
            R+SDT SS+ S   EQ       ++ LA     +GARVF ++EL+ ATK+F   NLIG G
Sbjct  38   RSSDTNSSELSVQEEQ-------TIELA----FQGARVFTLKELDAATKDFSNINLIGYG  86

Query  541  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  362
             FG V KGFL DGTIVAIK R + P Q+F EEV  LS  +HRNLV LLGYCQEN  Q+LV
Sbjct  87   MFGEVNKGFLQDGTIVAIKRRVSAPSQEFIEEVCYLSSIRHRNLVRLLGYCQENDLQMLV  146

Query  361  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  182
             EY+ NG++  HLYG  +  S KLEFK RLSIA G AKG+ HLH   PP+VH NFKT NV
Sbjct  147  YEYVSNGSVSTHLYGGNQVLSRKLEFKHRLSIAHGAAKGMVHLHSLNPPLVHMNFKTTNV  206

Query  181  LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
            LVDE+FIPKVADAG+  LL   N   A PS  +    PF DPE
Sbjct  207  LVDEDFIPKVADAGLRRLLNRTN--GASPSSRVTTDDPFHDPE  247



>ref|XP_010909568.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=379

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 158/240 (66%), Gaps = 17/240 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQE  593
             +C++   R  +R S+T SS+PS        G    L    GGV      +GAR F ++E
Sbjct  27   WYCLWR-SRSVSRTSETNSSEPSQ------AGQGIELPF-HGGVSYPPGFQGARHFTLEE  78

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L   TKNF   N+IG G FG V+KG L DG +VAIK R++ P Q+F EEV  LS  +HRN
Sbjct  79   LNVTTKNFSNINMIGYGMFGEVYKGLLHDG-MVAIKARTSAPSQEFIEEVHFLSSIRHRN  137

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV+LLGYCQENG Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  L
Sbjct  138  LVSLLGYCQENGMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGIL  197

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ-PSPFIDPE  56
            H   PP+VH NFKT NVLVDE+F PKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  198  HSLNPPLVHMNFKTANVLVDEDFTPKVADAGLQSLLDRI--DEAGPSSRLTIDDPFLDPE  255



>ref|XP_010682892.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 151/235 (64%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C+FH  R ++R S+T SS+PS  V  K+GG   S+          AR F  +EL  AT
Sbjct  27   WYCLFH-SRSASRTSETGSSEPSYQV-GKSGGIELSI--------REARRFSWEELSAAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF E +LIG G FG V+KG L +G +VAIK R   P Q+F EEV  LS  QHRN+V LL
Sbjct  77   KNFSEQSLIGVGKFGEVYKGLLTEGVLVAIKKRPVAPTQEFVEEVRYLSSIQHRNIVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE   QILV EY+PNG++ +HLYG G  S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQEKDQQILVYEYVPNGSVSSHLYGPGHGSREKLEFKHRLSIALGAAKGLAHLHSISP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENF+ KVADAGI + L     D  GPS  ++    F+ PE
Sbjct  197  RLLHKDFKTSNVLVDENFVAKVADAGIRNFLG--RSDVVGPSSQVEADEVFLAPE  249



>ref|XP_010909569.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
Length=378

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 159/240 (66%), Gaps = 18/240 (8%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQE  593
             +C++   R  +R S+T SS+PS    Q  G  +       GGV      +GAR F ++E
Sbjct  27   WYCLWR-SRSVSRTSETNSSEPS----QGQGIELP----FHGGVSYPPGFQGARHFTLEE  77

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L   TKNF   N+IG G FG V+KG L DG +VAIK R++ P Q+F EEV  LS  +HRN
Sbjct  78   LNVTTKNFSNINMIGYGMFGEVYKGLLHDG-MVAIKARTSAPSQEFIEEVHFLSSIRHRN  136

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV+LLGYCQENG Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  L
Sbjct  137  LVSLLGYCQENGMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGIL  196

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ-PSPFIDPE  56
            H   PP+VH NFKT NVLVDE+F PKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  197  HSLNPPLVHMNFKTANVLVDEDFTPKVADAGLQSLLDRI--DEAGPSSRLTIDDPFLDPE  254



>dbj|BAB90755.1| putative disease resistance protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY77080.1| hypothetical protein OsI_05040 [Oryza sativa Indica Group]
 gb|EAZ14713.1| hypothetical protein OsJ_04637 [Oryza sativa Japonica Group]
 dbj|BAH01248.1| unnamed protein product [Oryza sativa Japonica Group]
Length=364

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT+NF   NLIG G FG V+KG L DGTIVAIK R +PP  +F  EV
Sbjct  53   QGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEV  112

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
              LS  +HRNLVNLLGYCQENG Q+LV EY+PNG++  HL+G       KLEFKQRLSIA
Sbjct  113  NYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIA  172

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             G AKGL HLH   PP VH NFKT NVLVDE+ IPKVADAGI +LL  +     GPS   
Sbjct  173  HGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLG--GVGPSSRT  230

Query  82   QPSPFIDPE  56
               PF+DP 
Sbjct  231  SYDPFLDPR  239



>ref|XP_010682893.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=379

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 151/235 (64%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C+FH  R ++R S+T SS+PS   + K+GG   S+          AR F  +EL  AT
Sbjct  27   WYCLFH-SRSASRTSETGSSEPS--YQGKSGGIELSI--------REARRFSWEELSAAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF E +LIG G FG V+KG L +G +VAIK R   P Q+F EEV  LS  QHRN+V LL
Sbjct  76   KNFSEQSLIGVGKFGEVYKGLLTEGVLVAIKKRPVAPTQEFVEEVRYLSSIQHRNIVTLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE   QILV EY+PNG++ +HLYG G  S  KLEFK RLSIA G AKGL HLH   P
Sbjct  136  GYCQEKDQQILVYEYVPNGSVSSHLYGPGHGSREKLEFKHRLSIALGAAKGLAHLHSISP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENF+ KVADAGI + L     D  GPS  ++    F+ PE
Sbjct  196  RLLHKDFKTSNVLVDENFVAKVADAGIRNFLG--RSDVVGPSSQVEADEVFLAPE  248



>ref|XP_006338747.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338748.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Solanum 
tuberosum]
Length=380

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 150/235 (64%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
            CFC+F  KR  +  SDT SSDPS  V +  G  ++S         + AR F ++EL  AT
Sbjct  27   CFCIFR-KRTISTTSDTGSSDPSVQVGKNAGVELTS---------QDARPFHIEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F + +LIG G FG V+KG L DG +VAIK RSA   Q+F +EV  LS  QHRNLV LL
Sbjct  77   KGFSDKSLIGQGKFGEVYKGLLHDGMLVAIKRRSAVASQEFIDEVRYLSSIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENDQQNLVYEYIPNGSVSIHLYGGGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PE
Sbjct  197  RLIHKDFKTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPE  249



>ref|XP_002303015.1| kinase family protein [Populus trichocarpa]
 gb|EEE82288.1| kinase family protein [Populus trichocarpa]
Length=378

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 149/235 (63%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C++H K  S R S+T SS+ S  V +  G  +SS         + AR F M+EL  AT
Sbjct  26   LWCLYHKKTVS-RTSETGSSETSIQVGRHAGIELSS---------QEARRFEMEELGLAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  QHRNLV LL
Sbjct  76   KGFSEKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSSIQHRNLVTLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ NHLYG+G+    KLEFK RL IA G AKGL HLH Q P
Sbjct  136  GYCQENNLQFLVYEYISSGSVSNHLYGVGQTLEGKLEFKNRLPIALGAAKGLAHLHSQTP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             ++H NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PE
Sbjct  196  RLLHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGPSTQVTADEIFLAPE  248



>emb|CDP16750.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 150/234 (64%), Gaps = 13/234 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+FH +  S R S+  SSDPS   + +T G   SL          AR F ++EL  ATK
Sbjct  28   LCLFHSRSIS-RTSENGSSDPSDQ-DGRTAGIELSL--------RDARRFEIEELSLATK  77

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            +F + +LIG G FG VFKG L DG +VAIK R   P Q+F EEV  LS  QHRNLV+LLG
Sbjct  78   SFSDKSLIGQGKFGEVFKGLLQDGMLVAIKKRPGAPSQEFIEEVRYLSSIQHRNLVSLLG  137

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQ+NG QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL H+H   P 
Sbjct  138  YCQDNGQQILVYEYIPNGSVSIHLYGAGHVAQEKLEFKHRLSIALGAAKGLAHIHALSPR  197

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
            ++H +FKT NVLVDENFI KVADAG+ + L     D AGPS  +     F+ PE
Sbjct  198  LIHKDFKTSNVLVDENFIAKVADAGLRNFLGRF--DIAGPSSEMAADEMFLAPE  249



>ref|XP_003564993.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 [Brachypodium distachyon]
Length=365

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 130/189 (69%), Gaps = 2/189 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
             GAR   ++EL  AT NF  SNLIG G FG VF G L +GT++A+KTR +PP Q+F +EV
Sbjct  53   RGARRLTLEELRSATNNFSSSNLIGHGMFGDVFNGLLQNGTVIAVKTRHSPPSQEFIQEV  112

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
              LS   HRNLVN LGYCQENG Q+LV EY+PNG++  HL+G       +LEFKQRLSIA
Sbjct  113  NYLSSIGHRNLVNFLGYCQENGMQMLVYEYVPNGSVSTHLHGNSHGPGVRLEFKQRLSIA  172

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             GTAKGL HLH   PP VH NFKT NVLVDE+FIPKVADAGI  LL  I    A PS  I
Sbjct  173  HGTAKGLSHLHSLTPPAVHMNFKTANVLVDEDFIPKVADAGIRGLLDRIG--VACPSSRI  230

Query  82   QPSPFIDPE  56
               PF+ P 
Sbjct  231  SNDPFLGPR  239



>ref|XP_007032051.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY02977.1| Kinase superfamily protein [Theobroma cacao]
Length=379

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 151/235 (64%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+FH KR  +R S+T SSDPS  V+ +  G   SL          A+ F ++EL  AT
Sbjct  27   WFCLFH-KRGVSRRSETGSSDPS--VQGRHLGVELSL--------REAKRFEIEELSSAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L +G +VAIK R+    Q+F +E   LS  QHRNLV LL
Sbjct  76   KNFSDQNLIGEGKFGEVYKGLLQEGMLVAIKKRAGAYSQEFIDEACYLSSIQHRNLVTLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  136  GYCQENNQQFLIYEYIPNGSVSIHLYGAGQVSPQKLEFKHRLSIALGAAKGLAHLHSLSP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAG+ + L  I  D AGPS  +     F+ PE
Sbjct  196  RLVHKDFKTANVLVDENFIAKVADAGLRNFLGRI--DVAGPSSQVTADEIFLAPE  248



>ref|XP_011098971.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
 ref|XP_011098972.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
 ref|XP_011098973.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
Length=379

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 149/235 (63%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C+F  +  +   S+T SSDPS  V    GG V      R      AR F M+E+  AT
Sbjct  27   WYCIFRIRNVTR--SETGSSDPSVQV----GGAVGIEFTLRD-----ARRFEMEEMSLAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + +LIG G FG V+KG L DG +VAIK R  PP Q+F +EV  LS  QHRNLV+LL
Sbjct  76   KNFSDKSLIGQGKFGEVYKGLLHDGMLVAIKKRPGPPSQEFIDEVRYLSSIQHRNLVSLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+  QILV EY+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  136  GYCQESDLQILVYEYIPNGSVSIHLYGAGQVSQEKLEFKHRLSIALGAAKGLAHLHSLSP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP-SHSIQPSPFIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     D AGP S       F+ PE
Sbjct  196  RLIHKDFKTANVLVDENFIAKVADAGLRNFLGRF--DYAGPSSQDAADEIFLAPE  248



>ref|XP_008656889.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Zea mays]
 gb|AFW84023.1| putative transmembrane protein kinase family protein [Zea mays]
Length=391

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  440
            GAR F ++EL  AT  F E+NL+G G+FGLV+KG L DGT+VAIK R+  PRQ F+ E+ 
Sbjct  74   GARQFSLEELAHATNGFAEANLVGAGAFGLVYKGLLLDGTVVAIKRRAGAPRQDFANEIR  133

Query  439  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  260
            RLS   HRN+V L+G+CQE G Q+LV EYLPN ++  HLY  G+++ T+LEFKQRLSIA 
Sbjct  134  RLSEIWHRNVVTLIGFCQEGGLQMLVFEYLPNASVSGHLYDTGKETMTRLEFKQRLSIAI  193

Query  259  GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  80
            G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+    D    +    
Sbjct  194  GAAKGLSHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIHRLLR--GPDGGAVAALAS  251

Query  79   PSPFIDPE  56
               F DPE
Sbjct  252  RGVFQDPE  259



>ref|XP_011024761.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Populus euphratica]
Length=377

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 149/235 (63%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C++H K  S R S+T SS+ S    +  G  +SS         + AR F M+EL  AT
Sbjct  26   LWCLYHKKTVS-RTSETGSSETSVQ-GRHAGIELSS---------QEARRFEMEELGLAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  QHRNLV LL
Sbjct  75   KGFSEKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ NHLYG+G+    KLEFK RLSIA G AKGL HLH Q P
Sbjct  135  GYCQENNMQFLVYEYISSGSVSNHLYGVGQTLDGKLEFKHRLSIALGAAKGLAHLHSQTP  194

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PE
Sbjct  195  RLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSTQVTADEIFLAPE  247



>gb|KDP41870.1| hypothetical protein JCGZ_26888 [Jatropha curcas]
Length=380

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 147/235 (63%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+   K  S R S+T SS+PS  V +  G  +S            AR F M+EL  AT
Sbjct  27   WFCLSRKKSVS-RTSETGSSEPSIQVGRHVGVELS---------IREARRFEMEELSHAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  LS  QHRNLV LL
Sbjct  77   KNFSDKNLIGVGKFGEVYKGLLNDGMLVAIKKRPGAPSQEFVDEVRYLSPIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+P+G++ +HLY  G+ S  KLEFK RL IA G AKGL HLH   P
Sbjct  137  GYCQENNTQFLIYEYIPSGSVSSHLYAPGQVSDGKLEFKHRLPIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PE
Sbjct  197  RLVHKDFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSSQVTADDIFLAPE  249



>ref|XP_009378057.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
Length=380

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F   R  +R S+T SSDPS  V +  G  +S             R F+M+EL  AT
Sbjct  27   WFCIFR-NRLVSRTSETGSSDPSVQVGRHGGVELS---------MRETRRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  77   KNFSDKNLIGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ +HLYG G+ S  KLEFK RL+IA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSREKLEFKNRLTIAQGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  197  RLVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPE  249



>ref|XP_008656888.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Zea mays]
Length=405

 Score =   224 bits (571),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  440
            GAR F ++EL  AT  F E+NL+G G+FGLV+KG L DGT+VAIK R+  PRQ F+ E+ 
Sbjct  88   GARQFSLEELAHATNGFAEANLVGAGAFGLVYKGLLLDGTVVAIKRRAGAPRQDFANEIR  147

