BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24594_g5_i3 len=1985 path=[53545:0-559 54105:560-693 70225:694-694
54240:695-1323 49036:1324-1362 70732:1363-1369 70739:1370-1371
33320:1372-1984]

Length=1985
                                                                      Score     E

ref|XP_009770677.1|  PREDICTED: proline-rich receptor-like protei...    466   1e-155   
ref|XP_009770679.1|  PREDICTED: proline-rich receptor-like protei...    461   6e-154   
ref|XP_009629093.1|  PREDICTED: protein kinase APK1B, chloroplast...    457   4e-153   
ref|XP_009770680.1|  PREDICTED: protein kinase APK1B, chloroplast...    449   5e-150   
ref|XP_010321146.1|  PREDICTED: serine/threonine-protein kinase-l...    443   2e-147   
gb|KDO75093.1|  hypothetical protein CISIN_1g016789mg                   442   2e-146   
ref|XP_008223124.1|  PREDICTED: proline-rich receptor-like protei...    440   2e-145   
ref|XP_006419651.1|  hypothetical protein CICLE_v10005161mg             440   2e-145   
ref|XP_007223257.1|  hypothetical protein PRUPE_ppa007249mg             439   4e-145   
ref|XP_006342759.1|  PREDICTED: serine/threonine-protein kinase-l...    439   6e-145   
ref|XP_008223123.1|  PREDICTED: proline-rich receptor-like protei...    438   1e-144   
ref|XP_010098337.1|  Proline-rich receptor-like protein kinase PE...    436   6e-144   
ref|XP_006419652.1|  hypothetical protein CICLE_v10005161mg             435   1e-143   
ref|XP_008340829.1|  PREDICTED: probable receptor-like protein ki...    432   2e-142   
ref|XP_010649767.1|  PREDICTED: putative serine/threonine-protein...    431   7e-142   
ref|XP_009339839.1|  PREDICTED: proline-rich receptor-like protei...    428   9e-141   
ref|XP_007035517.1|  Kinase superfamily protein isoform 1               427   2e-140   
emb|CDO98894.1|  unnamed protein product                                426   4e-140   
ref|XP_008390720.1|  PREDICTED: proline-rich receptor-like protei...    426   7e-140   
ref|XP_009352231.1|  PREDICTED: proline-rich receptor-like protei...    425   1e-139   
ref|XP_009369125.1|  PREDICTED: proline-rich receptor-like protei...    425   2e-139   
ref|XP_010649765.1|  PREDICTED: putative serine/threonine-protein...    425   2e-139   
emb|CAN74612.1|  hypothetical protein VITISV_043188                     423   4e-137   Vitis vinifera
ref|XP_011090927.1|  PREDICTED: putative serine/threonine-protein...    419   5e-137   
ref|XP_008340830.1|  PREDICTED: proline-rich receptor-like protei...    414   3e-135   
ref|XP_004296813.1|  PREDICTED: receptor-like protein kinase THES...    412   2e-134   
ref|XP_007009417.1|  Kinase superfamily protein isoform 2               406   3e-132   
ref|XP_008796242.1|  PREDICTED: probable serine/threonine-protein...    402   4e-130   
ref|XP_010241786.1|  PREDICTED: proline-rich receptor-like protei...    399   2e-129   
ref|XP_010649769.1|  PREDICTED: proline-rich receptor-like protei...    397   8e-129   
ref|XP_010243555.1|  PREDICTED: proline-rich receptor-like protei...    397   9e-129   
gb|KDP40006.1|  hypothetical protein JCGZ_02004                         397   1e-128   
ref|XP_002516888.1|  serine/threonine protein kinase, putative          395   4e-128   Ricinus communis
ref|XP_010241759.1|  PREDICTED: proline-rich receptor-like protei...    394   2e-127   
ref|XP_010243554.1|  PREDICTED: proline-rich receptor-like protei...    393   4e-127   
ref|XP_010243553.1|  PREDICTED: proline-rich receptor-like protei...    391   3e-126   
ref|XP_010036980.1|  PREDICTED: putative serine/threonine-protein...    390   7e-126   
ref|XP_007009418.1|  Kinase superfamily protein isoform 3               389   2e-125   
ref|XP_010921751.1|  PREDICTED: probable serine/threonine-protein...    388   5e-125   
ref|XP_010243552.1|  PREDICTED: putative serine/threonine-protein...    387   1e-124   
ref|XP_010649770.1|  PREDICTED: proline-rich receptor-like protei...    384   2e-124   
ref|XP_007009416.1|  Kinase superfamily protein isoform 1               389   4e-124   
gb|EMS58706.1|  Nodulation receptor kinase                              384   9e-124   
dbj|BAJ92598.1|  predicted protein                                      381   2e-122   
gb|EYU43917.1|  hypothetical protein MIMGU_mgv1a023031mg                375   7e-121   
gb|EEC79088.1|  hypothetical protein OsI_19707                          374   1e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_010231482.1|  PREDICTED: probable receptor-like protein ki...    373   2e-119   
gb|EEE63486.1|  hypothetical protein OsJ_18302                          371   1e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382558.1|  PREDICTED: putative serine/threonine-protein...    370   3e-118   
ref|XP_009382559.1|  PREDICTED: putative serine/threonine-protein...    369   6e-118   
ref|XP_006654321.1|  PREDICTED: probable leucine-rich repeat rece...    367   3e-117   
ref|XP_009411699.1|  PREDICTED: putative serine/threonine-protein...    366   1e-116   
ref|XP_004962281.1|  PREDICTED: probable leucine-rich repeat rece...    365   2e-116   
ref|XP_006855470.1|  hypothetical protein AMTR_s00057p00187090          361   5e-115   
ref|XP_006645295.1|  PREDICTED: receptor-like protein kinase ANXU...    362   6e-115   
ref|NP_001140481.1|  LOC100272541                                       354   3e-112   Zea mays [maize]
gb|EAZ14756.1|  hypothetical protein OsJ_04683                          352   4e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77133.1|  hypothetical protein OsI_05098                          352   4e-111   Oryza sativa Indica Group [Indian rice]
gb|ACG32823.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...    352   5e-111   Zea mays [maize]
ref|XP_004971193.1|  PREDICTED: probable leucine-rich repeat rece...    351   5e-111   
ref|XP_002459059.1|  hypothetical protein SORBIDRAFT_03g045200          351   8e-111   Sorghum bicolor [broomcorn]
ref|XP_008656889.1|  PREDICTED: probable leucine-rich repeat rece...    333   6e-104   
ref|XP_010249313.1|  PREDICTED: putative serine/threonine-protein...    333   1e-103   
ref|XP_008656888.1|  PREDICTED: proline-rich receptor-like protei...    333   1e-103   
ref|XP_009420340.1|  PREDICTED: putative serine/threonine-protein...    331   2e-103   
ref|XP_010249305.1|  PREDICTED: putative serine/threonine-protein...    331   5e-103   
ref|XP_010556327.1|  PREDICTED: proline-rich receptor-like protei...    330   7e-103   
gb|EMT07740.1|  Receptor-like protein kinase ANXUR1                     330   1e-102   
gb|KDP41870.1|  hypothetical protein JCGZ_26888                         328   4e-102   
ref|XP_008778861.1|  PREDICTED: putative serine/threonine-protein...    328   5e-102   
ref|XP_008778862.1|  PREDICTED: putative serine/threonine-protein...    328   6e-102   
ref|XP_010556328.1|  PREDICTED: proline-rich receptor-like protei...    327   1e-101   
ref|XP_010909092.1|  PREDICTED: putative serine/threonine-protein...    325   6e-101   
ref|XP_009593052.1|  PREDICTED: nodulation receptor kinase              324   1e-100   
ref|XP_010249314.1|  PREDICTED: putative serine/threonine-protein...    324   2e-100   
dbj|BAB90755.1|  putative disease resistance protein kinase             323   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231741.1|  PREDICTED: putative serine/threonine-protein...    323   3e-100   
gb|KHG00527.1|  Serine/threonine-protein kinase-like protein ACR4       322   4e-100   
ref|XP_009385501.1|  PREDICTED: wall-associated receptor kinase-l...    323   5e-100   
ref|XP_010909094.1|  PREDICTED: protein kinase 2A, chloroplastic-...    320   7e-100   
ref|XP_007032051.1|  Kinase superfamily protein                         322   8e-100   
ref|XP_002320425.2|  hypothetical protein POPTR_0014s14170g             322   9e-100   Populus trichocarpa [western balsam poplar]
emb|CDP16750.1|  unnamed protein product                                322   1e-99    
ref|XP_008810475.1|  PREDICTED: protein kinase 2A, chloroplastic-...    322   1e-99    
ref|XP_010909569.1|  PREDICTED: putative serine/threonine-protein...    322   1e-99    
ref|XP_010909568.1|  PREDICTED: putative serine/threonine-protein...    322   1e-99    
ref|XP_004304571.1|  PREDICTED: nodulation receptor kinase-like         322   1e-99    
ref|XP_002512819.1|  serine/threonine protein kinase, putative          322   2e-99    Ricinus communis
ref|XP_011006133.1|  PREDICTED: proline-rich receptor-like protei...    321   2e-99    
ref|XP_009761544.1|  PREDICTED: nodulation receptor kinase              321   2e-99    
gb|EMS48868.1|  Receptor-like protein kinase ANXUR1                     321   2e-99    
ref|XP_011024759.1|  PREDICTED: receptor-like protein kinase HERK...    321   3e-99    
ref|XP_008802106.1|  PREDICTED: proline-rich receptor-like protei...    318   4e-99    
ref|XP_010502605.1|  PREDICTED: nodulation receptor kinase-like         320   6e-99    
ref|XP_010250486.1|  PREDICTED: receptor-like protein kinase THES...    320   8e-99    
ref|XP_010250484.1|  PREDICTED: receptor-like protein kinase THES...    320   9e-99    
emb|CDM85905.1|  unnamed protein product                                318   1e-98    
gb|AFK35308.1|  unknown                                                 318   2e-98    
ref|XP_003564993.1|  PREDICTED: putative leucine-rich repeat rece...    318   3e-98    
ref|XP_009345184.1|  PREDICTED: nodulation receptor kinase-like         318   3e-98    
ref|XP_002303015.1|  kinase family protein                              318   4e-98    Populus trichocarpa [western balsam poplar]
ref|XP_009378057.1|  PREDICTED: nodulation receptor kinase-like         318   4e-98    
gb|EMS46350.1|  Serine/threonine-protein kinase-like protein ACR4       317   4e-98    
gb|EPS71437.1|  hypothetical protein M569_03323                         315   6e-98    
ref|XP_003553985.1|  PREDICTED: probable receptor-like protein ki...    317   7e-98    
ref|XP_010425389.1|  PREDICTED: nodulation receptor kinase-like         317   8e-98    
ref|XP_008465399.1|  PREDICTED: proline-rich receptor-like protei...    317   1e-97    
ref|XP_010066397.1|  PREDICTED: putative serine/threonine-protein...    316   1e-97    
ref|XP_008231229.1|  PREDICTED: nodulation receptor kinase              316   2e-97    
ref|XP_007216792.1|  hypothetical protein PRUPE_ppa023700mg             316   2e-97    
ref|XP_008802108.1|  PREDICTED: receptor-like protein kinase THES...    313   2e-97    
ref|XP_006291298.1|  hypothetical protein CARUB_v10017433mg             315   3e-97    
ref|XP_008365347.1|  PREDICTED: nodulation receptor kinase-like i...    316   3e-97    
ref|XP_006844647.1|  hypothetical protein AMTR_s00016p00235240          316   3e-97    
ref|XP_008379039.1|  PREDICTED: nodulation receptor kinase-like i...    316   3e-97    
ref|NP_189304.2|  protein kinase family protein                         315   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645278.1|  PREDICTED: serine/threonine-protein kinase-l...    315   3e-97    
ref|XP_008341211.1|  PREDICTED: proline-rich receptor-like protei...    315   5e-97    
ref|XP_008365349.1|  PREDICTED: nodulation receptor kinase-like i...    315   5e-97    
ref|XP_008379041.1|  PREDICTED: nodulation receptor kinase-like i...    315   5e-97    
dbj|BAC43728.1|  putative protein kinase                                315   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024761.1|  PREDICTED: putative serine/threonine-protein...    315   6e-97    
ref|XP_002875333.1|  kinase family protein                              315   7e-97    
ref|XP_007161600.1|  hypothetical protein PHAVU_001G083100g             314   7e-97    
ref|XP_009129490.1|  PREDICTED: nodulation receptor kinase-like         314   8e-97    
emb|CAA66819.1|  hypothetical protein                                   314   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338747.1|  PREDICTED: nodulation receptor kinase-like i...    314   1e-96    
emb|CDY48978.1|  BnaA02g28180D                                          313   1e-96    
ref|XP_011098971.1|  PREDICTED: putative serine/threonine-protein...    313   2e-96    
ref|XP_010090930.1|  Nodulation receptor kinase                         314   2e-96    
gb|KHG04671.1|  Proline-rich receptor-like protein kinase PERK8         313   2e-96    
ref|XP_004143767.1|  PREDICTED: nodulation receptor kinase-like         313   2e-96    
emb|CDY13653.1|  BnaA06g32700D                                          313   3e-96    
ref|XP_010037055.1|  PREDICTED: proline-rich receptor-like protei...    310   4e-96    
ref|XP_010682892.1|  PREDICTED: proline-rich receptor-like protei...    313   4e-96    
ref|XP_006598688.1|  PREDICTED: protein kinase family protein iso...    312   8e-96    
ref|XP_010682893.1|  PREDICTED: putative serine/threonine-protein...    311   9e-96    
gb|KHN46840.1|  Putative receptor-like protein kinase                   311   1e-95    
ref|NP_001235374.1|  protein kinase family protein                      311   1e-95    
ref|XP_002459027.1|  hypothetical protein SORBIDRAFT_03g044740          311   1e-95    Sorghum bicolor [broomcorn]
ref|XP_010514329.1|  PREDICTED: nodulation receptor kinase-like         311   2e-95    
gb|EYU31881.1|  hypothetical protein MIMGU_mgv1a023868mg                311   2e-95    
ref|XP_009121453.1|  PREDICTED: putative serine/threonine-protein...    311   2e-95    
ref|XP_006395532.1|  hypothetical protein EUTSA_v10004401mg             310   3e-95    
ref|XP_004971158.1|  PREDICTED: serine/threonine-protein kinase-l...    310   3e-95    
gb|EMT16217.1|  Receptor-like protein kinase THESEUS 1                  311   4e-95    
ref|XP_002277073.1|  PREDICTED: probable receptor-like protein ki...    310   6e-95    Vitis vinifera
ref|XP_004493092.1|  PREDICTED: probable receptor-like protein ki...    309   7e-95    
ref|XP_006446906.1|  hypothetical protein CICLE_v10015605mg             308   2e-94    
emb|CDY28533.1|  BnaC02g36270D                                          307   4e-94    
emb|CAN73905.1|  hypothetical protein VITISV_039777                     308   4e-94    Vitis vinifera
ref|XP_009152029.1|  PREDICTED: nodulation receptor kinase isofor...    306   9e-94    
emb|CDX83640.1|  BnaC07g23800D                                          306   1e-93    
ref|XP_006468925.1|  PREDICTED: probable leucine-rich repeat rece...    306   2e-93    
gb|KDO45966.1|  hypothetical protein CISIN_1g016626mg                   306   2e-93    
ref|XP_004493095.1|  PREDICTED: probable receptor-like protein ki...    305   2e-93    
ref|XP_003624519.1|  Nodulation receptor kinase                         305   2e-93    
ref|XP_010554147.1|  PREDICTED: probable serine/threonine-protein...    305   3e-93    
ref|XP_010037045.1|  PREDICTED: probable LRR receptor-like serine...    303   4e-93    
ref|XP_009152030.1|  PREDICTED: nodulation receptor kinase isofor...    302   4e-93    
ref|XP_010037037.1|  PREDICTED: probable LRR receptor-like serine...    303   5e-93    
ref|XP_006468923.1|  PREDICTED: probable leucine-rich repeat rece...    304   9e-93    
gb|AAT58825.1|  putative protein kinase                                 301   1e-92    Oryza sativa Japonica Group [Japonica rice]
gb|KDO45964.1|  hypothetical protein CISIN_1g016626mg                   304   1e-92    
ref|XP_010554148.1|  PREDICTED: probable serine/threonine-protein...    302   6e-92    
ref|XP_010554145.1|  PREDICTED: probable serine/threonine-protein...    301   2e-91    
ref|XP_010554146.1|  PREDICTED: proline-rich receptor-like protei...    300   3e-91    
ref|XP_006468924.1|  PREDICTED: probable leucine-rich repeat rece...    299   5e-91    
ref|XP_006446905.1|  hypothetical protein CICLE_v10015605mg             296   1e-90    
ref|XP_010241794.1|  PREDICTED: proline-rich receptor-like protei...    296   1e-90    
ref|XP_004962282.1|  PREDICTED: probable leucine-rich repeat rece...    295   2e-90    
ref|XP_006468921.1|  PREDICTED: probable leucine-rich repeat rece...    297   4e-90    
gb|KDO45970.1|  hypothetical protein CISIN_1g016626mg                   294   4e-90    
ref|XP_010911009.1|  PREDICTED: proline-rich receptor-like protei...    290   1e-89    
ref|XP_010241801.1|  PREDICTED: proline-rich receptor-like protei...    291   5e-89    
ref|NP_001169946.1|  uncharacterized LOC100383845                       293   8e-89    Zea mays [maize]
ref|XP_010241787.1|  PREDICTED: proline-rich receptor-like protei...    290   6e-88    
emb|CDY00187.1|  BnaC09g01140D                                          293   8e-88    
ref|XP_008647498.1|  PREDICTED: LOC100272541 isoform X1                 285   1e-86    
ref|XP_002440989.1|  hypothetical protein SORBIDRAFT_09g018470          281   8e-86    Sorghum bicolor [broomcorn]
ref|XP_010528127.1|  PREDICTED: proline-rich receptor-like protei...    283   3e-85    
ref|XP_009420341.1|  PREDICTED: probable receptor-like protein ki...    283   4e-85    
emb|CDY63200.1|  BnaA09g52250D                                          292   5e-85    
ref|XP_010528125.1|  PREDICTED: proline-rich receptor-like protei...    281   2e-84    
ref|XP_010528121.1|  PREDICTED: proline-rich receptor-like protei...    281   3e-84    
ref|XP_010909093.1|  PREDICTED: receptor-like protein kinase HERK...    280   7e-84    
ref|XP_010909095.1|  PREDICTED: serine/threonine-protein kinase C...    275   7e-83    
gb|EMT31170.1|  Serine/threonine-protein kinase-like protein ACR4       271   5e-81    
ref|XP_008810477.1|  PREDICTED: protein kinase 2A, chloroplastic-...    270   8e-81    
ref|XP_008810478.1|  PREDICTED: protein kinase 2A, chloroplastic-...    269   1e-80    
ref|XP_008810476.1|  PREDICTED: serine/threonine-protein kinase A...    269   6e-80    
ref|XP_002990160.1|  hypothetical protein SELMODRAFT_131164             270   9e-80    
ref|XP_002992529.1|  hypothetical protein SELMODRAFT_162409             269   2e-79    
ref|XP_010651159.1|  PREDICTED: probable serine/threonine-protein...    265   3e-76    
dbj|BAF79953.1|  receptor-like kinase                                   266   2e-75    Marchantia polymorpha
dbj|BAK07663.1|  predicted protein                                      254   2e-74    
gb|KDO45969.1|  hypothetical protein CISIN_1g016626mg                   252   4e-74    
ref|XP_007205462.1|  hypothetical protein PRUPE_ppa007926mg             246   3e-71    
ref|XP_009367078.1|  PREDICTED: protein kinase APK1A, chloroplast...    251   5e-71    
ref|XP_009367079.1|  PREDICTED: protein kinase APK1A, chloroplast...    250   7e-71    
ref|XP_009367077.1|  PREDICTED: protein kinase APK1A, chloroplast...    250   1e-70    
ref|XP_008225618.1|  PREDICTED: probable serine/threonine-protein...    249   1e-70    
ref|XP_008359242.1|  PREDICTED: protein kinase APK1A, chloroplast...    247   7e-70    
ref|XP_008359234.1|  PREDICTED: protein kinase APK1A, chloroplast...    247   1e-69    
ref|XP_008349748.1|  PREDICTED: protein kinase APK1A, chloroplast...    244   7e-69    
ref|NP_001045323.2|  Os01g0935800                                       236   7e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528126.1|  PREDICTED: proline-rich receptor-like protei...    239   1e-68    
ref|XP_007016735.1|  Leucine-rich repeat receptor-like protein ki...    243   2e-68    
ref|XP_007016734.1|  Leucine-rich repeat receptor-like protein ki...    243   4e-68    
ref|XP_010909097.1|  PREDICTED: serine/threonine-protein kinase C...    235   5e-68    
ref|XP_009335090.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    239   1e-66    
ref|XP_010253665.1|  PREDICTED: protein kinase APK1A, chloroplast...    238   2e-66    
ref|XP_009335089.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    238   3e-66    
ref|XP_009335088.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    238   3e-66    
ref|XP_009335087.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    238   3e-66    
ref|XP_006406269.1|  hypothetical protein EUTSA_v10021237mg             229   1e-65    
gb|EYU22372.1|  hypothetical protein MIMGU_mgv1a014227mg                223   2e-64    
ref|XP_004293053.1|  PREDICTED: proline-rich receptor-like protei...    232   6e-64    
ref|XP_007150206.1|  hypothetical protein PHAVU_005G135500g             228   3e-63    
ref|XP_002530283.1|  serine-threonine protein kinase, plant-type,...    229   5e-63    Ricinus communis
ref|XP_008349749.1|  PREDICTED: probable leucine-rich repeat rece...    225   2e-62    
ref|XP_006488101.1|  PREDICTED: probable leucine-rich repeat rece...    223   5e-62    
gb|KDO73271.1|  hypothetical protein CISIN_1g009644mg                   226   1e-61    
ref|XP_006424580.1|  hypothetical protein CICLE_v10028221mg             225   1e-61    
ref|XP_006488100.1|  PREDICTED: probable leucine-rich repeat rece...    225   1e-61    
gb|KHN11203.1|  Proline-rich receptor-like protein kinase PERK15        219   5e-60    
gb|KHN21520.1|  Proline-rich receptor-like protein kinase PERK9         219   6e-60    
ref|XP_006594983.1|  PREDICTED: probable leucine-rich repeat rece...    218   6e-60    
ref|XP_006592693.1|  PREDICTED: probable leucine-rich repeat rece...    219   8e-60    
ref|XP_007016736.1|  Leucine-rich repeat receptor-like protein ki...    215   2e-59    
ref|XP_006594979.1|  PREDICTED: probable leucine-rich repeat rece...    218   2e-59    
ref|XP_004487113.1|  PREDICTED: probable leucine-rich repeat rece...    212   3e-57    
ref|XP_004487114.1|  PREDICTED: probable leucine-rich repeat rece...    211   3e-57    
ref|XP_003597233.1|  Receptor-like protein kinase ANXUR2                217   1e-56    
ref|XP_010098195.1|  Proline-rich receptor-like protein kinase PERK8    208   1e-55    
ref|XP_002885440.1|  hypothetical protein ARALYDRAFT_318885             194   4e-52    
ref|XP_002965380.1|  hypothetical protein SELMODRAFT_24884              191   1e-51    
gb|ABR25410.1|  phytosulfokine receptor precursor                       186   2e-51    Oryza sativa Indica Group [Indian rice]
ref|XP_008353259.1|  PREDICTED: proline-rich receptor-like protei...    190   2e-51    
ref|XP_010248070.1|  PREDICTED: wall-associated receptor kinase 5...    191   8e-51    
gb|EPS71974.1|  hypothetical protein M569_02784                         192   8e-51    
ref|XP_002977227.1|  hypothetical protein SELMODRAFT_24883              189   1e-50    
ref|XP_006299329.1|  hypothetical protein CARUB_v10015486mg             187   2e-50    
ref|XP_010466386.1|  PREDICTED: probable receptor-like protein ki...    188   4e-50    
ref|XP_010466385.1|  PREDICTED: probable receptor-like protein ki...    188   4e-50    
ref|XP_011025559.1|  PREDICTED: serine/threonine-protein kinase PBS1    189   5e-50    
ref|XP_002963090.1|  hypothetical protein SELMODRAFT_78793              186   7e-50    
dbj|BAB02941.1|  somatic embryogenesis receptor kinase-like protein     191   9e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367080.1|  PREDICTED: probable leucine-rich repeat rece...    189   2e-49    
gb|EYU41638.1|  hypothetical protein MIMGU_mgv1a0021482mg               191   2e-49    
ref|XP_002980244.1|  hypothetical protein SELMODRAFT_112637             184   4e-49    
ref|XP_004487115.1|  PREDICTED: probable leucine-rich repeat rece...    187   5e-49    
ref|XP_002978931.1|  hypothetical protein SELMODRAFT_109804             187   5e-49    
ref|XP_004490733.1|  PREDICTED: probable LRR receptor-like serine...    193   6e-49    
dbj|BAD87127.1|  receptor protein kinase-like                           185   8e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    194   9e-49    
ref|XP_008441597.1|  PREDICTED: wall-associated receptor kinase 2...    192   9e-49    
ref|XP_007208566.1|  hypothetical protein PRUPE_ppa023856mg             191   9e-49    
ref|XP_010043803.1|  PREDICTED: serine/threonine-protein kinase P...    185   1e-48    
sp|Q9LK03.3|PERK2_ARATH  RecName: Full=Proline-rich receptor-like...    192   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273356.1|  PREDICTED: wall-associated receptor kinase 3...    186   1e-48    
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...    193   1e-48    
ref|XP_004490730.1|  PREDICTED: probable LRR receptor-like serine...    193   2e-48    
ref|XP_010513421.1|  PREDICTED: proline-rich receptor-like protei...    191   2e-48    
ref|XP_010466843.1|  PREDICTED: proline-rich receptor-like protei...    191   2e-48    
ref|XP_010490110.1|  PREDICTED: proline-rich receptor-like protei...    192   2e-48    
ref|XP_010273358.1|  PREDICTED: wall-associated receptor kinase 2...    194   2e-48    
gb|KCW85797.1|  hypothetical protein EUGRSUZ_B02547                     184   3e-48    
ref|XP_010273347.1|  PREDICTED: putative wall-associated receptor...    191   3e-48    
ref|XP_008245810.1|  PREDICTED: probable leucine-rich repeat rece...    185   3e-48    
ref|XP_007019259.1|  Wall-associated kinase 2, putative                 191   4e-48    
ref|XP_002979054.1|  hypothetical protein SELMODRAFT_177353             184   4e-48    
ref|XP_006379812.1|  hypothetical protein POPTR_0008s14520g             183   5e-48    
ref|XP_001758766.1|  predicted protein                                  182   5e-48    
gb|KCW77032.1|  hypothetical protein EUGRSUZ_D01378                     183   6e-48    
ref|XP_004233885.1|  PREDICTED: probable receptor-like protein ki...    190   7e-48    
ref|XP_004246699.1|  PREDICTED: probable LRR receptor-like serine...    191   7e-48    
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    191   8e-48    
ref|NP_189097.1|  proline-rich receptor-like protein kinase PERK3       186   8e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510214.1|  PREDICTED: probable serine/threonine-protein...    182   8e-48    
ref|XP_006299531.1|  hypothetical protein CARUB_v10015703mg             189   8e-48    
ref|XP_009768306.1|  PREDICTED: probable LRR receptor-like serine...    191   8e-48    
emb|CDY66068.1|  BnaC08g48960D                                          189   9e-48    
ref|XP_002991493.1|  hypothetical protein SELMODRAFT_133636             183   9e-48    
sp|Q1PEM5.2|PERK3_ARATH  RecName: Full=Proline-rich receptor-like...    186   9e-48    
ref|XP_002980407.1|  hypothetical protein SELMODRAFT_12987              180   1e-47    
gb|EAY76270.1|  hypothetical protein OsI_04206                          191   1e-47    
gb|KGN47513.1|  hypothetical protein Csa_6G351870                       189   1e-47    
emb|CDY06005.1|  BnaA09g37750D                                          189   1e-47    
ref|XP_006353008.1|  PREDICTED: probable receptor-like protein ki...    190   1e-47    
ref|XP_010696375.1|  PREDICTED: probable LRR receptor-like serine...    190   1e-47    
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          191   1e-47    
ref|XP_007205469.1|  hypothetical protein PRUPE_ppa008002mg             182   1e-47    
ref|XP_002978933.1|  hypothetical protein SELMODRAFT_177358             183   1e-47    
dbj|BAB02005.1|  protein kinase-like protein                            187   1e-47    
ref|XP_010648093.1|  PREDICTED: wall-associated receptor kinase-l...    182   1e-47    
ref|XP_010551448.1|  PREDICTED: serine/threonine-protein kinase P...    182   1e-47    
dbj|BAD82283.1|  putative receptor-like protein kinase 2                191   1e-47    
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    188   1e-47    
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...    190   1e-47    
ref|XP_008245239.1|  PREDICTED: probable leucine-rich repeat rece...    184   1e-47    
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...    190   1e-47    
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...    190   2e-47    
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    190   2e-47    
ref|XP_001760779.1|  predicted protein                                  181   2e-47    
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    190   2e-47    
ref|XP_010551447.1|  PREDICTED: serine/threonine-protein kinase P...    182   2e-47    
ref|XP_010477726.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   2e-47    
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...    190   2e-47    
ref|XP_009140460.1|  PREDICTED: probable receptor-like protein ki...    188   2e-47    
ref|XP_010498925.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   2e-47    
gb|KCW53594.1|  hypothetical protein EUGRSUZ_J02865                     187   3e-47    
ref|XP_010673968.1|  PREDICTED: wall-associated receptor kinase-l...    187   3e-47    
ref|XP_003616057.1|  Protein kinase-like protein                        189   3e-47    
ref|XP_008793424.1|  PREDICTED: probable leucine-rich repeat rece...    188   3e-47    
ref|XP_002962688.1|  hypothetical protein SELMODRAFT_23147              179   3e-47    
ref|XP_006381498.1|  leucine-rich repeat family protein                 189   3e-47    
ref|XP_008662892.1|  PREDICTED: probable leucine-rich repeat rece...    183   3e-47    
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     189   3e-47    
emb|CAN82287.1|  hypothetical protein VITISV_028337                     182   3e-47    
ref|XP_010477724.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   3e-47    
ref|XP_006359565.1|  PREDICTED: wall-associated receptor kinase 5...    186   3e-47    
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    189   3e-47    
ref|XP_009404603.1|  PREDICTED: putative wall-associated receptor...    187   4e-47    
gb|ACO25567.1|  protein kinase-coding resistance protein                179   4e-47    
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    189   4e-47    
gb|AFW78432.1|  putative leucine-rich repeat receptor-like protei...    186   5e-47    
ref|XP_010498924.1|  PREDICTED: protein kinase APK1B, chloroplast...    181   5e-47    
ref|XP_006361768.1|  PREDICTED: probable LRR receptor-like serine...    188   5e-47    
ref|XP_009607288.1|  PREDICTED: serine/threonine-protein kinase-l...    188   5e-47    
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    189   5e-47    
ref|XP_010460176.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   5e-47    
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...    188   5e-47    
ref|XP_011092781.1|  PREDICTED: proline-rich receptor-like protei...    186   6e-47    
ref|XP_007161697.1|  hypothetical protein PHAVU_001G090800g             181   7e-47    
ref|XP_009116601.1|  PREDICTED: serine/threonine-protein kinase-l...    187   7e-47    
gb|AHZ44754.1|  CrRLK1L-like protein                                    187   7e-47    
ref|XP_010034816.1|  PREDICTED: putative leucine-rich repeat rece...    187   7e-47    
emb|CDP00198.1|  unnamed protein product                                180   7e-47    
ref|XP_003628672.1|  Protein kinase 2A                                  180   7e-47    
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     187   7e-47    
ref|XP_004144294.1|  PREDICTED: uncharacterized protein LOC101209380    190   7e-47    
ref|XP_006416035.1|  hypothetical protein EUTSA_v10008007mg             180   7e-47    
ref|XP_007137494.1|  hypothetical protein PHAVU_009G131700g             186   8e-47    
emb|CBI31162.3|  unnamed protein product                                190   8e-47    
ref|XP_011092780.1|  PREDICTED: proline-rich receptor-like protei...    185   8e-47    
ref|XP_006390205.1|  hypothetical protein EUTSA_v10018707mg             180   8e-47    
ref|XP_006828003.1|  hypothetical protein AMTR_s00008p00241640          184   8e-47    
emb|CDY46084.1|  BnaA09g42080D                                          184   9e-47    
gb|KCW77026.1|  hypothetical protein EUGRSUZ_D01371                     187   9e-47    
ref|XP_010927441.1|  PREDICTED: wall-associated receptor kinase 2...    186   9e-47    
ref|XP_007019260.1|  Wall-associated kinase 2, putative                 186   9e-47    
ref|XP_010460175.1|  PREDICTED: protein kinase APK1B, chloroplast...    180   9e-47    
ref|XP_009802544.1|  PREDICTED: proline-rich receptor-like protei...    186   9e-47    
gb|KDP21313.1|  hypothetical protein JCGZ_21784                         179   1e-46    
ref|XP_006402689.1|  hypothetical protein EUTSA_v10005780mg             187   1e-46    
ref|XP_007139789.1|  hypothetical protein PHAVU_008G058800g             185   1e-46    
ref|XP_010911127.1|  PREDICTED: wall-associated receptor kinase-l...    180   1e-46    
ref|XP_007142004.1|  hypothetical protein PHAVU_008G244400g             187   1e-46    
ref|XP_009367491.1|  PREDICTED: wall-associated receptor kinase 3...    182   1e-46    
emb|CDM84720.1|  unnamed protein product                                187   1e-46    
ref|XP_009757162.1|  PREDICTED: probable LRR receptor-like serine...    187   1e-46    
ref|XP_010682614.1|  PREDICTED: serine/threonine-protein kinase P...    179   1e-46    
ref|XP_010259987.1|  PREDICTED: receptor-like protein kinase HERK 1     186   1e-46    
ref|XP_007019262.1|  Wall-associated kinase 2, putative                 186   1e-46    
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...    187   1e-46    
ref|XP_010059291.1|  PREDICTED: receptor-like protein kinase At3g...    181   1e-46    
ref|XP_007207222.1|  hypothetical protein PRUPE_ppa001056mg             187   1e-46    
ref|XP_006304514.1|  hypothetical protein CARUB_v10011340mg             179   1e-46    
ref|XP_009628064.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-46    
dbj|BAF79957.1|  receptor-like kinase                                   187   2e-46    
ref|XP_006662853.1|  PREDICTED: probable leucine-rich repeat rece...    187   2e-46    
ref|XP_002878271.1|  hypothetical protein ARALYDRAFT_486409             186   2e-46    
ref|XP_008380925.1|  PREDICTED: proline-rich receptor-like protei...    183   2e-46    
gb|KHN46968.1|  Wall-associated receptor kinase 3                       185   2e-46    
gb|EMT20930.1|  Putative LRR receptor-like serine/threonine-prote...    187   2e-46    
ref|XP_003527959.1|  PREDICTED: wall-associated receptor kinase 3...    185   2e-46    
gb|ACO25566.1|  protein kinase-coding resistance protein                177   2e-46    
ref|XP_010682613.1|  PREDICTED: serine/threonine-protein kinase P...    179   2e-46    
ref|XP_001773277.1|  predicted protein                                  177   2e-46    
gb|ACO25569.1|  protein kinase-coding resistance protein                177   2e-46    
ref|XP_002887301.1|  kinase family protein                              180   2e-46    
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    187   2e-46    
ref|XP_009620317.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-46    
gb|KDP41352.1|  hypothetical protein JCGZ_15759                         181   2e-46    
ref|XP_010906678.1|  PREDICTED: wall-associated receptor kinase 4...    185   2e-46    
ref|XP_011094724.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-46    
ref|XP_004170705.1|  PREDICTED: wall-associated receptor kinase 5...    185   2e-46    
ref|XP_010033808.1|  PREDICTED: senescence-induced receptor-like ...    181   2e-46    
ref|XP_008245214.1|  PREDICTED: serine/threonine-protein kinase PBS1    178   2e-46    
ref|XP_007139762.1|  hypothetical protein PHAVU_008G056900g             184   2e-46    
ref|XP_010098559.1|  putative receptor-like protein kinase              186   3e-46    
ref|XP_010663708.1|  PREDICTED: wall-associated receptor kinase 2...    184   3e-46    
gb|KFK40245.1|  hypothetical protein AALP_AA3G349100                    186   3e-46    
gb|EMT07873.1|  Putative serine/threonine-protein kinase                180   3e-46    
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     186   3e-46    
ref|XP_007044608.1|  Kinase superfamily protein                         178   3e-46    
ref|XP_011086519.1|  PREDICTED: serine/threonine-protein kinase PBS1    178   3e-46    
emb|CAN65309.1|  hypothetical protein VITISV_043466                     179   3e-46    
dbj|BAF79984.1|  receptor-like kinase                                   187   3e-46    
ref|XP_010469358.1|  PREDICTED: serine/threonine-protein kinase-l...    186   3e-46    
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    186   3e-46    
ref|XP_010512201.1|  PREDICTED: serine/threonine-protein kinase-l...    186   3e-46    
ref|XP_011021647.1|  PREDICTED: serine/threonine-protein kinase P...    178   3e-46    
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             185   3e-46    
ref|XP_010326255.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-46    
ref|XP_002885643.1|  hypothetical protein ARALYDRAFT_319144             180   3e-46    
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    186   3e-46    
ref|NP_191501.1|  serine/threonine-protein kinase-like protein ACR4     186   3e-46    
ref|XP_009358188.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-46    
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    186   3e-46    
emb|CDX68101.1|  BnaA07g21410D                                          178   3e-46    
emb|CDP17298.1|  unnamed protein product                                185   3e-46    
ref|XP_009344414.1|  PREDICTED: probable receptor-like protein ki...    185   4e-46    
ref|XP_009358189.1|  PREDICTED: probable LRR receptor-like serine...    186   4e-46    
gb|KEH43006.1|  malectin/receptor-like kinase family protein            185   4e-46    
gb|EYU22227.1|  hypothetical protein MIMGU_mgv1a024435mg                185   4e-46    
ref|XP_004300050.1|  PREDICTED: probable leucine-rich repeat rece...    186   4e-46    
ref|XP_009370883.1|  PREDICTED: probable LRR receptor-like serine...    186   4e-46    
ref|XP_010413696.1|  PREDICTED: serine/threonine-protein kinase-l...    185   4e-46    
ref|XP_008806490.1|  PREDICTED: serine/threonine-protein kinase PBS1    177   4e-46    
ref|XP_009784970.1|  PREDICTED: receptor-like protein kinase HERK 1     178   4e-46    
gb|KCW53639.1|  hypothetical protein EUGRSUZ_J02902                     180   4e-46    
gb|KDP34926.1|  hypothetical protein JCGZ_09214                         185   4e-46    
emb|CDX85945.1|  BnaC06g21890D                                          178   4e-46    
ref|XP_004302840.1|  PREDICTED: probable LRR receptor-like serine...    185   4e-46    
emb|CAB62020.1|  receptor-like protein kinase homolog                   181   4e-46    
gb|ACO25572.1|  protein kinase-coding resistance protein                176   4e-46    
ref|XP_006290261.1|  hypothetical protein CARUB_v10016669mg             185   4e-46    
ref|XP_010522022.1|  PREDICTED: probable LRR receptor-like serine...    185   4e-46    
gb|KEH35372.1|  wall-associated receptor kinase-like protein            184   5e-46    
ref|XP_007158107.1|  hypothetical protein PHAVU_002G124700g             179   5e-46    
gb|EAY73106.1|  hypothetical protein OsI_00982                          182   5e-46    
gb|ABD28574.1|  Protein kinase; Peptidoglycan-binding LysM              183   5e-46    
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    186   5e-46    
ref|XP_008649343.1|  PREDICTED: serine/threonine-protein kinase A...    179   5e-46    
ref|XP_001753871.1|  predicted protein                                  175   5e-46    
ref|XP_010426068.1|  PREDICTED: receptor-like protein kinase HERK 1     183   5e-46    
ref|XP_010477386.1|  PREDICTED: wall-associated receptor kinase 1...    184   5e-46    
ref|XP_004247017.1|  PREDICTED: probable LRR receptor-like serine...    186   5e-46    
ref|XP_011004155.1|  PREDICTED: probable LRR receptor-like serine...    185   5e-46    
ref|XP_001752425.1|  predicted protein                                  176   5e-46    
ref|XP_010534471.1|  PREDICTED: wall-associated receptor kinase 2...    184   5e-46    
ref|XP_010063911.1|  PREDICTED: wall-associated receptor kinase 5...    184   6e-46    
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    185   6e-46    
gb|KGN47510.1|  hypothetical protein Csa_6G350360                       177   6e-46    
gb|AAQ82660.1|  Pto-like serine/threonine kinase                        177   6e-46    
ref|XP_004307444.1|  PREDICTED: wall-associated receptor kinase 3...    181   6e-46    
ref|XP_006842574.1|  hypothetical protein AMTR_s00077p00152440          185   6e-46    
ref|XP_010111033.1|  Wall-associated receptor kinase-like 2             182   6e-46    
ref|XP_009596095.1|  PREDICTED: proline-rich receptor-like protei...    183   6e-46    
ref|XP_010037927.1|  PREDICTED: probable LRR receptor-like serine...    185   7e-46    
ref|XP_006366995.1|  PREDICTED: putative proline-rich receptor-li...    181   7e-46    
gb|KHN44286.1|  Wall-associated receptor kinase 2                       183   7e-46    
ref|XP_006418751.1|  hypothetical protein EUTSA_v10002411mg             183   7e-46    
gb|KCW48219.1|  hypothetical protein EUGRSUZ_K01945                     184   7e-46    
ref|XP_002531401.1|  Serine/threonine-protein kinase PBS1, putative     177   7e-46    
ref|XP_009363504.1|  PREDICTED: serine/threonine-protein kinase P...    177   7e-46    
gb|ACB59201.1|  protein kinase family protein                           177   7e-46    
ref|XP_010233320.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    181   7e-46    
gb|EEE69536.1|  hypothetical protein OsJ_29010                          177   7e-46    
ref|XP_008788474.1|  PREDICTED: wall-associated receptor kinase 5...    183   7e-46    
ref|XP_006344368.1|  PREDICTED: probable LRR receptor-like serine...    185   7e-46    
ref|NP_001240130.1|  probable LRR receptor-like serine/threonine-...    183   8e-46    
ref|XP_002276020.1|  PREDICTED: probable LRR receptor-like serine...    185   8e-46    
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...    185   8e-46    
ref|XP_004302489.1|  PREDICTED: probable leucine-rich repeat rece...    185   8e-46    
ref|NP_001235415.1|  protein kinase family protein                      177   8e-46    
ref|XP_007158729.1|  hypothetical protein PHAVU_002G177200g             185   8e-46    
ref|XP_003551180.1|  PREDICTED: serine/threonine-protein kinase P...    177   8e-46    
ref|XP_009623118.1|  PREDICTED: probable receptor-like protein ki...    184   8e-46    
gb|EEC78602.1|  hypothetical protein OsI_18628                          177   8e-46    
gb|EYU42054.1|  hypothetical protein MIMGU_mgv1a000864mg                185   9e-46    
ref|XP_010036608.1|  PREDICTED: probable receptor-like protein ki...    184   9e-46    
emb|CBI15799.3|  unnamed protein product                                185   9e-46    
ref|XP_010314124.1|  PREDICTED: probable leucine-rich repeat rece...    183   9e-46    
ref|XP_010522021.1|  PREDICTED: probable LRR receptor-like serine...    185   9e-46    
gb|KHG18290.1|  Receptor-like serine/threonine-protein kinase ALE2      176   9e-46    
tpg|DAA57113.1|  TPA: putative transmembrane protein kinase famil...    185   9e-46    
gb|EEC72208.1|  hypothetical protein OsI_05296                          184   9e-46    
ref|XP_004165909.1|  PREDICTED: wall-associated receptor kinase 2...    182   9e-46    
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...    185   9e-46    
ref|XP_011037761.1|  PREDICTED: probable receptor-like protein ki...    184   9e-46    
ref|XP_007019266.1|  Wall-associated kinase 2, putative                 183   1e-45    
ref|XP_007139761.1|  hypothetical protein PHAVU_008G056800g             182   1e-45    
ref|XP_009117290.1|  PREDICTED: probable receptor-like protein ki...    184   1e-45    
emb|CDX99115.1|  BnaA06g18060D                                          183   1e-45    
ref|XP_009150283.1|  PREDICTED: receptor-like protein kinase HERK 1     184   1e-45    
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    184   1e-45    
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    184   1e-45    
gb|AET01539.2|  LRR receptor-like kinase plant-like protein, puta...    184   1e-45    
ref|XP_003627063.1|  Kinase-like protein                                184   1e-45    
gb|EYU19114.1|  hypothetical protein MIMGU_mgv1a002320mg                182   1e-45    
dbj|BAJ85679.1|  predicted protein                                      182   1e-45    
ref|XP_011039809.1|  PREDICTED: probable receptor-like protein ki...    183   1e-45    
gb|EEC79410.1|  hypothetical protein OsI_20362                          184   1e-45    
dbj|BAJ93703.1|  predicted protein                                      184   1e-45    
emb|CDY60801.1|  BnaC05g50820D                                          177   1e-45    
ref|XP_009105891.1|  PREDICTED: proline-rich receptor-like protei...    182   1e-45    
ref|XP_010273252.1|  PREDICTED: putative wall-associated receptor...    182   1e-45    