Query  439  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  260
            RLS   HRN+V L+G+CQE G Q+LV EYLPN ++  HLY  G+++ T+LEFKQRLSIA 
Sbjct  148  RLSEIWHRNVVTLIGFCQEGGLQMLVFEYLPNASVSGHLYDTGKETMTRLEFKQRLSIAI  207

Query  259  GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  80
            G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+    D    +    
Sbjct  208  GAAKGLSHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIHRLLR--GPDGGAVAALAS  265

Query  79   PSPFIDPE  56
               F DPE
Sbjct  266  RGVFQDPE  273



>ref|XP_010249314.1| PREDICTED: putative serine/threonine-protein kinase isoform X3 
[Nelumbo nucifera]
Length=386

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 155/238 (65%), Gaps = 13/238 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELE  587
             FC+   +  S R S+T SSD S     +  G  S + L+   +P     AR F M+EL 
Sbjct  27   WFCLSQNRSIS-RPSETGSSDQSV----QAVGRTSRVELSLRPLPPDSREARRFLMEELA  81

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATK+F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV
Sbjct  82   LATKDFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLV  141

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
            +LLGYCQEN  Q+L+ EY+PNG++ +HLY  G+ S  +LEFK RLSIA G AKGL HLH 
Sbjct  142  SLLGYCQENDQQMLIYEYIPNGSVSSHLY--GQVSGERLEFKHRLSIAMGAAKGLAHLHS  199

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
              P ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PE
Sbjct  200  LSPRLIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPE  255



>gb|KHG04671.1| Proline-rich receptor-like protein kinase PERK8 [Gossypium arboreum]
Length=389

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 151/235 (64%), Gaps = 22/235 (9%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+FH KR  +R S+T SSDPS  V+ +  G   SL          AR F ++EL  AT
Sbjct  31   WFCLFH-KRGVSRTSETGSSDPS--VQGRHIGVQLSL--------REARRFELRELSLAT  79

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R+  P Q+F +E        HRNLV LL
Sbjct  80   KNFSDRNLIGEGKFGEVYKGLLQDGMLVAIKKRAGAPSQEFIDE--------HRNLVTLL  131

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+PNG++  HLYG+G+ S+ K+EFK RLSIA G AKGL HLH   P
Sbjct  132  GYCQENNQQFLVYEYIPNGSVSIHLYGVGQVSAQKIEFKHRLSIALGAAKGLAHLHSLSP  191

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAG+ + L  I  D AGPS  +     F+ PE
Sbjct  192  RLVHKDFKTANVLVDENFIAKVADAGLRNFLGRI--DVAGPSSQVTADEIFLAPE  244



>ref|XP_011006133.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Populus 
euphratica]
 ref|XP_011006134.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Populus 
euphratica]
Length=377

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 150/235 (64%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C++H K  S R S+T SS+ S  V+ +  G   SL        + AR F M+EL  AT
Sbjct  26   LWCLYHKKSVS-RTSETGSSETS--VQGRHAGIELSL--------QEARRFEMEELSLAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F E NL+G G FG V+KG L DG +VAIK R   P  +F +EV  LS  QHRNLV LL
Sbjct  75   KGFSEKNLMGFGKFGEVYKGLLNDGMVVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+P+G++ NHLYG G+    KLEFK RLSIA G AKGL HLH   P
Sbjct  135  GYCQENDLQFLVYEYIPSGSVSNHLYGPGQTLDGKLEFKHRLSIALGAAKGLAHLHSLSP  194

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH NFKT NVLVDENFI KVADAG+ + L ++  D AGPS  +     F+ PE
Sbjct  195  RLVHKNFKTANVLVDENFIAKVADAGLRNFLGKV--DIAGPSTQVTSDEIFLAPE  247



>ref|XP_002512819.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF49322.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=381

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H K  S R S+T SSDPS     +  G   SL          AR F M EL  AT
Sbjct  27   WFCLSHKKSVS-RTSETGSSDPSIQAPGRHVGVELSL--------REARRFEMDELSHAT  77

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK RS    Q+F +EV  LS  QHRN+V LL
Sbjct  78   KNFVDKNLIGIGKFGEVYKGLLNDGMLVAIKKRSGASSQEFVDEVRYLSPIQHRNIVTLL  137

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+P+G++ +HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  138  GYCQENNLQFLVYEYIPSGSVSSHLYGPSQFSDGKLEFKHRLSIALGAAKGLAHLHSLSP  197

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             +VH +FKT NVLVDENFI KVADAG+ + L  +  D AGPS  +
Sbjct  198  RLVHKDFKTANVLVDENFIAKVADAGLPNFLGRV--DVAGPSSQV  240



>gb|EMS48868.1| Receptor-like protein kinase ANXUR1 [Triticum urartu]
Length=371

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  440
            GAR F ++E+  ATKNF ++NL+G G+FG V+ G L DGT+VAIK R   PRQ F +EV 
Sbjct  41   GARRFTLEEMSHATKNFSDANLVGAGTFGKVYMGLLLDGTVVAIKRRVGAPRQDFVDEVR  100

Query  439  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  260
            R S   HRN+V L+GYCQ+ G Q+LV E+LPNG++C HLY  G++S T+LEFKQRLSIA 
Sbjct  101  RQSEIWHRNVVTLIGYCQDGGLQMLVFEHLPNGSVCGHLYDSGKESMTRLEFKQRLSIAI  160

Query  259  GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  80
            G AKGL HLH   PP++H  FKT NVLVDENFI KV+DAG+  LL+ +  D   P +  +
Sbjct  161  GAAKGLDHLHSLAPPLIHKGFKTSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLNGFR  219

Query  79   PSPFIDPE  56
               + DP+
Sbjct  220  SGIYQDPD  227



>gb|EYU31881.1| hypothetical protein MIMGU_mgv1a023868mg [Erythranthe guttata]
Length=380

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 145/236 (61%), Gaps = 10/236 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             + +FH +  S   S+T SSDPS  V    G   +            AR + M EL  AT
Sbjct  27   WYFIFHRRNVSG-TSETGSSDPSIQVGTSVGTEFT---------LRDARRYEMGELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            +NF E +LIG G FG V+KG L DG +VAIK R   P Q+F +EV  LS  QHRNLV LL
Sbjct  77   RNFSEQSLIGQGKFGEVYKGLLHDGILVAIKKRPGTPTQEFVDEVRYLSSIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  QI+V EY+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENDLQIIVYEYIPNGSVSVHLYGAGQVSQVKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*T  50
             ++H +FKT NVLVDENFI KVADAG+ + L + +++    S       F+ PE T
Sbjct  197  RLIHKDFKTSNVLVDENFIAKVADAGLRNFLGKFDYEGPSSSELTADRIFLAPEVT  252



>ref|XP_002459027.1| hypothetical protein SORBIDRAFT_03g044740 [Sorghum bicolor]
 gb|EES04147.1| hypothetical protein SORBIDRAFT_03g044740 [Sorghum bicolor]
Length=366

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT+NF  +NLIG G+FG V+KG L DGT+VA+K R +PP Q+F +EV
Sbjct  53   QGARSLTLEELNFATRNFSNANLIGQGTFGEVYKGLLQDGTVVAVKRRHSPPSQEFIQEV  112

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
              L+   HRNLV LLGYCQENG Q+LV EY+PNG++  HL+G    +  +LEFKQRLSIA
Sbjct  113  NYLASLCHRNLVKLLGYCQENGMQMLVYEYIPNGSVSTHLHGNSHATGLRLEFKQRLSIA  172

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             GTAKGL HLH   PP +H NFKT NVLVDE+F+PKVAD GI  +L  +     G S   
Sbjct  173  HGTAKGLSHLHSLTPPAIHMNFKTSNVLVDEDFVPKVADTGIPGMLDRLG--VTGLSSRT  230

Query  82   QPSPFIDP  59
               PF+DP
Sbjct  231  STDPFVDP  238



>gb|KDO45969.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=302

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 143/225 (64%), Gaps = 12/225 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  77   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  197  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  239



>ref|XP_007161600.1| hypothetical protein PHAVU_001G083100g [Phaseolus vulgaris]
 gb|ESW33594.1| hypothetical protein PHAVU_001G083100g [Phaseolus vulgaris]
Length=377

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 143/225 (64%), Gaps = 20/225 (9%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGG---VPEGARVFRMQELE  587
             FC+   +R  +R S+T SSDPS               + R G   +P   R F M+EL 
Sbjct  26   WFCL-SRQRNVSRTSETGSSDPSQ--------------VGRHGAIELPRDTRRFEMEELS  70

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATK+F E NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV
Sbjct  71   LATKSFSEKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSAIHHRNLV  130

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
            +LLGYCQEN  Q L+ EY+PNG++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH 
Sbjct  131  SLLGYCQENSLQFLIYEYVPNGSVSSHLYGAGQQSREKLEFKHRLSIAQGAAKGLAHLHS  190

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPS  92
              P +VH NFKT NVLVDENFI KVADAG+ + L +I  D AG S
Sbjct  191  LSPRLVHKNFKTANVLVDENFISKVADAGLRNFLGKI--DIAGSS  233



>ref|XP_007216792.1| hypothetical protein PRUPE_ppa023700mg [Prunus persica]
 gb|EMJ17991.1| hypothetical protein PRUPE_ppa023700mg [Prunus persica]
Length=380

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 148/235 (63%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H  R  +R S+T SSDPS  V +  G  +S             R F+M+EL  AT
Sbjct  27   WFCLSH-NRSVSRTSETGSSDPSVQVGRHAGVELS---------MRETRRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF ++NLIG G FG V+ GFL DG +VAIK R   P Q+F  EV  LS  QHR++V LL
Sbjct  77   KNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDE+ + KVADAGI + L  +  D AGPS  +     F+ PE
Sbjct  197  RLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRV--DIAGPSSQVTADEMFLAPE  249



>ref|XP_006446906.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 ref|XP_006446907.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60146.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60147.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
Length=380

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSGQAGRNVGIELS---------IREARRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  77   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             VVH +FKT NVLVDE+FI KVADAG+ + L     D  GPS  +     F+ PE
Sbjct  197  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVVGPSSQVTADEIFLAPE  249



>ref|XP_008231229.1| PREDICTED: nodulation receptor kinase [Prunus mume]
Length=380

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 148/235 (63%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H  R  +R S+T SSDPS  V +  G  +S             R F+M+EL  AT
Sbjct  27   WFCLSH-NRSVSRTSETGSSDPSVQVGRHAGVELS---------MRETRRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF ++NLIG G FG V+ GFL DG +VAIK R   P Q+F  EV  LS  QHR++V LL
Sbjct  77   KNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDE+ + KVADAGI + L  +  D AGPS  +     F+ PE
Sbjct  197  RLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRV--DIAGPSSQVTADEIFLAPE  249



>ref|XP_004304571.1| PREDICTED: nodulation receptor kinase-like [Fragaria vesca subsp. 
vesca]
Length=378

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 146/234 (62%), Gaps = 15/234 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            FC+    R  +R S+T SSDPS  V    G  +S             R F+M+EL  ATK
Sbjct  28   FCL--RNRSVSRTSETGSSDPSVQVGTHGGVELS---------IRETRRFQMEELSLATK  76

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF + NLIG G FG V+ GFL DG +VAIK R   P Q+F+ EV  LS  QHRN+V+LLG
Sbjct  77   NFSDKNLIGEGKFGEVYMGFLHDGMLVAIKKRPGLPSQEFTNEVNYLSAIQHRNIVSLLG  136

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQEN  Q LV EY+ +G++ +HLYG G+    KLEFK RLSIA G AKGL +LH   P 
Sbjct  137  YCQENNLQFLVYEYIHSGSVSSHLYGTGQHVREKLEFKNRLSIALGAAKGLAYLHSLSPR  196

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP-SHSIQPSPFIDPE  56
            +VH NF+T NVLVDENFI KVADAGI + L     D AGP S  I    F+ PE
Sbjct  197  LVHKNFRTANVLVDENFIAKVADAGIRNFL---GKDMAGPSSQVIADEIFLSPE  247



>ref|XP_010250484.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250485.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Nelumbo nucifera]
Length=388

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 152/238 (64%), Gaps = 11/238 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELE  587
             FC+    R  +R S+T SSDPS  V    G     L    G +P     AR F M+EL 
Sbjct  27   WFCL-SRDRNISRTSETGSSDPSIQV----GRVELPLTGTFGSLPPDSREARRFLMEELA  81

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATK+F++ NLIG G FG V+KG L DG IVAIK R+  P Q+F EEV  LS  +HRN+V
Sbjct  82   LATKDFNDINLIGEGKFGKVYKGLLHDGMIVAIKKRNGLPSQEFFEEVRYLSSIRHRNIV  141

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
            +LLGYCQEN  Q+++ EY+PNG++ +HLYG  + S  KLEFK RLSIA G AKGL HLH 
Sbjct  142  SLLGYCQENDQQMIIYEYIPNGSVSSHLYGTSQVSREKLEFKHRLSIALGAAKGLSHLHA  201

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
              P ++H  FKT NVLVDENFI KVADAG+ +LL  +  D AG S  I     F+ PE
Sbjct  202  LSPRLIHKGFKTVNVLVDENFIAKVADAGLYNLLARV--DVAGSSFGIMADDAFLAPE  257



>ref|XP_004971158.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X1 [Setaria italica]
 ref|XP_004971159.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X2 [Setaria italica]
Length=366

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT+NF  +NLIG G FG V+KG L DGTIVA+K R APP Q+F +EV
Sbjct  53   QGARCLTLEELNLATRNFSNANLIGQGMFGEVYKGLLQDGTIVAVKRRHAPPSQEFVQEV  112

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
              LS  QHRNLV LLGYCQEN  Q+LV EY+PNG++  HL+G       +LEFK RLSIA
Sbjct  113  NYLSSLQHRNLVKLLGYCQENVVQMLVYEYIPNGSVSTHLHGYSHAPGVRLEFKHRLSIA  172

Query  262  SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             G AKGL HLH   PP +H NFKT NVLVDE+FIPKVAD GI  LL  +     G S   
Sbjct  173  HGAAKGLSHLHSLTPPAIHMNFKTSNVLVDEDFIPKVADTGIPGLLDRLG--VTGLSSRT  230

Query  82   QPSPFIDP  59
               PF+DP
Sbjct  231  PNDPFVDP  238



>ref|XP_010250486.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X2 
[Nelumbo nucifera]
Length=387

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 153/239 (64%), Gaps = 14/239 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPS--APVEQKTGGPVSSLALARGGVPEG--ARVFRMQEL  590
             FC+    R  +R S+T SSDPS    VE    G   SL       P+   AR F M+EL
Sbjct  27   WFCL-SRDRNISRTSETGSSDPSIQGRVELPLTGTFGSLP------PDSREARRFLMEEL  79

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATK+F++ NLIG G FG V+KG L DG IVAIK R+  P Q+F EEV  LS  +HRN+
Sbjct  80   ALATKDFNDINLIGEGKFGKVYKGLLHDGMIVAIKKRNGLPSQEFFEEVRYLSSIRHRNI  139

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQEN  Q+++ EY+PNG++ +HLYG  + S  KLEFK RLSIA G AKGL HLH
Sbjct  140  VSLLGYCQENDQQMIIYEYIPNGSVSSHLYGTSQVSREKLEFKHRLSIALGAAKGLSHLH  199

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
               P ++H  FKT NVLVDENFI KVADAG+ +LL  +  D AG S  I     F+ PE
Sbjct  200  ALSPRLIHKGFKTVNVLVDENFIAKVADAGLYNLLARV--DVAGSSFGIMADDAFLAPE  256



>ref|XP_006468925.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X5 [Citrus sinensis]
Length=380

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 143/225 (64%), Gaps = 12/225 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  77   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  197  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  239



>gb|KDO45966.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45967.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45968.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=380

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 143/225 (64%), Gaps = 12/225 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  77   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  197  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  239



>ref|XP_004493092.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X1 [Cicer arietinum]
 ref|XP_004493093.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X2 [Cicer arietinum]
 ref|XP_004493094.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X3 [Cicer arietinum]
Length=381

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 143/234 (61%), Gaps = 10/234 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F     S R S+T SSDPS     + GG  S             R F M+EL  AT
Sbjct  27   WFCLFRRTSVS-RTSETGSSDPSQDAVGRHGGIESQ--------TRDTRRFVMEELSIAT  77

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF++ NLIG G FG V+KG L DG +VAIK R   P  +F +EV  LS  QHRNLV L+
Sbjct  78   KNFNDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGVPTPEFVDEVRYLSSIQHRNLVTLI  137

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++ +HLYG  +    K+EFK RLSIA G AKGL HLH   P
Sbjct  138  GYCQENNLQFLIYEYVPNGSVSSHLYGASQQPREKIEFKHRLSIAQGAAKGLAHLHSLSP  197

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             +VH NFKT NVLVDENFI KVAD+G+ + L  ++  A+  S       F+ PE
Sbjct  198  RLVHKNFKTSNVLVDENFISKVADSGLRNFLGRVDI-ASSSSQVASDEIFLAPE  250



>emb|CDM85905.1| unnamed protein product [Triticum aestivum]
Length=365

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT NF  SNL+G G FG V+ G L DGTI+A+K R +PP Q+F  EV
Sbjct  53   QGARCMTLEELRSATNNFSSSNLVGHGMFGEVYNGLLQDGTIIAVKRRHSPPSQEFLHEV  112

Query  442  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  266
              LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  113  NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISTHLHGNGNSPTVRLEFKQRLAI  172

Query  265  ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  86
            A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  173  AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFVPKVADTGIRGLLDRLGN--AGPPSM  230

Query  85   IQPSPFIDPE  56
            I   PF+DP 
Sbjct  231  IFNDPFVDPR  240



>gb|EMT07740.1| Receptor-like protein kinase ANXUR1 [Aegilops tauschii]
Length=394

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR F ++E+  ATKNF ++NL+G G+FG V+ G L DGT+VAIK R   PRQ F +EV
Sbjct  80   QGARRFTLEEMSHATKNFSDANLVGAGTFGKVYMGLLLDGTVVAIKRRVGAPRQDFVDEV  139

Query  442  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  263
             R S   HRN+V L+GYCQ+ G Q+LV E+LPNG++C HLY  G++S T+LEFKQRLSIA
Sbjct  140  RRQSEIWHRNVVTLIGYCQDGGLQMLVFEHLPNGSVCGHLYDTGKESMTRLEFKQRLSIA  199

Query  262  SGTAK--GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  89
             G AK  GL HLH   PP++H  FKT NVLVDENFI KV+DAG+  LL+ +  D   P +
Sbjct  200  IGAAKGGGLDHLHSLAPPLIHKGFKTSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLN  258

Query  88   SIQPSPFIDPE  56
              +   + DPE
Sbjct  259  GFRSGIYQDPE  269



>ref|XP_002320425.2| hypothetical protein POPTR_0014s14170g [Populus trichocarpa]
 gb|EEE98740.2| hypothetical protein POPTR_0014s14170g [Populus trichocarpa]
Length=377

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 149/235 (63%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             +C+ H K  S R S+T SS+ S  V+ +  G   SL        + AR F M+EL  AT
Sbjct  26   LWCLSHKKSVS-RTSETGSSETS--VQGRHAGIELSL--------QEARRFEMEELSLAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F E NL+G G FG V+KG L +G +VAIK R   P  +F +EV  LS  QHRNLV LL
Sbjct  75   KGFSEKNLMGFGKFGEVYKGLLNNGMVVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+P+G++ NHLYG G+    KLEFK RLSIA G AKGL HLH   P
Sbjct  135  GYCQENDLQFLVYEYIPSGSVSNHLYGPGQTLDGKLEFKHRLSIALGAAKGLAHLHSLSP  194

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH NFKT NVLVDENFI KVADAG+ + L ++  D AGPS  +     F+ PE
Sbjct  195  RLVHKNFKTANVLVDENFIAKVADAGLRNFLGKV--DIAGPSTQVTSDEIFLAPE  247



>gb|EMS46350.1| Serine/threonine-protein kinase-like protein ACR4 [Triticum urartu]
Length=365

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT NF  SNL+G G FG V+ G L DGTI+A+K R +PP Q+F  EV
Sbjct  53   QGARCMTLEELRSATNNFSSSNLVGHGMFGEVYNGLLQDGTIIAVKRRHSPPSQEFLHEV  112

Query  442  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  266
              LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  113  NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISTHLHGNGHSPTARLEFKQRLAI  172

Query  265  ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  86
            A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  173  AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFLPKVADTGIRGLLDRLGN--AGPPSM  230

Query  85   IQPSPFIDPE  56
            I   PF+DP 
Sbjct  231  IFNDPFVDPR  240



>ref|XP_002277073.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 ref|XP_010660662.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 ref|XP_010660663.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 emb|CBI21260.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 148/236 (63%), Gaps = 14/236 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H  R  +R S+T SSDPS  V +  G     LAL        AR F M EL  AT
Sbjct  27   WFCLSH-NRSVSRTSETGSSDPSVQVGRNVG---VELALRE------ARHFEMAELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + +LIG G FG V+KG L DG  VAIK R   P Q F +EV  LS  +HRNLV LL
Sbjct  77   KNFSDISLIGEGKFGEVYKGLLHDGMFVAIKKRFGGPSQDFVDEVRYLSAIEHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQENG Q L+ E++P+G++ ++LYG   + S  KLEFK RL IA G AKGL HLH   
Sbjct  137  GYCQENGQQFLIYEHIPSGSISSYLYGTAAQVSQEKLEFKNRLQIALGAAKGLAHLHTLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
            P +VH +FKT NVLVDENFIPKVADAG+ + L  I  D AGPS  +     F+ PE
Sbjct  197  PRLVHKDFKTANVLVDENFIPKVADAGLRNFLGRI--DIAGPSSQVVADEIFLAPE  250



>ref|XP_010066397.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010066398.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 gb|KCW64288.1| hypothetical protein EUGRSUZ_G01925 [Eucalyptus grandis]
 gb|KCW64289.1| hypothetical protein EUGRSUZ_G01925 [Eucalyptus grandis]
Length=379

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
            AR F M+EL  ATKNFD+ NLIG G FG V+KG L +G +VAIK RSA P Q+F +EV  
Sbjct  64   ARRFEMEELSMATKNFDDKNLIGVGKFGEVYKGLLHNGMLVAIKKRSASPTQEFVDEVRF  123

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            LS  QHR+LV+LLGYCQ++  Q+LV EY+PNG++  HLYG  + S  KLEFK RLSIA G
Sbjct  124  LSCIQHRHLVSLLGYCQDHHTQLLVYEYIPNGSVSTHLYGAAQLSREKLEFKHRLSIALG  183

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             AKGL HLH   P +VH +FKT NVLVDENFIPKVADAG+ + L     D AGPS  +  
Sbjct  184  AAKGLFHLHSLTPRLVHKDFKTANVLVDENFIPKVADAGLRNFLG--RADTAGPSSEVTA  241

Query  76   SP-FIDPE  56
               F+ PE
Sbjct  242  DDIFLAPE  249



>ref|XP_009345184.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345185.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345187.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345188.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
Length=380

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 145/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+    R  +R S+T SSDPS  V +  G  +S            AR F M+EL  A 
Sbjct  27   WFCI-SRNRSVSRTSETGSSDPSIQVGRHGGVELS---------MREARRFHMEELSLAA  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG G+FG VF GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  77   KHFSDKNLIGQGNFGEVFMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY+ +G++ +HL+G G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  137  GYCQENNLQFLVYEYIHSGSVSSHLFGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSP  196

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             VVH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  197  RVVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPE  249



>ref|XP_006468923.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Citrus sinensis]
Length=386

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 144/225 (64%), Gaps = 6/225 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLAT  82

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  83   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLL  142

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  143  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  202

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  203  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  245



>gb|AFK35308.1| unknown [Lotus japonicus]
Length=380

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 144/239 (60%), Gaps = 24/239 (10%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQEL  590
            C C    +R  +R S+T SSDPS               + R G  E      R F M+EL
Sbjct  30   CLCR---QRSVSRTSETGSSDPSQ--------------VGRHGAIELQIRDTRRFAMEEL  72

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATKNF++ NLIG G FG V+ G L DG +VAIK R   P Q+F +EV  LS  QHRN+
Sbjct  73   SLATKNFNDGNLIGQGKFGEVYNGLLQDGVLVAIKKRFGTPSQEFVDEVRYLSSIQHRNI  132

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V L+GYCQEN  Q L+ EY+PNG++ +HLYG G+ S  KLEFK RLSIA G AKGL H+H
Sbjct  133  VTLIGYCQENNLQFLIYEYVPNGSVSSHLYGAGQQSQEKLEFKLRLSIAQGAAKGLAHIH  192

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
               P +VH +FKT NVLVDENFI KVADAG+   L  +  D  G S  +     F+ PE
Sbjct  193  SLSPRLVHKDFKTANVLVDENFIAKVADAGLKHFLGRV--DIVGSSSQVAADEIFLAPE  249



>gb|KDO45964.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45965.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=386

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 144/225 (64%), Gaps = 6/225 (3%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLAT  82

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  83   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLL  142

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  143  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSP  202

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  203  RVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  245



>emb|CAN73905.1| hypothetical protein VITISV_039777 [Vitis vinifera]
Length=414

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 148/236 (63%), Gaps = 14/236 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+ H  R  +R S+T SSDPS  V +  G     LAL        AR F M EL  AT
Sbjct  60   WFCLSH-NRSVSRTSETGSSDPSVQVGRNVG---VELALRE------ARHFEMAELSLAT  109

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + +LIG G FG V+KG L DG  VAIK R   P Q F +EV  LS  +HRNLV LL
Sbjct  110  KNFSDISLIGEGKFGEVYKGLLHDGMFVAIKKRFGGPSQDFVDEVRYLSAIEHRNLVTLL  169

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQENG Q L+ E++P+G++ ++LYG   + S  KLEFK RL IA G AKGL HLH   
Sbjct  170  GYCQENGQQFLIYEHIPSGSISSYLYGTAAQVSQEKLEFKNRLQIALGAAKGLAHLHTLS  229

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
            P +VH +FKT NVLVDENFIPKVADAG+ + L  I  D AGPS  +     F+ PE
Sbjct  230  PRLVHKDFKTANVLVDENFIPKVADAGLRNFLGRI--DIAGPSSQVVADEIFLAPE  283



>ref|XP_010556327.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Tarenaya hassleriana]
Length=381

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +  S R S+TASSDPS   E+     +S            AR F M+EL QAT
Sbjct  27   WFCLFRRQNVS-RTSETASSDPSIQAERNVAIELS---------LREARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG G FG V+KG   DG +VAIK R+  P Q+F+ EV  LS   HRNLV LL
Sbjct  77   KGFTSKSLIGIGKFGEVYKGLHQDGMLVAIKKRTRSPTQEFANEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG  G+    KLEF+ RL+++ G AKGL HLH   
Sbjct  137  GYCQENNMQFLVYEYVPNGSVSSHLYGDGGKGPGRKLEFRNRLTVSLGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ +LL     D    S  +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGLPNLLG--REDVGSSSQMVADKIFLAPE  249



>ref|XP_009129490.1| PREDICTED: nodulation receptor kinase-like [Brassica rapa]
 ref|XP_009129491.1| PREDICTED: nodulation receptor kinase-like [Brassica rapa]
Length=374

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 147/234 (63%), Gaps = 17/234 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F   R+ N +  T SSDPS+   Q+       L++        +R F M+EL QAT
Sbjct  27   WFCIF---RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFEMEELAQAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R+  P Q+F  EV  LS  +HRNLV LL
Sbjct  75   KSFTHKSLIGVGKFGEVYKGLLQDGVLVAIKRRTGLPTQEFVNEVRYLSAIKHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+  Q LV EY+PNG++ NHLYG G    ++LEF+ RL+I+ G AKGL HLH   P
Sbjct  135  GYCQESNMQFLVYEYVPNGSVSNHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSP  191

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     DA   SH +    F+ PE
Sbjct  192  RLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDAGISSHVVADHIFLSPE  243



>ref|XP_008465399.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Cucumis 
melo]
Length=379

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 141/226 (62%), Gaps = 10/226 (4%)
 Frame = -1

Query  733  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  554
            R S R S+T SSDPS  V +  G  ++            AR F M EL  AT +F E NL
Sbjct  33   RNSARTSETGSSDPSVQVGRHVGIELT---------LRDARRFDMAELVLATNDFSEKNL  83

Query  553  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  374
            IG G FG V+KG L DG  VAIK R   P Q F EEV  LS  QHRNLV LLGYCQEN  
Sbjct  84   IGEGKFGEVYKGMLQDGIFVAIKKRHGAPSQDFVEEVHYLSSIQHRNLVTLLGYCQENNL  143

Query  373  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  194
            Q L+ +Y+PNG++ +H+YG  + S+ +LEFK RLSIA G AKGL HLH   P ++H NFK
Sbjct  144  QFLIFDYIPNGSVSSHIYGTEQRSAERLEFKIRLSIALGAAKGLSHLHSMSPRLIHRNFK  203

Query  193  TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            T NVLVDENFI KVADAG+ ++++  +  +   S +     F+ PE
Sbjct  204  TSNVLVDENFIAKVADAGLHNVMRRFDV-SESSSRATADEIFLAPE  248



>ref|XP_003553985.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X1 [Glycine max]
 ref|XP_006604204.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X2 [Glycine max]
 ref|XP_006604205.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X3 [Glycine max]
 ref|XP_006604206.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X4 [Glycine max]
 ref|XP_006604207.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X5 [Glycine max]
 gb|KHN28599.1| Putative receptor-like protein kinase [Glycine soja]
Length=379

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 142/229 (62%), Gaps = 21/229 (9%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQEL  590
             FC+   +R  +R S+T SSDPS               + R G  E      R F M+EL
Sbjct  27   WFCL-SRQRNVSRTSETGSSDPSQ--------------VGRHGAIELPIRDTRRFEMEEL  71