>ref|XP_009770677.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770678.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Nicotiana sylvestris]
Length=374

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 275/352 (78%), Gaps = 11/352 (3%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             + SN+NSD ASSDPSA V         ++ L RGG     + FRM+ELE+AT+NFDESNL
Sbjct  34    KNSNKNSDGASSDPSAVV---------TMELKRGGPSPSFKQFRMEELEKATRNFDESNL  84

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IGCGSFGLVFKG L DGT+VAIK RS  P+Q+F+EEVA LS  QHRNLVNLLGYC ++GY
Sbjct  85    IGCGSFGLVFKGLLCDGTVVAIKRRSGTPKQEFNEEVAHLSRIQHRNLVNLLGYCLDSGY  144

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
              +LV EYLPNG+MCNHLY  G+DS+TKLEFKQRLSIA GTAKGL HLHGQ P ++HGNFK
Sbjct  145   SMLVFEYLPNGSMCNHLYDTGKDSATKLEFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFK  204

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE+NQ G+  E SD+Y
Sbjct  205   TANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSVNAFRDPEINQIGILCETSDVY  262

Query  652   GFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRL  473
              FGVFL ELITG+EA+ I   GSNQ++L+WVE  LSSD LV++RL+G ++AE MRDLI+L
Sbjct  263   SFGVFLLELITGKEASDIDEFGSNQSILEWVEKQLSSDQLVDNRLLGSFTAEVMRDLIKL  322

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             A+RC SFPG+ RP ++ V ++ ERILEKE M +T MGE ++ +TLGSQLFTN
Sbjct  323   ALRCMSFPGRYRPTIETVVLDLERILEKEQMHTTVMGEGTSIVTLGSQLFTN  374



>ref|XP_009770679.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Nicotiana sylvestris]
Length=372

 Score =   461 bits (1187),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 275/352 (78%), Gaps = 13/352 (4%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             + SN+NSD ASSDPSA V         ++ L RGG     + FRM+ELE+AT+NFDESNL
Sbjct  34    KNSNKNSDGASSDPSAVV---------TMELKRGGPSPSFKQFRMEELEKATRNFDESNL  84

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IGCGSFGLVFKG L DGT+VAIK RS  P+Q+F+EEVA LS  QHRNLVNLLGYC ++GY
Sbjct  85    IGCGSFGLVFKGLLCDGTVVAIKRRSGTPKQEFNEEVAHLSRIQHRNLVNLLGYCLDSGY  144

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
              +LV EYLPNG+MCNHLYG  +DS+TKLEFKQRLSIA GTAKGL HLHGQ P ++HGNFK
Sbjct  145   SMLVFEYLPNGSMCNHLYG--KDSATKLEFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFK  202

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE+NQ G+  E SD+Y
Sbjct  203   TANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSVNAFRDPEINQIGILCETSDVY  260

Query  652   GFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRL  473
              FGVFL ELITG+EA+ I   GSNQ++L+WVE  LSSD LV++RL+G ++AE MRDLI+L
Sbjct  261   SFGVFLLELITGKEASDIDEFGSNQSILEWVEKQLSSDQLVDNRLLGSFTAEVMRDLIKL  320

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             A+RC SFPG+ RP ++ V ++ ERILEKE M +T MGE ++ +TLGSQLFTN
Sbjct  321   ALRCMSFPGRYRPTIETVVLDLERILEKEQMHTTVMGEGTSIVTLGSQLFTN  372



>ref|XP_009629093.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 217/324 (67%), Positives = 260/324 (80%), Gaps = 2/324 (1%)
 Frame = -2

Query  1288  LALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAP  1109
             + L RGG     + FRM+ELE+AT+NFDE NLIGCGSFGLVFKG L DGT+VAIK RS  
Sbjct  1     MELKRGGPSPSFKQFRMEELEKATRNFDEGNLIGCGSFGLVFKGLLCDGTVVAIKRRSGN  60

Query  1108  PRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKL  929
             P+Q+F+EEVA LS  QHRNLVNLLGYCQ++GY +LV EYLPNG+MCNHLY  G+DS+TKL
Sbjct  61    PKQEFNEEVAYLSTIQHRNLVNLLGYCQDSGYSMLVFEYLPNGSMCNHLYDTGKDSATKL  120

Query  928   EFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINH  749
             EFKQRLSIA GTAKGL HLHGQ P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  
Sbjct  121   EFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--  178

Query  748   DAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTML  569
             D AGPS     + F DPE+NQ G+  E SD+Y FGVFL ELITG+EA+HI   GSNQ++L
Sbjct  179   DDAGPSGLSSVNAFRDPEINQIGILCETSDVYSFGVFLLELITGKEASHIDEFGSNQSIL  238

Query  568   QWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEK  389
             +WVE  LSSD LV+HRL+G ++AE MRDLI+LA+RC SFPG+ RP M+ V ++ ERILEK
Sbjct  239   EWVEKQLSSDQLVDHRLLGSFTAEVMRDLIKLALRCMSFPGRYRPTMETVVLDLERILEK  298

Query  388   EIMGSTAMGEASATLTLGSQLFTN  317
             E M +T MGE ++ +TLGSQLFTN
Sbjct  299   EQMHTTVMGEGTSIVTLGSQLFTN  322



>ref|XP_009770680.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
 ref|XP_009770681.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
 ref|XP_009770682.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Nicotiana sylvestris]
Length=322

 Score =   449 bits (1156),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 259/324 (80%), Gaps = 2/324 (1%)
 Frame = -2

Query  1288  LALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAP  1109
             + L RGG     + FRM+ELE+AT+NFDESNLIGCGSFGLVFKG L DGT+VAIK RS  
Sbjct  1     MELKRGGPSPSFKQFRMEELEKATRNFDESNLIGCGSFGLVFKGLLCDGTVVAIKRRSGT  60

Query  1108  PRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKL  929
             P+Q+F+EEVA LS  QHRNLVNLLGYC ++GY +LV EYLPNG+MCNHLY  G+DS+TKL
Sbjct  61    PKQEFNEEVAHLSRIQHRNLVNLLGYCLDSGYSMLVFEYLPNGSMCNHLYDTGKDSATKL  120

Query  928   EFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINH  749
             EFKQRLSIA GTAKGL HLHGQ P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  
Sbjct  121   EFKQRLSIAIGTAKGLSHLHGQRPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--  178

Query  748   DAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTML  569
             D AGPS     + F DPE+NQ G+  E SD+Y FGVFL ELITG+EA+ I   GSNQ++L
Sbjct  179   DDAGPSGLSSVNAFRDPEINQIGILCETSDVYSFGVFLLELITGKEASDIDEFGSNQSIL  238

Query  568   QWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEK  389
             +WVE  LSSD LV++RL+G ++AE MRDLI+LA+RC SFPG+ RP ++ V ++ ERILEK
Sbjct  239   EWVEKQLSSDQLVDNRLLGSFTAEVMRDLIKLALRCMSFPGRYRPTIETVVLDLERILEK  298

Query  388   EIMGSTAMGEASATLTLGSQLFTN  317
             E M +T MGE ++ +TLGSQLFTN
Sbjct  299   EQMHTTVMGEGTSIVTLGSQLFTN  322



>ref|XP_010321146.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Solanum lycopersicum]
Length=320

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/322 (64%), Positives = 260/322 (81%), Gaps = 2/322 (1%)
 Frame = -2

Query  1282  LARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPR  1103
             + RGG    +R+FRM+ELE+ATK+FDE++LIGCGSFGLVFKG L DGT+VAIK R   P+
Sbjct  1     MKRGGSFGQSRLFRMEELEKATKHFDENSLIGCGSFGLVFKGLLCDGTVVAIKRRLGTPK  60

Query  1102  QQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEF  923
             Q+F+EEVARLS  QHRNLV+LLGYCQ++GY +LV EYLPNG+M NHLY  G++S+TKLEF
Sbjct  61    QEFTEEVARLSRIQHRNLVSLLGYCQDSGYSMLVFEYLPNGSMHNHLYDTGKESATKLEF  120

Query  922   KQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDA  743
             KQRLSIA GTAKGL HLH Q P ++HGNFKT NVLVDE+FI KVADAGI  LL++I  D 
Sbjct  121   KQRLSIAIGTAKGLSHLHSQHPSIIHGNFKTANVLVDEDFIAKVADAGILKLLEKI--DD  178

Query  742   AGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW  563
             AGPS     + F DPE+NQ G+  E SD+Y FGVFL EL+TGR+A+HI   GSNQ++L W
Sbjct  179   AGPSGLSSFNAFKDPEINQIGIHCETSDVYSFGVFLLELVTGRDASHIDEFGSNQSVLDW  238

Query  562   VEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI  383
             VE  LSS+ LV+HRL+G ++AE MRD +++A+RC SFPG+ RP M+ V ++ E+ILE+EI
Sbjct  239   VEKQLSSEQLVDHRLLGSFTAEVMRDFVKIALRCMSFPGRYRPTMETVVLDLEKILEREI  298

Query  382   MGSTAMGEASATLTLGSQLFTN  317
             M +T MGE ++T+TLGSQLFTN
Sbjct  299   MHTTVMGEGTSTVTLGSQLFTN  320



>gb|KDO75093.1| hypothetical protein CISIN_1g016789mg [Citrus sinensis]
Length=382

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 266/354 (75%), Gaps = 5/354 (1%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             SK Y N+NS+T SSDPSA VE   G GP S+      G P+GAR F M+ELEQATK F E
Sbjct  33    SKNYQNKNSETGSSDPSALVEWNRGAGPSSATGQPSFG-PQGARQFSMEELEQATKQFSE  91

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
             ++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV LLGYCQ+
Sbjct  92    TSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTLLGYCQQ  150

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   PP+VH 
Sbjct  151   NGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLKPPLVHK  210

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPEV +SGVFSE S
Sbjct  211   NFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPEVEESGVFSEMS  268