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATKNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNL
Sbjct  72   SLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVHYLSSIHHRNL  131

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQEN  Q L+ EY+PNG++ +HLYG G++   KLEFK RLSIA G AKGL HLH
Sbjct  132  VSLLGYCQENNLQFLIYEYVPNGSVSSHLYGAGQNPQEKLEFKHRLSIAQGAAKGLAHLH  191

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
               P +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +
Sbjct  192  SLSPRLVHKNFKTTNVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQV  238



>emb|CDY48978.1| BnaA02g28180D [Brassica napus]
Length=374

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 146/234 (62%), Gaps = 17/234 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F   R+ N +  T SSDPS+   Q+       L++        +R F M+EL QAT
Sbjct  27   WFCIF---RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFEMEELAQAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  75   KSFTHKSLIGTGKFGEVYKGLLQDGVLVAIKRRHGLPTQEFVNEVRYLSSIKHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+  Q LV EY+PNG++ NHLYG G    ++LEF+ RL+I+ G AKGL HLH   P
Sbjct  135  GYCQESNMQFLVYEYVPNGSVSNHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSP  191

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     DA   SH +    F+ PE
Sbjct  192  RLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDAGTSSHVVADHIFLSPE  243



>ref|XP_004493095.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X4 [Cicer arietinum]
Length=379

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 143/234 (61%), Gaps = 12/234 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F     S R S+T SSDPS     + GG  S             R F M+EL  AT
Sbjct  27   WFCLFRRTSVS-RTSETGSSDPSQV--GRHGGIESQ--------TRDTRRFVMEELSIAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF++ NLIG G FG V+KG L DG +VAIK R   P  +F +EV  LS  QHRNLV L+
Sbjct  76   KNFNDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGVPTPEFVDEVRYLSSIQHRNLVTLI  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++ +HLYG  +    K+EFK RLSIA G AKGL HLH   P
Sbjct  136  GYCQENNLQFLIYEYVPNGSVSSHLYGASQQPREKIEFKHRLSIAQGAAKGLAHLHSLSP  195

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             +VH NFKT NVLVDENFI KVAD+G+ + L  ++  A+  S       F+ PE
Sbjct  196  RLVHKNFKTSNVLVDENFISKVADSGLRNFLGRVD-IASSSSQVASDEIFLAPE  248



>ref|XP_008379041.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Malus 
domestica]
Length=393

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+    R   R S+T SSDPS  V +  G  +S             R F M+EL  AT
Sbjct  40   WFCV-SRNRSVPRTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLAT  89

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  90   KHFSDKNLIGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  149

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  150  GYCQENNLQXLVYEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSP  209

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  210  RLVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPE  262



>ref|XP_008365349.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Malus 
domestica]
Length=393

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+    R   R S+T SSDPS  V +  G  +S             R F M+EL  AT
Sbjct  40   WFCV-SRNRSVPRTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLAT  89

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  90   KHFSDKNLIGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  149

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  150  GYCQENNLQXLVYEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSP  209

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  210  RLVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVXADEMFLAPE  262



>ref|XP_006598688.1| PREDICTED: protein kinase family protein isoform X5 [Glycine 
max]
Length=378

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 138/225 (61%), Gaps = 14/225 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+   +R  +R S+T SSDPS         P+              R F M+EL  AT
Sbjct  27   WFCL-SRQRNVSRTSETGSSDPSQGRHGAMELPI-----------RDTRRFEMEELSLAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LL
Sbjct  75   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNLVSLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH   P
Sbjct  135  GYCQENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLHSLSP  194

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +
Sbjct  195  RLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQV  237



>gb|KHN46840.1| Putative receptor-like protein kinase [Glycine soja]
Length=379

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 140/229 (61%), Gaps = 21/229 (9%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQEL  590
             FC+   +R  +R S+T SSDPS               + R G  E      R F M+EL
Sbjct  27   WFCL-SRQRNVSRTSETGSSDPSQ--------------VGRHGAMELPIRDTRRFEMEEL  71

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATKNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNL
Sbjct  72   SLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNL  131

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQEN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH
Sbjct  132  VSLLGYCQENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLH  191

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
               P +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +
Sbjct  192  SLSPRLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQV  238



>ref|NP_001235374.1| protein kinase family protein [Glycine max]
 ref|XP_006598684.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
 ref|XP_006598685.1| PREDICTED: protein kinase family protein isoform X2 [Glycine 
max]
 ref|XP_006598686.1| PREDICTED: protein kinase family protein isoform X3 [Glycine 
max]
 ref|XP_006598687.1| PREDICTED: protein kinase family protein isoform X4 [Glycine 
max]
 gb|ACM89566.1| protein kinase family protein [Glycine max]
Length=379

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 140/229 (61%), Gaps = 21/229 (9%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQEL  590
             FC+   +R  +R S+T SSDPS               + R G  E      R F M+EL
Sbjct  27   WFCL-SRQRNVSRTSETGSSDPSQ--------------VGRHGAMELPIRDTRRFEMEEL  71

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
              ATKNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNL
Sbjct  72   SLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNL  131

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            V+LLGYCQEN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH
Sbjct  132  VSLLGYCQENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLH  191

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
               P +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +
Sbjct  192  SLSPRLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQV  238



>ref|XP_008365347.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
 ref|XP_008365348.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
Length=398

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+    R   R S+T SSDPS  V +  G  +S             R F M+EL  AT
Sbjct  45   WFCV-SRNRSVPRTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLAT  94

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  95   KHFSDKNLIGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  154

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  155  GYCQENNLQXLVYEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSP  214

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  215  RLVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVXADEMFLAPE  267



>ref|XP_008379039.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
 ref|XP_008379040.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
Length=398

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+    R   R S+T SSDPS  V +  G  +S             R F M+EL  AT
Sbjct  45   WFCV-SRNRSVPRTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLAT  94

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F + NLIG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LL
Sbjct  95   KHFSDKNLIGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLL  154

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQEN  Q LV EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P
Sbjct  155  GYCQENNLQXLVYEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSP  214

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
             +VH +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  215  RLVHKDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPE  267



>ref|XP_006468924.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Citrus sinensis]
Length=385

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 143/230 (62%), Gaps = 17/230 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  77   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG-----LCHL  233
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKG     L HL
Sbjct  137  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGDPLQSLAHL  196

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
            H   P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  197  HSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  244



>ref|XP_006395532.1| hypothetical protein EUTSA_v10004401mg [Eutrema salsugineum]
 gb|ESQ32818.1| hypothetical protein EUTSA_v10004401mg [Eutrema salsugineum]
Length=380

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    Q+       L++        AR F M+EL QAT
Sbjct  27   WFCIFRRKNVS-RTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GYCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRNRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--RDDVGTSSHVVADQNFLSPE  249



>ref|XP_010556328.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Tarenaya hassleriana]
Length=380

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 146/235 (62%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +  S R S+TASSDPS  ++++      SL          AR F M+EL QAT
Sbjct  27   WFCLFRRQNVS-RTSETASSDPS--IQERNVAIELSL--------REARRFEMEELAQAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG G FG V+KG   DG +VAIK R+  P Q+F+ EV  LS   HRNLV LL
Sbjct  76   KGFTSKSLIGIGKFGEVYKGLHQDGMLVAIKKRTRSPTQEFANEVRYLSSIHHRNLVTLL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG  G+    KLEF+ RL+++ G AKGL HLH   
Sbjct  136  GYCQENNMQFLVYEYVPNGSVSSHLYGDGGKGPGRKLEFRNRLTVSLGAAKGLAHLHSLS  195

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ +LL     D    S  +    F+ PE
Sbjct  196  PRLIHKDFKTANVLVDENFIAKVADAGLPNLLG--REDVGSSSQMVADKIFLAPE  248



>ref|XP_003624519.1| Nodulation receptor kinase [Medicago truncatula]
 gb|AES80737.1| tyrosine kinase family protein [Medicago truncatula]
Length=379

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 143/238 (60%), Gaps = 20/238 (8%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELE  587
             F +F     S R S+T SSDPS     + G          GG+       R F M+EL 
Sbjct  27   WFYLFRQTSVS-RTSETGSSDPS-----QVG--------RHGGIELQMRDTRRFAMEELS  72

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
             ATKNF++ NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS  QHRNLV
Sbjct  73   HATKNFNDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGVTSQEFVDEVRYLSSIQHRNLV  132

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             L+GYCQEN  Q L+ EY+PNG++ +HLYG  +    KLEFK RLSIA G AKGL HLH 
Sbjct  133  TLIGYCQENNLQFLIYEYVPNGSVSSHLYGASQQPREKLEFKHRLSIAQGAAKGLAHLHS  192

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
              P +VH NFKT NVLVDENFI KVADAG+ + L  +  +  G S  +     F+ PE
Sbjct  193  LSPRLVHKNFKTSNVLVDENFISKVADAGLRNFLARV--EIVGTSSQVATDEIFLAPE  248



>ref|XP_008341211.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Malus 
domestica]
Length=380

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 138/220 (63%), Gaps = 12/220 (5%)
 Frame = -1

Query  712  DTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFG  533
            +T SSDPS  V +  G  +S             R F+M+EL  ATKNF + NLIG G FG
Sbjct  41   ETGSSDPSVQVGRHGGVELS---------MRETRRFQMEELSLATKNFSDKNLIGQGKFG  91

Query  532  LVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEY  353
             V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV EY
Sbjct  92   EVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQFLVYEY  151

Query  352  LPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVD  173
            + +G++ +HLYG G+ S  KLEFK RL+IA G AKGL HLH   P +VH +FKT NVLVD
Sbjct  152  IHSGSVSSHLYGTGQHSREKLEFKNRLTIAQGAAKGLAHLHSLSPRLVHKDFKTANVLVD  211

Query  172  ENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPE  56
            ENFI KVADAGI + L  +  D AG S  +     F+ PE
Sbjct  212  ENFIAKVADAGIRNFLGXV--DIAGSSSQVTADEMFLAPE  249



>ref|XP_004143767.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus]
 ref|XP_004171662.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus]
 gb|KGN51138.1| hypothetical protein Csa_5G466350 [Cucumis sativus]
Length=379

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 140/226 (62%), Gaps = 10/226 (4%)
 Frame = -1

Query  733  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  554
            R + R S+T SSDPS  V +  G  ++            AR F M EL  AT +F + NL
Sbjct  33   RNTARTSETGSSDPSVQVGRHVGIELT---------LRDARRFEMAELVLATNDFSDKNL  83

Query  553  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  374
            IG G FG V+KG L DG  VAIK R   P Q F +EV  LS  QHRNLV LLGYCQEN  
Sbjct  84   IGEGKFGEVYKGMLQDGMFVAIKKRHGAPSQDFVDEVHYLSSIQHRNLVTLLGYCQENNL  143

Query  373  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  194
            Q L+ +Y+PNG++ +H+YG  + S+ KLEFK RLSIA G AKGL HLH   P + H NFK
Sbjct  144  QFLIFDYIPNGSVSSHIYGTEQRSAEKLEFKIRLSIALGAAKGLSHLHSMSPRLTHRNFK  203

Query  193  TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            T NVLVDENFI KVADAG+ ++++  +  +   S +     F+ PE
Sbjct  204  TSNVLVDENFIAKVADAGLHNVMRRFDV-SESSSRATADEIFLAPE  248



>ref|XP_006291298.1| hypothetical protein CARUB_v10017433mg [Capsella rubella]
 gb|EOA24196.1| hypothetical protein CARUB_v10017433mg [Capsella rubella]
Length=380

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    Q+       L++        AR F M+EL QAT
Sbjct  27   WFCVFRRKNLS-RTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GYCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     +    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REEVGTSSHIVADQIFLSPE  249



>ref|NP_189304.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE77201.1| protein kinase family protein [Arabidopsis thaliana]
Length=380

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    +     +S            AR F M+EL QAT
Sbjct  27   WFCVFRRKNLS-RTSETGSSDPSTQEGRNVAIELSM---------REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            G+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249



>emb|CAA66819.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB01733.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
Length=374

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    +     +S            AR F M+EL QAT
Sbjct  27   WFCVFRRKNLS-RTSETGSSDPSTQEGRNVAIELSM---------REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            G+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249



>emb|CDX83640.1| BnaC07g23800D [Brassica napus]
Length=377

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S  + +T SSDPS      T G   ++ L+       AR F M+EL QAT
Sbjct  27   WFCIFRRKNASRTSDETGSSDPS------TQGINVAIELSM----REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GYCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRNRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPE  249



>emb|CDY28533.1| BnaC02g36270D [Brassica napus]
Length=374

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 145/234 (62%), Gaps = 17/234 (7%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F   R+ N +  T SSDPS+   Q+       L++        +R F M+EL QAT
Sbjct  27   WFCIF---RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFGMEELAQAT  74

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  75   KSFTSKSLIGTGKFGEVYKGLLQDGVLVAIKRRHGLPTQEFVNEVRYLSSIKHRNLVTLL  134

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQE+  Q LV EY+PNG++  HLYG G    ++LEF+ RL+I+ G AKGL HLH   P
Sbjct  135  GYCQESNTQFLVYEYVPNGSVSYHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSP  191

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++H +FKT NVLVDENFI KVADAG+ + L     DA   SH +    F+ PE
Sbjct  192  RLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDAGTSSHVVADHIFLSPE  243



>ref|XP_006468921.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Citrus sinensis]
 ref|XP_006468922.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Citrus sinensis]
Length=391

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 144/230 (63%), Gaps = 11/230 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC++   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  AT
Sbjct  27   WFCLYR-NRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLAT  82

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            KNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LL
Sbjct  83   KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLL  142

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG-----LCHL  233
            GYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKG     L HL
Sbjct  143  GYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGDPLQSLAHL  202

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
            H   P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  203  HSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  250



>dbj|BAC43728.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAO63400.1| At3g26700 [Arabidopsis thaliana]
Length=380

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 142/235 (60%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    +     +S            AR F M+EL QAT
Sbjct  27   WFCVFRRKNLS-RTSETGSSDPSTQEGRNVAIELSM---------REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGGVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            G+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249



>ref|XP_009152029.1| PREDICTED: nodulation receptor kinase isoform X1 [Brassica rapa]
Length=377

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S  + +T SSDPS      T G   ++ L+       AR F M+EL QAT
Sbjct  27   WFCIFRRKNASRTSDETGSSDPS------TQGRNVAIELSM----REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPE  249



>emb|CDY13653.1| BnaA06g32700D [Brassica napus]
Length=377

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S  + +T SSDPS      T G   ++ L+       AR F M+EL QAT
Sbjct  27   WFCIFRRKNASRTSDETGSSDPS------TQGRNVAIELSM----REARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPE  249



>ref|XP_009121453.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
Length=399

 Score =   211 bits (538),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 142/235 (60%), Gaps = 11/235 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S++ SSDPS    +     +S            AR F+M+EL QAT
Sbjct  44   WFCIFRRKNAS-RTSESGSSDPSTQERRSVAMDLSM---------REARSFKMEELAQAT  93