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             DIY FGVFL EL+TG+EA+HI  LGS + ++QWV + LSS++ V+HRL G ++ EGMRDL
Sbjct  269   DIYSFGVFLLELVTGQEASHIVSLGSYEALIQWVRSRLSSNNFVDHRLAGTFTTEGMRDL  328

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             IRL ++C S PG+ RP M++V  E ERI EKE+  +T MGE +AT+ LGS+LFT
Sbjct  329   IRLTLQCMSSPGRRRPKMEIVMTELERIHEKEMALTTFMGEGTATIALGSELFT  382



>ref|XP_008223124.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Prunus mume]
Length=376

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 266/352 (76%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QATK+FDES+
Sbjct  34    KNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             +Q+LV E++PNG++CNHLY    +SSTKLEFKQRLSIA G AKGLCHLHG  PP+VH NF
Sbjct  147   FQVLVFEHIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPEV  SGV SE SD+
Sbjct  207   KTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPEVGASGVASEMSDV  264

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVFL EL+TG+EA  I  LGSN+++ QWVE+ LSS+ LV+ RL+G ++ EGMRDLIR
Sbjct  265   YSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLVGSFTGEGMRDLIR  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFPG+ RP M+MV VE ERI EKE+  +T MGE + T  LGS LFT
Sbjct  325   LTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGTDTFALGSVLFT  376



>ref|XP_006419651.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
 ref|XP_006489140.1| PREDICTED: probable receptor-like protein kinase At5g38990-like 
[Citrus sinensis]
 gb|ESR32891.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
Length=382

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 265/354 (75%), Gaps = 5/354 (1%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             SK Y N+NS+T SSDPSA VE   G GP S+      G P+GAR F M+ELEQATK F E
Sbjct  33    SKNYQNKNSETGSSDPSALVEWNRGAGPSSATGQPSFG-PQGARQFSMEELEQATKQFSE  91

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
             ++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV LLGYCQ+
Sbjct  92    TSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTLLGYCQQ  150

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   PP+VH 
Sbjct  151   NGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLKPPLVHK  210

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPEV +SGVFSE S
Sbjct  211   NFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPEVEESGVFSEMS  268

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             DIY FGVFL EL+TG+EA+HI  LGS + ++QWV + LSS++ V+HRL G ++ EGMRDL
Sbjct  269   DIYSFGVFLLELVTGQEASHIVSLGSYEALIQWVRSRLSSNNFVDHRLAGTFTTEGMRDL  328

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             IRL ++C S PG+ RP M++V  E ERI EKE+  +T MGE +A + LGS+LFT
Sbjct  329   IRLTLQCMSSPGRRRPKMEIVMTELERIHEKEMALTTFMGEGTAKIALGSELFT  382



>ref|XP_007223257.1| hypothetical protein PRUPE_ppa007249mg [Prunus persica]
 gb|EMJ24456.1| hypothetical protein PRUPE_ppa007249mg [Prunus persica]
Length=376

 Score =   439 bits (1129),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 265/352 (75%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QATK+FDES+
Sbjct  34    KNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             +Q+LV EY+PNG++CNHLY    +SSTKLEFKQRLSIA G AKGLCHLHG  PP+VH NF
Sbjct  147   FQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPEV  SGV SE SD+
Sbjct  207   KTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPEVGASGVASEMSDV  264

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             + FGVFL EL+TG+EA  I  LGSN+++ QWVE+ LSS+ LV+ RL G ++ EGMRDLIR
Sbjct  265   HSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIR  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFPG+ RP M+MV VE ERI EKE+  +T MGE + T  LGS LFT
Sbjct  325   LTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGTDTFALGSVLFT  376



>ref|XP_006342759.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342760.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X2 [Solanum tuberosum]
Length=373

 Score =   439 bits (1128),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 277/353 (78%), Gaps = 13/353 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             ++YSNRNSD+ASSDPSA VE           L RGG    +R+FRM+ELE++TK+FDE++
Sbjct  34    RKYSNRNSDSASSDPSAVVE-----------LKRGGSFGPSRLFRMEELEKSTKHFDENS  82

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIGCGSFGLVFKG L DGT+VAIK R   P+Q+F+EEVARLS  QHRNLV+LLGYCQ++G
Sbjct  83    LIGCGSFGLVFKGLLCDGTVVAIKRRLGTPKQEFTEEVARLSRIQHRNLVSLLGYCQDSG  142

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             Y +LV EYLPNG+M NHLY  G++ +TKLEFKQRLSIA G AKGL HLH Q P ++HGNF
Sbjct  143   YSMLVFEYLPNGSMHNHLYDTGKEFATKLEFKQRLSIAIGAAKGLSHLHSQHPSIIHGNF  202

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDE+FI KVADAGI  LL++I  D AGPS     + F DPE++Q G+  E SD+
Sbjct  203   KTANVLVDEDFIAKVADAGILKLLEKI--DDAGPSGLSSFNAFKDPEISQIGIHCETSDV  260

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVFL EL+TGR+A+HI   GSNQ++L WVE  LSS+ LV+HRL+G ++AE MRD ++
Sbjct  261   YSFGVFLLELVTGRDASHIDEFGSNQSVLDWVEKQLSSEQLVDHRLLGSFTAEVMRDFVK  320

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             +A+RC SFPG+ RP M+ V ++ E+ILE+E+M +T MGE ++T+TLGSQLFTN
Sbjct  321   IALRCMSFPGRYRPTMETVVLDLEKILEREMMHTTVMGEGTSTVTLGSQLFTN  373



>ref|XP_008223123.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X1 [Prunus mume]
Length=378

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 218/354 (62%), Positives = 267/354 (75%), Gaps = 11/354 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K  SN+NS+T SSDPSA VE   GGP S       GV +GAR+F ++EL+QATK+FDES+
Sbjct  34    KNLSNKNSETGSSDPSAIVEWSRGGPSS-------GVRQGARLFTLEELDQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGR--DSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             +Q+LV E++PNG++CNHLYG     +SSTKLEFKQRLSIA G AKGLCHLHG  PP+VH 
Sbjct  147   FQVLVFEHIPNGSVCNHLYGNDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHK  206

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDE+FI  VADAGI+ LL++I  + AGPS +   + F DPEV  SGV SE S
Sbjct  207   NFKTANVLVDEDFIAHVADAGIAKLLEKI--EEAGPSRTSSVNIFQDPEVGASGVASEMS  264

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             D+Y FGVFL EL+TG+EA  I  LGSN+++ QWVE+ LSS+ LV+ RL+G ++ EGMRDL
Sbjct  265   DVYSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLVGSFTGEGMRDL  324

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             IRL ++C SFPG+ RP M+MV VE ERI EKE+  +T MGE + T  LGS LFT
Sbjct  325   IRLTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGTDTFALGSVLFT  378



>ref|XP_010098337.1| Proline-rich receptor-like protein kinase PERK15 [Morus notabilis]
 gb|EXB74841.1| Proline-rich receptor-like protein kinase PERK15 [Morus notabilis]
Length=382

 Score =   436 bits (1122),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/352 (62%), Positives = 266/352 (76%), Gaps = 3/352 (1%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             ++ SN+NS+T SSDPSA  E   GGP SS        P GAR FRM+ELE+ATK+F+ESN
Sbjct  34    RKLSNKNSETGSSDPSALAEWNRGGPSSSGVAQPPFGPVGARQFRMEELEKATKHFNESN  93

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG GSFG V+KGFL DGT VA+K R+  P Q+F+EEVA +S   HRNLV LLGYCQE+G
Sbjct  94    LIGYGSFGSVYKGFLHDGT-VAVKRRAGAPGQEFAEEVASVSEIHHRNLVTLLGYCQESG  152

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             YQ+LV EYLPNG++CNHLY   +D  TKLEFKQR+SIA G AKGLCHLHG  PP+VH NF
Sbjct  153   YQMLVFEYLPNGSVCNHLYDTRKDPPTKLEFKQRISIALGAAKGLCHLHGLKPPMVHRNF  212

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDE FI KVADAG+S LL++I  + AGPS +   + F DPEV  SG  SE SD+
Sbjct  213   KTANVLVDEEFIAKVADAGVSKLLEKI--EEAGPSRASSVNVFQDPEVGTSGFASEMSDV  270

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVFL EL+TG+EA     LGSN++++QWVE+ LS ++ V+HRL G ++ EGMRDLIR
Sbjct  271   YSFGVFLLELVTGQEALRNEILGSNESLVQWVESRLSINNFVDHRLSGSFTMEGMRDLIR  330

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFPGK RP M  V +E ERI EKE+  +T MGE +AT+TLGSQLF+
Sbjct  331   LTLQCMSFPGKRRPKMATVVLELERIQEKEMAITTVMGEGTATITLGSQLFS  382



>ref|XP_006419652.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
 gb|ESR32892.1| hypothetical protein CICLE_v10005161mg [Citrus clementina]
Length=382

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/354 (62%), Positives = 264/354 (75%), Gaps = 5/354 (1%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             SK Y N+NS+T SSDPSA  +   G GP S+      G P+GAR F M+ELEQATK F E
Sbjct  33    SKNYQNKNSETGSSDPSALGKWNRGAGPSSATGQPSFG-PQGARQFSMEELEQATKQFSE  91

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
             ++LIG GSFG V+KG L D T+VAIK R   PRQ+F  EV  LS  +HRNLV LLGYCQ+
Sbjct  92    TSLIGFGSFGPVYKGLLRD-TVVAIKRRVGSPRQEFVAEVTYLSEIRHRNLVTLLGYCQQ  150

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             NGYQ+LV EYLPNG+MCNHLY  G +SSTKLEFKQR+SIA G AKGLCHLH   PP+VH 
Sbjct  151   NGYQMLVFEYLPNGSMCNHLYETGLESSTKLEFKQRVSIALGAAKGLCHLHSLKPPLVHK  210

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENFI KVAD GIS LL+ I  + AGPSH    + F DPEV +SGVFSE S
Sbjct  211   NFKTANVLVDENFIAKVADTGISKLLENI--EEAGPSHGSIVNVFRDPEVEESGVFSEMS  268

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             DIY FGVFL EL+TG+EA+HI  LGS + ++QWV + LSS++ V+HRL G ++ EGMRDL
Sbjct  269   DIYSFGVFLLELVTGQEASHIVSLGSYEALIQWVRSRLSSNNFVDHRLAGTFTTEGMRDL  328

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             IRL ++C S PG+ RP M++V  E ERI EKE+  +T MGE +A + LGS+LFT
Sbjct  329   IRLTLQCMSSPGRRRPKMEIVMTELERIHEKEMALTTFMGEGTAKIALGSELFT  382



>ref|XP_008340829.1| PREDICTED: probable receptor-like protein kinase At2g39360 isoform 
X1 [Malus domestica]
Length=376

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 261/352 (74%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QATK+FDESN
Sbjct  34    KSFSNRTSETGSSDPSALVEWNRGGPSS-------GARQGPRVFTLEELDQATKHFDESN  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS  +HR+LV +LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIRHRHLVTILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             YQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  PP+VH NF
Sbjct  147   YQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKPPIVHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENFI KVADAGIS LL++I  + AGPS +   + F DPE   SGV SE SD+
Sbjct  207   KTANVLVDENFIAKVADAGISKLLEKI--EEAGPSSTSSVNFFEDPEAGASGVTSEMSDV  264

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QWVE+ LSS++LV+ RL G ++AEGMRDLIR
Sbjct  265   YSFGVFALELLTGQEAVHIGSLGSNESLFQWVESRLSSNNLVDRRLAGSFTAEGMRDLIR  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV  E ERI EKE+  +T MGE + T+TLGS LFT
Sbjct  325   LTLQCMSFPAKRRPKMEMVVAELERIQEKEMAMTTVMGEGTDTITLGSVLFT  376



>ref|XP_010649767.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Vitis vinifera]
 emb|CBI26094.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   431 bits (1108),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 265/357 (74%), Gaps = 4/357 (1%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVE-QKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L  K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQATK F
Sbjct  31    LQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQATKQF  89

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV LLGYC
Sbjct  90    NESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTLLGYC  149

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE+G Q+LV EYLPNG+MCNHLY  G D++TKLEFK+RLSIA G AKGL HLH   PP+V
Sbjct  150   QESGSQMLVFEYLPNGSMCNHLYDTGLDATTKLEFKRRLSIALGAAKGLRHLHTLKPPLV  209

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  PE+ +S  FSE
Sbjct  210   HRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQHPEIEESRTFSE  267

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMR  488
              SD+Y FGVFL ELITGREA +    GS++++ QWVE  LS +D V+HRL+G ++ EGM+
Sbjct  268   ISDVYSFGVFLLELITGREALYDESFGSDESLFQWVETRLSINDFVDHRLVGSFTMEGMK  327

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             DLI+L ++C S  GK +  ++ V +E ERI EKE+  +T MGE +   TLGSQLFT+
Sbjct  328   DLIKLMLQCMSLSGKWQLKIEKVVLELERIHEKEMALTTGMGEGTTKFTLGSQLFTS  384



>ref|XP_009339839.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=376

 Score =   428 bits (1100),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 260/352 (74%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QATK+FDES+
Sbjct  34    KSFSNRTSETGSSDPSAIVEWNRGGPSS-------GARQGPRVFTLEELDQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS   HR+LV++LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIHHRHLVSILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             YQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  PP+ H NF
Sbjct  147   YQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKPPIAHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENFI +VADAGIS LL++I  + AGPS +   + F DPE   SGV SE SD+
Sbjct  207   KTANVLVDENFIARVADAGISKLLEKI--EEAGPSRTSSVNFFEDPEAGASGVTSEMSDV  264

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QWVE+ LSS++LV+ RL G ++AEGMRDLIR
Sbjct  265   YSFGVFALELLTGQEAVHIGSLGSNESLFQWVESRLSSNNLVDRRLAGSFTAEGMRDLIR  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV  E ERI EKE+  +T MGE + T+TLGS LFT
Sbjct  325   LTLKCMSFPAKRRPKMEMVVAELERIQEKEMAMTTVMGEGTDTITLGSVLFT  376



>ref|XP_007035517.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007035518.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06443.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06444.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=382

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/356 (60%), Positives = 269/356 (76%), Gaps = 5/356 (1%)
 Frame = -2

Query  1381  TSKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             + K +SNR S+T SSDPSA +E   G GP SS   +  G P+GAR F ++ELEQATK F 
Sbjct  30    SCKNFSNRTSETGSSDPSALMEWNKGSGPSSSAGQSLFG-PQGARQFILEELEQATKQFS  88

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             +SNLIGCGSFG V+KG L D  +VAIK     PRQ+F   V  LS  +HRNLV LLGYCQ
Sbjct  89    DSNLIGCGSFGPVYKGLLRD-IVVAIKRHPGAPRQEFVAGVIYLSEIRHRNLVTLLGYCQ  147

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E+G Q+LV EYLPNG+MCNHLY  GR++ T+LEFKQRLSIA G A+GLCHLHG  PP++H
Sbjct  148   ESGSQMLVYEYLPNGSMCNHLYDTGREAPTRLEFKQRLSIALGVARGLCHLHGLKPPLIH  207

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEA  665
              NFKT NVLVDE+FI KVADAG S LL++I  + AGPSH+   + F DPEV  SG F+E 
Sbjct  208   KNFKTANVLVDEDFIAKVADAGFSMLLEKI--EEAGPSHTSSVNVFQDPEVEVSGSFTEM  265

Query  664   SDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRD  485
             SD+Y FGVFL ELITG+EA HI  L SN++++QWV++ LSS+D V+ +L+G ++ +G+RD
Sbjct  266   SDVYSFGVFLLELITGKEAVHINYLRSNESLIQWVQSRLSSNDFVDRQLVGNFTMDGIRD  325

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             +IRL ++C SFPGKERPNM++V +E ERI EKE+  +T  GE +A +TLGS+LF +
Sbjct  326   MIRLTLKCMSFPGKERPNMNIVVLELERIHEKEMELTTVRGEGTAKITLGSELFAS  381



>emb|CDO98894.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/355 (60%), Positives = 270/355 (76%), Gaps = 7/355 (2%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAP--VEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             ++ SN+NS+T SSDPSA   +E K GG  SS +    G P+ AR FR++ELEQAT+NFDE
Sbjct  34    QKPSNKNSETGSSDPSAVGNLELKRGGASSSTSPPLAG-PQEARQFRLEELEQATRNFDE  92

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
              NLIGCGS GLV+KG L DGT+VA+K  +  PR++F EEV  LS   HRNLV LLGY Q+
Sbjct  93    GNLIGCGSLGLVYKGLLCDGTVVAVKRLTGAPRREFVEEVIGLSRIHHRNLVTLLGYFQD  152

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
               YQ+L+ EYLPNG++CNHLY  G++   KLEF+QRLSIA G AKGLC+LHGQ PP+VHG
Sbjct  153   GSYQMLIFEYLPNGSICNHLYDTGKEGMPKLEFRQRLSIALGAAKGLCYLHGQIPPLVHG  212

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENF  KVADAG+S LL +  +  AGPS S   + F DPE+ + G F E S
Sbjct  213   NFKTANVLVDENFTAKVADAGLSILLGKFEY--AGPS-STSANAFRDPEMVKMGRFFETS  269

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             D+Y FGVFL ELITG +A+H+   GS+++++ WVE HL+S+++V+HRL+G ++ EGMRDL
Sbjct  270   DVYSFGVFLLELITGMDASHMGAFGSSESVVTWVERHLNSNNMVDHRLVGSFTEEGMRDL  329

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             IRL +RC SFPG+ RP M+MVA+E ++ILEKEIM +T  GE +  +TLGSQLFTN
Sbjct  330   IRLMLRCMSFPGRLRPTMEMVAIELDQILEKEIMLTTVEGEGT-IVTLGSQLFTN  383



>ref|XP_008390720.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=377

 Score =   426 bits (1094),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 260/352 (74%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SN+NS+T SS+PSA VE   GGP S       G   G R+F ++EL QATK+FDES+
Sbjct  35    KSFSNKNSETGSSNPSAIVELNRGGPDS-------GARHGPRLFTLEELNQATKHFDESS  87

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK RS  PR+ F  EV  LS   HR+LV +LGYCQE+G
Sbjct  88    LLGYGSFGLVYKGLLRDGTVVAIKRRSGAPRRDFVSEVTYLSEIHHRHLVTILGYCQESG  147

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             +Q+LV EYLP+G++CNHLY    + STKLEFKQRLSIA G AKGL HLHG  PP+VH NF
Sbjct  148   FQVLVYEYLPSGSICNHLYDTRSEPSTKLEFKQRLSIALGAAKGLSHLHGLKPPIVHKNF  207

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENF  KVADAGIS LL++I  + AGPSH+     F DP    SGV SE SD+
Sbjct  208   KTANVLVDENFTAKVADAGISKLLEKI--EEAGPSHTPSVKFFEDPGAGSSGVTSEMSDV  265

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QW+E+ LSS++LV+ RL G ++AEGMRDLIR
Sbjct  266   YSFGVFALELLTGQEALHIGSLGSNESLFQWLESRLSSNNLVDRRLTGSFTAEGMRDLIR  325

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV +E ERI EKE+  +  MGE + T+TLGS LFT
Sbjct  326   LTLQCMSFPAKRRPRMEMVVMELERIQEKEMSMTIVMGEGTDTITLGSVLFT  377



>ref|XP_009352231.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=377

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 262/352 (74%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SN+NS+T SSDPSA VE   GGP S    AR     G R+F ++EL+QATK+FDES+
Sbjct  35    KSFSNKNSETGSSDPSAIVEWNRGGPGSE---AR----HGPRLFTLEELDQATKHFDESS  87

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK RS  PRQ F  +V  LS   HR+LV +LGYCQE+G
Sbjct  88    LLGYGSFGLVYKGLLRDGTVVAIKRRSGAPRQDFVSQVTYLSEIHHRHLVRILGYCQESG  147

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             +Q+LV EYLP+G++CNHLY    + ST+ EFKQRLSIA G AKGL HLHG  PP+VH NF
Sbjct  148   FQVLVYEYLPSGSICNHLYDTRSEPSTEFEFKQRLSIALGAAKGLSHLHGLKPPIVHKNF  207

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENF  KVADAGIS LL++I  + AGPS +   + F DPE   SGV SE SD+
Sbjct  208   KTANVLVDENFTAKVADAGISKLLEKI--EEAGPSRTSSVNFFKDPEAGSSGVTSEMSDV  265

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QWVE+ LSS++L + RL G ++AEGMRDLIR
Sbjct  266   YSFGVFTLELLTGQEALHIGFLGSNESLFQWVESWLSSNNLADRRLAGSFTAEGMRDLIR  325

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV +E ERI EKE+  +T MGE + T+TLGS LFT
Sbjct  326   LTLQCMSFPAKRRPKMEMVVMELERIQEKEMSMTTVMGEGTDTITLGSVLFT  377



>ref|XP_009369125.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=376

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 259/352 (74%), Gaps = 9/352 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QATK+FDES+
Sbjct  34    KSFSNRTSETGSSDPSAIVEWNRGGPSS-------GARQGPRVFTLEELDQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS   HR+LV++LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIHHRHLVSILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             YQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  PP+ H NF
Sbjct  147   YQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKPPIAHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENFI +VADAGIS LL++I  + AGPS +   + F DPE   SGV SE SD+
Sbjct  207   KTANVLVDENFIARVADAGISKLLEKI--EEAGPSRTSSVNFFEDPEAGASGVTSEMSDV  264

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QWVE+ LSS++LV+ RL G ++AEGMRDLIR
Sbjct  265   YSFGVFALELLTGQEAVHIGSLGSNESLFQWVESRLSSNNLVDRRLAGSFTAEGMRDLIR  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV  E ERI EKE+  +T MGE + T+T GS LFT
Sbjct  325   LTLKCMSFPAKRRPKMEMVVAELERIQEKEMAMTTVMGEGTDTITPGSVLFT  376



>ref|XP_010649765.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
 ref|XP_010649766.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
Length=390

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 265/362 (73%), Gaps = 9/362 (2%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVE-QKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L  K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQATK F
Sbjct  31    LQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQATKQF  89

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV LLGYC
Sbjct  90    NESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTLLGYC  149

Query  1027  QENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             QE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G AKGL HLH  
Sbjct  150   QESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALGAAKGLRHLHTL  209

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQS  683
              PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  PE+ +S
Sbjct  210   KPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQHPEIEES  267

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYS  503
               FSE SD+Y FGVFL ELITGREA +    GS++++ QWVE  LS +D V+HRL+G ++
Sbjct  268   RTFSEISDVYSFGVFLLELITGREALYDESFGSDESLFQWVETRLSINDFVDHRLVGSFT  327

Query  502   AEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              EGM+DLI+L ++C S  GK +  ++ V +E ERI EKE+  +T MGE +   TLGSQLF
Sbjct  328   MEGMKDLIKLMLQCMSLSGKWQLKIEKVVLELERIHEKEMALTTGMGEGTTKFTLGSQLF  387

Query  322   TN  317
             T+
Sbjct  388   TS  389



>emb|CAN74612.1| hypothetical protein VITISV_043188 [Vitis vinifera]
Length=496

 Score =   423 bits (1087),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 265/368 (72%), Gaps = 15/368 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVE-QKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L  K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQATK F
Sbjct  131   LQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQATKQF  189

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV LLGYC
Sbjct  190   NESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTLLGYC  249

Query  1027  QENGYQILVLEYLPNGTMCNHLYG-----------MGRDSSTKLEFKQRLSIASGTAKGL  881
             QE+G Q+LV EYLPNG+MCNHLY             G D++TKLEFK+RLSIA G AKGL
Sbjct  250   QESGSQMLVFEYLPNGSMCNHLYARHVTVVHCLTDTGLDATTKLEFKRRLSIALGAAKGL  309

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFID  701
              HLH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   + F  
Sbjct  310   RHLHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSVNVFQH  367

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHR  521
             PE+ +S  FSE SD+Y FGVFL ELITGREA +    GS++++ QWVE  LS +D V+HR
Sbjct  368   PEIEESRTFSEISDVYSFGVFLLELITGREALYDESFGSDESLFQWVETRLSINDFVDHR  427

Query  520   LMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLT  341
             L+G ++ EGM+DLI+L ++C S  GK +  ++ V +E ERI EKE+  +T MGE +   T
Sbjct  428   LVGSFTMEGMKDLIKLMLQCMSLSGKWQLKIEKVVLELERIHEKEMALTTGMGEGTTKFT  487

Query  340   LGSQLFTN  317
             LGSQLFT+
Sbjct  488   LGSQLFTS  495



>ref|XP_011090927.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
Length=380

 Score =   419 bits (1076),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 218/378 (58%), Positives = 273/378 (72%), Gaps = 6/378 (2%)
 Frame = -2

Query  1453  CKPSTGKKVNVGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALAR  1274
             C    G    +G  +F++   ML   ++ SN++S+T SSDPSA VE K G P +   L  
Sbjct  9     CGVVGGGLTVLGLAIFLVWFFML-RCRKLSNKDSETGSSDPSAVVELKRG-PTAVPPLP-  65

Query  1273  GGVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQF  1094
              G    AR FR++ELEQA++ F+E+NLIG G+FGLVFKG L DGT+VAIK RS  PRQ+F
Sbjct  66    -GPYNKAREFRIEELEQASRQFNENNLIGFGTFGLVFKGLLNDGTVVAIKRRSGHPRQEF  124

Query  1093  SEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQR  914
             +EEVA LS  QHRNLV LLG CQE G QILV EYLPNG+MC+HLY  G+DS TKLEFKQR
Sbjct  125   TEEVAYLSAIQHRNLVKLLGSCQEKGSQILVFEYLPNGSMCSHLYDTGKDSITKLEFKQR  184

Query  913   LSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
             LSIA G AKGL HLH   PPVVH NFKT NVLVDENFI KVADAG+  LL++I  + AG 
Sbjct  185   LSIAIGAAKGLRHLHSLQPPVVHSNFKTANVLVDENFIAKVADAGVLKLLEKI--EDAGS  242

Query  733   SHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA  554
             S S   + F DPE+     F + +DIY FG+FL ELI+G+EA       SN ++L+WV+ 
Sbjct  243   SSSSSFNAFRDPELGLHEAFHDTNDIYSFGIFLLELISGKEATEKEAFLSNDSILKWVQE  302

Query  553   HLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
             HLS +DLV++RL+G ++AEGMRDL+RL ++C SFPG+ERP M  V +E ++IL+KE+  +
Sbjct  303   HLSLNDLVDYRLIGSFTAEGMRDLVRLMLKCMSFPGRERPRMGNVVLELDQILDKEMTRT  362

Query  373   TAMGEASATLTLGSQLFT  320
             T MGE  AT+TLGSQLFT
Sbjct  363   TVMGEGMATVTLGSQLFT  380



>ref|XP_008340830.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Malus domestica]
Length=369

 Score =   414 bits (1063),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 252/352 (72%), Gaps = 16/352 (5%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SNR S+T SSDPSA VE   GGP S       G  +G RVF ++EL+QATK+FDESN
Sbjct  34    KSFSNRTSETGSSDPSALVEWNRGGPSS-------GARQGPRVFTLEELDQATKHFDESN  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PR  F  EV  LS  +HR+LV +LGYCQE+G
Sbjct  87    LLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRHDFVSEVTYLSEIRHRHLVTILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             YQ+LV EYLPNG++ +HLY    + STKLEFKQRLSIA G A+GL HLHG  PP+VH NF
Sbjct  147   YQVLVYEYLPNGSISSHLYDTRPEPSTKLEFKQRLSIALGAARGLSHLHGLKPPIVHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENFI KVADAGIS LL++I    A  +               SGV SE SD+
Sbjct  207   KTANVLVDENFIAKVADAGISKLLEKIEEAEANNACD---------RAGASGVTSEMSDV  257

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVF  EL+TG+EA HI  LGSN+++ QWVE+ LSS++LV+ RL G ++AEGMRDLIR
Sbjct  258   YSFGVFALELLTGQEAVHIGSLGSNESLFQWVESRLSSNNLVDRRLAGSFTAEGMRDLIR  317

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L ++C SFP K RP M+MV  E ERI EKE+  +T MGE + T+TLGS LFT
Sbjct  318   LTLQCMSFPAKRRPKMEMVVAELERIQEKEMAMTTVMGEGTDTITLGSVLFT  369



>ref|XP_004296813.1| PREDICTED: receptor-like protein kinase THESEUS 1-like [Fragaria 
vesca subsp. vesca]
Length=377

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/353 (59%), Positives = 257/353 (73%), Gaps = 12/353 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K   N+NS+T SSDPSA          +   L RGG P  AR F M+ELEQATK+FDES+
Sbjct  36    KHLFNKNSETGSSDPSAGK--------NLFELNRGG-PSSARHFTMEELEQATKHFDESS  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFGLV+KG L DGT+VAIK R   PRQ+F  EV  LS   HRNLV +LGYCQE+G
Sbjct  87    LLGFGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVKILGYCQESG  146

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
             +Q+L+ EYLPNG++ NHLY    D S KLEFKQRLS+A G AKGLCHLHG  PP++H NF
Sbjct  147   FQMLIFEYLPNGSISNHLYDTKHDPSIKLEFKQRLSVALGAAKGLCHLHGLRPPIIHKNF  206

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQS-GVFSEASD  659
             +T NVLVDENFI KV+DAGI+ LL++I  + AGPSH+   + F DPEV  S    SE SD
Sbjct  207   QTSNVLVDENFIAKVSDAGIAKLLEKI--EEAGPSHTSSVNFFQDPEVGPSESASSEVSD  264

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLI  479
             +Y FGVFL E+IT +E   I  LGSN+++ QWV++ LSS++LV+ RL G ++ EGMRD+I
Sbjct  265   VYSFGVFLMEIITVQETLDIGSLGSNESLFQWVQSRLSSNNLVDSRLAGSFTIEGMRDMI  324

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             RL ++C SFPG+ RP M+MV VE ERI EKE+  +T MGE + T+TLGS LFT
Sbjct  325   RLTLQCMSFPGERRPKMEMVVVELERIQEKEMAMTTVMGEGTDTITLGSALFT  377



>ref|XP_007009417.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18227.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=383

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/355 (57%), Positives = 255/355 (72%), Gaps = 6/355 (2%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             +K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQATK FD 
Sbjct  32    NKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQATKQFDA  89

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
             SNL+G GSFG V+KG L D T+VAIK R   P+Q+F  E   LS  QHRNLV L GYCQE
Sbjct  90    SNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEAIYLSEIQHRNLVTLQGYCQE  148

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             +G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G AKGLCHLHG  PP+VH 
Sbjct  149   SGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALGAAKGLCHLHGLKPPLVHR  208

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   + F DPE   SG F+E S
Sbjct  209   NFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASVTVFQDPEAEASGTFTEMS  266

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             D+Y FGVFL ELITG+EA H+  L SN++++QWV + LSS++ V+HRL+G ++ EG+RD+
Sbjct  267   DVYSFGVFLLELITGQEAVHMDSLASNESLIQWVRSRLSSNNFVDHRLVGSFTMEGIRDM  326

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             IRL ++C +FP   RP MD V +  E+I EKE+  +T MGE +AT+TLGS+LF +
Sbjct  327   IRLTLQCMTFPANCRPRMDKVVLVLEQIHEKEMALTTVMGEGTATITLGSELFAS  381



>ref|XP_008796242.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Phoenix dactylifera]
Length=414

 Score =   402 bits (1033),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 202/354 (57%), Positives = 253/354 (71%), Gaps = 3/354 (1%)
 Frame = -2

Query  1375  KRY-SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDES  1199
             +R+ SNRNS+T SSDP   VE    G +S          +GAR F ++EL QATK+FDE 
Sbjct  62    RRFPSNRNSETGSSDPPTIVEWSRRGRISFAGGGHATEHQGARQFTLEELSQATKSFDEC  121

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NL+G GSFGLV+KG L DGTIVAIK R   P+ +F EEV +LS   HRNLV L+GYCQE 
Sbjct  122   NLVGSGSFGLVYKGLLLDGTIVAIKMRRGSPQPEFVEEVKKLSEICHRNLVTLIGYCQEG  181

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
             G Q+LV EYLPNG++ +HLY  GRD + +LEFKQRLS+A GTAKGL HLH   P VVH +
Sbjct  182   GLQMLVFEYLPNGSISHHLYDTGRDIAMRLEFKQRLSVAIGTAKGLNHLHSLVPQVVHKD  241

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASD  659
             FK+ NVLVDENFI KVADAGI+ LL+ +  D AGPS S   + F DPEV + G  SEASD
Sbjct  242   FKSSNVLVDENFIAKVADAGIAKLLQRL--DNAGPSRSSDGNVFQDPEVEEFGALSEASD  299

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLI  479
             +Y FGVFL ELITGREAAH+    S ++++QWVE HL S+DL++ RL   +++EGM+DLI
Sbjct  300   VYSFGVFLLELITGREAAHLLSPESEESLVQWVEGHLVSNDLIDRRLGSSFTSEGMKDLI  359

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              L +RC +  G+ RP M  VA E +RILE E+  +T MG+ +A +TLGSQLF +
Sbjct  360   GLTLRCLNPSGRGRPKMSSVATELDRILETEMTLTTVMGDGTAIVTLGSQLFNS  413



>ref|XP_010241786.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X2 [Nelumbo nucifera]
Length=386

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 261/355 (74%), Gaps = 5/355 (1%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K   N+NS+T SSDPSA VE   GG  +S   +  G P+G + F ++ELEQATK+F +SN
Sbjct  34    KNLLNKNSETGSSDPSAQVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQATKHFSKSN  92

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LLG+CQE+ 
Sbjct  93    LIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLLGFCQEDD  152

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  PP+ H NF
Sbjct  153   SQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVPPLAHKNF  212

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPEVNQSGVFSEASD  659
             KT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPEV +SG FS  SD
Sbjct  213   KTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPEVGESGKFSGMSD  270

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRL-MGKYSAEGMRDL  482
             +Y FGVFL ELITG+EA  I  L S+++++QWVE+HL S++LV+HRL    +++EGM DL
Sbjct  271   VYSFGVFLLELITGQEALKINSLRSHESLIQWVESHLCSNNLVDHRLATSSFTSEGMMDL  330

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             IRL ++C S PGK RP MDM+ +E +RILEKE+  +T MGE +AT+T GSQLFT+
Sbjct  331   IRLTLQCMSSPGKGRPKMDMIMLELDRILEKEMTLTTVMGEGTATVTPGSQLFTS  385



>ref|XP_010649769.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 isoform 
X3 [Vitis vinifera]
Length=375

 Score =   397 bits (1020),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 256/362 (71%), Gaps = 24/362 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVE-QKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L  K +SN+NS+T SSDPSAPVE  + GGP S+ A    G P+GAR F M+ELEQATK F
Sbjct  31    LQCKNFSNKNSETGSSDPSAPVEWNRRGGPSSAAAPPLSG-PQGARQFTMEELEQATKQF  89

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  QHRNLV LLGYC
Sbjct  90    NESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQHRNLVTLLGYC  149

Query  1027  QENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             QE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G AKGL HLH  
Sbjct  150   QESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALGAAKGLRHLHTL  209

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQS  683
              PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +        P VN  
Sbjct  210   KPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQT--------PSVN--  257

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYS  503
              VF        FGVFL ELITGREA +    GS++++ QWVE  LS +D V+HRL+G ++
Sbjct  258   -VFQHPD----FGVFLLELITGREALYDESFGSDESLFQWVETRLSINDFVDHRLVGSFT  312

Query  502   AEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              EGM+DLI+L ++C S  GK +  ++ V +E ERI EKE+  +T MGE +   TLGSQLF
Sbjct  313   MEGMKDLIKLMLQCMSLSGKWQLKIEKVVLELERIHEKEMALTTGMGEGTTKFTLGSQLF  372

Query  322   TN  317
             T+
Sbjct  373   TS  374



>ref|XP_010243555.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X4 [Nelumbo nucifera]
Length=385

 Score =   397 bits (1021),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 200/355 (56%), Positives = 255/355 (72%), Gaps = 6/355 (2%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K++ NRNS+T+SSDPSA VE       SS         +G + F ++ELEQATK+F + N
Sbjct  34    KKHRNRNSETSSSDPSAVVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATKHFSKGN  93

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG+CQE+G
Sbjct  94    LIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLGFCQEDG  153

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              Q+LV EY+PNG++ +H+Y  G++S T LEFKQRLSIA G AKGLCHLH   PPVVH NF
Sbjct  154   SQMLVFEYVPNGSLSSHIYDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIPPVVHKNF  213

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPEVNQSGVFSEAS  662
             +  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPEV +S  FSE S
Sbjct  214   RMSNVLVDENFIAKVADAGISKLLERIE----DPSSSSQTGGNVFQDPEVRESRTFSEMS  269

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             D+Y FG+FL ELITG+E   I  LGS+++++QWV++ L S++ V+HRL   ++ EGM++L
Sbjct  270   DVYSFGIFLLELITGQETLKINSLGSHESLMQWVKSCLHSNNFVDHRLASCFTLEGMKNL  329

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              RL  +C +  GK RP MDMV +E ERILE E+  +T MG+ +AT+TLGSQLFT+
Sbjct  330   TRLMFQCMNIVGKGRPKMDMVMLELERILENEMTLTTVMGDGTATVTLGSQLFTS  384



>gb|KDP40006.1| hypothetical protein JCGZ_02004 [Jatropha curcas]
Length=382

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 255/357 (71%), Gaps = 11/357 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP----EGARVFRMQELEQATKNF  1208
             K +SN+NS+T SSDP A VE   GG  SS      G P    +GAR F M ELEQATK F
Sbjct  32    KNFSNKNSETGSSDPYAVVEWNRGGQCSSAP----GRPLFGSQGARAFTMDELEQATKQF  87

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              ESNLIG GSFG V+KG L D T VAIK R + PR+ F  EV  LS  +HRNLV+LLGYC
Sbjct  88    SESNLIGYGSFGSVYKGLLQD-TTVAIKRRPSAPREDFVAEVFYLSEIRHRNLVSLLGYC  146

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE   Q+LV EY+PN ++ NHLY  G  SSTKLEFKQRLSIA G AKGLCHLHG  PP+V
Sbjct  147   QERDSQMLVFEYVPNDSIGNHLYDTGLTSSTKLEFKQRLSIALGAAKGLCHLHGLNPPLV  206

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H NFKT NVLVDENF+ KVADAGIS LL++I  + AGPS++   + F DPE   SG F+E
Sbjct  207   HKNFKTTNVLVDENFLVKVADAGISKLLEKI--EEAGPSYTSGVNVFWDPETGVSGTFTE  264

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMR  488
              SD+Y FGVFL ELITG+EA H+  LG ++ ++QWV + L+S++ V+ RL+G ++ +G+R
Sbjct  265   MSDVYSFGVFLLELITGQEAIHLGFLGYDEGLIQWVASRLNSNNFVDRRLLGSFTEDGIR  324

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             DLIRL ++C SFP   RP M+M+ VE ERI EKE+  +T  G+ +AT   GS+LFT+
Sbjct  325   DLIRLTLQCMSFPRIGRPKMEMIVVELERIHEKEMALTTVTGDGTATFIKGSELFTS  381



>ref|XP_002516888.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF45502.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=375

 Score =   395 bits (1015),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 202/352 (57%), Positives = 251/352 (71%), Gaps = 8/352 (2%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K +SN+NS+T SSDPSA      GG  SS         +GAR F M ELEQATK F +SN
Sbjct  32    KNFSNKNSETGSSDPSA-----LGGRSSSAPSRYIFGSQGARQFTMDELEQATKQFSDSN  86

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG GSFG V+KG L D ++VAIK R    R  F  EV  LS  +HRNLV+LLGYC+E G
Sbjct  87    LIGYGSFGSVYKGLLHD-SVVAIKRRPNVARDDFVAEVIYLSEIRHRNLVSLLGYCKERG  145

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              Q+LV EY+PNG+MCNHLY  G +SSTKLEFKQRLSIA G AKGLCHLH   PP+VH NF
Sbjct  146   SQMLVFEYVPNGSMCNHLYDRGLESSTKLEFKQRLSIALGAAKGLCHLHSLNPPLVHKNF  205

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             +  NVLVDENFI KVADAGIS LL++I  + AGPS +   + F DPE   SG F+E SD+
Sbjct  206   RMANVLVDENFIVKVADAGISKLLEKI--EEAGPSFTSGVNVFQDPETEVSGTFTEMSDV  263

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIR  476
             Y FGVFL EL+TG+EA H+   G++++++QWV + L+S+  V+ RLMG ++ +G+RDLIR
Sbjct  264   YSFGVFLLELLTGQEAVHLGFSGTDESLIQWVASRLNSNSFVDRRLMGSFTRDGIRDLIR  323

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             L +RC SFPG  RP M+MV  E ERI ++E+  +T MGE +AT   GS+LFT
Sbjct  324   LTLRCMSFPGTGRPKMEMVVAELERIHDREMELTTVMGEGTATFLKGSELFT  375



>ref|XP_010241759.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241768.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241775.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010241781.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Nelumbo nucifera]
Length=389

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 261/358 (73%), Gaps = 8/358 (2%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELEQATK+F 
Sbjct  34    KNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQATKHFS  92

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LLG+CQ
Sbjct  93    KSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLLGFCQ  152

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  PP+ H
Sbjct  153   EDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVPPLAH  212

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPEV +SG FS 
Sbjct  213   KNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPEVGESGKFSG  270

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRL-MGKYSAEGM  491
              SD+Y FGVFL ELITG+EA  I  L S+++++QWVE+HL S++LV+HRL    +++EGM
Sbjct  271   MSDVYSFGVFLLELITGQEALKINSLRSHESLIQWVESHLCSNNLVDHRLATSSFTSEGM  330

Query  490   RDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              DLIRL ++C S PGK RP MDM+ +E +RILEKE+  +T MGE +AT+T GSQLFT+
Sbjct  331   MDLIRLTLQCMSSPGKGRPKMDMIMLELDRILEKEMTLTTVMGEGTATVTPGSQLFTS  388



>ref|XP_010243554.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X3 [Nelumbo nucifera]
Length=386

 Score =   393 bits (1010),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/356 (56%), Positives = 255/356 (72%), Gaps = 7/356 (2%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA-PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDES  1199
             K++ NRNS+T+SSDPSA  VE       SS         +G + F ++ELEQATK+F + 
Sbjct  34    KKHRNRNSETSSSDPSAVAVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATKHFSKG  93

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG+CQE+
Sbjct  94    NLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLGFCQED  153

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
             G Q+LV EY+PNG++ +H+Y  G++S T LEFKQRLSIA G AKGLCHLH   PPVVH N
Sbjct  154   GSQMLVFEYVPNGSLSSHIYDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIPPVVHKN  213

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPEVNQSGVFSEA  665
             F+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPEV +S  FSE 
Sbjct  214   FRMSNVLVDENFIAKVADAGISKLLERIE----DPSSSSQTGGNVFQDPEVRESRTFSEM  269

Query  664   SDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRD  485
             SD+Y FG+FL ELITG+E   I  LGS+++++QWV++ L S++ V+HRL   ++ EGM++
Sbjct  270   SDVYSFGIFLLELITGQETLKINSLGSHESLMQWVKSCLHSNNFVDHRLASCFTLEGMKN  329

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             L RL  +C +  GK RP MDMV +E ERILE E+  +T MG+ +AT+TLGSQLFT+
Sbjct  330   LTRLMFQCMNIVGKGRPKMDMVMLELERILENEMTLTTVMGDGTATVTLGSQLFTS  385



>ref|XP_010243553.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 isoform 
X2 [Nelumbo nucifera]
Length=391

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 255/361 (71%), Gaps = 12/361 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             K++ NRNS+T+SSDPSA VE       SS         +G + F ++ELEQATK+F + N
Sbjct  34    KKHRNRNSETSSSDPSAVVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATKHFSKGN  93

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG+CQE+G
Sbjct  94    LIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLGFCQEDG  153

Query  1015  YQILVLEYLPNGTMCNHLYGM------GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
              Q+LV EY+PNG++ +H+Y        G++S T LEFKQRLSIA G AKGLCHLH   PP
Sbjct  154   SQMLVFEYVPNGSLSSHIYVFCCLSDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIPP  213

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPEVNQSG  680
             VVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPEV +S 
Sbjct  214   VVHKNFRMSNVLVDENFIAKVADAGISKLLERIE----DPSSSSQTGGNVFQDPEVRESR  269

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
              FSE SD+Y FG+FL ELITG+E   I  LGS+++++QWV++ L S++ V+HRL   ++ 
Sbjct  270   TFSEMSDVYSFGIFLLELITGQETLKINSLGSHESLMQWVKSCLHSNNFVDHRLASCFTL  329

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             EGM++L RL  +C +  GK RP MDMV +E ERILE E+  +T MG+ +AT+TLGSQLFT
Sbjct  330   EGMKNLTRLMFQCMNIVGKGRPKMDMVMLELERILENEMTLTTVMGDGTATVTLGSQLFT  389

Query  319   N  317
             +
Sbjct  390   S  390



>ref|XP_010036980.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010036987.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010036997.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037004.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037013.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037021.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 ref|XP_010037028.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Eucalyptus grandis]
 gb|KCW84434.1| hypothetical protein EUGRSUZ_B01279 [Eucalyptus grandis]
Length=384

 Score =   390 bits (1001),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 250/350 (71%), Gaps = 2/350 (1%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT+ FDESNLIG
Sbjct  37    ANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELATRQFDESNLIG  96

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LLGYC ENG Q+
Sbjct  97    HGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLLGYCLENGCQM  156

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   PP+VH NFKT 
Sbjct  157   LVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRPPLVHKNFKTA  216

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE  + G FSE SD Y F
Sbjct  217   NVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPEAGELGGFSEMSDAYSF  275

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL EL+TG EAA    L  +++++QWVE+  S  +LV+ RL+G ++ +GMRDL RL +
Sbjct  276   GVFLLELVTG-EAAPNMILSGHESLIQWVESRESLINLVDPRLLGTFTMDGMRDLTRLTL  334

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              C   P + RP MD +A E ERI EKE+  +T MGE +AT+T GS+LFT+
Sbjct  335   LCMISPRERRPKMDAIAWELERIREKEMALTTVMGEGTATITPGSELFTS  384



>ref|XP_007009418.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY18228.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
Length=389

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 244/344 (71%), Gaps = 6/344 (2%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             +K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQATK FD 
Sbjct  38    NKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQATKQFDA  95

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQE  1022
             SNL+G GSFG V+KG L D T+VAIK R   P+Q+F  E   LS  QHRNLV L GYCQE
Sbjct  96    SNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEAIYLSEIQHRNLVTLQGYCQE  154

Query  1021  NGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHG  842
             +G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G AKGLCHLHG  PP+VH 
Sbjct  155   SGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALGAAKGLCHLHGLKPPLVHR  214

Query  841   NFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEAS  662
             NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   + F DPE   SG F+E S
Sbjct  215   NFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASVTVFQDPEAEASGTFTEMS  272

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             D+Y FGVFL ELITG+EA H+  L SN++++QWV + LSS++ V+HRL+G ++ EG+RD+
Sbjct  273   DVYSFGVFLLELITGQEAVHMDSLASNESLIQWVRSRLSSNNFVDHRLVGSFTMEGIRDM  332

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASA  350
             IRL ++C +FP   RP MD V +  E+I EKE+  +T MGE  +
Sbjct  333   IRLTLQCMTFPANCRPRMDKVVLVLEQIHEKEMALTTVMGEGDS  376



>ref|XP_010921751.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Elaeis guineensis]
 ref|XP_010921753.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Elaeis guineensis]
Length=384

 Score =   388 bits (996),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 194/350 (55%), Positives = 246/350 (70%), Gaps = 3/350 (1%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +NR+S+T SSDP   +E   GG +SS         +GAR F  +EL QAT NFDE NL+G
Sbjct  37    ANRSSETGSSDPPT-IEWSRGGRMSSAGGGHATEHQGARQFTFEELSQATNNFDECNLVG  95

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+ G L DGTIVAIK R + PRQ+F EEV +LS   HRNLV L+GYCQE G Q+
Sbjct  96    SGSFGLVYNGLLLDGTIVAIKRRQSAPRQEFIEEVKKLSEICHRNLVALIGYCQEGGLQM  155

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             +V E+LPNG++  HLY   RD   +LEFKQRLS+A G AKGL HLH   P VVH +FK+ 
Sbjct  156   IVFEHLPNGSISRHLYDSARDRVARLEFKQRLSVAIGAAKGLAHLHNLVPQVVHKDFKSS  215

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPEV + G  SEASD+Y F
Sbjct  216   NVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSFGGNVFQDPEVEEFGALSEASDVYSF  273

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL ELITGREAAH     S++++ QWVEAHL S DL++ RL   ++ EGM+DLI+L +
Sbjct  274   GVFLLELITGREAAHFFSPESDESLAQWVEAHLISKDLLDQRLGSSFTPEGMKDLIKLTL  333

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             +C +  G++RP M  V  + + ILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  334   QCLNPSGRKRPKMSAVVADLDLILETEMTLTTVMGDGTAIVTLGSQLFTS  383



>ref|XP_010243552.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
Length=392

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 255/362 (70%), Gaps = 13/362 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA-PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDES  1199
             K++ NRNS+T+SSDPSA  VE       SS         +G + F ++ELEQATK+F + 
Sbjct  34    KKHRNRNSETSSSDPSAVAVESNRRHGFSSEGATSIPEVQGVKQFTLEELEQATKHFSKG  93

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG GSFGLV+KG L DGTIVAIK R + PRQ+F  EV  LS  +HRN+V LLG+CQE+
Sbjct  94    NLIGKGSFGLVYKGLLSDGTIVAIKRRQSAPRQEFVNEVLHLSEVKHRNIVTLLGFCQED  153

Query  1018  GYQILVLEYLPNGTMCNHLYGM------GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             G Q+LV EY+PNG++ +H+Y        G++S T LEFKQRLSIA G AKGLCHLH   P
Sbjct  154   GSQMLVFEYVPNGSLSSHIYVFCCLSDNGQESITTLEFKQRLSIALGAAKGLCHLHSLIP  213

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP--SPFIDPEVNQS  683
             PVVH NF+  NVLVDENFI KVADAGIS LL+ I      PS S Q   + F DPEV +S
Sbjct  214   PVVHKNFRMSNVLVDENFIAKVADAGISKLLERIED----PSSSSQTGGNVFQDPEVRES  269

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYS  503
               FSE SD+Y FG+FL ELITG+E   I  LGS+++++QWV++ L S++ V+HRL   ++
Sbjct  270   RTFSEMSDVYSFGIFLLELITGQETLKINSLGSHESLMQWVKSCLHSNNFVDHRLASCFT  329

Query  502   AEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              EGM++L RL  +C +  GK RP MDMV +E ERILE E+  +T MG+ +AT+TLGSQLF
Sbjct  330   LEGMKNLTRLMFQCMNIVGKGRPKMDMVMLELERILENEMTLTTVMGDGTATVTLGSQLF  389

Query  322   TN  317
             T+
Sbjct  390   TS  391



>ref|XP_010649770.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X4 [Vitis vinifera]
Length=312

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 232/313 (74%), Gaps = 7/313 (2%)
 Frame = -2

Query  1240  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  1061
             M+ELEQATK F+ESNLIG GSFGLV+KGFL DGTIVAIK R  PPR++F  E   LS  Q
Sbjct  1     MEELEQATKQFNESNLIGYGSFGLVYKGFLSDGTIVAIKRRPGPPRREFVAEATNLSEIQ  60

Query  1060  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLY-----GMGRDSSTKLEFKQRLSIASG  896
             HRNLV LLGYCQE+G Q+LV EYLPNG+MCNHLY       G D++TKLEFK+RLSIA G
Sbjct  61    HRNLVTLLGYCQESGSQMLVFEYLPNGSMCNHLYVHCLTDTGLDATTKLEFKRRLSIALG  120

Query  895   TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  716
              AKGL HLH   PP+VH NFKT NVLVDENFI KVAD GIS LL++I  + AGPS +   
Sbjct  121   AAKGLRHLHTLKPPLVHRNFKTANVLVDENFIAKVADTGISRLLEKI--EDAGPSQTPSV  178

Query  715   SPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD  536
             + F  PE+ +S  FSE SD+Y FGVFL ELITGREA +    GS++++ QWVE  LS +D
Sbjct  179   NVFQHPEIEESRTFSEISDVYSFGVFLLELITGREALYDESFGSDESLFQWVETRLSIND  238

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
              V+HRL+G ++ EGM+DLI+L ++C S  GK +  ++ V +E ERI EKE+  +T MGE 
Sbjct  239   FVDHRLVGSFTMEGMKDLIKLMLQCMSLSGKWQLKIEKVVLELERIHEKEMALTTGMGEG  298

Query  355   SATLTLGSQLFTN  317
             +   TLGSQLFT+
Sbjct  299   TTKFTLGSQLFTS  311



>ref|XP_007009416.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18226.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 259/384 (67%), Gaps = 35/384 (9%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDE  1202
             +K +SNRNSDT SSDP+A  E   G GP S+   +  G     R F ++ELEQATK FD 
Sbjct  89    NKNFSNRNSDTGSSDPTARAEWNRGAGPSSAAGFSLFGTQ--GRRFTLEELEQATKQFDA  146

Query  1201  SNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQF-SEEVAR------------LSMTQ  1061
             SNL+G GSFG V+KG L D T+VAIK R   P+Q+F +E++ R            LS  Q
Sbjct  147   SNLMGHGSFGSVYKGLLRD-TVVAIKRRQGAPQQEFVAEDLDRKLISIYVKQAIYLSEIQ  205

Query  1060  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  881
             HRNLV L GYCQE+G Q+LV EYLPNG++CNHLY    +SS +LEFKQRLSIA G AKGL
Sbjct  206   HRNLVTLQGYCQESGSQMLVYEYLPNGSICNHLYDSRMESSARLEFKQRLSIALGAAKGL  265

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFID  701
             CHLHG  PP+VH NFKT NVLVDENFI KVADAG+  LL+ I  +  GPS +   + F D
Sbjct  266   CHLHGLKPPLVHRNFKTANVLVDENFIAKVADAGVWKLLQRI--EEGGPSCTASVTVFQD  323

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW--------------  563
             PE   SG F+E SD+Y FGVFL ELITG+EA H+  L SN++++QW              
Sbjct  324   PEAEASGTFTEMSDVYSFGVFLLELITGQEAVHMDSLASNESLIQWVHEFERSVCFFATF  383

Query  562   --VEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEK  389
               V + LSS++ V+HRL+G ++ EG+RD+IRL ++C +FP   RP MD V +  E+I EK
Sbjct  384   LKVRSRLSSNNFVDHRLVGSFTMEGIRDMIRLTLQCMTFPANCRPRMDKVVLVLEQIHEK  443

Query  388   EIMGSTAMGEASATLTLGSQLFTN  317
             E+  +T MGE +AT+TLGS+LF +
Sbjct  444   EMALTTVMGEGTATITLGSELFAS  467



>gb|EMS58706.1| Nodulation receptor kinase [Triticum urartu]
Length=378

 Score =   384 bits (987),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 247/351 (70%), Gaps = 11/351 (3%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLI  1190
             NR S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QAT NF E+NL+
Sbjct  37    NRTSETGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQATNNFSEANLV  89