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  94   KSFTNKSLIGTGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLL  153

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL HLH   
Sbjct  154  GYCQENNTQFLVYEYVPNGSVSSHLYGGGDKVSGNRLEFRNRLAISIGAAKGLAHLHSLS  213

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ PE
Sbjct  214  PRLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLSPE  268



>ref|XP_010425389.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=379

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 145/233 (62%), Gaps = 14/233 (6%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKN  572
            C+F  K  S R S+T SSDPS      T G   ++ L+       AR F M+EL QATK+
Sbjct  29   CVFRPKNLS-RTSETGSSDPS------TQGRNVAIELSM----REARRFEMEELAQATKS  77

Query  571  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  392
            F   +LIG G FG V+KG L DG +VAIK R + P Q+F  EV  LS   HRNLV LLGY
Sbjct  78   FTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPSLPTQEFVNEVRYLSSIHHRNLVTLLGY  137

Query  391  CQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P 
Sbjct  138  CQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPR  197

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  198  LIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  248



>ref|XP_002875333.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51592.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=380

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  K  S R S+T SSDPS    Q+       L++        AR F M+EL QAT
Sbjct  27   WFCVFRRKNLS-RTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQAT  76

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  77   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLL  136

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            G+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   
Sbjct  137  GFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLS  196

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI KVADAG+ + L     +    SH +    F+ PE
Sbjct  197  PRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REEVGTSSHIVADQIFLSPE  249



>ref|XP_010502605.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
 ref|XP_010502606.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
 ref|XP_010502607.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=380

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 144/233 (62%), Gaps = 13/233 (6%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKN  572
            C+F  K  S R S+T SSDPS    Q+       L++        AR F M+EL QATK+
Sbjct  29   CVFRPKNLS-RTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQATKS  78

Query  571  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  392
            F   +LIG G FG V+KG L DG +VAIK R + P Q+F  EV  LS   HRNLV LLGY
Sbjct  79   FTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPSLPTQEFVNEVRYLSSIHHRNLVTLLGY  138

Query  391  CQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P 
Sbjct  139  CQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPR  198

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  199  LIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249



>ref|XP_010514329.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=380

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 143/233 (61%), Gaps = 13/233 (6%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKN  572
            C+F  K  S R S+T SSDPS    Q+       L++        AR F M+EL QATK+
Sbjct  29   CVFRPKNLS-RTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQATKS  78

Query  571  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  392
            F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LLGY
Sbjct  79   FTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLLGY  138

Query  391  CQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P 
Sbjct  139  CQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPR  198

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  199  LIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249



>ref|XP_002990160.1| hypothetical protein SELMODRAFT_131164 [Selaginella moellendorffii]
 gb|EFJ08720.1| hypothetical protein SELMODRAFT_131164 [Selaginella moellendorffii]
Length=384

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 152/232 (66%), Gaps = 12/232 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   + + +  SDTASSDPSA    + G      A+A     + A+ F  QEL+ ATK
Sbjct  36   LCLMRVRHWPSATSDTASSDPSA----QEG------AIAAAVEAQHAKQFAFQELDHATK  85

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+ SNLIG G FGLV+KG L DGTIVAIKTR++ P Q+F  EV  LS  +H+N+V+LLG
Sbjct  86   GFNPSNLIGRGRFGLVYKGLLEDGTIVAIKTRASAPTQEFVTEVVNLSQLRHKNVVSLLG  145

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            +CQE+ +Q+LV +YLPNG++ +HL     + + +L+FKQR++IA G A+GL +LH   PP
Sbjct  146  FCQEHDHQMLVYDYLPNGSVSSHLCDPNGNPTGELDFKQRVAIALGAARGLEYLHSGNPP  205

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP  59
             VH +FKT NVL+DEN + KV D G+S LL  +    A PS +   S F DP
Sbjct  206  RVHQDFKTSNVLLDENLVAKVTDVGLSKLL--VTSHNAMPSANGSSSHFADP  255



>ref|XP_002992529.1| hypothetical protein SELMODRAFT_162409 [Selaginella moellendorffii]
 gb|EFJ06467.1| hypothetical protein SELMODRAFT_162409 [Selaginella moellendorffii]
Length=384

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 152/232 (66%), Gaps = 12/232 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   + + +  SDTASSDPSA    + G      A+A     + A+ F  QEL+ ATK
Sbjct  36   LCLMRVRHWPSATSDTASSDPSA----QEG------AIAAAVEAQHAKQFAFQELDHATK  85

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+ SNLIG G FGLV+KG L DGTIVAIKTR++ P Q+F  EV  LS  +H+N+V+LLG
Sbjct  86   GFNPSNLIGRGRFGLVYKGLLEDGTIVAIKTRASAPTQEFVTEVVNLSQLRHKNVVSLLG  145

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            +CQE+ +Q+LV +YLPNG++ +HL     + + +L+FKQR++IA G A+GL +LH   PP
Sbjct  146  FCQEHDHQMLVYDYLPNGSVSSHLCDPNGNPTGELDFKQRVAIALGAARGLEYLHSGNPP  205

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP  59
             VH +FKT NVL+DEN + KV D G+S LL  +    A PS +   S F DP
Sbjct  206  RVHQDFKTSNVLLDENLVAKVTDVGLSKLL--VTSHNAMPSANGSSSHFADP  255



>ref|XP_010554148.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X4 [Tarenaya hassleriana]
 ref|XP_010554150.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X4 [Tarenaya hassleriana]
Length=385

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QAT
Sbjct  26   WFCLFG-RRSVSRTSGTASSDPSLQ-----AGRNVAMELSLGE----ARRFEMEELAQAT  75

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  76   KGFTSKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALL  135

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   
Sbjct  136  GYCQENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLS  195

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PE
Sbjct  196  PRLIHKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPE  248



>ref|XP_010554147.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X3 [Tarenaya hassleriana]
Length=398

 Score =   207 bits (528),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QAT
Sbjct  44   WFCLFG-RRSVSRTSGTASSDPSL-----QAGRNVAMELSLGE----ARRFEMEELAQAT  93

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  94   KGFTSKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALL  153

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   
Sbjct  154  GYCQENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLS  213

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PE
Sbjct  214  PRLIHKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPE  266



>ref|XP_006446905.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 ref|XP_006446908.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60145.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60148.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
Length=312

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 123/183 (67%), Gaps = 3/183 (2%)
 Frame = -1

Query  601  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  422
            M+EL  ATKNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  Q
Sbjct  1    MEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQ  60

Query  421  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  242
            HRNLV LLGYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL
Sbjct  61   HRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGL  120

Query  241  CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FI  65
             HLH   P VVH +FKT NVLVDE+FI KVADAG+ + L     D  GPS  +     F+
Sbjct  121  AHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVVGPSSQVTADEIFL  178

Query  64   DPE  56
             PE
Sbjct  179  APE  181



>ref|XP_010554145.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   207 bits (528),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QAT
Sbjct  44   WFCLFG-RRSVSRTSGTASSDPSL-----QAGRNVAMELSLGE----ARRFEMEELAQAT  93

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  94   KGFTSKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALL  153

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   
Sbjct  154  GYCQENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLS  213

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PE
Sbjct  214  PRLIHKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPE  266



>gb|KDO45970.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45971.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=312

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 120/173 (69%), Gaps = 2/173 (1%)
 Frame = -1

Query  601  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  422
            M+EL  ATKNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  Q
Sbjct  1    MEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQ  60

Query  421  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  242
            HRNLV LLGYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL
Sbjct  61   HRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGL  120

Query  241  CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  83
             HLH   P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +
Sbjct  121  AHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQV  171



>ref|XP_010554146.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X2 [Tarenaya hassleriana]
Length=402

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 146/235 (62%), Gaps = 14/235 (6%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+F  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QAT
Sbjct  44   WFCLFG-RRSVSRTSGTASSDPSLQ------GRNVAMELSLGE----ARRFEMEELAQAT  92

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K F   +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LL
Sbjct  93   KGFTSKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALL  152

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GYCQEN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   
Sbjct  153  GYCQENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLS  212

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PE
Sbjct  213  PRLIHKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPE  265



>ref|NP_001169946.1| uncharacterized LOC100383845 [Zea mays]
 ref|XP_008673228.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 ref|XP_008673229.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 ref|XP_008673231.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 gb|ACN35326.1| unknown [Zea mays]
 gb|ACN36772.1| unknown [Zea mays]
 tpg|DAA55993.1| TPA: putative transmembrane protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA55994.1| TPA: putative transmembrane protein kinase family protein isoform 
2 [Zea mays]
Length=366

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 141/228 (62%), Gaps = 21/228 (9%)
 Frame = -1

Query  742  HYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDE  563
            H KR S+ +S++  SD + P  Q+                  AR   ++EL  AT+NF  
Sbjct  32   HRKRTSD-SSESGFSDQALPESQE------------------ARCLSLEELNFATRNFSN  72

Query  562  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  383
             NLIG G+FG V+KG L DGTIVA+K R +PP Q+F +EV  L+   H NLV LLGYCQE
Sbjct  73   GNLIGQGTFGEVYKGLLQDGTIVAVKRRHSPPSQEFIQEVNYLASLCHWNLVKLLGYCQE  132

Query  382  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  203
            +G Q+LV EY+ NG++  HL+G      ++LEFK+RLSIA GTAKGL HLH   PP VH 
Sbjct  133  DGMQMLVYEYISNGSVSTHLHGNSHALGSRLEFKKRLSIAHGTAKGLSHLHSLTPPAVHM  192

Query  202  NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP  59
            NFKT NVLVDE+F PKVAD GI  +L  +     G S      PF++P
Sbjct  193  NFKTSNVLVDEDFAPKVADTGIPGMLDRLG--VTGLSSRTFNDPFVEP  238



>emb|CDY00187.1| BnaC09g01140D [Brassica napus]
Length=432

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 140/235 (60%), Gaps = 11/235 (5%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQAT  578
             FC+   K  S R S++ SSDPS    +     +S            AR F+++EL QAT
Sbjct  44   WFCIIRRKNAS-RTSESGSSDPSTQEGRSVAMDLSM---------REARRFKVEELAQAT  93

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
            K+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LL
Sbjct  94   KSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLL  153

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            GY QEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL HLH   
Sbjct  154  GYSQENNTQFLVYEYVPNGSVSSHLYGAGDKVSGNRLEFRNRLAISIGAAKGLAHLHSLS  213

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ PE
Sbjct  214  PRLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLSPE  268



>emb|CDY63200.1| BnaA09g52250D [Brassica napus]
Length=678

 Score =   207 bits (527),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 142/234 (61%), Gaps = 11/234 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
            FC+F  K  S R S++ SSDPS    +     +S            AR F+M+EL QATK
Sbjct  45   FCIFRRKNAS-RTSESGSSDPSTQERRSVAMDLSM---------REARSFKMEELAQATK  94

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            +F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LLG
Sbjct  95   SFTNKSLIGTGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNLVTLLG  154

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            YCQEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL HLH   P
Sbjct  155  YCQENNTQFLVYEYVPNGSVSSHLYGGGDKVSGNRLEFRNRLAISIGAAKGLAHLHSLSP  214

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ PE
Sbjct  215  RLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLSPE  268



>ref|XP_009152030.1| PREDICTED: nodulation receptor kinase isoform X2 [Brassica rapa]
Length=317

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 124/188 (66%), Gaps = 3/188 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
            AR F M+EL QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  
Sbjct  4    ARRFEMEELAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRY  63

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIAS  260
            LS   HRNLV LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ 
Sbjct  64   LSSINHRNLVTLLGYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISI  123

Query  259  GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  80
            G AKGL HLH   P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ + 
Sbjct  124  GAAKGLAHLHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVA  181

Query  79   PSPFIDPE  56
               F+ PE
Sbjct  182  DQIFLSPE  189



>dbj|BAF79953.1| receptor-like kinase [Marchantia polymorpha]
Length=632

 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 145/242 (60%), Gaps = 15/242 (6%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSAPVEQKTG--GPVSSLALARGGVPEG----ARVFRMQEL  590
            C+   K + +  SDT SSDPSA V+   G  GP+     AR   PE     AR F ++EL
Sbjct  268  CLLRAKSWPSATSDTGSSDPSAQVDWAKGPEGPI-----ARSVAPESDTSKARYFSLEEL  322

Query  589  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  410
            E ATK F  +N IG G FG V+KG L DGTIVA+K R     Q F   V  LS  +H++L
Sbjct  323  EHATKKFSANNKIGRGGFGEVYKGLLEDGTIVAVKGRQGAATQDFQAAVEFLSRMRHKHL  382

Query  409  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLH  230
            VN+LG+CQEN  QI+V +YLPNG++C HLY        KL+F+QRL+IA G AKGL +LH
Sbjct  383  VNVLGFCQENDQQIVVYDYLPNGSVCGHLYDDNGAPVGKLDFRQRLAIALGAAKGLEYLH  442

Query  229  GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ----PSPFID  62
               P ++H +FKT NVL+D   + KV D G+S LL E  H   GP  S       + F+D
Sbjct  443  TTTPKLIHRDFKTSNVLLDAYLVAKVTDFGLSLLLAEGPHPQEGPVLSSLNGDGTAGFLD  502

Query  61   PE  56
            PE
Sbjct  503  PE  504



>ref|XP_010651159.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010651160.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI16311.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   201 bits (510),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 146/235 (62%), Gaps = 10/235 (4%)
 Frame = -1

Query  751  CMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQA  581
            C+   KR+  R S+TASS PS PVE    G  +SL  A    P G    R   + ELE A
Sbjct  170  CLMRVKRFIRRTSETASSVPSPPVEWD--GRNTSLQ-ASALSPYGTTHLRQLTIMELEHA  226

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T NF ++N+IG G FGLV+KG L DG+IVAIK R   P Q F+ EV R++  QH++LV L
Sbjct  227  TCNFSQNNIIGEGGFGLVYKGLLLDGSIVAIKRRLHTPTQFFAHEVKRIARVQHKHLVKL  286

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GYC+EN  Q+LV +YL NG + NHLY        +LE  QRLSIA G AKGL HLH   
Sbjct  287  IGYCEENHQQLLVNDYLQNGNVGNHLYDSEGLPMGRLEIWQRLSIALGAAKGLEHLHSLV  346

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P  +H +F+T NVLVDENF  KV+D G+S LL E     AG S +I    F+DPE
Sbjct  347  PSFLHMHFRTSNVLVDENFTAKVSDFGLSRLLAE--GARAGSSSAI--DCFLDPE  397



>ref|XP_008225618.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=515

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 146/234 (62%), Gaps = 6/234 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV-PEGARVFRMQELEQAT  578
             C+   KR+  R S+T SS PS PVE + G  +S  A+A      +  R   + ELEQAT
Sbjct  162  ICLMRVKRFIRRTSETESSVPSPPVEWERGN-MSPYAVALSVYNTQNLRQLTVLELEQAT  220