Query  1189  GCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQ  1010
             G GSFGLV+KG LFDG++VAIK R+  PR +FS+EV RLS   HRN+V L+GYCQE G Q
Sbjct  90    GAGSFGLVYKGLLFDGSVVAIKRRTGAPRLEFSDEVRRLSEICHRNIVTLIGYCQEGGLQ  149

Query  1009  ILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKT  830
             +LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   PP++H NFKT
Sbjct  150   MLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLMPPLIHKNFKT  209

Query  829   GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYG  650
              NVLVDENFI KVADAG+  LL+   H+  G SH    S + DPE +    FSE+SD+Y 
Sbjct  210   SNVLVDENFIAKVADAGLFRLLR--GHEDVGSSHGFSSSVYQDPEAHSVAQFSESSDVYS  267

Query  649   FGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLA  470
             FGVFL ELITGREAA ++   S +++  W+EAH SS++L++ RL G ++ EGM++ + LA
Sbjct  268   FGVFLLELITGREAASLQPPESRESLAHWLEAHFSSNELIDPRLGGGFTTEGMKEFVGLA  327

Query  469   MRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              +C +   + RP + +VA E +RILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  328   FQCLNPSSRRRPKIRLVAAELDRILETEMSLTTIMGDGTAIITLGSQLFTS  378



>dbj|BAJ92598.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   381 bits (978),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 246/351 (70%), Gaps = 11/351 (3%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLI  1190
             NR S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QAT NF E+NL+
Sbjct  37    NRTSETGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQATNNFSEANLV  89

Query  1189  GCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQ  1010
             G GSFGLV+KG LFDG++VAIK R   PR +F++EV RLS   HRN+V L+GYCQE G Q
Sbjct  90    GAGSFGLVYKGLLFDGSVVAIKRRMGAPRLEFADEVRRLSEICHRNIVTLIGYCQEGGLQ  149

Query  1009  ILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKT  830
             +LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   PP++H NFKT
Sbjct  150   MLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLMPPLIHKNFKT  209

Query  829   GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYG  650
              NVLVDENFI KVADAG+  L +   H+  G SH    S + DPE +    FSE+SD+Y 
Sbjct  210   SNVLVDENFIAKVADAGLVRLFR--GHEDIGSSHGFSSSVYQDPEAHSVAQFSESSDVYS  267

Query  649   FGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLA  470
             FGVFL ELITG+EAA+++   S +++  W+EAH SS++L++ RL G ++ EGM++ + LA
Sbjct  268   FGVFLLELITGKEAANLQPPESRESLAHWLEAHFSSNELIDPRLGGGFTTEGMKEFVGLA  327

Query  469   MRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              +C +   + RP M +VA E +RILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  328   FQCLNPSSRRRPKMRLVAAELDRILETEMSLTTIMGDGTAIITLGSQLFTS  378



>gb|EYU43917.1| hypothetical protein MIMGU_mgv1a023031mg, partial [Erythranthe 
guttata]
Length=343

 Score =   375 bits (964),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 230/315 (73%), Gaps = 12/315 (4%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             N++S+TASSDPSA    K GG          G P  A+ FR++ELEQAT++F+ESNLIGC
Sbjct  41    NKDSETASSDPSAAETAKRGG----------GGPHEAKQFRIEELEQATRHFNESNLIGC  90

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FGLVFKG L DGT+VAIK R+ PPRQ+F EEVA LS  +HRNLV LLGYCQE G Q+L
Sbjct  91    GIFGLVFKGLLSDGTVVAIKRRNGPPRQEFVEEVANLSEIRHRNLVALLGYCQERGCQML  150

Query  1003  VLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGN  824
             V EYLPNG+MC+HLY  G+ S TKLEFKQR+SIA G AKGL HLHG  PP++HGNF+T N
Sbjct  151   VFEYLPNGSMCSHLYDTGKSSITKLEFKQRMSIAIGAAKGLSHLHGLRPPLIHGNFRTAN  210

Query  823   VLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFG  644
             VLVDENFI KVADAG+  LL+ I  + A  S +   + F DPE+ Q GV  E +DIY FG
Sbjct  211   VLVDENFIAKVADAGVLKLLERI--EDASSSSTSSFNAFKDPELGQHGVLHETNDIYSFG  268

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMR  464
             +FL EL++G+EA +     SN T LQWV+  +SS++LV+HRL G ++ EGMRD I++ + 
Sbjct  269   IFLLELLSGKEATYQEAFRSNDTTLQWVQEEISSNNLVDHRLSGSFTEEGMRDFIKIMIP  328

Query  463   CTSFPGKERPNMDMV  419
             C SFP  +RP M+ V
Sbjct  329   CVSFPSADRPRMEYV  343



>gb|EEC79088.1| hypothetical protein OsI_19707 [Oryza sativa Indica Group]
Length=378

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 241/348 (69%), Gaps = 12/348 (3%)
 Frame = -2

Query  1357  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  1187
             NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39    NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92    LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152   LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+  LL+   ++  GPSH    S + DPEV     FSE+SD+Y F
Sbjct  212   NVLVDENFIAKVADAGLVRLLR--GYEDVGPSHGFSSSVYQDPEVQSVLQFSESSDVYSF  269

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL ELITGREAA +    S +++ QW+E H SS++L++ RL   +++EGM++ + L  
Sbjct  270   GVFLLELITGREAACLISPDSRESLAQWIEGHFSSNELIDPRLGANFTSEGMKEFVGLTF  329

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             +C +   + RP M +VA E +RILE E+  +T MG+ +A +TLGS LF
Sbjct  330   QCLTPSSRRRPKMRLVATELDRILETEMSLTTIMGDGTAIITLGSTLF  377



>ref|XP_010231482.1| PREDICTED: probable receptor-like protein kinase At2g39360 [Brachypodium 
distachyon]
Length=380

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 242/349 (69%), Gaps = 11/349 (3%)
 Frame = -2

Query  1357  NSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIGC  1184
              S+T SSDPS  VE   GG  SS        PE  GAR F ++EL QAT NF E+NL+G 
Sbjct  41    TSETGSSDPSTLVEWGKGGRSSS-------APEHQGARHFPLEELAQATNNFSEANLVGA  93

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             GSFGLV+KG L DG++VAIK R   PR +F+EEV RLS   HRN+V L+GYCQE G Q+L
Sbjct  94    GSFGLVYKGLLLDGSVVAIKRRMGAPRHEFAEEVRRLSEISHRNIVTLIGYCQEGGLQML  153

Query  1003  VLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGN  824
             V EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH    P++H NFKT N
Sbjct  154   VYEYSPNGNVCSHLYDTGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLVHPLIHKNFKTSN  213

Query  823   VLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFG  644
             VLVDENFI KVAD G+  LL+   +D  GPS     S + DPE +    FSE+SD+Y FG
Sbjct  214   VLVDENFIAKVADYGLVGLLR--GYDDVGPSQGFTSSVYQDPEAHSVAQFSESSDVYSFG  271

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMR  464
             VFL ELITGREAA +    S +++  W+EAH SS++L++ RL G +++EGM++ + LA +
Sbjct  272   VFLLELITGREAARLAPPESRESLAHWLEAHFSSNELIDPRLGGGFTSEGMKEFVGLAFQ  331

Query  463   CTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             C +   + RP M +VAVE +RILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  332   CLNPSCRRRPKMRLVAVELDRILETEMSLTTIMGDGTAIITLGSQLFTS  380



>gb|EEE63486.1| hypothetical protein OsJ_18302 [Oryza sativa Japonica Group]
Length=378

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 240/348 (69%), Gaps = 12/348 (3%)
 Frame = -2

Query  1357  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  1187
             NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39    NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92    LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152   LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+  LL+   ++   PSH    S + DPEV     FSE+SD+Y F
Sbjct  212   NVLVDENFIAKVADAGLVRLLR--GYEDVSPSHGFSSSVYQDPEVQSVLQFSESSDVYSF  269

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL ELITGREAA +    S +++ QW+E H SS++L++ RL   +++EGM++ + L  
Sbjct  270   GVFLLELITGREAACLISPDSRESLAQWIEGHFSSNELIDPRLGANFTSEGMKEFVGLTF  329

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             +C +   + RP M +VA E +RILE E+  +T MG+ +A +TLGS LF
Sbjct  330   QCLTPSSRRRPKMRLVATELDRILETEMSLTTIMGDGTAIITLGSTLF  377



>ref|XP_009382558.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=379

 Score =   370 bits (950),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 242/350 (69%), Gaps = 9/350 (3%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +N++S+T SSDPS  VE      +SS      G    AR F ++ELE+ATKNF ESNL+G
Sbjct  38    ANKSSETGSSDPSTLVEWNRRDRISS-----SGCGRSARQFTLEELEEATKNFSESNLVG  92

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R + PRQ+F EEV  LS  +HRNLV L+GYC+E G Q+
Sbjct  93    TGSFGLVYKGLLLDGTLVAIKRRVSVPRQKFVEEVEILSEIRHRNLVTLIGYCEEGGLQM  152

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV EYLPNG +  HLY   + S ++LEFKQRL+IA G AKGL HLH   PP+VH +FKT 
Sbjct  153   LVFEYLPNGGVSRHLYDGEQHSLSRLEFKQRLAIAIGAAKGLAHLHSLAPPLVHKDFKTN  212

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+  L++       GP  S   S F DPEV + G FSEASD+Y F
Sbjct  213   NVLVDENFIAKVADAGLHKLVQ--GSGEIGPQGS--SSIFQDPEVGELGGFSEASDVYSF  268

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL E I+G E AH   L S+  + QWVEAH  S+DL++ RL   +++EGM++LI L +
Sbjct  269   GVFLLEFISGMEVAHCFSLDSHSFLAQWVEAHAGSNDLIDRRLSNAFTSEGMKELIALTL  328

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             RC +  G  RP M  +AVE ++ILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  329   RCLNPSGHNRPKMRAIAVELDQILETEMALTTVMGDGTAIVTLGSQLFTS  378



>ref|XP_009382559.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   369 bits (947),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 242/350 (69%), Gaps = 9/350 (3%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +N++S+T SSDPS  VE      +SS      G    AR F ++ELE+ATKNF ESNL+G
Sbjct  36    ANKSSETGSSDPSTLVEWNRRDRISS-----SGCGRSARQFTLEELEEATKNFSESNLVG  90

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R + PRQ+F EEV  LS  +HRNLV L+GYC+E G Q+
Sbjct  91    TGSFGLVYKGLLLDGTLVAIKRRVSVPRQKFVEEVEILSEIRHRNLVTLIGYCEEGGLQM  150

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV EYLPNG +  HLY   + S ++LEFKQRL+IA G AKGL HLH   PP+VH +FKT 
Sbjct  151   LVFEYLPNGGVSRHLYDGEQHSLSRLEFKQRLAIAIGAAKGLAHLHSLAPPLVHKDFKTN  210

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+  L++       GP  S   S F DPEV + G FSEASD+Y F
Sbjct  211   NVLVDENFIAKVADAGLHKLVQ--GSGEIGPQGS--SSIFQDPEVGELGGFSEASDVYSF  266

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAM  467
             GVFL E I+G E AH   L S+  + QWVEAH  S+DL++ RL   +++EGM++LI L +
Sbjct  267   GVFLLEFISGMEVAHCFSLDSHSFLAQWVEAHAGSNDLIDRRLSNAFTSEGMKELIALTL  326

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             RC +  G  RP M  +AVE ++ILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  327   RCLNPSGHNRPKMRAIAVELDQILETEMALTTVMGDGTAIVTLGSQLFTS  376



>ref|XP_006654321.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=379

 Score =   367 bits (943),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 241/347 (69%), Gaps = 11/347 (3%)
 Frame = -2

Query  1357  NSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIGC  1184
             +S+T SSDPS  VE   GG  SSLA      PE  GAR F + EL QATKNF E+NL+G 
Sbjct  41    SSETGSSDPSTLVEWGKGGR-SSLA------PEHQGARQFSLDELAQATKNFSEANLVGV  93

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             GSFGLV+KG L DG++VAIK R    RQ F+EEV +LS   HRN+V L+GYCQE G Q+L
Sbjct  94    GSFGLVYKGLLLDGSVVAIKKRIGAQRQDFAEEVRKLSEITHRNIVTLVGYCQEGGLQML  153

Query  1003  VLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGN  824
             V EY+PNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT N
Sbjct  154   VSEYVPNGSVSGHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTSN  213

Query  823   VLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFG  644
             VLVDENFI KVADAG++ LL+   ++ AGPSH    S + DPE+     FSE+SD+Y FG
Sbjct  214   VLVDENFIAKVADAGLARLLR--GYEDAGPSHGFSSSVYQDPELQSVMQFSESSDVYSFG  271

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMR  464
             VFL ELITGREAA +    S +++  W+E H SS +L++ RL   +++EGM++ + L  +
Sbjct  272   VFLLELITGREAACLISPDSRESLAHWIEGHFSSSELIDPRLGANFTSEGMKEFVGLTFQ  331

Query  463   CTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             C +   + RP M +VA E +RILE E+  +T MG+ +A +TLGS LF
Sbjct  332   CLNPSSRRRPKMRLVATELDRILETEMSLTTIMGDGTAIITLGSTLF  378



>ref|XP_009411699.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411700.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=383

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 241/357 (68%), Gaps = 4/357 (1%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             +L  +  +N++S+T SSDPS PVE      +S          +GAR F ++ELE+ATKNF
Sbjct  30    ILCCRTPANKSSETGSSDPSNPVEWGRRDRISCAGCGLASEHQGARQFTLEELEEATKNF  89

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              ESN++G GSFGLV+KG L DGTIVAIK R + PRQ F E+V  LS  +HRNLV L+GYC
Sbjct  90    SESNIVGTGSFGLVYKGLLLDGTIVAIKRRVSVPRQAFIEQVKILSEIRHRNLVTLIGYC  149

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE G Q+LV EYLPNG++ NHLY   + S T+LEFKQRL++A G AKGL HLH   PP+V
Sbjct  150   QEGGLQMLVFEYLPNGSVSNHLYDSEQHSLTRLEFKQRLAVAIGAAKGLAHLHSLSPPLV  209

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDENFI KVADAG   LL+       GP  S   + F DP V +   FSE
Sbjct  210   HQDFKTSNVLVDENFIAKVADAGFFKLLQ--GSGEVGPQGS--SNIFQDPGVGELQGFSE  265

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMR  488
             ASDIY FGVFL ELI+G E  H     S   ++QWVEAH+ S+DL++ RL   +++EGM+
Sbjct  266   ASDIYSFGVFLLELISGIEVTHCISQDSYSFLVQWVEAHMGSNDLIDRRLESGFTSEGMK  325

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             +LI L  +C +     RP M  V VE +RILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  326   ELIALTFQCLNPSEHSRPKMRAVVVELDRILETEMALTTVMGDGTAIVTLGSQLFTS  382



>ref|XP_004962281.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Setaria italica]
Length=382

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 245/346 (71%), Gaps = 5/346 (1%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             SDT SSDPS  VE   GG  SSLA       + AR F ++EL QATKNF ++N++G GSF
Sbjct  42    SDTGSSDPSTLVEWGKGGR-SSLAPEPETEHQVARQFSLEELVQATKNFSDANIVGAGSF  100

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             GLV+ G L DGTIVAIK R    RQ+F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  101   GLVYMGLLLDGTIVAIKRRVGAARQEFADEVRWLSEIRHRNVVTLIGYCQEGGLQMLVYE  160

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             YLPNG++C HLYG G  S+ +LEFKQRLSIA G AKGL HLH +  P++H NFKT NVLV
Sbjct  161   YLPNGSVCGHLYGKG--STARLEFKQRLSIAIGAAKGLNHLHSRDVPLIHKNFKTNNVLV  218

Query  814   DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFL  635
             DENFI KVADAG+  LL+    D AGPSH    S + DPEV     FSE+SD+Y FGVFL
Sbjct  219   DENFIAKVADAGLVRLLR--GSDEAGPSHGFSSSVYQDPEVQSVAQFSESSDVYSFGVFL  276

Query  634   WELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTS  455
              ELITGREAA +    S + +  W+EAH SS++L++ RL G +++EGM++L+ LA +C +
Sbjct  277   LELITGREAASLMPPESREYLAHWMEAHFSSNELIDPRLGGSFTSEGMKELVGLAFQCLN  336

Query  454   FPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
                + RP M +VA E +RILE E+  +T MG+ +A +TLGSQLFT+
Sbjct  337   PSSRRRPRMRLVATELDRILETEMSMTTFMGDGTAIVTLGSQLFTS  382



>ref|XP_006855470.1| hypothetical protein AMTR_s00057p00187090 [Amborella trichopoda]
 gb|ERN16937.1| hypothetical protein AMTR_s00057p00187090 [Amborella trichopoda]
Length=373

 Score =   361 bits (927),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 246/361 (68%), Gaps = 21/361 (6%)
 Frame = -2

Query  1390  MLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKN  1211
               L  K  +NRNS+T SSDPSA  ++   G +              R F ++EL QATK+
Sbjct  29    FFLHRKSSANRNSETGSSDPSA--QEWNKGTM--------------RQFTLEELGQATKH  72

Query  1210  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  1031
             F ESNLIG G FGLVFKG L DGT+VAIK RS+  R +F EEV  LS  +HRNLV+LLGY
Sbjct  73    FSESNLIGEGRFGLVFKGLLRDGTVVAIKRRSSAARPEFVEEVHYLSEIRHRNLVSLLGY  132

Query  1030  CQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPV  851
             CQE   Q+LV EYLPNG++ +HLY  G D +TKLEFK RL IA G AKGL HLHG  PP+
Sbjct  133   CQEYDQQMLVYEYLPNGSVSSHLYDTGLDPTTKLEFKYRLFIALGAAKGLSHLHGMAPPL  192

Query  850   VHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFS  671
             VH +FKT NVLVDENFI KVAD G+S LL+ I  D A  S   +   F+DPEV  +G FS
Sbjct  193   VHKDFKTSNVLVDENFIAKVADVGLSRLLERI--DEASSSRVTRGDVFLDPEVGDAGSFS  250

Query  670   EASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSA  500
             E+SD+Y FGVFL EL+TGR+A  ++   S +++ +WVE+ + S++   +V+ RL   Y+ 
Sbjct  251   ESSDVYSFGVFLLELVTGRQAGSLKLSESVRSLYEWVESCVESNEYGSIVDPRLGPGYTK  310

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFT  320
             EGM +L RL +RC S  G  RP M+ V+ E +RILE+E+  +T MGE +AT+TLGSQLFT
Sbjct  311   EGMGNLFRLILRCLSLNGGRRPAMEQVSTELDRILEEEMTLTTVMGEGTATVTLGSQLFT  370

Query  319   N  317
             +
Sbjct  371   S  371



>ref|XP_006645295.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Oryza brachyantha]
Length=380

 Score =   362 bits (928),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 236/347 (68%), Gaps = 9/347 (3%)
 Frame = -2

Query  1351  DTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIGCGS  1178
             DT SS+ + P   + G    +L+      PE  GAR F ++EL  ATKNF E+NL+G GS
Sbjct  41    DTGSSETTPPALVEWGRCGRTLS-----APEYQGARQFSLEELAHATKNFGEANLVGAGS  95

Query  1177  FGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVL  998
             FG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G Q+LV 
Sbjct  96    FGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGGLQMLVF  155

Query  997   EYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVL  818
             EYLPNG++C HLY  G++S T+LEFKQRLSIA G AKGL HLH   PP++H  FKT NVL
Sbjct  156   EYLPNGSVCGHLYDTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKGFKTSNVL  215

Query  817   VDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVF  638
             VDENFI KVADAGI  LL+    D  G   S   S + DPEV+     SE+SD+Y F VF
Sbjct  216   VDENFIAKVADAGIDRLLR--GFDGGGAPSSCSSSIYQDPEVHSLSQLSESSDVYSFAVF  273

Query  637   LWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCT  458
             L ELITG+EAA +      + +  W+EAH SS++L + RL G +++EGM++L+ L  +C 
Sbjct  274   LLELITGKEAASLISSEQREPLAHWMEAHFSSNELTDPRLGGSFTSEGMKELVGLTSQCL  333

Query  457   SFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             S   + RP M ++A E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  334   STSARRRPRMRLIAAELDRILEKEMTLTTVMGDGTAIVTLGSQLFTS  380



>ref|NP_001140481.1| LOC100272541 [Zea mays]
 gb|ACF83917.1| unknown [Zea mays]
 gb|AFW77618.1| putative transmembrane protein kinase family protein [Zea mays]
Length=381

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 240/346 (69%), Gaps = 5/346 (1%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             SDT SSDPS  VE   GG  S   LA     + AR F +++L QATKNF ++N+IG GSF
Sbjct  41    SDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATKNFSDTNIIGAGSF  97

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             GLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  98    GLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIGYCQEGGLQMLVYE  157

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             YLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP++H +FKT NVLV
Sbjct  158   YLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPPLIHKDFKTNNVLV  217

Query  814   DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFL  635
             DENFI KVADAG+  L++    D AGPS     S + DPEV     FSE+SD+Y FGVFL
Sbjct  218   DENFIAKVADAGLVRLIR--GSDDAGPSRGFSNSVYQDPEVQSMTQFSESSDVYSFGVFL  275

Query  634   WELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTS  455
              ELITGREAA +    S + +  W+EAH SS++L++ RL G ++AEGM++L+ LA +C +
Sbjct  276   LELITGREAASLIPTESREYLAHWMEAHFSSNELIDPRLAGNFTAEGMKELVGLAFQCLN  335

Query  454   FPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
                + RP M +VA E +RILE E+  +T MG+ +  +TLGSQLF++
Sbjct  336   PSSRRRPRMRLVATELDRILETEMSMTTFMGDGTTIVTLGSQLFSS  381



>gb|EAZ14756.1| hypothetical protein OsJ_04683 [Oryza sativa Japonica Group]
Length=384

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 241/356 (68%), Gaps = 13/356 (4%)
 Frame = -2

Query  1366  SNRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESN  1196
             S RNSDT SS+ P   VE    G   S        PE  GAR F ++EL  ATKNF ++N
Sbjct  36    SRRNSDTGSSETPPTLVEWGRCGRTLS-------APEYQGARQFSLEELAHATKNFSDAN  88

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G
Sbjct  89    LVGAGSFGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGG  148

Query  1015  YQILVLEYLPNGTMCNHLYG-MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
              Q+LV EYLPNG++C HLY   G++S T+LEFKQRLSIA G AKGL HLH   PP++H  
Sbjct  149   LQMLVFEYLPNGSVCGHLYANTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKG  208

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEAS  662
             FKT NVLVDENFI KVADAGI  LL+  +  A     S   S  + DPEV+     SE+S
Sbjct  209   FKTSNVLVDENFIAKVADAGIDRLLRGFDGAAPSHHPSSSCSSIYQDPEVHSLAQLSESS  268

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS-DDLVEHRLMGKYSAEGMRD  485
             D+Y FGVFL ELITG+EAA +      + ++ W+E+H SS +++ + RL G +++EGM++
Sbjct  269   DVYSFGVFLLELITGKEAASLISSEPREPLVHWMESHFSSNNEVTDPRLGGSFTSEGMKE  328

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             L+ L ++C S   + RP M ++A E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  329   LVGLTLQCVSTSARRRPKMRLIAAELDRILEKEMSLTTVMGDGTAIVTLGSQLFTS  384



>gb|EAY77133.1| hypothetical protein OsI_05098 [Oryza sativa Indica Group]
Length=384

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 241/356 (68%), Gaps = 13/356 (4%)
 Frame = -2

Query  1366  SNRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESN  1196
             S RNSDT SS+ P   VE    G   S        PE  GAR F ++EL  ATKNF ++N
Sbjct  36    SRRNSDTGSSETPPTLVEWGRCGRTLS-------APEYQGARQFSLEELAHATKNFSDAN  88

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             L+G GSFG V+KG L DGT+VA+K R A PRQ F +EV RLS   HRN+V L+GYCQE G
Sbjct  89    LVGAGSFGPVYKGLLLDGTVVAVKRRVASPRQDFVDEVKRLSEIWHRNVVTLIGYCQEGG  148

Query  1015  YQILVLEYLPNGTMCNHLYG-MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
              Q+LV EYLPNG++C HLY   G++S T+LEFKQRLSIA G AKGL HLH   PP++H  
Sbjct  149   LQMLVFEYLPNGSVCGHLYADTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKG  208

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEAS  662
             FKT NVLVDENFI KVADAGI  LL+  +  A     S   S  + DPEV+     SE+S
Sbjct  209   FKTSNVLVDENFIAKVADAGIDRLLRGFDGAAPSHHPSSSCSSIYQDPEVHSLAQLSESS  268

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS-DDLVEHRLMGKYSAEGMRD  485
             D+Y FGVFL ELITG+EAA +      + ++ W+E+H SS +++ + RL G +++EGM++
Sbjct  269   DVYSFGVFLLELITGKEAASLISSEPREPLVHWMESHFSSNNEVTDPRLGGSFTSEGMKE  328

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             L+ L ++C S   + RP M ++A E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  329   LVGLTLQCVSTSARRRPKMRLIAAELDRILEKEMSLTTVMGDGTAIVTLGSQLFTS  384



>gb|ACG32823.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
Length=381

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 239/346 (69%), Gaps = 5/346 (1%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             SDT SSDPS  VE   GG  S   LA     + AR F +++L QATKNF ++N+IG GSF
Sbjct  41    SDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATKNFSDTNIIGAGSF  97

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             GLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  98    GLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIGYCQEGGLQMLVYE  157

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             YLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP++H +FKT NVLV
Sbjct  158   YLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPPLIHKDFKTNNVLV  217

Query  814   DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFL  635
             DENFI KVAD G+  L++    D AGPS     S + DPEV     FSE+SD+Y FGVFL
Sbjct  218   DENFIAKVADPGLVRLIR--GSDDAGPSRGFSNSVYQDPEVQSMTQFSESSDVYSFGVFL  275

Query  634   WELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTS  455
              ELITGREAA +    S + +  W+EAH SS++L++ RL G ++AEGM++L+ LA +C +
Sbjct  276   LELITGREAASLIPTESREYLAHWMEAHFSSNELIDPRLAGNFTAEGMKELVGLAFQCLN  335

Query  454   FPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
                + RP M +VA E +RILE E+  +T MG+ +  +TLGSQLF++
Sbjct  336   PSSRRRPRMRLVATELDRILETEMSMTTFMGDGTTIVTLGSQLFSS  381



>ref|XP_004971193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=379

 Score =   351 bits (901),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 242/351 (69%), Gaps = 16/351 (5%)
 Frame = -2

Query  1357  NSDTASSDPSAPVEQKTG--GPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLI  1190
             +SDT SS  + P   + G  G  SS        PE  GAR F ++EL  ATKNF E+NL+
Sbjct  41    SSDTGSSSEAPPTLAEWGRCGRTSS-------APEFHGARQFSLEELAHATKNFAEANLV  93

Query  1189  GCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQ  1010
             G GSFGLV+KG L DGT+VA+K R+   RQ F++E+ RLS   HRN+V L+GYCQE G Q
Sbjct  94    GAGSFGLVYKGLLLDGTVVAVKRRTGAARQDFADEIRRLSEIWHRNVVTLIGYCQEGGLQ  153

Query  1009  ILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKT  830
             +LV EYLPNG++  HLY  G++S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT
Sbjct  154   MLVFEYLPNGSVNGHLYDTGKESMTRLEFKQRLSIAIGAAKGLNHLHTLAPPLIHRDFKT  213

Query  829   GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYG  650
              NVLVDENFI KV+DAGI  L++ +  + A PS+    S + DP+ +     SE+SD+Y 
Sbjct  214   SNVLVDENFIAKVSDAGIDRLMRGL--EGATPSNG---SVYQDPQAHSLAQLSESSDVYS  268

Query  649   FGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLA  470
             FGVFL ELITGREAA +    S ++   W+EA  +S++L++ RL G +++EGM +L+ LA
Sbjct  269   FGVFLLELITGREAAALIPPESKESFAHWMEAQFTSNELIDPRLGGSFTSEGMTELVGLA  328

Query  469   MRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              +C +   + RP M +VA E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  329   FQCLNPSARRRPRMRLVAAELDRILEKEMTLTTVMGDGTAIVTLGSQLFTS  379



>ref|XP_002459059.1| hypothetical protein SORBIDRAFT_03g045200 [Sorghum bicolor]
 gb|EES04179.1| hypothetical protein SORBIDRAFT_03g045200 [Sorghum bicolor]
Length=379

 Score =   351 bits (900),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 224/314 (71%), Gaps = 3/314 (1%)
 Frame = -2

Query  1258  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  1079
             GAR F ++EL  AT NF E+NL+G G FGLV+KG L DGT+VAIK R+  PRQ FS+E+ 
Sbjct  69    GARQFSLEELAHATHNFAEANLVGAGGFGLVYKGLLLDGTVVAIKRRAGAPRQDFSDEIR  128

Query  1078  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  899
             RLS   HRN+V L+GYCQ+ G Q+LV EYLPNG++  HLY  G++S T+LEFKQRLSIA 
Sbjct  129   RLSEIWHRNVVTLIGYCQDGGLQMLVFEYLPNGSVSGHLYDTGKESMTRLEFKQRLSIAI  188

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+  N  AA P  +  
Sbjct  189   GAAKGLNHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIDRLLRGFN-GAATP--AAN  245

Query  718   PSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD  539
                F DPEV+     SE+SD+Y FGVFL ELITGREAA +    SN +  Q +EA  SS+
Sbjct  246   GGVFQDPEVHSLAQLSESSDVYSFGVFLLELITGREAAGLIPPESNDSFAQLMEARFSSN  305

Query  538   DLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGE  359
             +LV+ RL G +++EGM +++ LA  C S   + RP M +VA E +RILEKE+  +T MG+
Sbjct  306   ELVDPRLGGSFTSEGMAEVVGLAFHCLSTSARRRPRMRLVAAELDRILEKEMTLTTVMGD  365

Query  358   ASATLTLGSQLFTN  317
              +A +TLGSQLFT+
Sbjct  366   GTAIVTLGSQLFTS  379



>ref|XP_008656889.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Zea mays]
 gb|AFW84023.1| putative transmembrane protein kinase family protein [Zea mays]
Length=391

 Score =   333 bits (855),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 224/320 (70%), Gaps = 8/320 (3%)
 Frame = -2

Query  1258  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  1079
             GAR F ++EL  AT  F E+NL+G G+FGLV+KG L DGT+VAIK R+  PRQ F+ E+ 
Sbjct  74    GARQFSLEELAHATNGFAEANLVGAGAFGLVYKGLLLDGTVVAIKRRAGAPRQDFANEIR  133

Query  1078  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  899
             RLS   HRN+V L+G+CQE G Q+LV EYLPN ++  HLY  G+++ T+LEFKQRLSIA 
Sbjct  134   RLSEIWHRNVVTLIGFCQEGGLQMLVFEYLPNASVSGHLYDTGKETMTRLEFKQRLSIAI  193

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+    D    +    
Sbjct  194   GAAKGLSHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIHRLLR--GPDGGAVAALAS  251

Query  718   PSPFIDPEVNQSGVF----SEASDIYGFGVFLWELITGREAAHIRGLGSNQ-TMLQWVEA  554
                F DPEV+ S       +E+SD+Y FGVFL EL+TGREAA +   GS++ ++ QW+EA
Sbjct  252   RGVFQDPEVHSSAQAQLSETESSDVYSFGVFLLELVTGREAAGLMPPGSSKDSLAQWMEA  311

Query  553   HLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
               +S++LV+ RL G +++EGM +++ LA  C S   + RP M +VA E +RILEKE+  +
Sbjct  312   RFASNELVDPRLGGSFTSEGMAEVVGLASSCLSPSARRRPRMRLVAAELDRILEKEMALT  371

Query  373   TAMGE-ASATLTLGSQLFTN  317
             T MG+  +A +TLGSQLFT+
Sbjct  372   TVMGDGGTAIVTLGSQLFTS  391



>ref|XP_010249313.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Nelumbo nucifera]
Length=387

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 234/363 (64%), Gaps = 14/363 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATK  1214
             L+  R  +R S+T SSD S  V     G  S + L+   +P     AR F M+EL  ATK
Sbjct  30    LSQNRSISRPSETGSSDQSVQV-----GRTSRVELSLRPLPPDSREARRFLMEELALATK  84

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             +F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV+LLG
Sbjct  85    DFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLVSLLG  144

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             YCQEN  Q+L+ EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL HLH   P 
Sbjct  145   YCQENDQQMLIYEYIPNGSVSSHLYGTGQVSGERLEFKHRLSIAMGAAKGLAHLHSLSPR  204

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGV  677
             ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PEV +   
Sbjct  205   LIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPEVREFRR  262

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKY  506
             FSE SD+Y FGVFL EL++G EA   R   S + M++W   +  S +   +++ RL   +
Sbjct  263   FSEKSDVYSFGVFLLELVSGHEAMQSRSSESGRNMVEWAHNYDDSSNISTIIDQRLGNSF  322

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM++ I+L +RC     + R  M  V  E +RILEKE+  +T MGE + T+TLGSQL
Sbjct  323   TTEGMKEFIQLTVRCVDPSRERRLTMSYVVGELDRILEKEMSLTTIMGEGTTTVTLGSQL  382

Query  325   FTN  317
             FT+
Sbjct  383   FTS  385



>ref|XP_008656888.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Zea mays]
Length=405

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 224/320 (70%), Gaps = 8/320 (3%)
 Frame = -2

Query  1258  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  1079
             GAR F ++EL  AT  F E+NL+G G+FGLV+KG L DGT+VAIK R+  PRQ F+ E+ 
Sbjct  88    GARQFSLEELAHATNGFAEANLVGAGAFGLVYKGLLLDGTVVAIKRRAGAPRQDFANEIR  147

Query  1078  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  899
             RLS   HRN+V L+G+CQE G Q+LV EYLPN ++  HLY  G+++ T+LEFKQRLSIA 
Sbjct  148   RLSEIWHRNVVTLIGFCQEGGLQMLVFEYLPNASVSGHLYDTGKETMTRLEFKQRLSIAI  207

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             G AKGL HLH   PP++H +FKT NVLVDENFI KV+DAGI  LL+    D    +    
Sbjct  208   GAAKGLSHLHSLAPPLIHRDFKTSNVLVDENFIAKVSDAGIHRLLR--GPDGGAVAALAS  265

Query  718   PSPFIDPEVNQSGVF----SEASDIYGFGVFLWELITGREAAHIRGLGSNQ-TMLQWVEA  554
                F DPEV+ S       +E+SD+Y FGVFL EL+TGREAA +   GS++ ++ QW+EA
Sbjct  266   RGVFQDPEVHSSAQAQLSETESSDVYSFGVFLLELVTGREAAGLMPPGSSKDSLAQWMEA  325

Query  553   HLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
               +S++LV+ RL G +++EGM +++ LA  C S   + RP M +VA E +RILEKE+  +
Sbjct  326   RFASNELVDPRLGGSFTSEGMAEVVGLASSCLSPSARRRPRMRLVAAELDRILEKEMALT  385

Query  373   TAMGE-ASATLTLGSQLFTN  317
             T MG+  +A +TLGSQLFT+
Sbjct  386   TVMGDGGTAIVTLGSQLFTS  405



>ref|XP_009420340.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   331 bits (849),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 231/350 (66%), Gaps = 23/350 (7%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R+SDT SS+ S   EQ       ++ LA     +GARVF ++EL+ ATK+F   NLIG G
Sbjct  38    RSSDTNSSELSVQEEQ-------TIELA----FQGARVFTLKELDAATKDFSNINLIGYG  86

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V KGFL DGTIVAIK R + P Q+F EEV  LS  +HRNLV LLGYCQEN  Q+LV
Sbjct  87    MFGEVNKGFLQDGTIVAIKRRVSAPSQEFIEEVCYLSSIRHRNLVRLLGYCQENDLQMLV  146

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY+ NG++  HLYG  +  S KLEFK RLSIA G AKG+ HLH   PP+VH NFKT NV
Sbjct  147   YEYVSNGSVSTHLYGGNQVLSRKLEFKHRLSIAHGAAKGMVHLHSLNPPLVHMNFKTTNV  206

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGVFSEASDIYGFG  644
             LVDE+FIPKVADAG+  LL   N   A PS  +    PF DPEV +SG FS  SD+Y FG
Sbjct  207   LVDEDFIPKVADAGLRRLLNRTN--GASPSSRVTTDDPFHDPEVKESGGFSLKSDVYSFG  264

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAEGMRDLIRL  473
             VFL EL+ GR+        S+Q +++W + +  S D+   ++ R++  +++EGM++ +RL
Sbjct  265   VFLMELLCGRDVR------SDQRLIEWAQNYEDSIDISTVIDPRMVSSFTSEGMKEFLRL  318

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
                C +   + RP+MD V +E +RI EKE+  +T MGE + T+TLGSQLF
Sbjct  319   ITWCLNPSSERRPSMDYVEIELQRIREKELQLTTVMGEGTTTVTLGSQLF  368



>ref|XP_010249305.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249306.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249307.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249308.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249310.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249311.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010249312.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
Length=388

 Score =   331 bits (848),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 178/363 (49%), Positives = 234/363 (64%), Gaps = 13/363 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATK  1214
             L+  R  +R S+T SSD S     +  G  S + L+   +P     AR F M+EL  ATK
Sbjct  30    LSQNRSISRPSETGSSDQSV----QAVGRTSRVELSLRPLPPDSREARRFLMEELALATK  85

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             +F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV+LLG
Sbjct  86    DFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLVSLLG  145

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             YCQEN  Q+L+ EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL HLH   P 
Sbjct  146   YCQENDQQMLIYEYIPNGSVSSHLYGTGQVSGERLEFKHRLSIAMGAAKGLAHLHSLSPR  205

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGV  677
             ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PEV +   
Sbjct  206   LIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPEVREFRR  263

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKY  506
             FSE SD+Y FGVFL EL++G EA   R   S + M++W   +  S +   +++ RL   +
Sbjct  264   FSEKSDVYSFGVFLLELVSGHEAMQSRSSESGRNMVEWAHNYDDSSNISTIIDQRLGNSF  323

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM++ I+L +RC     + R  M  V  E +RILEKE+  +T MGE + T+TLGSQL
Sbjct  324   TTEGMKEFIQLTVRCVDPSRERRLTMSYVVGELDRILEKEMSLTTIMGEGTTTVTLGSQL  383

Query  325   FTN  317
             FT+
Sbjct  384   FTS  386



>ref|XP_010556327.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Tarenaya hassleriana]
Length=381

 Score =   330 bits (847),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 225/352 (64%), Gaps = 16/352 (5%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+TASSDPS   E+     +S            AR F M+EL QATK F   +LIG 
Sbjct  37    SRTSETASSDPSIQAERNVAIELS---------LREARRFEMEELAQATKGFTSKSLIGI  87

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG   DG +VAIK R+  P Q+F+ EV  LS   HRNLV LLGYCQEN  Q L
Sbjct  88    GKFGEVYKGLHQDGMLVAIKKRTRSPTQEFANEVRYLSSIHHRNLVTLLGYCQENNMQFL  147

Query  1003  VLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             V EY+PNG++ +HLYG  G+    KLEF+ RL+++ G AKGL HLH   P ++H +FKT 
Sbjct  148   VYEYVPNGSVSSHLYGDGGKGPGRKLEFRNRLTVSLGAAKGLAHLHSLSPRLIHKDFKTA  207

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+ +LL     D    S  +    F+ PEV +   FSE SD+Y F
Sbjct  208   NVLVDENFIAKVADAGLPNLLG--REDVGSSSQMVADKIFLAPEVQEFRRFSEKSDVYAF  265

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL----VEHRLMGKYSAEGMRDLI  479
             GVFL EL+TGREA+      S++T+++W++ ++ ++DL    ++ RL   Y+AEGM +L+
Sbjct  266   GVFLLELVTGREASEPSPSNSSRTLVEWMQNNMDNEDLSTAVIDERLGNSYTAEGMEELM  325

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             RL MRC     + RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  326   RLTMRCLQVSSERRPGMSYVVAELERILDKEVSLTTLMGEGTPTVTLGSQLF  377



>gb|EMT07740.1| Receptor-like protein kinase ANXUR1 [Aegilops tauschii]
Length=394

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/318 (52%), Positives = 221/318 (69%), Gaps = 6/318 (2%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR F ++E+  ATKNF ++NL+G G+FG V+ G L DGT+VAIK R   PRQ F +EV
Sbjct  80    QGARRFTLEEMSHATKNFSDANLVGAGTFGKVYMGLLLDGTVVAIKRRVGAPRQDFVDEV  139

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
              R S   HRN+V L+GYCQ+ G Q+LV E+LPNG++C HLY  G++S T+LEFKQRLSIA
Sbjct  140   RRQSEIWHRNVVTLIGYCQDGGLQMLVFEHLPNGSVCGHLYDTGKESMTRLEFKQRLSIA  199

Query  901   SGTAK--GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  728
              G AK  GL HLH   PP++H  FKT NVLVDENFI KV+DAG+  LL+ +  D   P +
Sbjct  200   IGAAKGGGLDHLHSLAPPLIHKGFKTSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLN  258

Query  727   SIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
               +   + DPE +     S +SD+Y FGVFL ELITGREAA +    S +++  W+EA  
Sbjct  259   GFRSGIYQDPEAHSLAQLSASSDVYSFGVFLLELITGREAASLVSPESTESLAHWLEA--  316

Query  547   SSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPG-KERPNMDMVAVEAERILEKEIMGST  371
             S D++ + RL G +++EGM++L+ L M+C S    + RP M +VA E +RILEKE+  +T
Sbjct  317   SGDEVADPRLGGSFTSEGMKELVGLTMQCLSPSAVRRRPKMRLVAAELDRILEKEMTLTT  376

Query  370   AMGEASATLTLGSQLFTN  317
              MG+ +A +TLGSQLFT+
Sbjct  377   VMGDGTAIITLGSQLFTS  394



>gb|KDP41870.1| hypothetical protein JCGZ_26888 [Jatropha curcas]
Length=380

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 178/371 (48%), Positives = 233/371 (63%), Gaps = 17/371 (5%)
 Frame = -2

Query  1423  VGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVF  1244
             VG  +F++     L+ K+  +R S+T SS+PS  V +  G  +S            AR F
Sbjct  19    VGIVIFLIW--FCLSRKKSVSRTSETGSSEPSIQVGRHVGVELSI---------REARRF  67

Query  1243  RMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMT  1064
              M+EL  ATKNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  LS  
Sbjct  68    EMEELSHATKNFSDKNLIGVGKFGEVYKGLLNDGMLVAIKKRPGAPSQEFVDEVRYLSPI  127

Query  1063  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  884
             QHRNLV LLGYCQEN  Q L+ EY+P+G++ +HLY  G+ S  KLEFK RL IA G AKG
Sbjct  128   QHRNLVTLLGYCQENNTQFLIYEYIPSGSVSSHLYAPGQVSDGKLEFKHRLPIALGAAKG  187

Query  883   LCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-F  707
             L HLH   P +VH +FKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F
Sbjct  188   LAHLHSLSPRLVHKDFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSSQVTADDIF  245

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDD  536
             + PEV +   FS+ SD++ FGVFL EL+ GREA       SNQ +++WV   + +     
Sbjct  246   LAPEVKEFRRFSDKSDVFSFGVFLLELLCGREATESPSPDSNQNLVEWVQNTQDYSEFSS  305

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             +V+ RL   ++AEGM + I+L +RC     + RP+M  V +E +RILEKE+  +T MGE 
Sbjct  306   IVDQRLGTSFTAEGMEEFIQLIVRCLEPSSERRPSMSYVVMELDRILEKEMSLTTVMGEG  365

Query  355   SATLTLGSQLF  323
             + T+TLGSQLF
Sbjct  366   TPTVTLGSQLF  376



>ref|XP_008778861.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Phoenix dactylifera]
Length=390

 Score =   328 bits (841),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 241/369 (65%), Gaps = 24/369 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPS-----APVEQKTGGPVSSLALARGGVP-----EGARVFRMQ  1235
             L   R  +R S+T SS+PS     + +   + G    L   RGGV      +GAR F+++
Sbjct  30    LLRNRGVSRTSETNSSEPSLQDQYSALLNFSAGQSIELPF-RGGVSYPPDFQGARCFKLE  88

Query  1234  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  1055
             EL  ATKNF   NLIG G FG V+KG L DG +VAIK R + P Q+F EEV  LS  +HR
Sbjct  89    ELSVATKNFSNINLIGYGMFGEVYKGLLHDG-MVAIKRRPSAPSQEFIEEVHFLSSIRHR  147

Query  1054  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  875
             NLV+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  
Sbjct  148   NLVSLLGYCQENNMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGV  207

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDP  698
             LH   PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DP
Sbjct  208   LHSLNPPLVHTNFKTANVLVDEDFIPKVADAGLRSLLDRI--DEAGPSSRMTTDDPFLDP  265

Query  697   EVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVE  527
             EV +SG FS  SD+Y FGVFL EL++GREA       S+Q++++  + +    +   LV+
Sbjct  266   EVKESGRFSVRSDVYSFGVFLLELVSGREAR------SDQSIIELAQKYQEPSNISTLVD  319

Query  526   HRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASAT  347
              R+   +++EGMR+ +RL   C +   + RP M+ V +E +RI EKE+  +T M E S T
Sbjct  320   QRMGSSFTSEGMREFLRLIAWCVNPSSQRRPPMNYVELELDRIHEKEMSLTTIMPEGSTT  379

Query  346   LTLGSQLFT  320
             +TLGSQLFT
Sbjct  380   VTLGSQLFT  388



>ref|XP_008778862.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Phoenix dactylifera]
Length=379

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 240/365 (66%), Gaps = 27/365 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALA-RGGVP-----EGARVFRMQELEQ  1223
             L   R  +R S+T SS+PS   +        S+ L  RGGV      +GAR F+++EL  
Sbjct  30    LLRNRGVSRTSETNSSEPSLQGQ--------SIELPFRGGVSYPPDFQGARCFKLEELSV  81

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF   NLIG G FG V+KG L DG +VAIK R + P Q+F EEV  LS  +HRNLV+
Sbjct  82    ATKNFSNINLIGYGMFGEVYKGLLHDG-MVAIKRRPSAPSQEFIEEVHFLSSIRHRNLVS  140

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  LH  
Sbjct  141   LLGYCQENNMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGVLHSL  200

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQ  686
              PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPEV +
Sbjct  201   NPPLVHTNFKTANVLVDEDFIPKVADAGLRSLLDRI--DEAGPSSRMTTDDPFLDPEVKE  258

Query  685   SGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLM  515
             SG FS  SD+Y FGVFL EL++GREA       S+Q++++  + +    +   LV+ R+ 
Sbjct  259   SGRFSVRSDVYSFGVFLLELVSGREAR------SDQSIIELAQKYQEPSNISTLVDQRMG  312

Query  514   GKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
               +++EGMR+ +RL   C +   + RP M+ V +E +RI EKE+  +T M E S T+TLG
Sbjct  313   SSFTSEGMREFLRLIAWCVNPSSQRRPPMNYVELELDRIHEKEMSLTTIMPEGSTTVTLG  372

Query  334   SQLFT  320
             SQLFT
Sbjct  373   SQLFT  377



>ref|XP_010556328.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Tarenaya hassleriana]
Length=380

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 227/352 (64%), Gaps = 17/352 (5%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+TASSDPS  ++++      SL          AR F M+EL QATK F   +LIG 
Sbjct  37    SRTSETASSDPS--IQERNVAIELSL--------REARRFEMEELAQATKGFTSKSLIGI  86

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG   DG +VAIK R+  P Q+F+ EV  LS   HRNLV LLGYCQEN  Q L
Sbjct  87    GKFGEVYKGLHQDGMLVAIKKRTRSPTQEFANEVRYLSSIHHRNLVTLLGYCQENNMQFL  146

Query  1003  VLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             V EY+PNG++ +HLYG  G+    KLEF+ RL+++ G AKGL HLH   P ++H +FKT 
Sbjct  147   VYEYVPNGSVSSHLYGDGGKGPGRKLEFRNRLTVSLGAAKGLAHLHSLSPRLIHKDFKTA  206

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+ +LL     D    S  +    F+ PEV +   FSE SD+Y F
Sbjct  207   NVLVDENFIAKVADAGLPNLLG--REDVGSSSQMVADKIFLAPEVQEFRRFSEKSDVYAF  264

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL----VEHRLMGKYSAEGMRDLI  479
             GVFL EL+TGREA+      S++T+++W++ ++ ++DL    ++ RL   Y+AEGM +L+
Sbjct  265   GVFLLELVTGREASEPSPSNSSRTLVEWMQNNMDNEDLSTAVIDERLGNSYTAEGMEELM  324

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             RL MRC     + RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  325   RLTMRCLQVSSERRPGMSYVVAELERILDKEVSLTTLMGEGTPTVTLGSQLF  376



>ref|XP_010909092.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=373

 Score =   325 bits (832),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 232/358 (65%), Gaps = 26/358 (7%)
 Frame = -2

Query  1360  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  1199
             R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31    RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83    NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
               Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH   PP+VH N
Sbjct  143   DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLHSLNPPLVHMN  202

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGVFSEAS  662
             FKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPEV +SG FS  S
Sbjct  203   FKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPEVKESGRFSVTS  260

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGM  491
             D+Y FGVFL EL++GREA       S+  +++  +++    +   LV+ R+   +++EGM
Sbjct  261   DVYSFGVFLMELVSGREAR------SDLHIIELAQSYQEPSNISTLVDQRMGSSFTSEGM  314

Query  490   RDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              + +RL   C +   + RP M+ V  E +RI EKE+  +T M E S T+TLGSQLFT 
Sbjct  315   SEFLRLIAWCLNPSSERRPPMNFVESELDRIREKEMSLTTIMPEGSTTVTLGSQLFTT  372



>ref|XP_009593052.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
 ref|XP_009593053.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
 ref|XP_009593054.1| PREDICTED: nodulation receptor kinase [Nicotiana tomentosiformis]
Length=380

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 225/355 (63%), Gaps = 15/355 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             KR  +R S+T SSDPS  V  KT G   +L          AR F+++EL  ATK F + +
Sbjct  33    KRSISRTSETGSSDPSIQV-GKTAGIELTL--------RDARRFQIEELSLATKGFSDKS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK RSA P Q+F +EV  LS  QHRNLV LLGYCQE+ 
Sbjct  84    LIGQGKFGEVYKGLLHDGMLVAIKRRSAVPSQEFIDEVRYLSSIQHRNLVTLLGYCQEHD  143

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P ++H +F
Sbjct  144   QQILVYEYIPNGSVSIHLYGDGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDF  203

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASD  659
             KT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PEV +   FSE SD
Sbjct  204   KTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPEVREFRRFSEKSD  261

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
              Y FGVFL EL++GREA  +     N  +++WVE +  S +   +++ RL   ++ EGM 
Sbjct  262   TYSFGVFLLELVSGREAMDLLSSDLNINIVEWVENYQESGNISAIIDQRLGNSFTTEGME  321

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             + ++L +RC     + RP M  V  E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  322   EFMQLTVRCMDPSSERRPTMSYVVTELDRILEKEMSLTTIMGEGTPVVTLGSQLF  376



>ref|XP_010249314.1| PREDICTED: putative serine/threonine-protein kinase isoform X3 
[Nelumbo nucifera]
Length=386

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/363 (49%), Positives = 233/363 (64%), Gaps = 15/363 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATK  1214
             L+  R  +R S+T SSD S     +  G  S + L+   +P     AR F M+EL  ATK
Sbjct  30    LSQNRSISRPSETGSSDQSV----QAVGRTSRVELSLRPLPPDSREARRFLMEELALATK  85

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             +F + NLIG G FG V+KG L DG +VAIK RS  P Q+F EEV  LS  +HRNLV+LLG
Sbjct  86    DFSDMNLIGEGKFGKVYKGLLHDGMVVAIKKRSGAPSQEFFEEVRSLSSIRHRNLVSLLG  145

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             YCQEN  Q+L+ EY+PNG++ +HLY  G+ S  +LEFK RLSIA G AKGL HLH   P 
Sbjct  146   YCQENDQQMLIYEYIPNGSVSSHLY--GQVSGERLEFKHRLSIAMGAAKGLAHLHSLSPR  203

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGV  677
             ++H +FKT NVLVDENFI K+ADAG+ +LL  +  DAAGPS  I     F+ PEV +   
Sbjct  204   LIHKDFKTSNVLVDENFIAKIADAGLRNLLGRV--DAAGPSSQIMADDIFLAPEVREFRR  261

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKY  506
             FSE SD+Y FGVFL EL++G EA   R   S + M++W   +  S +   +++ RL   +
Sbjct  262   FSEKSDVYSFGVFLLELVSGHEAMQSRSSESGRNMVEWAHNYDDSSNISTIIDQRLGNSF  321

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM++ I+L +RC     + R  M  V  E +RILEKE+  +T MGE + T+TLGSQL
Sbjct  322   TTEGMKEFIQLTVRCVDPSRERRLTMSYVVGELDRILEKEMSLTTIMGEGTTTVTLGSQL  381

Query  325   FTN  317
             FT+
Sbjct  382   FTS  384



>dbj|BAB90755.1| putative disease resistance protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY77080.1| hypothetical protein OsI_05040 [Oryza sativa Indica Group]
 gb|EAZ14713.1| hypothetical protein OsJ_04637 [Oryza sativa Japonica Group]
 dbj|BAH01248.1| unnamed protein product [Oryza sativa Japonica Group]
Length=364

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 211/317 (67%), Gaps = 11/317 (3%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT+NF   NLIG G FG V+KG L DGTIVAIK R +PP  +F  EV
Sbjct  53    QGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEV  112

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
               LS  +HRNLVNLLGYCQENG Q+LV EY+PNG++  HL+G       KLEFKQRLSIA
Sbjct  113   NYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIA  172

Query  901   SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  722
              G AKGL HLH   PP VH NFKT NVLVDE+ IPKVADAGI +LL  +     GPS   
Sbjct  173   HGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLG--GVGPSSRT  230

Query  721   QPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS  542
                PF+DP + +S  FS  SD+Y FGVFL EL++G+ A       S+Q +++WV+    S
Sbjct  231   SYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRAL------SDQNIIRWVQNFQQS  284

Query  541   DD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGST  371
              D   + ++R+   Y++EGMR+ +RL   C +   + RP+M++V  E  RI E+E+  +T
Sbjct  285   SDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTT  344

Query  370   AMGEASATLTLGSQLFT  320
              M E++ T+TLGSQLFT
Sbjct  345   IMPESTPTVTLGSQLFT  361



>ref|XP_004231741.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=380

 Score =   323 bits (829),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 225/355 (63%), Gaps = 15/355 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             KR+ +  SDT SSDPS  V +  G  ++S         + AR F ++EL  ATK F + +
Sbjct  33    KRFISTTSDTGSSDPSVQVGKNAGVELTS---------QDARRFHIEELSLATKGFSDKS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK RSA P Q+F +EV  LS  QHRNLV LLGYCQEN 
Sbjct  84    LIGQGKFGEVYKGLLHDGMLVAIKRRSAVPSQEFVDEVRYLSSIQHRNLVTLLGYCQEND  143