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
             NF+E N+IG   FGLV+KG L DG+IVAIK R   P Q F  EV R++   H +++ L+
Sbjct  221  CNFNEINIIGQCRFGLVYKGLLQDGSIVAIKRRRHAPTQYFFHEVKRIAHVNHVHVLRLI  280

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            GYCQ+   Q+LV EYLPNG + NHLY        KL  +QRLSIA G AKGL HLH   P
Sbjct  281  GYCQDASQQLLVYEYLPNGNVGNHLYDAEGLPIGKLGIRQRLSIALGAAKGLAHLHNLVP  340

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P++H  F+T NVL+DENF  KV+D G++ LL + +H  AG S +I    F+DPE
Sbjct  341  PLLHMYFRTSNVLLDENFTAKVSDYGLTKLLVKGHH--AGSSSAI--DYFLDPE  390



>ref|XP_007205462.1| hypothetical protein PRUPE_ppa007926mg [Prunus persica]
 gb|EMJ06661.1| hypothetical protein PRUPE_ppa007926mg [Prunus persica]
Length=351

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 6/228 (3%)
 Frame = -1

Query  736  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV-PEGARVFRMQELEQATKNFDES  560
            KR+  R S+T SS PS  VE + G  +S  A+A      +  R   + ELEQAT NF+E 
Sbjct  4    KRFIRRTSETGSSAPSPSVEWERGN-MSPYAVALSLYNTQNLRQLTILELEQATCNFNEI  62

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            N+IG   FGLV+KG L DG+IVAIK R   P Q F  EV R++   H +++ L+GYCQ+ 
Sbjct  63   NIIGQCRFGLVYKGLLQDGSIVAIKRRLHAPTQYFFHEVKRIAHVNHVHVLRLIGYCQDA  122

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
              Q+LV EYLPNG + NHLY        KL  +QRLSIA G AKGL HLH   PP++H  
Sbjct  123  SQQLLVYEYLPNGNVGNHLYDAEGLPIGKLGIRQRLSIALGAAKGLAHLHNLVPPLLHMY  182

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            F+T NVL+DENF  KV+D G++ LL + +H  AG S +I    F DPE
Sbjct  183  FRTSNVLLDENFTAKVSDYGLTKLLVKGHH--AGSSSTI--DYFRDPE  226



>ref|XP_009367080.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Pyrus x bretschneideri]
Length=435

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQ
Sbjct  194  ICLMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQ  250

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ 
Sbjct  251  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILR  310

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH  
Sbjct  311  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSL  370

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  371  VPPLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAVD--CFLDPE  421



>ref|XP_010909093.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X2 [Elaeis 
guineensis]
Length=349

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 137/229 (60%), Gaps = 41/229 (18%)
 Frame = -1

Query  721  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  560
            R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31   RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83   NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
              Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AK                
Sbjct  143  DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAK----------------  186

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
                    DE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  187  --------DEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPE  225



>ref|XP_009367079.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Pyrus x bretschneideri]
Length=521

 Score =   193 bits (490),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQ
Sbjct  169  ICLMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQ  225

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ 
Sbjct  226  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILR  285

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH  
Sbjct  286  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSL  345

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  346  VPPLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPE  396



>ref|XP_009367078.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=524

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQ
Sbjct  172  ICLMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQ  228

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ 
Sbjct  229  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILR  288

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH  
Sbjct  289  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSL  348

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  349  VPPLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPE  399



>ref|XP_008359242.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Malus domestica]
Length=499

 Score =   192 bits (487),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+TASS PS P  Q   G  S  A+A    P  A   R   + ELEQ
Sbjct  147  ICLMRVKRLTRRTSETASSPPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTILELEQ  203

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  204  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHVHILR  263

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  K RLSIA G AKGL HLH  
Sbjct  264  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKHRLSIALGAAKGLAHLHSL  323

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+F  KV+D G++ LL  + H  AG S ++    F DPE
Sbjct  324  VPPLLHMHFGTSNVLLDESFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFRDPE  374



>ref|XP_009367077.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=546

 Score =   192 bits (488),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQ
Sbjct  194  ICLMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQ  250

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ 
Sbjct  251  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILR  310

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH  
Sbjct  311  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSL  370

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  371  VPPLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPE  421



>ref|XP_008349749.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Malus domestica]
Length=434

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A A    P  A   R   + ELEQ
Sbjct  153  ICLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAXAHS--PYSAPNLRQLTILELEQ  209

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  210  ATCNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  269

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRLSIA G AKGL HL   
Sbjct  270  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLSIALGAAKGLAHLRSL  329

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  330  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  380



>ref|XP_008359234.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Malus domestica]
Length=521

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + R S+TASS PS P  Q   G  S  A+A    P  A   R   + ELEQ
Sbjct  169  ICLMRVKRLTRRTSETASSPPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTILELEQ  225

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT+NF+E N+IG G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  226  ATRNFNEINIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHVHILR  285

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        KL  K RLSIA G AKGL HLH  
Sbjct  286  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKHRLSIALGAAKGLAHLHSL  345

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F T NVL+DE+F  KV+D G++ LL  + H  AG S ++    F DPE
Sbjct  346  VPPLLHMHFGTSNVLLDESFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFRDPE  396



>ref|XP_008349748.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Malus domestica]
Length=505

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A A    P  A   R   + ELEQ
Sbjct  153  ICLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAXAHS--PYSAPNLRQLTILELEQ  209

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  210  ATCNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  269

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRLSIA G AKGL HL   
Sbjct  270  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLSIALGAAKGLAHLRSL  329

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  330  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  380



>gb|KHG00527.1| Serine/threonine-protein kinase-like protein ACR4 [Gossypium 
arboreum]
Length=357

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 144/228 (63%), Gaps = 31/228 (14%)
 Frame = -1

Query  736  KRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDES  560
            K +SNR S+T SSDPS   E   G GP SS   +  G P+GA+ F ++ELEQATK F ES
Sbjct  32   KSFSNRASETGSSDPSTLTEWNRGVGPSSSAGPSLYG-PQGAKEFMLEELEQATKQFAES  90

Query  559  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  380
            +LIG GSFGLV+KG L D  +VAIK     PR +F   VA L  T++R            
Sbjct  91   SLIGYGSFGLVYKGLLRD-VVVAIKRHPGIPRPEF---VAGLG-TRNR------------  133

Query  379  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  200
               +L   + PN          GR++ T+LEFKQRLSIA G A+GLCHLHG  PP++H N
Sbjct  134  ---LLSRRWFPN-------VDTGREAPTRLEFKQRLSIALGAARGLCHLHGLKPPLIHKN  183

Query  199  FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            FKTGNVLVDE+FI KVADAG+S LL++I  + A PS++   + F DPE
Sbjct  184  FKTGNVLVDEDFIAKVADAGVSMLLEKI--EEASPSYTSSVNIFRDPE  229



>ref|XP_009335090.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X4 [Pyrus x bretschneideri]
Length=524

 Score =   189 bits (481),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQ
Sbjct  172  MCLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQ  228

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  229  ATSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  288

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL   
Sbjct  289  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSL  348

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  349  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  399



>ref|XP_009335089.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X3 [Pyrus x bretschneideri]
Length=527

 Score =   189 bits (480),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQ
Sbjct  175  MCLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQ  231

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  232  ATSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  291

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL   
Sbjct  292  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSL  351

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  352  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  402



>ref|XP_009335088.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Pyrus x bretschneideri]
Length=544

 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQ
Sbjct  192  MCLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQ  248

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  249  ATSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  308

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL   
Sbjct  309  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSL  368

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  369  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  419



>ref|XP_009335087.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Pyrus x bretschneideri]
Length=546

 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 143/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQ  584
             C+   KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQ
Sbjct  194  MCLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQ  250

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ 
Sbjct  251  ATSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILR  310

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL   
Sbjct  311  LIGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSL  370

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  371  VPPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPE  421



>ref|XP_009420341.1| PREDICTED: probable receptor-like protein kinase At1g30570 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=346

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 131/223 (59%), Gaps = 38/223 (17%)
 Frame = -1

Query  721  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  542
            R+SDT SS+ S   EQ       ++ LA     +GARVF ++EL+ ATK+F   NLIG G
Sbjct  38   RSSDTNSSELSVQEEQ-------TIELA----FQGARVFTLKELDAATKDFSNINLIGYG  86

Query  541  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  362
             FG V KGFL DGTIVAIK R + P Q+F EEV  LS  +HRNLV LLGYCQEN  Q+LV
Sbjct  87   MFGEVNKGFLQDGTIVAIKRRVSAPSQEFIEEVCYLSSIRHRNLVRLLGYCQENDLQMLV  146

Query  361  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  182
             EY+ NG++  HLYG  +  S KLEFK RLSIA G AK                      
Sbjct  147  YEYVSNGSVSTHLYGGNQVLSRKLEFKHRLSIAHGAAK----------------------  184

Query  181  LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  56
              DE+FIPKVADAG+  LL   N   A PS  +    PF DPE
Sbjct  185  --DEDFIPKVADAGLRRLLNRTN--GASPSSRVTTDDPFHDPE  223



>ref|XP_007016736.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
3, partial [Theobroma cacao]
 gb|EOY34355.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
3, partial [Theobroma cacao]
Length=375

 Score =   181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 136/233 (58%), Gaps = 7/233 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+
Sbjct  76   ICLMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQ  132

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+G
Sbjct  133  NFSQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVG  192

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YC  +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP
Sbjct  193  YCGNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPP  252

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE
Sbjct  253  LLHMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPE  301



>ref|XP_010528127.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X4 [Tarenaya hassleriana]
Length=331

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 3/185 (2%)
 Frame = -1

Query  607  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  428
            F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  16   FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  75

Query  427  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  251
              HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  76   IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  135

Query  250  KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  71
            KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  136  KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  193

Query  70   FIDPE  56
             + PE
Sbjct  194  LLAPE  198



>ref|XP_004293053.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like 
[Fragaria vesca subsp. vesca]
Length=544

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -1

Query  613  RVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARL  434
            R   + ELEQAT NF+E+N+IG G FGLV+KG L DGTIVAIK R   P Q F +EV  +
Sbjct  217  RQLTILELEQATSNFNENNIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFQEVKHI  276

Query  433  SMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGT  254
            +   H +++ L+GYCQ++  Q+LV +YLPNG + NHLY        KL  +QRLS+A G 
Sbjct  277  ARVNHVHILRLIGYCQDSSQQLLVYDYLPNGNVGNHLYDAEGLPIGKLNLRQRLSVALGA  336

Query  253  AKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS  74
            AKGL HLH   PP++H NF+T NVL+D+NF  KV+D G++ LL +  +   G S +I   
Sbjct  337  AKGLAHLHSLVPPLLHMNFRTSNVLLDDNFTAKVSDYGLTRLLNKAPY--TGSSSAI--D  392

Query  73   PFIDPE*TTL  44
             F+DPE  +L
Sbjct  393  CFLDPELDSL  402



>ref|XP_010528125.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X2 [Tarenaya hassleriana]
Length=362

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 3/185 (2%)
 Frame = -1

Query  607  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  428
            F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  47   FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  106

Query  427  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  251
              HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  107  IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  166

Query  250  KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  71
            KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  167  KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  224

Query  70   FIDPE  56
             + PE
Sbjct  225  LLAPE  229



>ref|XP_007016735.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
2 [Theobroma cacao]
 gb|EOY34354.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
2 [Theobroma cacao]
Length=475

 Score =   181 bits (458),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 136/233 (58%), Gaps = 7/233 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+
Sbjct  126  ICLMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQ  182

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+G
Sbjct  183  NFSQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVG  242

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YC  +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP
Sbjct  243  YCGNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPP  302

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE
Sbjct  303  LLHMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPE  351



>ref|XP_010253665.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253666.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253667.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253668.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
Length=524

 Score =   181 bits (460),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 139/233 (60%), Gaps = 4/233 (2%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   KR   R S+T SS PS  VE         +  +     +  R   + EL++AT 
Sbjct  172  ICLMRAKRIVRRTSETGSSVPSPLVELAREHCSPHIVASSLFEQQNIRQLSIVELKEATS  231

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF +SN+IG G FGLV+KG L DG+++AIK R   P + F +E+  +    HR+LV L+G
Sbjct  232  NFSQSNIIGEGGFGLVYKGLLQDGSMIAIKRRFHDPSRYFVQEIENIGHVCHRHLVKLIG  291

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YCQE   Q+LV EYLP G + N+LY        KL+ + RLS+A G AKGL +LH   PP
Sbjct  292  YCQEIHQQLLVYEYLPYGNIGNYLYDRDGFPIGKLDIQGRLSMALGAAKGLEYLHSMVPP  351

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             +H +F+T NVLVDENF+ KV+D G+S LL E +   AG S +I    F+DPE
Sbjct  352  FLHMHFRTSNVLVDENFVAKVSDFGLSRLLDESSR--AGSSAAI--DCFLDPE  400



>ref|XP_010528121.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528122.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528123.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528124.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
Length=380

 Score =   178 bits (451),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 3/185 (2%)
 Frame = -1

Query  607  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  428
            F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  65   FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  124

Query  427  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  251
              HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  125  IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  184

Query  250  KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  71
            KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  185  KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  242

Query  70   FIDPE  56
             + PE
Sbjct  243  LLAPE  247



>ref|XP_007016734.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY34353.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
1 [Theobroma cacao]
Length=517

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 136/233 (58%), Gaps = 7/233 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+
Sbjct  168  ICLMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQ  224

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+G
Sbjct  225  NFSQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVG  284

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            YC  +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP
Sbjct  285  YCGNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPP  344

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            ++H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE
Sbjct  345  LLHMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPE  393



>gb|EMT31170.1| Serine/threonine-protein kinase-like protein ACR4 [Aegilops tauschii]
Length=337

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 114/190 (60%), Gaps = 31/190 (16%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  443
            +GAR   ++EL  AT NF  SNL+G G FG                            EV
Sbjct  53   QGARCMTLEELRSATNNFSSSNLVGHGMFG----------------------------EV  84

Query  442  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  266
              LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  85   NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISAHLHGNGNSPTVRLEFKQRLAI  144

Query  265  ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  86
            A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  145  AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFLPKVADTGIRGLLDRLGN--AGPPSM  202

Query  85   IQPSPFIDPE  56
            I   PF+DP 
Sbjct  203  IFNDPFVDPR  212



>gb|KHN11203.1| Proline-rich receptor-like protein kinase PERK15 [Glycine soja]
Length=452

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 137/237 (58%), Gaps = 10/237 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE---GARVFRMQELE  587
            C C+   KR+  + S+ ASS PS  VE    G V++        P      R   + ELE
Sbjct  100  CICLMRVKRFMRQTSEAASSMPSPTVEM---GRVNNTQNVNAFPPHYTLNTRQLTILELE  156

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QAT+NF  SN+I  G FG V+KG L DG+IVAIK R     Q F  EV +++   H +LV
Sbjct  157  QATRNFSHSNIISEGGFGFVYKGLLQDGSIVAIKRRLFALTQDFVLEVNQIAHIHHTHLV  216