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              QILV EY+PNG++  HLYG    +  KLEFK RLSIA G AKGL HLH   P ++H +F
Sbjct  144   QQILVYEYIPNGSVSIHLYGGDHVTQEKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDF  203

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASD  659
             KT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PEV +   FSE SD
Sbjct  204   KTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPEVREFRRFSEKSD  261

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
              Y FG+FL EL++G EA  +     N  +++WVE +  S +   +++ RL   ++ EGM 
Sbjct  262   AYSFGIFLLELVSGHEAMDLLSSELNVNIVEWVENYQESGNISAIIDPRLGNSFTREGME  321

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             + ++L +RC     ++RP M  V +E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  322   EFMQLTVRCVDSSSEKRPTMSYVVMELDRILEKEMSLTTIMGEGTPVVTLGSQLF  376



>gb|KHG00527.1| Serine/threonine-protein kinase-like protein ACR4 [Gossypium 
arboreum]
Length=357

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 239/355 (67%), Gaps = 32/355 (9%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTG-GPVSSLALARGGVPEGARVFRMQELEQATKNFDES  1199
             K +SNR S+T SSDPS   E   G GP SS   +  G P+GA+ F ++ELEQATK F ES
Sbjct  32    KSFSNRASETGSSDPSTLTEWNRGVGPSSSAGPSLYG-PQGAKEFMLEELEQATKQFAES  90

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             +LIG GSFGLV+KG L D  +VAIK     PR +F   VA L  T++R            
Sbjct  91    SLIGYGSFGLVYKGLLRD-VVVAIKRHPGIPRPEF---VAGLG-TRNR------------  133

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
                +L   + PN          GR++ T+LEFKQRLSIA G A+GLCHLHG  PP++H N
Sbjct  134   ---LLSRRWFPN-------VDTGREAPTRLEFKQRLSIALGAARGLCHLHGLKPPLIHKN  183

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASD  659
             FKTGNVLVDE+FI KVADAG+S LL++I  + A PS++   + F DPEV   G F+E SD
Sbjct  184   FKTGNVLVDEDFIAKVADAGVSMLLEKI--EEASPSYTSSVNIFRDPEVEVLGSFTETSD  241

Query  658   IYGFGVFLWELITGR-EAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDL  482
             +Y FG FL ELITG+ EA HI  +GSN++++QWV++ LS +D V+HRL+G ++ +G++D+
Sbjct  242   VYSFGAFLLELITGQDEAMHINYMGSNESLIQWVQSRLSCNDFVDHRLVGSFTMDGIKDM  301

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             I+LA++C SFPG+ RP+M+ V++E ERI E E+  +T   E +A + LGS+LF +
Sbjct  302   IKLALKCMSFPGERRPDMNTVSIELERIRENEMEMTTVKSEGTAKIALGSELFAS  356



>ref|XP_009385501.1| PREDICTED: wall-associated receptor kinase-like 20 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   323 bits (827),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 237/372 (64%), Gaps = 25/372 (7%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKT----GGPVSSLALARGGVPE--GARV  1247
              I+ R  L  ++  S   S+T SSDPS  V Q      GG VS         PE  GAR 
Sbjct  23    IIIIRYCLFRNRSISR--SETNSSDPSLQVGQTVEPSLGGGVSY-------APEFQGARC  73

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F ++EL  ATKNF   NLIG G+FG V KG L DG +VAIK RS P  Q+F EEV  +S 
Sbjct  74    FTLEELNVATKNFSNINLIGYGTFGEVSKGLLHDGMVVAIKRRSCPRSQEFIEEVRYVSS  133

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
              +HRNLV+LLGYCQE+  Q+L+ EY+PNG++  HLYG  + SS KLEFK RLSIA G AK
Sbjct  134   IRHRNLVSLLGYCQEDHIQMLIYEYIPNGSVSTHLYGAIQASSVKLEFKHRLSIAHGAAK  193

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPF  707
             G+ HLH   PP+VH NFKT NVLVD +  PKV DAGI SLL  I+  AA  S   +  PF
Sbjct  194   GMVHLHSLNPPLVHMNFKTRNVLVDGDLTPKVGDAGIHSLLDRID-GAASSSRITEDDPF  252

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---  536
             +DP+V +SG  S  SD+Y FGVFL EL+TGREA       S+++++Q  + +  + D   
Sbjct  253   LDPDVKESGTLSIKSDVYSFGVFLLELVTGREAR------SDRSIIQQAQNYHEAVDLST  306

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             LV++R+   +++EG+ DL++L   C +   +ERP M  V +E  RI E+E+  +T MGE 
Sbjct  307   LVDNRMGSSFTSEGIWDLLQLISWCLNSSSEERPPMKFVELELHRIHEREMSLTTIMGEG  366

Query  355   SATLTLGSQLFT  320
             + T+TLGSQLFT
Sbjct  367   TTTVTLGSQLFT  378



>ref|XP_010909094.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X3 [Elaeis 
guineensis]
Length=325

 Score =   320 bits (821),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 173/327 (53%), Positives = 221/327 (68%), Gaps = 17/327 (5%)
 Frame = -2

Query  1273  GGV--PEG---ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAP  1109
             GGV  P G   AR F ++EL  ATKNF   NLIG G FG V+KG L DG IVAIK R + 
Sbjct  5     GGVSYPPGLQEARRFTLEELNVATKNFGNINLIGYGMFGEVYKGLLHDGMIVAIKIRPSA  64

Query  1108  PRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKL  929
             PRQ+F EEV  LS  +HRNLV+LLGYCQEN  Q+L+ EY+PNG++  HLYG G+ ++++L
Sbjct  65    PRQEFVEEVHYLSSIRHRNLVSLLGYCQENDLQMLIYEYIPNGSVSTHLYGSGQVATSRL  124

Query  928   EFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINH  749
             EFK RLSIA G AKGL  LH   PP+VH NFKT NVLVDE+FIPKVADAG+ SLL  I  
Sbjct  125   EFKHRLSIAHGAAKGLGFLHSLNPPLVHMNFKTANVLVDEDFIPKVADAGLRSLLDRI--  182

Query  748   DAAGPSHSIQP-SPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTM  572
             D AGPS  +    PF+DPEV +SG FS  SD+Y FGVFL EL++GREA       S+  +
Sbjct  183   DDAGPSSRMTTDDPFLDPEVKESGRFSVTSDVYSFGVFLMELVSGREAR------SDLHI  236

Query  571   LQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAER  401
             ++  +++    +   LV+ R+   +++EGM + +RL   C +   + RP M+ V  E +R
Sbjct  237   IELAQSYQEPSNISTLVDQRMGSSFTSEGMSEFLRLIAWCLNPSSERRPPMNFVESELDR  296

Query  400   ILEKEIMGSTAMGEASATLTLGSQLFT  320
             I EKE+  +T M E S T+TLGSQLFT
Sbjct  297   IREKEMSLTTIMPEGSTTVTLGSQLFT  323



>ref|XP_007032051.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY02977.1| Kinase superfamily protein [Theobroma cacao]
Length=379

 Score =   322 bits (826),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 231/360 (64%), Gaps = 20/360 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  KR  +R S+T SSDPS  V+ +  G   SL          A+ F ++EL  ATKNF 
Sbjct  30    LFHKRGVSRRSETGSSDPS--VQGRHLGVELSL--------REAKRFEIEELSSATKNFS  79

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L +G +VAIK R+    Q+F +E   LS  QHRNLV LLGYCQ
Sbjct  80    DQNLIGEGKFGEVYKGLLQEGMLVAIKKRAGAYSQEFIDEACYLSSIQHRNLVTLLGYCQ  139

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH
Sbjct  140   ENNQQFLIYEYIPNGSVSIHLYGAGQVSPQKLEFKHRLSIALGAAKGLAHLHSLSPRLVH  199

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENFI KVADAG+ + L  I  D AGPS  +     F+ PEV +   FSE
Sbjct  200   KDFKTANVLVDENFIAKVADAGLRNFLGRI--DVAGPSSQVTADEIFLAPEVREFRRFSE  257

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE-----AHLSSDDLVEHRLMGKYS  503
              SD+Y FGVFL EL++GREA+ +    S + +++WV+     +++SS  +++ RL   ++
Sbjct  258   KSDVYSFGVFLLELVSGREASELPSSDSTENLVEWVQNSQDYSNISS--MIDQRLGSSFT  315

Query  502   AEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              EGM + I+L +RC     + RP M  V +E +RIL+KE+  +T MGE + T+TLGSQLF
Sbjct  316   GEGMEEFIKLMVRCVEPSSERRPAMSYVVMELDRILDKEMSLTTVMGEGTPTVTLGSQLF  375



>ref|XP_002320425.2| hypothetical protein POPTR_0014s14170g [Populus trichocarpa]
 gb|EEE98740.2| hypothetical protein POPTR_0014s14170g [Populus trichocarpa]
Length=377

 Score =   322 bits (825),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 238/371 (64%), Gaps = 20/371 (5%)
 Frame = -2

Query  1423  VGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVF  1244
             VG+ +F+L     L+ K+  +R S+T SS+ S  V+ +  G   SL        + AR F
Sbjct  19    VGAVIFLL---WCLSHKKSVSRTSETGSSETS--VQGRHAGIELSL--------QEARRF  65

Query  1243  RMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMT  1064
              M+EL  ATK F E NL+G G FG V+KG L +G +VAIK R   P  +F +EV  LS  
Sbjct  66    EMEELSLATKGFSEKNLMGFGKFGEVYKGLLNNGMVVAIKKRPGAPSPEFVDEVRYLSPI  125

Query  1063  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  884
             QHRNLV LLGYCQEN  Q LV EY+P+G++ NHLYG G+    KLEFK RLSIA G AKG
Sbjct  126   QHRNLVTLLGYCQENDLQFLVYEYIPSGSVSNHLYGPGQTLDGKLEFKHRLSIALGAAKG  185

Query  883   LCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-F  707
             L HLH   P +VH NFKT NVLVDENFI KVADAG+ + L ++  D AGPS  +     F
Sbjct  186   LAHLHSLSPRLVHKNFKTANVLVDENFIAKVADAGLRNFLGKV--DIAGPSTQVTSDEIF  243

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDD  536
             + PEV +   FSE SD++ FGVFL EL++G+EAA     G+NQ +++WV   + + +   
Sbjct  244   LAPEVREFRRFSEKSDVFSFGVFLLELLSGKEAAE-PSPGTNQNLVEWVQNTQDYANFAS  302

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             +V+ RL   ++AEGM + I+L +RC     + RP M+ V +E +RI+EKE+  +T MGE 
Sbjct  303   IVDQRLGSSFTAEGMEEFIQLMLRCVEPSSERRPAMNYVVMELDRIIEKEMNLTTVMGEG  362

Query  355   SATLTLGSQLF  323
             + T+TLGS LF
Sbjct  363   TPTVTLGSHLF  373



>emb|CDP16750.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 228/360 (63%), Gaps = 15/360 (4%)
 Frame = -2

Query  1390  MLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKN  1211
             + L   R  +R S+  SSDPS   + +T G   SL          AR F ++EL  ATK+
Sbjct  28    LCLFHSRSISRTSENGSSDPSDQ-DGRTAGIELSL--------RDARRFEIEELSLATKS  78

Query  1210  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  1031
             F + +LIG G FG VFKG L DG +VAIK R   P Q+F EEV  LS  QHRNLV+LLGY
Sbjct  79    FSDKSLIGQGKFGEVFKGLLQDGMLVAIKKRPGAPSQEFIEEVRYLSSIQHRNLVSLLGY  138

Query  1030  CQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPV  851
             CQ+NG QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL H+H   P +
Sbjct  139   CQDNGQQILVYEYIPNGSVSIHLYGAGHVAQEKLEFKHRLSIALGAAKGLAHIHALSPRL  198

Query  850   VHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVF  674
             +H +FKT NVLVDENFI KVADAG+ + L     D AGPS  +     F+ PEV +   F
Sbjct  199   IHKDFKTSNVLVDENFIAKVADAGLRNFLGRF--DIAGPSSEMAADEMFLAPEVKEFRRF  256

Query  673   SEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD---DLVEHRLMGKYS  503
             SE SD++ FGVFL EL++GREA  +    +NQ +++W++ +  S     +++ RL   ++
Sbjct  257   SEKSDVHSFGVFLLELVSGREALDLLSSDTNQNLVEWLQNYQESGAIAAIIDQRLGNSFT  316

Query  502   AEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              EGM + I+L +RC +   + RP M  V VE +RILE E+  +T MGE +  +TLGSQLF
Sbjct  317   KEGMEEFIQLIVRCVNPSSERRPAMSYVVVELDRILENEMNLTTIMGEGTPVVTLGSQLF  376



>ref|XP_008810475.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
Length=380

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 232/365 (64%), Gaps = 26/365 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQ  1223
             L  KR  +R S T SS+PS     +E    G VS         P G   AR F ++EL  
Sbjct  30    LLRKRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLEELNV  81

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HRNLV+
Sbjct  82    ATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHRNLVS  141

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  LH  
Sbjct  142   LLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGFLHSM  201

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQ  686
              PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DPEV +
Sbjct  202   NPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDPEVKE  259

Query  685   SGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLM  515
             SG FS  SD+Y FGVFL EL++GREA       S+Q +++  + +    +   LV+ R+ 
Sbjct  260   SGRFSVMSDVYSFGVFLMELVSGREAR------SDQRIIELAQNYQEPHNISTLVDQRMG  313

Query  514   GKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
               +++EGM + +RL   C +   K RP M+ V +E +RI EKE+  +T M E   T+TLG
Sbjct  314   SSFTSEGMNEFLRLIAWCLNPSSKRRPPMNYVELELDRIHEKEMSLTTIMPEGGTTVTLG  373

Query  334   SQLFT  320
             SQLFT
Sbjct  374   SQLFT  378



>ref|XP_010909569.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
Length=378

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 236/365 (65%), Gaps = 26/365 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQELEQA  1220
             L   R  +R S+T SS+PS    Q  G  +       GGV      +GAR F ++EL   
Sbjct  30    LWRSRSVSRTSETNSSEPS----QGQGIELP----FHGGVSYPPGFQGARHFTLEELNVT  81

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             TKNF   N+IG G FG V+KG L DG +VAIK R++ P Q+F EEV  LS  +HRNLV+L
Sbjct  82    TKNFSNINMIGYGMFGEVYKGLLHDG-MVAIKARTSAPSQEFIEEVHFLSSIRHRNLVSL  140

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             LGYCQENG Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  LH   
Sbjct  141   LGYCQENGMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGILHSLN  200

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ-PSPFIDPEVNQS  683
             PP+VH NFKT NVLVDE+F PKVADAG+ SLL  I  D AGPS  +    PF+DPEV +S
Sbjct  201   PPLVHMNFKTANVLVDEDFTPKVADAGLQSLLDRI--DEAGPSSRLTIDDPFLDPEVKES  258

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMG  512
             G FS  SD+Y FGVFL EL+TGREA       S+Q++++  + +    +   LV+ R+  
Sbjct  259   GRFSVRSDVYSFGVFLLELVTGREAR------SDQSIIELAQKYEEPTNISTLVDQRMGS  312

Query  511   KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGS  332
              +++EGM + +RL   C +   + RP M+ V +E +RI EKE+  +T M E S T+TLGS
Sbjct  313   SFTSEGMSEFLRLIAWCVNPSSERRPPMNYVELELDRIYEKEMSLTTIMPEGSTTVTLGS  372

Query  331   QLFTN  317
             QLFT 
Sbjct  373   QLFTT  377



>ref|XP_010909568.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=379

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 235/365 (64%), Gaps = 25/365 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQELEQA  1220
             L   R  +R S+T SS+PS        G    L    GGV      +GAR F ++EL   
Sbjct  30    LWRSRSVSRTSETNSSEPSQ------AGQGIELPF-HGGVSYPPGFQGARHFTLEELNVT  82

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             TKNF   N+IG G FG V+KG L DG +VAIK R++ P Q+F EEV  LS  +HRNLV+L
Sbjct  83    TKNFSNINMIGYGMFGEVYKGLLHDG-MVAIKARTSAPSQEFIEEVHFLSSIRHRNLVSL  141

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             LGYCQENG Q+L+ EY+PNG++  HLYG G+ +S +LEFK RLSIA G AKGL  LH   
Sbjct  142   LGYCQENGMQMLIYEYIPNGSVSTHLYGSGQVASARLEFKHRLSIAHGAAKGLGILHSLN  201

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ-PSPFIDPEVNQS  683
             PP+VH NFKT NVLVDE+F PKVADAG+ SLL  I  D AGPS  +    PF+DPEV +S
Sbjct  202   PPLVHMNFKTANVLVDEDFTPKVADAGLQSLLDRI--DEAGPSSRLTIDDPFLDPEVKES  259

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMG  512
             G FS  SD+Y FGVFL EL+TGREA       S+Q++++  + +    +   LV+ R+  
Sbjct  260   GRFSVRSDVYSFGVFLLELVTGREAR------SDQSIIELAQKYEEPTNISTLVDQRMGS  313

Query  511   KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGS  332
              +++EGM + +RL   C +   + RP M+ V +E +RI EKE+  +T M E S T+TLGS
Sbjct  314   SFTSEGMSEFLRLIAWCVNPSSERRPPMNYVELELDRIYEKEMSLTTIMPEGSTTVTLGS  373

Query  331   QLFTN  317
             QLFT 
Sbjct  374   QLFTT  378



>ref|XP_004304571.1| PREDICTED: nodulation receptor kinase-like [Fragaria vesca subsp. 
vesca]
Length=378

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 225/356 (63%), Gaps = 20/356 (6%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             R  +R S+T SSDPS  V    G  +S             R F+M+EL  ATKNF + NL
Sbjct  33    RSVSRTSETGSSDPSVQVGTHGGVELS---------IRETRRFQMEELSLATKNFSDKNL  83

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+ GFL DG +VAIK R   P Q+F+ EV  LS  QHRN+V+LLGYCQEN  
Sbjct  84    IGEGKFGEVYMGFLHDGMLVAIKKRPGLPSQEFTNEVNYLSAIQHRNIVSLLGYCQENNL  143

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q LV EY+ +G++ +HLYG G+    KLEFK RLSIA G AKGL +LH   P +VH NF+
Sbjct  144   QFLVYEYIHSGSVSSHLYGTGQHVREKLEFKNRLSIALGAAKGLAYLHSLSPRLVHKNFR  203

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGP-SHSIQPSPFIDPEVNQSGVFSEASDI  656
             T NVLVDENFI KVADAGI + L +   D AGP S  I    F+ PEV +   FSE SD+
Sbjct  204   TANVLVDENFIAKVADAGIRNFLGK---DMAGPSSQVIADEIFLSPEVREFRRFSEKSDV  260

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVE-----AHLSSDDLVEHRLMGKYSAEGM  491
             Y FG+FL EL++GREAA +    +NQ +++WV+      ++SS  +++ RL   ++AE M
Sbjct  261   YSFGIFLLELVSGREAAKLTSADTNQDIVEWVQNIQDVGNISS--IIDDRLGNIFTAEAM  318

Query  490   RDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
               LI+L +RC     + RP M  V  E E ILEKE+  +T MGE ++T+  GSQLF
Sbjct  319   EKLIQLIIRCVEGSSERRPTMSHVVTELEGILEKEMSLTTIMGEGTSTVIPGSQLF  374



>ref|XP_002512819.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF49322.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=381

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/371 (48%), Positives = 233/371 (63%), Gaps = 16/371 (4%)
 Frame = -2

Query  1423  VGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVF  1244
             VG  +F++     L+ K+  +R S+T SSDPS     +  G   SL          AR F
Sbjct  19    VGIVIFLIW--FCLSHKKSVSRTSETGSSDPSIQAPGRHVGVELSL--------REARRF  68

Query  1243  RMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMT  1064
              M EL  ATKNF + NLIG G FG V+KG L DG +VAIK RS    Q+F +EV  LS  
Sbjct  69    EMDELSHATKNFVDKNLIGIGKFGEVYKGLLNDGMLVAIKKRSGASSQEFVDEVRYLSPI  128

Query  1063  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  884
             QHRN+V LLGYCQEN  Q LV EY+P+G++ +HLYG  + S  KLEFK RLSIA G AKG
Sbjct  129   QHRNIVTLLGYCQENNLQFLVYEYIPSGSVSSHLYGPSQFSDGKLEFKHRLSIALGAAKG  188

Query  883   LCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-F  707
             L HLH   P +VH +FKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F
Sbjct  189   LAHLHSLSPRLVHKDFKTANVLVDENFIAKVADAGLPNFLGRV--DVAGPSSQVTADEIF  246

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDD  536
               PEV +   FS+  D++ FGVFL EL++GREA       S+Q +++WV   + + +   
Sbjct  247   QAPEVREFRRFSDKGDVFSFGVFLLELLSGREATESPSPDSSQNLVEWVQNTQDYSAFSS  306

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             +V+ RL  +++AEGM + I+L ++C     + RP+M  V +E +RILEKE+  +T MGE 
Sbjct  307   VVDQRLGTRFTAEGMEEFIQLIIQCLEPSSERRPSMSYVVMELDRILEKEMTLTTVMGEG  366

Query  355   SATLTLGSQLF  323
             + T+TLGSQLF
Sbjct  367   TPTVTLGSQLF  377



>ref|XP_011006133.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Populus 
euphratica]
 ref|XP_011006134.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Populus 
euphratica]
Length=377

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 181/373 (49%), Positives = 239/373 (64%), Gaps = 24/373 (6%)
 Frame = -2

Query  1423  VGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVF  1244
             VG+ +F+L     L  K+  +R S+T SS+ S  V+ +  G   SL        + AR F
Sbjct  19    VGAVIFLL---WCLYHKKSVSRTSETGSSETS--VQGRHAGIELSL--------QEARRF  65

Query  1243  RMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMT  1064
              M+EL  ATK F E NL+G G FG V+KG L DG +VAIK R   P  +F +EV  LS  
Sbjct  66    EMEELSLATKGFSEKNLMGFGKFGEVYKGLLNDGMVVAIKKRPGAPSPEFVDEVRYLSPI  125

Query  1063  QHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG  884
             QHRNLV LLGYCQEN  Q LV EY+P+G++ NHLYG G+    KLEFK RLSIA G AKG
Sbjct  126   QHRNLVTLLGYCQENDLQFLVYEYIPSGSVSNHLYGPGQTLDGKLEFKHRLSIALGAAKG  185

Query  883   LCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-F  707
             L HLH   P +VH NFKT NVLVDENFI KVADAG+ + L ++  D AGPS  +     F
Sbjct  186   LAHLHSLSPRLVHKNFKTANVLVDENFIAKVADAGLRNFLGKV--DIAGPSTQVTSDEIF  243

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE-----AHLSS  542
             + PEV +   FSE SD++ FGVFL EL++G+EAA     G++Q +++WV+     A+ +S
Sbjct  244   LAPEVREFRRFSEKSDVFSFGVFLLELLSGKEAAE-PSPGTSQNLVEWVQNTQDYANFAS  302

Query  541   DDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG  362
               +V+ RL   ++AEGM + I+L +RC     + RP M+ V +E +RI+EKE+  +T MG
Sbjct  303   --IVDQRLGSSFTAEGMEEFIQLMLRCVEPSSERRPAMNYVVMELDRIIEKEMNLTTVMG  360

Query  361   EASATLTLGSQLF  323
             E + T+TLGS LF
Sbjct  361   EGTPTVTLGSHLF  373



>ref|XP_009761544.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761545.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761546.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
 ref|XP_009761547.1| PREDICTED: nodulation receptor kinase [Nicotiana sylvestris]
Length=380

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 223/355 (63%), Gaps = 15/355 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             KR  +R S+T SSDPS  V  KT G   +L          AR F+++EL  ATK F + +
Sbjct  33    KRSISRTSETGSSDPSIQV-GKTAGIELTL--------RDARRFQIEELSLATKGFSDKS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK RS  P Q+F +EV  LS  QHRNLV LLGYCQE  
Sbjct  84    LIGQGKFGEVYKGLLHDGMLVAIKRRSVVPSQEFIDEVRYLSSIQHRNLVTLLGYCQERD  143

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              QILV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P ++H +F
Sbjct  144   QQILVYEYIPNGSVSVHLYGDGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDF  203

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASD  659
             KT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PEV +   FSE SD
Sbjct  204   KTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSQVAADEIFLAPEVREFRRFSEKSD  261

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
              Y FGVFL EL++GREA  +     N  +++WVE +  S +   +++ RL   ++ EGM 
Sbjct  262   AYSFGVFLLELVSGREAMDLLSSDLNINIVEWVENYQESGNISAIIDQRLGNSFTTEGMG  321

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             + ++L +RC     + RP M  V  E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  322   EFMQLTVRCMDPSSERRPTMSYVVTELDRILEKEMSLTTIMGEGTPVVTLGSQLF  376



>gb|EMS48868.1| Receptor-like protein kinase ANXUR1 [Triticum urartu]
Length=371

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 220/334 (66%), Gaps = 23/334 (7%)
 Frame = -2

Query  1258  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  1079
             GAR F ++E+  ATKNF ++NL+G G+FG V+ G L DGT+VAIK R   PRQ F +EV 
Sbjct  41    GARRFTLEEMSHATKNFSDANLVGAGTFGKVYMGLLLDGTVVAIKRRVGAPRQDFVDEVR  100

Query  1078  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  899
             R S   HRN+V L+GYCQ+ G Q+LV E+LPNG++C HLY  G++S T+LEFKQRLSIA 
Sbjct  101   RQSEIWHRNVVTLIGYCQDGGLQMLVFEHLPNGSVCGHLYDSGKESMTRLEFKQRLSIAI  160

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             G AKGL HLH   PP++H  FKT NVLVDENFI KV+DAG+  LL+ +  D   P +  +
Sbjct  161   GAAKGLDHLHSLAPPLIHKGFKTSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLNGFR  219

Query  718   PSPFIDPEV-------------------NQSGVFSEASDIYGFGVFLWELITGREAAHIR  596
                + DP++                   +     S +SD+Y FGVFL ELITGREAA + 
Sbjct  220   SGIYQDPDLCLLRSTPLLSDRYACVLRAHSLAQLSASSDVYSFGVFLLELITGREAATLV  279

Query  595   GLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPG-KERPNMDMV  419
                S +++  W+E   S D++ + RL G +++EGM++L+ L M+C S    + RP M +V
Sbjct  280   SPESTESLAHWLET--SGDEVADPRLGGSFTSEGMKELVGLTMQCLSPSAVRRRPKMRLV  337

Query  418   AVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
             A E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  338   AAELDRILEKEMTLTTVMGDGTAIITLGSQLFTS  371



>ref|XP_011024759.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X1 [Populus 
euphratica]
 ref|XP_011024760.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X1 [Populus 
euphratica]
Length=378

 Score =   321 bits (822),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/358 (49%), Positives = 227/358 (63%), Gaps = 16/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  K+  +R S+T SS+ S  V +  G  +SS         + AR F M+EL  ATK F 
Sbjct  29    LYHKKTVSRTSETGSSETSVQVGRHAGIELSS---------QEARRFEMEELGLATKGFS  79

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  QHRNLV LLGYCQ
Sbjct  80    EKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLLGYCQ  139

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+ +G++ NHLYG+G+    KLEFK RLSIA G AKGL HLH Q P +VH
Sbjct  140   ENNMQFLVYEYISSGSVSNHLYGVGQTLDGKLEFKHRLSIALGAAKGLAHLHSQTPRLVH  199

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PEV +   FSE
Sbjct  200   KNFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSTQVTADEIFLAPEVREFRQFSE  257

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA---HLSSDDLVEHRLMGKYSAE  497
              SD++ FGVFL EL++G+EA       ++Q +++WV+    + +   +V+HR+   ++AE
Sbjct  258   KSDVFSFGVFLLELLSGKEATE-PSPETSQNLVEWVQKTQDYTNFSTIVDHRMGSSFTAE  316