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             L+GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIA G +KG+ HLH 
Sbjct  217  KLIGYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIALGASKGVEHLHS  276

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
              PP+VH NF+T NVL+DEN+  KVA  G   L  ++  D AG S  +    F+DPE
Sbjct  277  LVPPLVHTNFRTSNVLLDENYTAKVAVYGFCKLQTQV--DNAGSSSHV--DCFLDPE  329



>ref|XP_006592693.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 ref|XP_006592694.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
 ref|XP_006592695.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Glycine max]
 ref|XP_006592696.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Glycine max]
Length=474

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 137/237 (58%), Gaps = 10/237 (4%)
 Frame = -1

Query  757  CFCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE---GARVFRMQELE  587
            C C+   KR+  + S+ ASS PS  VE    G V++        P      R   + ELE
Sbjct  122  CICLMRVKRFMRQTSEAASSMPSPTVEM---GRVNNTQNVNAFPPHYTLNTRQLTILELE  178

Query  586  QATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLV  407
            QAT+NF  SN+I  G FG V+KG L DG+IVAIK R     Q F  EV +++   H +LV
Sbjct  179  QATRNFSHSNIISEGGFGFVYKGLLQDGSIVAIKRRLFALTQDFVLEVNQIAHIHHTHLV  238

Query  406  NLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHG  227
             L+GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIA G +KG+ HLH 
Sbjct  239  KLIGYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIALGASKGVEHLHS  298

Query  226  QCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
              PP+VH NF+T NVL+DEN+  KVA  G   L  ++  D AG S  +    F+DPE
Sbjct  299  LVPPLVHTNFRTSNVLLDENYTAKVAVYGFCKLQTQV--DNAGSSSHV--DCFLDPE  351



>ref|XP_007150206.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 ref|XP_007150207.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 gb|ESW22200.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 gb|ESW22201.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
Length=473

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 135/233 (58%), Gaps = 8/233 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   K+   + S+ ASS PS  VE          A +    P+  R   + ELEQAT+
Sbjct  126  ICLMRVKKSMRQTSEVASSMPSPTVEMGRVNTQHVTAFS----PQNTRQLTILELEQATR  181

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
            NF  +N+IG G FG+V+KG L DG+IVAIK R       F  EV +++   H +LV L+G
Sbjct  182  NFSHNNIIGEGGFGVVYKGLLQDGSIVAIKRRLFALTPDFVVEVKQIAHIHHIHLVKLIG  241

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++N  Q+LV EYLPN  + +HLY        +L   +RLSIA G +KG+ HLH   PP
Sbjct  242  YYEDNHQQLLVYEYLPNSNVGSHLYDSEGLPVGRLNLWRRLSIALGASKGVEHLHSLVPP  301

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            +VH NF+T NVL+DEN+  KV+D G   L  ++  D AG S ++    F+DPE
Sbjct  302  LVHTNFRTSNVLLDENYTAKVSDYGFCKLQAQV--DRAGSSSNV--DCFLDPE  350



>ref|XP_010541334.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X6 [Tarenaya hassleriana]
 ref|XP_010541335.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X6 [Tarenaya hassleriana]
Length=330

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 139/240 (58%), Gaps = 7/240 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  75   MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  129

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  130  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  189

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  190  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  249

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPIS  35
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP     P+S
Sbjct  250  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDPLFAISPLS  307



>ref|XP_010541333.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X5 [Tarenaya hassleriana]
Length=345

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 139/240 (58%), Gaps = 7/240 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  90   MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  144

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  145  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  204

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  205  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  264

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPIS  35
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP     P+S
Sbjct  265  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDPLFAISPLS  322



>ref|XP_002530283.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF32090.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=518

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 140/236 (59%), Gaps = 13/236 (6%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFR---MQELEQ  584
             C+   K+     S+TASS PS+P +   G   +    A    P  AR  R   + E+E 
Sbjct  166  MCLMRIKKVLRHRSETASSMPSSPSDLARG---NIFPYAAAQSPFNARDLRQLSIVEVEH  222

Query  583  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  404
            AT NF +SN+IG GSFG  +KG L DG+IVAIK     P Q F  EV  ++   H++LV+
Sbjct  223  ATHNFSQSNIIGEGSFGFAYKGLLLDGSIVAIKRCLHKPVQDFVHEVKHIASVHHKHLVD  282

Query  403  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  224
            L+GYC++   + LV +Y+ NG + ++LYG+      KL+ +QRLSIA G AKGL +LH  
Sbjct  283  LIGYCEDTHQKFLVYDYISNGNVGSYLYGL---PIGKLDMRQRLSIALGAAKGLQYLHSM  339

Query  223  CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             PP++H +F++ NVL+ +N I KV+D G+  L  E +   AG S +I    F+DPE
Sbjct  340  VPPLLHMHFRSSNVLLGDNIIAKVSDYGLLKLAMESHR--AGTSSAID--YFLDPE  391



>gb|KHN21520.1| Proline-rich receptor-like protein kinase PERK9, partial [Glycine 
soja]
Length=450

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 139/235 (59%), Gaps = 9/235 (4%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             C+   KR+  + S+ ASS PS  VE  +     V++ +          R   + ELEQA
Sbjct  100  ICLMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILELEQA  156

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T+NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L
Sbjct  157  TRNFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKL  216

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   
Sbjct  217  IGYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLV  276

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE
Sbjct  277  PPLIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPE  327



>ref|XP_002440989.1| hypothetical protein SORBIDRAFT_09g018470 [Sorghum bicolor]
 gb|EES19419.1| hypothetical protein SORBIDRAFT_09g018470 [Sorghum bicolor]
Length=256

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  448  EVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLS  269
            +V  LS  +HRN+V L+GYCQE G Q+LV EYLPNG++C HLY   + S+T+LEFKQRLS
Sbjct  2    QVRWLSEIRHRNIVTLIGYCQEGGLQMLVYEYLPNGSVCGHLYDTRKGSATRLEFKQRLS  61

Query  268  IASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  89
            IA G AKGL HLH   PP++H +FKT NVLVDENFI KVADAG+  L++    D AGPSH
Sbjct  62   IAIGAAKGLNHLHSLDPPLIHKDFKTNNVLVDENFIAKVADAGLVRLIR--GSDDAGPSH  119

Query  88   SIQPSPFIDPE  56
                S + DPE
Sbjct  120  GFSNSVYQDPE  130



>ref|XP_006594983.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X5 [Glycine max]
Length=418

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 139/235 (59%), Gaps = 9/235 (4%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             C+   KR+  + S+ ASS PS  VE  +     V++ +          R   + E+EQA
Sbjct  68   ICLMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILEVEQA  124

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T+NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L
Sbjct  125  TRNFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKL  184

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   
Sbjct  185  IGYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLV  244

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE
Sbjct  245  PPLIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPE  295



>ref|XP_010541329.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X1 [Tarenaya hassleriana]
Length=405

 Score =   167 bits (424),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 139/240 (58%), Gaps = 7/240 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  150  MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  204

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  205  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  264

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  265  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  324

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPIS  35
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP     P+S
Sbjct  325  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDPLFAISPLS  382



>ref|XP_010541331.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X3 [Tarenaya hassleriana]
Length=397

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 139/240 (58%), Gaps = 7/240 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  142  MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  196

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  197  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  256

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  257  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  316

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPIS  35
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP     P+S
Sbjct  317  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDPLFAISPLS  374



>ref|XP_010541330.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X2 [Tarenaya hassleriana]
Length=397

 Score =   167 bits (423),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 139/240 (58%), Gaps = 7/240 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  142  MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  196

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  197  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  256

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  257  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  316

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE*TTLPIS  35
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP     P+S
Sbjct  317  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDPLFAISPLS  374



>ref|XP_010541332.1| PREDICTED: serine/threonine-protein kinase-like protein CCR4 
isoform X4 [Tarenaya hassleriana]
Length=395

 Score =   167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 136/232 (59%), Gaps = 7/232 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  575
             C+   +      S+T SS   +P E +    +SS      G  +  R   + EL+QAT 
Sbjct  150  MCVGRRRFLRQTTSETVSSPLPSPREMQEKIKISSC-----GSTQNLRKITLPELDQATN  204

Query  574  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  395
             F+++N++G G FG V+KG L DG+IVA+K R     Q F  E+ RL+  QH+NLV + G
Sbjct  205  YFNQNNMMGEGLFGSVYKGLLQDGSIVAVKRRIHNQNQSFVRELNRLAQVQHKNLVKICG  264

Query  394  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  215
            Y ++   QIL+ +Y+ NG +  +LY      + +L  +QRL IA   AKGL HLHG  PP
Sbjct  265  YYEDTHQQILISDYIHNGDVGRYLYDSDGIPNGRLNIQQRLLIALDAAKGLEHLHGLDPP  324

Query  214  VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP  59
            +VH +F+T NVL+DENF  KV+D GIS L+ E +H  AGPS S     FIDP
Sbjct  325  LVHMHFRTRNVLLDENFTAKVSDYGISRLVCEDSHQ-AGPS-STSTDSFIDP  374



>ref|NP_001045282.2| Os01g0929200 [Oryza sativa Japonica Group]
 dbj|BAF07196.2| Os01g0929200, partial [Oryza sativa Japonica Group]
Length=141

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = -1

Query  628  VPE--GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQF  455
            +PE  GAR   ++EL  AT+NF   NLIG G FG V+KG L DGTIVAIK R +PP  +F
Sbjct  4    IPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEF  63

Query  454  SEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQR  275
              EV  LS  +HRNLVNLLGYCQENG Q+LV EY+PNG++  HL+G       KLEFKQR
Sbjct  64   IHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQR  123

Query  274  LSIASGTAKG  245
            LSIA G AKG
Sbjct  124  LSIAHGAAKG  133



>ref|XP_006594979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 ref|XP_006594980.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
 ref|XP_006594981.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Glycine max]
 ref|XP_006594982.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Glycine max]
Length=476

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 139/235 (59%), Gaps = 9/235 (4%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQA  581
             C+   KR+  + S+ ASS PS  VE  +     V++ +          R   + E+EQA
Sbjct  126  ICLMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILEVEQA  182

Query  580  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  401
            T+NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L
Sbjct  183  TRNFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKL  242

Query  400  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  221
            +GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   
Sbjct  243  IGYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLV  302

Query  220  PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            PP++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE
Sbjct  303  PPLIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPE  353



>ref|XP_003597233.1| Receptor-like protein kinase ANXUR2 [Medicago truncatula]
Length=945

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = -1

Query  736  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATKNFD  566
            KR+  + SD+ASS PS  VE    G +++        P   +  R+  + E+EQAT  F+
Sbjct  395  KRFKKQPSDSASSVPSQAVEM---GRINNSQYVNAFSPHYMQNTRLLTILEIEQATGKFN  451

Query  565  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  386
            +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +++   H +LV L+GY  
Sbjct  452  QSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQIAQIHHIHLVKLIGYYD  511

Query  385  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  206
            ++  Q+LV EYLPNG + NHLY        KL  ++R+SIA G +KGL HLH   PP++H
Sbjct  512  DSYQQLLVYEYLPNGNVGNHLYDSEGLPIGKLNLQRRVSIALGASKGLEHLHSLVPPLLH  571

Query  205  GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
             NF T NVL+DEN+  KV+D G   L  EI  D AG S ++    F DPE
Sbjct  572  TNFSTRNVLLDENYTAKVSDYGFFKLQTEI--DQAGSSSNV--DYFHDPE  617



>gb|KDO73271.1| hypothetical protein CISIN_1g009644mg [Citrus sinensis]
Length=530

 Score =   164 bits (415),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 136/239 (57%), Gaps = 17/239 (7%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARVFRMQE  593
             C+   KR   R S+  SS PS   E + G      G VS +        +  +   + E
Sbjct  179  ICLMCVKRRIRR-SEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQLTILE  231

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++   HR+
Sbjct  232  LKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLQTQIQNFLHEVKHIARVHHRH  291

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AKGL HL
Sbjct  292  LVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAKGLEHL  351

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            H   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F+DPE
Sbjct  352  HSLVPPLFHMHFRTSNVLLEENYTAKVSDYGLLKLVTGSHH--AGSTSAV--DCFLDPE  406



>ref|XP_010098195.1| Proline-rich receptor-like protein kinase PERK8 [Morus notabilis]
 gb|EXB74651.1| Proline-rich receptor-like protein kinase PERK8 [Morus notabilis]
Length=496

 Score =   163 bits (413),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 144/234 (62%), Gaps = 6/234 (3%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV-PEGARVFRMQELEQAT  578
             C+   K+   R S++ASS PS+PVE + GG  S  A+A      +  R   + E+EQAT
Sbjct  144  ICLMRVKKLIRRTSESASSVPSSPVEWERGG-TSPYAVALSPFDTQNLRELSILEVEQAT  202

Query  577  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  398
             NF ++N+IG G FGL +KG L DG+IVAIK R   P + F  +V +++  QH +LV L+
Sbjct  203  CNFSQNNIIGEGRFGLAYKGMLQDGSIVAIKRRLQTPTRSFFHQVKQIARVQHVHLVKLI  262

Query  397  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  218
            G+  ++   +L+ +YL NG + NHLY        KL  + R+SIA G AKGL HLH   P
Sbjct  263  GFYYDSYQHLLIYDYLLNGNVGNHLYDSEGLPIGKLGIRHRVSIALGAAKGLGHLHSLVP  322

Query  217  PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            P +H NF+T NVL+DE F+ KV+D G+S LL E NH  AG S +I    F+DPE
Sbjct  323  PQLHLNFRTRNVLLDETFMAKVSDYGLSKLLIEGNH--AGSSSAI--DCFLDPE  372



>ref|XP_006424580.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 ref|XP_006424581.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 ref|XP_006488098.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Citrus sinensis]
 ref|XP_006488099.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Citrus sinensis]
 gb|ESR37820.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 gb|ESR37821.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
Length=514

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 136/239 (57%), Gaps = 17/239 (7%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARVFRMQE  593
             C+   KR   R S+  SS PS   E + G      G VS +        +  +   + E
Sbjct  163  ICLMCVKRRIRR-SEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQLTILE  215

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++   HR+
Sbjct  216  LKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIARVHHRH  275

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AKGL HL
Sbjct  276  LVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAKGLEHL  335

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            H   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F+DPE
Sbjct  336  HSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCFLDPE  390



>ref|XP_006488100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Citrus sinensis]
Length=510

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 136/239 (57%), Gaps = 17/239 (7%)
 Frame = -1

Query  754  FCMFHYKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARVFRMQE  593
             C+   KR   R S+  SS PS   E + G      G VS +        +  +   + E
Sbjct  159  ICLMCVKRRIRR-SEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQLTILE  211

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  413
            L+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++   HR+
Sbjct  212  LKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIARVHHRH  271

Query  412  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  233
            LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AKGL HL
Sbjct  272  LVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAKGLEHL  331

Query  232  HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            H   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F+DPE
Sbjct  332  HSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCFLDPE  386



>ref|XP_006488101.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Citrus sinensis]
Length=415

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -1

Query  595  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  416
            EL+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++   HR
Sbjct  116  ELKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIARVHHR  175

Query  415  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  236
            +LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AKGL H
Sbjct  176  HLVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAKGLEH  235

Query  235  LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  56
            LH   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F+DPE
Sbjct  236  LHSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCFLDPE  291



>ref|XP_004487115.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Cicer arietinum]
Length=408

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
             R+  + ELEQAT NF +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +
Sbjct  155  TRLLTILELEQATGNFSQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQ  214

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            ++   H NLV L+GY +++  Q+LV EYLPNG + NHLY        KL+ ++R+SIA G
Sbjct  215  IAHIHHINLVKLIGYYEDSYQQLLVYEYLPNGNVGNHLYDNEGLPIGKLDLRRRVSIALG  274

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             +KGL HLH   PP+ H NF T NVL+DEN+  KV+D G   L  + N   AG S ++  
Sbjct  275  ASKGLEHLHSLVPPLFHRNFSTRNVLLDENYTAKVSDYGFCKLHTKFNQ--AGSSSNV--  330

Query  76   SPFIDPE  56
              F DPE
Sbjct  331  DCFHDPE  337



>ref|XP_004487113.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Cicer arietinum]
Length=460

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
             R+  + ELEQAT NF +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +
Sbjct  155  TRLLTILELEQATGNFSQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQ  214

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            ++   H NLV L+GY +++  Q+LV EYLPNG + NHLY        KL+ ++R+SIA G
Sbjct  215  IAHIHHINLVKLIGYYEDSYQQLLVYEYLPNGNVGNHLYDNEGLPIGKLDLRRRVSIALG  274

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             +KGL HLH   PP+ H NF T NVL+DEN+  KV+D G   L  + N   AG S ++  
Sbjct  275  ASKGLEHLHSLVPPLFHRNFSTRNVLLDENYTAKVSDYGFCKLHTKFNQ--AGSSSNV--  330

Query  76   SPFIDPE  56
              F DPE
Sbjct  331  DCFHDPE  337



>ref|XP_004487114.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Cicer arietinum]
Length=458

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = -1

Query  616  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  437
             R+  + ELEQAT NF +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +
Sbjct  153  TRLLTILELEQATGNFSQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQ  212

Query  436  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  257
            ++   H NLV L+GY +++  Q+LV EYLPNG + NHLY        KL+ ++R+SIA G
Sbjct  213  IAHIHHINLVKLIGYYEDSYQQLLVYEYLPNGNVGNHLYDNEGLPIGKLDLRRRVSIALG  272

Query  256  TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  77
             +KGL HLH   PP+ H NF T NVL+DEN+  KV+D G   L  + N   AG S ++  
Sbjct  273  ASKGLEHLHSLVPPLFHRNFSTRNVLLDENYTAKVSDYGFCKLHTKFNQ--AGSSSNV--  328

Query  76   SPFIDPE  56
              F DPE
Sbjct  329  DCFHDPE  335



>dbj|BAF46308.1| leucine-rich repeat transmembrane protein kinase [Ipomoea nil]
Length=377

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 125/197 (63%), Gaps = 11/197 (6%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTR---SAPPRQQFS  452
            +G + F  +E+  AT+NFD+S+L+G G +G V+KG L DGT+VAIK     S    ++F 
Sbjct  33   DGVKDFTFEEMALATQNFDDSSLVGRGGYGKVYKGILADGTVVAIKRAQEGSLQGEKEFL  92

Query  451  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  272
             E+  LS   HRNLV+L+GYC E G Q+LV E++PNGT+ +HL G  ++    L+F  R+
Sbjct  93   TEIELLSRLHHRNLVSLIGYCGEEGDQMLVYEFMPNGTLRDHLSGKSKEP---LDFAMRM  149

Query  271  SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  95
             IA G+AKG+ +LH +  PP+ H + K  N+L+D   I KVAD G+S L    + +   P
Sbjct  150  RIALGSAKGILYLHTEADPPIFHRDIKASNILLDTKLIAKVADFGLSRLAPVPDLEGVLP  209

Query  94   SH---SIQPSP-FIDPE  56
            +H    ++ +P ++DPE
Sbjct  210  AHVSTVVKGTPGYLDPE  226



>dbj|BAD87127.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=361

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 11/197 (6%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTR---SAPPRQQFS  452
            +G + F  QEL   T +F +S LIG G +G V++G L DGTIVAIK     S    ++F 
Sbjct  4    DGVKDFSFQELSHGTNDFSDSALIGQGGYGKVYRGILSDGTIVAIKRAQQGSLQGSKEFF  63

Query  451  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  272
             E+  LS   HRNLV+LLGYC E   Q+LV E++PNGT+ +HL    ++    L F  RL
Sbjct  64   TEIELLSRLHHRNLVSLLGYCDEEDEQMLVYEFMPNGTLRDHLSARSKE---PLNFPTRL  120

Query  271  SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  95
             IA G+++G+ +LH +  PP+ H + K  N+L+D  F+ KVAD G+S L  E   +   P
Sbjct  121  RIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGLSRLAPEPESEGIAP  180

Query  94   SH---SIQPSP-FIDPE  56
             H    I+ +P ++DPE
Sbjct  181  GHVSTVIKGTPGYLDPE  197



>ref|XP_009768306.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=952

 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 125/197 (63%), Gaps = 11/197 (6%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTR---SAPPRQQFS  452
            +G + F  +EL  ATKNF+ S+L+G G +G V+KG L DGT+VAIK     S   +++F 
Sbjct  606  DGVKEFNFEELTLATKNFNNSSLVGQGGYGKVYKGTLTDGTVVAIKRALEGSLQGQKEFL  665

Query  451  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  272
             E+  LS   HRNLV+LLGYC E G Q+LV E++PNGT+ +H+ G  ++    L F  RL
Sbjct  666  TEIELLSRLHHRNLVSLLGYCGEEGEQMLVYEFMPNGTLRDHISGKCKE---PLSFAMRL  722

Query  271  SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  95
             +A G+AKG+ +LH +  PP+ H + K  N+L+D  FI KVAD G+S L    N +   P
Sbjct  723  RVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFIAKVADFGLSRLAPVPNLEGTLP  782

Query  94   SH---SIQPSP-FIDPE  56
            +H    ++ +P ++DPE
Sbjct  783  AHVSTVVKGTPGYLDPE  799



>ref|XP_007205469.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
 gb|EMJ06668.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
Length=349

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 120/197 (61%), Gaps = 11/197 (6%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTR---SAPPRQQFS  452
            +G + F  +E+  AT+NFD S  +G G +G V++G L D TIVAIK     S    ++F 
Sbjct  4    DGVKAFTFKEMTLATRNFDSSTQLGRGGYGKVYRGILSDDTIVAIKRAEEGSLQGEKEFL  63

Query  451  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  272
             E+  LS   HRNLV+L+GYC E G Q+LV E++PNGT+ + L    + S   L F  RL
Sbjct  64   TEIELLSRLHHRNLVSLVGYCDEEGEQMLVYEFMPNGTLRDWLCVTAKGS---LSFGTRL  120

Query  271  SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  95
             IA G+AKG+ +LH +  PP+ H + KT N+L+D N + KVAD G+S L    +    GP
Sbjct  121  QIALGSAKGILYLHNEANPPIFHRDIKTTNILLDSNLMAKVADFGLSRLAPLQDDAGTGP  180

Query  94   SH---SIQPSP-FIDPE  56
            S+    ++ +P ++DPE
Sbjct  181  SYVSTVVKGTPGYLDPE  197



>gb|KCW85796.1| hypothetical protein EUGRSUZ_B02547 [Eucalyptus grandis]
Length=271

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 125/207 (60%), Gaps = 15/207 (7%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPP------RQQ  458
            G+ VF ++E+E+AT +FD++NL+G G FG V+KG L  G +VAIK    PP       ++
Sbjct  47   GSSVFTLKEMEEATSSFDDANLVGKGGFGRVYKGILRSGQVVAIKKMELPPSKEADGERE  106

Query  457  FSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQ  278
            F  EV  LS   H NLV+L+GYC +   + LV EYLPNG + +HL G+G    +K+++  
Sbjct  107  FRVEVDILSRLDHPNLVSLIGYCADGKQRFLVYEYLPNGNLQDHLNGIG---DSKMDWPS  163

Query  277  RLSIASGTAKGLCHLHGQCP---PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHD  107
            RL +A G AKGL +LH       P+VH +FK+ NVL+  +F  K++D G++ L+ +   +
Sbjct  164  RLQVAIGAAKGLAYLHSGSAVGIPIVHRDFKSTNVLLTADFEAKISDFGLAKLMPK-GQE  222

Query  106  AAGPSHSIQPSPFIDPE*TT--LPISF  32
                +  +    + DPE T+  +PI +
Sbjct  223  ICETARMLGTFGYFDPEYTSRFVPIRY  249



>gb|KCW85799.1| hypothetical protein EUGRSUZ_B02547 [Eucalyptus grandis]
Length=257

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 122/201 (61%), Gaps = 13/201 (6%)
 Frame = -1

Query  619  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPP------RQQ  458
            G+ VF ++E+E+AT +FD++NL+G G FG V+KG L  G +VAIK    PP       ++
Sbjct  47   GSSVFTLKEMEEATSSFDDANLVGKGGFGRVYKGILRSGQVVAIKKMELPPSKEADGERE  106

Query  457  FSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQ  278
            F  EV  LS   H NLV+L+GYC +   + LV EYLPNG + +HL G+G    +K+++  
Sbjct  107  FRVEVDILSRLDHPNLVSLIGYCADGKQRFLVYEYLPNGNLQDHLNGIG---DSKMDWPS  163

Query  277  RLSIASGTAKGLCHLHGQCP---PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHD  107
            RL +A G AKGL +LH       P+VH +FK+ NVL+  +F  K++D G++ L+ +   +
Sbjct  164  RLQVAIGAAKGLAYLHSGSAVGIPIVHRDFKSTNVLLTADFEAKISDFGLAKLMPK-GQE  222

Query  106  AAGPSHSIQPSPFIDPE*TTL  44
                +  +    + DPE T++
Sbjct  223  ICETARMLGTFGYFDPEYTSV  243



>emb|CAB62020.1| receptor-like protein kinase homolog [Arabidopsis thaliana]
Length=512

 Score =   152 bits (385),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 118/185 (64%), Gaps = 12/185 (6%)
 Frame = -1

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQ----FSEEVARLSMT  425
            ++ AT NFDES  IG G FG V+KG L DGT VA+K R  P  QQ    F  E+  LS  
Sbjct  160  VKDATNNFDESRNIGVGGFGKVYKGELNDGTKVAVK-RGNPKSQQGLAEFRTEIEMLSQF  218

Query  424  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  245
            +HR+LV+L+GYC EN   IL+ EY+ NGT+ +HLYG G  S   L +KQRL I  G A+G
Sbjct  219  RHRHLVSLIGYCDENNEMILIYEYMENGTVKSHLYGSGLPS---LTWKQRLEICIGAARG  275

Query  244  LCHLH-GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS-P  71
            L +LH G   PV+H + K+ N+L+DENF+ KVAD G+S    E+  D    S +++ S  
Sbjct  276  LHYLHTGDSKPVIHRDVKSANILLDENFMAKVADFGLSKTGPEL--DQTHVSTAVKGSFG  333

Query  70   FIDPE  56
            ++DPE
Sbjct  334  YLDPE  338



>ref|XP_010426068.1| PREDICTED: receptor-like protein kinase HERK 1 [Camelina sativa]
Length=627

 Score =   153 bits (386),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 117/185 (63%), Gaps = 12/185 (6%)
 Frame = -1

Query  592  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQ----FSEEVARLSMT  425
            ++ AT NFDES  IG G FG V+KG L DGT VA+K R  P  QQ    F  E+  LS  
Sbjct  275  VKDATNNFDESRNIGVGGFGKVYKGELNDGTKVAVK-RGNPKSQQGLAEFRTEIEMLSQF  333

Query  424  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  245
            +HR+LV+L+GYC EN   IL+ EY+ NGT+  HLYG G  S   L +KQRL I  G A+G
Sbjct  334  RHRHLVSLIGYCDENNEMILIYEYMENGTVKGHLYGSGNPS---LTWKQRLEICIGAARG  390

Query  244  LCHLH-GQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS-P  71
            L +LH G   PV+H + K+ N+L+DENF+ KVAD G+S    E+  D    S +++ S  
Sbjct  391  LHYLHTGDSKPVIHRDVKSANILLDENFMAKVADFGLSKTGPEL--DQTHVSTAVKGSFG  448

Query  70   FIDPE  56
            ++DPE
Sbjct  449  YLDPE  453



>ref|XP_004972229.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=961

 Score =   155 bits (391),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 122/190 (64%), Gaps = 13/190 (7%)
 Frame = -1

Query  661  PVSSLALAR---GGVPE--GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTI  497
            P +S  +A+   GG P+  GAR F   EL+  T NF+E+N IG G +G V+KG L DGT 
Sbjct  597  PFASWGIAQKDSGGAPQLKGARFFSFDELKTCTNNFEENNEIGSGGYGKVYKGILADGTG  656

Query  496  VAIKTRSAPPRQ---QFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNH  326
            VAIK      +Q   +F  E+  LS   H+NLV+L+G+C E G Q+LV EY+ NGT+  +
Sbjct  657  VAIKRAEYGSKQGSFEFKNEIELLSRVHHKNLVSLIGFCYEQGEQMLVYEYVSNGTLRQN  716

Query  325  LYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVA  149
            L G+G      L++K+RL IA G+A+GL +LH    PP++H + K+ N+L+D+NF  KVA
Sbjct  717  LQGIG----IYLDWKKRLRIALGSARGLAYLHELANPPIIHRDVKSTNILLDDNFKAKVA  772

Query  148  DAGISSLLKE  119
            D G+S L+ +
Sbjct  773  DFGLSKLVSD  782



>ref|XP_009628064.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=952

 Score =   154 bits (390),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 124/197 (63%), Gaps = 11/197 (6%)
 Frame = -1

Query  622  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTR---SAPPRQQFS  452
            +G + F   EL  ATKNF+ S+L+G G +G V+KG L DGT+VAIK     S   +++F 
Sbjct  606  DGVKEFNFDELTLATKNFNNSSLVGQGGYGKVYKGTLTDGTVVAIKRALEGSLQGQKEFL  665

Query  451  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  272
             E+  LS   HRNLV+LLGYC E G Q+LV E++PNGT+ +H+ G  ++    L F  RL
Sbjct  666  TEIELLSRLHHRNLVSLLGYCGEEGEQMLVYEFMPNGTLRDHISGKCKE---PLSFAMRL  722

Query  271  SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  95
             +A G+AKG+ +LH +  PP+ H + K  N+L+D  FI KVAD G+S L    + +   P
Sbjct  723  RVALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFIAKVADFGLSRLAPVPDLEGTLP  782

Query  94   SH---SIQPSP-FIDPE  56
            +H    ++ +P ++DPE
Sbjct  783  AHVSTVVKGTPGYLDPE  799



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4030302126726