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L ++C       RP M  V +E +RILEKE   +T MGE + T+TLGSQLF
Sbjct  317   GMEEFIQLMLQCVEPSSDRRPIMSYVVMELDRILEKERNLTTVMGEGTPTVTLGSQLF  374



>ref|XP_008802106.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X1 [Phoenix dactylifera]
Length=304

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 195/276 (71%), Gaps = 2/276 (1%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             +L  +  +NR+S+T SSDP   VE   GG ++S         +GAR F  +EL QATKNF
Sbjct  30    ILHRRTCANRSSETGSSDPPTIVEWTRGGRITSAGGGHATEHQGARQFTFEELSQATKNF  89

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNL+G GSFGLV+KG L DGTIVAIK R   P Q+F EEV RLS   HRNLV L+GYC
Sbjct  90    NESNLVGSGSFGLVYKGLLLDGTIVAIKRRRGAPLQEFVEEVKRLSEICHRNLVTLIGYC  149

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE G Q+LV E+LPNG++  HLY + R   T+LEFKQRLS+A G AKGL HLH   P VV
Sbjct  150   QEGGLQMLVFEHLPNGSISRHLYDIARGPVTRLEFKQRLSVAIGAAKGLAHLHNLVPQVV  209

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FK+ NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPEV + G  SE
Sbjct  210   HKDFKSSNVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSSGGNVFQDPEVEEFGALSE  267

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV  560
             ASD+Y FGVFL ELITGREAAH    GS++++ QWV
Sbjct  268   ASDVYSFGVFLLELITGREAAHFFSPGSDESLAQWV  303



>ref|XP_010502605.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
 ref|XP_010502606.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
 ref|XP_010502607.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=380

 Score =   320 bits (820),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 222/351 (63%), Gaps = 15/351 (4%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+T SSDPS    Q+       L++        AR F M+EL QATK+F   +LIG 
Sbjct  37    SRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQATKSFTNKSLIGI  87

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG L DG +VAIK R + P Q+F  EV  LS   HRNLV LLGYCQE+  Q L
Sbjct  88    GKFGEVYKGLLQDGVLVAIKKRPSLPTQEFVNEVRYLSSIHHRNLVTLLGYCQESNTQFL  147

Query  1003  VLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             V EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P ++H +FKT 
Sbjct  148   VYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPRLIHKDFKTA  207

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+ + L     D    SH +    F+ PEV +   FSE SD+Y F
Sbjct  208   NVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPEVQEFRRFSEKSDVYAF  265

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIR  476
             GVFL EL++GREA+      S QT+++W++      D   +++ RL G Y+AEG+ +LI 
Sbjct  266   GVFLLELVSGREASEPCPSSSTQTLVEWMQNLKDYADIPMMIDERLGGTYTAEGVEELIT  325

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  326   LTLRCVDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  376



>ref|XP_010250486.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X2 
[Nelumbo nucifera]
Length=387

 Score =   320 bits (820),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 231/363 (64%), Gaps = 16/363 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPS--APVEQKTGGPVSSLALARGGVPEG--ARVFRMQELEQAT  1217
             L+  R  +R S+T SSDPS    VE    G   SL       P+   AR F M+EL  AT
Sbjct  30    LSRDRNISRTSETGSSDPSIQGRVELPLTGTFGSLP------PDSREARRFLMEELALAT  83

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             K+F++ NLIG G FG V+KG L DG IVAIK R+  P Q+F EEV  LS  +HRN+V+LL
Sbjct  84    KDFNDINLIGEGKFGKVYKGLLHDGMIVAIKKRNGLPSQEFFEEVRYLSSIRHRNIVSLL  143

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQEN  Q+++ EY+PNG++ +HLYG  + S  KLEFK RLSIA G AKGL HLH   P
Sbjct  144   GYCQENDQQMIIYEYIPNGSVSSHLYGTSQVSREKLEFKHRLSIALGAAKGLSHLHALSP  203

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSG  680
              ++H  FKT NVLVDENFI KVADAG+ +LL  +  D AG S  I     F+ PEV +  
Sbjct  204   RLIHKGFKTVNVLVDENFIAKVADAGLYNLLARV--DVAGSSFGIMADDAFLAPEVREFR  261

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGK  509
              FSE SD+Y F VFL EL++G EA   +   S + +++W   +  S +   +++ RL   
Sbjct  262   RFSEKSDVYSFAVFLLELVSGHEAMKSQSSESGENIVEWARNYDDSSNISTIIDPRLGNS  321

Query  508   YSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQ  329
             ++ EGM++ I+L +RC     + RP+M+ V  E +RILEKE+  +T MGE + T+TLGS 
Sbjct  322   FTTEGMKEFIQLTVRCLDHSSERRPSMNFVVGELDRILEKEMSLTTIMGEGTTTVTLGSH  381

Query  328   LFT  320
             LFT
Sbjct  382   LFT  384



>ref|XP_010250484.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250485.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X1 
[Nelumbo nucifera]
Length=388

 Score =   320 bits (819),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 230/362 (64%), Gaps = 13/362 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATK  1214
             L+  R  +R S+T SSDPS  V    G     L    G +P     AR F M+EL  ATK
Sbjct  30    LSRDRNISRTSETGSSDPSIQV----GRVELPLTGTFGSLPPDSREARRFLMEELALATK  85

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             +F++ NLIG G FG V+KG L DG IVAIK R+  P Q+F EEV  LS  +HRN+V+LLG
Sbjct  86    DFNDINLIGEGKFGKVYKGLLHDGMIVAIKKRNGLPSQEFFEEVRYLSSIRHRNIVSLLG  145

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             YCQEN  Q+++ EY+PNG++ +HLYG  + S  KLEFK RLSIA G AKGL HLH   P 
Sbjct  146   YCQENDQQMIIYEYIPNGSVSSHLYGTSQVSREKLEFKHRLSIALGAAKGLSHLHALSPR  205

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGV  677
             ++H  FKT NVLVDENFI KVADAG+ +LL  +  D AG S  I     F+ PEV +   
Sbjct  206   LIHKGFKTVNVLVDENFIAKVADAGLYNLLARV--DVAGSSFGIMADDAFLAPEVREFRR  263

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKY  506
             FSE SD+Y F VFL EL++G EA   +   S + +++W   +  S +   +++ RL   +
Sbjct  264   FSEKSDVYSFAVFLLELVSGHEAMKSQSSESGENIVEWARNYDDSSNISTIIDPRLGNSF  323

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM++ I+L +RC     + RP+M+ V  E +RILEKE+  +T MGE + T+TLGS L
Sbjct  324   TTEGMKEFIQLTVRCLDHSSERRPSMNFVVGELDRILEKEMSLTTIMGEGTTTVTLGSHL  383

Query  325   FT  320
             FT
Sbjct  384   FT  385



>emb|CDM85905.1| unnamed protein product [Triticum aestivum]
Length=365

 Score =   318 bits (816),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 214/319 (67%), Gaps = 12/319 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT NF  SNL+G G FG V+ G L DGTI+A+K R +PP Q+F  EV
Sbjct  53    QGARCMTLEELRSATNNFSSSNLVGHGMFGEVYNGLLQDGTIIAVKRRHSPPSQEFLHEV  112

Query  1081  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  905
               LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  113   NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISTHLHGNGNSPTVRLEFKQRLAI  172

Query  904   ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  725
             A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  173   AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFVPKVADTGIRGLLDRLGN--AGPPSM  230

Query  724   IQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLS  545
             I   PF+DP   +S +FS  SD+Y FGVFL ELI+GR AA      S+Q +++WV+    
Sbjct  231   IFNDPFVDPRGKESMIFSIQSDVYSFGVFLVELISGRTAA------SDQGIIEWVQNFQE  284

Query  544   SDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
             S D   + + R+   ++ +GM++L+RLA+RC +   + RP+M +V  E  RI ++EI  +
Sbjct  285   SSDISTIADRRMTSGFTPQGMKELLRLALRCVNPTSENRPSMSLVEAEIHRIRKQEIRRT  344

Query  373   TAMGEASATLTLGSQLFTN  317
             T M     T+TLGSQLFT+
Sbjct  345   TGMPVGDTTVTLGSQLFTS  363



>gb|AFK35308.1| unknown [Lotus japonicus]
Length=380

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 221/363 (61%), Gaps = 26/363 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQELEQAT  1217
             L  +R  +R S+T SSDPS               + R G  E      R F M+EL  AT
Sbjct  31    LCRQRSVSRTSETGSSDPSQ--------------VGRHGAIELQIRDTRRFAMEELSLAT  76

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             KNF++ NLIG G FG V+ G L DG +VAIK R   P Q+F +EV  LS  QHRN+V L+
Sbjct  77    KNFNDGNLIGQGKFGEVYNGLLQDGVLVAIKKRFGTPSQEFVDEVRYLSSIQHRNIVTLI  136

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQEN  Q L+ EY+PNG++ +HLYG G+ S  KLEFK RLSIA G AKGL H+H   P
Sbjct  137   GYCQENNLQFLIYEYVPNGSVSSHLYGAGQQSQEKLEFKLRLSIAQGAAKGLAHIHSLSP  196

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSG  680
              +VH +FKT NVLVDENFI KVADAG+   L  +  D  G S  +     F+ PEV +  
Sbjct  197   RLVHKDFKTANVLVDENFIAKVADAGLKHFLGRV--DIVGSSSQVAADEIFLAPEVREFR  254

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV----EAHLSSDDLVEHRLMG  512
              FSE SD+Y +GVFL EL++G+EA       SN  +++WV    + HL S  +++ RL  
Sbjct  255   RFSEKSDVYSYGVFLLELLSGKEATESPSPDSNLNLVEWVLRNQDRHLMS-KIIDRRLES  313

Query  511   KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGS  332
              ++AEGM   I L +RC     + RP M  V  E +RILEKE+  +T MGE + T+TLGS
Sbjct  314   SFTAEGMEAYILLVIRCLDLSSERRPAMSYVETELDRILEKEMNLTTIMGEGTPTVTLGS  373

Query  331   QLF  323
             QLF
Sbjct  374   QLF  376



>ref|XP_003564993.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 [Brachypodium distachyon]
Length=365

 Score =   318 bits (814),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 210/316 (66%), Gaps = 12/316 (4%)
 Frame = -2

Query  1258  GARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVA  1079
             GAR   ++EL  AT NF  SNLIG G FG VF G L +GT++A+KTR +PP Q+F +EV 
Sbjct  54    GARRLTLEELRSATNNFSSSNLIGHGMFGDVFNGLLQNGTVIAVKTRHSPPSQEFIQEVN  113

Query  1078  RLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIAS  899
              LS   HRNLVN LGYCQENG Q+LV EY+PNG++  HL+G       +LEFKQRLSIA 
Sbjct  114   YLSSIGHRNLVNFLGYCQENGMQMLVYEYVPNGSVSTHLHGNSHGPGVRLEFKQRLSIAH  173

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             GTAKGL HLH   PP VH NFKT NVLVDE+FIPKVADAGI  LL  I    A PS  I 
Sbjct  174   GTAKGLSHLHSLTPPAVHMNFKTANVLVDEDFIPKVADAGIRGLLDRIG--VACPSSRIS  231

Query  718   PSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD  539
               PF+ P   +S VFS  SDIY FGVFL ELI+GR+A        +Q++++WV+    S 
Sbjct  232   NDPFLGPRGKESMVFSIQSDIYSFGVFLVELISGRKAV------VDQSIIEWVQNFQESS  285

Query  538   D---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
             D   + + R+   +++EGM++L+RLA  C +   + RP+M +V  E  RI E+EI  +T 
Sbjct  286   DISAIADSRMTSGFTSEGMKELLRLASWCLNPMSETRPSMSLVEAEIHRIREQEIRLTTV  345

Query  367   MG-EASATLTLGSQLF  323
             M  E + T+TLGSQLF
Sbjct  346   MSVERTPTVTLGSQLF  361



>ref|XP_009345184.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345185.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345187.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
 ref|XP_009345188.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
Length=380

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 221/358 (62%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             ++  R  +R S+T SSDPS  V +  G  +S            AR F M+EL  A K+F 
Sbjct  30    ISRNRSVSRTSETGSSDPSIQVGRHGGVELS---------MREARRFHMEELSLAAKHFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G+FG VF GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQ
Sbjct  81    DKNLIGQGNFGEVFMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+ +G++ +HL+G G+ S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  141   ENNLQFLVYEYIHSGSVSSHLFGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSPRVVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE
Sbjct  201   KDFKTANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPEVREFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA       SNQ M++WV+      +   +++ RL   ++ E
Sbjct  259   KSDVYSFGVFLLELVSGREARDFASSDSNQNMVEWVQNIQEGSNVSCIIDGRLGNSFTGE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              M  LI+L MRC     + RP+M  V  E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  319   AMEGLIQLIMRCVEASSERRPSMSNVVTELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  376



>ref|XP_002303015.1| kinase family protein [Populus trichocarpa]
 gb|EEE82288.1| kinase family protein [Populus trichocarpa]
Length=378

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 177/370 (48%), Positives = 231/370 (62%), Gaps = 19/370 (5%)
 Frame = -2

Query  1420  GSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFR  1241
             G  +F+L     L  K+  +R S+T SS+ S  V +  G  +SS         + AR F 
Sbjct  20    GVVIFVL---WCLYHKKTVSRTSETGSSETSIQVGRHAGIELSS---------QEARRFE  67

Query  1240  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  1061
             M+EL  ATK F E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  Q
Sbjct  68    MEELGLATKGFSEKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSSIQ  127

Query  1060  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  881
             HRNLV LLGYCQEN  Q LV EY+ +G++ NHLYG+G+    KLEFK RL IA G AKGL
Sbjct  128   HRNLVTLLGYCQENNLQFLVYEYISSGSVSNHLYGVGQTLEGKLEFKNRLPIALGAAKGL  187

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FI  704
              HLH Q P ++H NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+
Sbjct  188   AHLHSQTPRLLHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGPSTQVTADEIFL  245

Query  703   DPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDDL  533
              PEV +   FSE SD++ FGVFL EL++G+EA       ++Q +++WV   + + +   +
Sbjct  246   APEVREFRQFSEKSDVFSFGVFLLELLSGKEATE-PSPETSQNLVEWVQNTQDYTNFSSI  304

Query  532   VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEAS  353
             V+HRL   ++AEGM + I+L ++C       RP M  V +E +RILEKE   +T MGE +
Sbjct  305   VDHRLGSSFTAEGMEEFIQLMLQCVEPSSDRRPLMSYVVMELDRILEKERNLTTVMGEGT  364

Query  352   ATLTLGSQLF  323
              T+TLGSQLF
Sbjct  365   PTVTLGSQLF  374



>ref|XP_009378057.1| PREDICTED: nodulation receptor kinase-like [Pyrus x bretschneideri]
Length=380

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 218/354 (62%), Gaps = 15/354 (4%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             R  +R S+T SSDPS  V +  G  +S             R F+M+EL  ATKNF + NL
Sbjct  34    RLVSRTSETGSSDPSVQVGRHGGVELS---------MRETRRFQMEELSLATKNFSDKNL  84

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  
Sbjct  85    IGQGKFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNL  144

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q LV EY+ +G++ +HLYG G+ S  KLEFK RL+IA G AKGL HLH   P +VH +FK
Sbjct  145   QFLVYEYIHSGSVSSHLYGTGQHSREKLEFKNRLTIAQGAAKGLAHLHSLSPRLVHKDFK  204

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDI  656
             T NVLVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE SD+
Sbjct  205   TANVLVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPEVREFRRFSEKSDV  262

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRD  485
             Y FGVFL EL++GREA       S Q M++WV+      +   +++ RL   ++ E M  
Sbjct  263   YSFGVFLLELVSGREARDFASSDSTQNMVEWVQNIQEGSNVSCIIDERLGNSFTGEAMEG  322

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             LI+L MRC     + RP M  V +E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  323   LIQLIMRCVEASSERRPGMSHVVMELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  376



>gb|EMS46350.1| Serine/threonine-protein kinase-like protein ACR4 [Triticum urartu]
Length=365

 Score =   317 bits (813),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 213/319 (67%), Gaps = 12/319 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT NF  SNL+G G FG V+ G L DGTI+A+K R +PP Q+F  EV
Sbjct  53    QGARCMTLEELRSATNNFSSSNLVGHGMFGEVYNGLLQDGTIIAVKRRHSPPSQEFLHEV  112

Query  1081  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  905
               LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  113   NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISTHLHGNGHSPTARLEFKQRLAI  172

Query  904   ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  725
             A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  173   AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFLPKVADTGIRGLLDRLGN--AGPPSM  230

Query  724   IQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLS  545
             I   PF+DP   +S +FS  SD+Y FGVFL ELI+GR AA      S+Q +++WV     
Sbjct  231   IFNDPFVDPRGKESMIFSIQSDVYSFGVFLVELISGRTAA------SDQGIIEWVRNFQE  284

Query  544   SDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
             S +   + + R+   ++  GM++L+RLA RC +   ++RP+M +V  E  RI E+EI  +
Sbjct  285   SSEISAIADRRMTSGFTPRGMKELLRLASRCVNPASEDRPSMSLVEAEIHRIREQEIRRT  344

Query  373   TAMGEASATLTLGSQLFTN  317
             TAM     T+TLGSQLFT+
Sbjct  345   TAMPVGDTTVTLGSQLFTS  363



>gb|EPS71437.1| hypothetical protein M569_03323 [Genlisea aurea]
Length=320

 Score =   315 bits (808),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 222/316 (70%), Gaps = 22/316 (7%)
 Frame = -2

Query  1255  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  1076
             AR F+M+ELEQ+T++FDESNLIG G+FGLVFKGFL DGTIVAIK R+ PP+++FSEEVA 
Sbjct  24    ARRFKMEELEQSTRHFDESNLIGYGTFGLVFKGFLSDGTIVAIKRRNGPPQREFSEEVAY  83

Query  1075  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  896
             LS  +HRNLV L+GYCQ+ G  +LV EYLPNG++ +HL+    DS TKLEFKQRLSI+ G
Sbjct  84    LSRIRHRNLVTLIGYCQDRGSLMLVFEYLPNGSIRSHLH----DSKTKLEFKQRLSISIG  139

Query  895   TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  716
              AKGL HLHG  PPVVHGNF+TGNVLVDENFI KVAD G+S L+ +I  D +  S S   
Sbjct  140   AAKGLSHLHGLQPPVVHGNFQTGNVLVDENFIAKVADTGVSKLIAKI--DGSSSSPSSSH  197

Query  715   SPFIDPEVN-QSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD  539
               F DPE+        E++D+Y FGVFL EL++GRE         ++  +  +     SD
Sbjct  198   DVFRDPELGPHEAASHESNDVYSFGVFLLELVSGREV-------KDEVPIHILHQVRRSD  250

Query  538   DLVEHRLMG--KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAM  365
                   L+G   ++ EGMR ++ L  +CT FPG ERP M+ VA+E E ILE EI  +T M
Sbjct  251   ------LVGGSSFTEEGMRWVMGLIQKCTVFPGSERPRMENVAMELEEILESEITRTTVM  304

Query  364   GEASATLTLGSQLFTN  317
             GE + T+TLGSQLFTN
Sbjct  305   GEGTTTVTLGSQLFTN  320



>ref|XP_003553985.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X1 [Glycine max]
 ref|XP_006604204.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X2 [Glycine max]
 ref|XP_006604205.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X3 [Glycine max]
 ref|XP_006604206.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X4 [Glycine max]
 ref|XP_006604207.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X5 [Glycine max]
 gb|KHN28599.1| Putative receptor-like protein kinase [Glycine soja]
Length=379

 Score =   317 bits (813),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 225/365 (62%), Gaps = 30/365 (8%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQELEQAT  1217
             L+ +R  +R S+T SSDPS               + R G  E      R F M+EL  AT
Sbjct  30    LSRQRNVSRTSETGSSDPSQ--------------VGRHGAIELPIRDTRRFEMEELSLAT  75

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             KNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LL
Sbjct  76    KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVHYLSSIHHRNLVSLL  135

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQEN  Q L+ EY+PNG++ +HLYG G++   KLEFK RLSIA G AKGL HLH   P
Sbjct  136   GYCQENNLQFLIYEYVPNGSVSSHLYGAGQNPQEKLEFKHRLSIAQGAAKGLAHLHSLSP  195

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSG  680
              +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +     F+  EV +  
Sbjct  196   RLVHKNFKTTNVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQVATDEIFLASEVREFR  253

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRL  518
              FSE SD+Y FGVFL EL++G+EA       SNQ +++WV   LS+ D      +++ RL
Sbjct  254   RFSEKSDVYSFGVFLLELLSGKEAIEPPFPDSNQNLVEWV---LSNQDRGMMSYIIDRRL  310

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTL  338
                ++AEGM + I L +RC     + RP M  V +E +RILEKE+  +T MGE + T+TL
Sbjct  311   ESSFTAEGMEEYILLIIRCLDPSSERRPAMSYVEMELDRILEKEMNLTTVMGEGTPTVTL  370

Query  337   GSQLF  323
             GSQLF
Sbjct  371   GSQLF  375



>ref|XP_010425389.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=379

 Score =   317 bits (812),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 223/351 (64%), Gaps = 16/351 (5%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+T SSDPS      T G   ++ L+       AR F M+EL QATK+F   +LIG 
Sbjct  37    SRTSETGSSDPS------TQGRNVAIELSM----REARRFEMEELAQATKSFTNKSLIGI  86

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG L DG +VAIK R + P Q+F  EV  LS   HRNLV LLGYCQE+  Q L
Sbjct  87    GKFGEVYKGLLQDGVLVAIKKRPSLPTQEFVNEVRYLSSIHHRNLVTLLGYCQESNTQFL  146

Query  1003  VLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             V EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P ++H +FKT 
Sbjct  147   VYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPRLIHKDFKTA  206

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+ + L     D    SH +    F+ PEV +   FSE SD+Y F
Sbjct  207   NVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPEVQEFRRFSEKSDVYAF  264

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIR  476
             GVFL EL++GREA+      S QT+++W++      D   +++ RL G Y+AEG+ +LI 
Sbjct  265   GVFLLELVSGREASEPSPSSSTQTLVEWMQNLKDYADIPMMIDERLGGTYTAEGVEELIT  324

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  325   LTLRCVDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  375



>ref|XP_008465399.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Cucumis 
melo]
Length=379

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 227/377 (60%), Gaps = 16/377 (4%)
 Frame = -2

Query  1444  STGKKVNVGSNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV  1265
             S G    VG  + +L+    L   R S R S+T SSDPS  V +  G  ++         
Sbjct  12    SAGAVALVGLIIILLR---FLARSRNSARTSETGSSDPSVQVGRHVGIELT---------  59

Query  1264  PEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEE  1085
                AR F M EL  AT +F E NLIG G FG V+KG L DG  VAIK R   P Q F EE
Sbjct  60    LRDARRFDMAELVLATNDFSEKNLIGEGKFGEVYKGMLQDGIFVAIKKRHGAPSQDFVEE  119

Query  1084  VARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  905
             V  LS  QHRNLV LLGYCQEN  Q L+ +Y+PNG++ +H+YG  + S+ +LEFK RLSI
Sbjct  120   VHYLSSIQHRNLVTLLGYCQENNLQFLIFDYIPNGSVSSHIYGTEQRSAERLEFKIRLSI  179

Query  904   ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  725
             A G AKGL HLH   P ++H NFKT NVLVDENFI KVADAG+ ++++  +  +   S +
Sbjct  180   ALGAAKGLSHLHSMSPRLIHRNFKTSNVLVDENFIAKVADAGLHNVMRRFDV-SESSSRA  238

Query  724   IQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLS  545
                  F+ PEV +   FSE SD+Y FGVFL EL++G++A        N T++ W++ + +
Sbjct  239   TADEIFLAPEVKEFRQFSEKSDVYSFGVFLLELVSGQKATDAPVSDPNYTLVDWIQNNQT  298

Query  544   SDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
               D   + + RL   ++ EGM +L+ L  +C  +  + RP M  V  E ERILEKE+  +
Sbjct  299   KSDIASITDPRLGKSFTEEGMAELMYLIRQCVEYSSERRPVMSYVVTELERILEKEMNLT  358

Query  373   TAMGEASATLTLGSQLF  323
             T MGE S T+TLGSQLF
Sbjct  359   TVMGEGSPTVTLGSQLF  375



>ref|XP_010066397.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010066398.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 gb|KCW64288.1| hypothetical protein EUGRSUZ_G01925 [Eucalyptus grandis]
 gb|KCW64289.1| hypothetical protein EUGRSUZ_G01925 [Eucalyptus grandis]
Length=379

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 209/315 (66%), Gaps = 6/315 (2%)
 Frame = -2

Query  1255  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  1076
             AR F M+EL  ATKNFD+ NLIG G FG V+KG L +G +VAIK RSA P Q+F +EV  
Sbjct  64    ARRFEMEELSMATKNFDDKNLIGVGKFGEVYKGLLHNGMLVAIKKRSASPTQEFVDEVRF  123

Query  1075  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  896
             LS  QHR+LV+LLGYCQ++  Q+LV EY+PNG++  HLYG  + S  KLEFK RLSIA G
Sbjct  124   LSCIQHRHLVSLLGYCQDHHTQLLVYEYIPNGSVSTHLYGAAQLSREKLEFKHRLSIALG  183

Query  895   TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  716
              AKGL HLH   P +VH +FKT NVLVDENFIPKVADAG+ + L     D AGPS  +  
Sbjct  184   AAKGLFHLHSLTPRLVHKDFKTANVLVDENFIPKVADAGLRNFLGRA--DTAGPSSEVTA  241

Query  715   SP-FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS-  542
                F+ PEV +   FSE  D+Y FGVFL EL++GREA       S+Q++++W + +    
Sbjct  242   DDIFLAPEVKEFRRFSEKCDVYSFGVFLLELVSGREATETPSPESSQSLVEWSQNNQDYS  301

Query  541   --DDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
                D+++ +L   ++ EGM + IRL +RC     + RP M+ V VE +RILEKE   +T 
Sbjct  302   MFSDIIDPKLASSFTIEGMEEFIRLIVRCVDVSSERRPVMNYVMVELDRILEKERSLTTV  361

Query  367   MGEASATLTLGSQLF  323
             M E    +TLGSQLF
Sbjct  362   MVEGMPNVTLGSQLF  376



>ref|XP_008231229.1| PREDICTED: nodulation receptor kinase [Prunus mume]
Length=380

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 221/358 (62%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L+  R  +R S+T SSDPS  V +  G  +S             R F+M+EL  ATKNF 
Sbjct  30    LSHNRSVSRTSETGSSDPSVQVGRHAGVELSM---------RETRRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             ++NLIG G FG V+ GFL DG +VAIK R   P Q+F  EV  LS  QHR++V LLGYCQ
Sbjct  81    DTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+ +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH
Sbjct  141   ENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+ + KVADAGI + L  +  D AGPS  +     F+ PEV +   FSE
Sbjct  201   KDFKTANVLVDEDLLAKVADAGIRNFLGRV--DIAGPSSQVTADEIFLAPEVREFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAE  497
              SDIY FGVFL EL++GREA  +    SNQ +++WV+    + +   +++ RL   ++ E
Sbjct  259   KSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              M   I L MRC     + RP M  V +E +RI EKEI  +T MGE  +T+  GSQLF
Sbjct  319   AMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKEISLTTIMGEGPSTVIPGSQLF  376



>ref|XP_007216792.1| hypothetical protein PRUPE_ppa023700mg [Prunus persica]
 gb|EMJ17991.1| hypothetical protein PRUPE_ppa023700mg [Prunus persica]
Length=380

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 221/358 (62%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L+  R  +R S+T SSDPS  V +  G  +S             R F+M+EL  ATKNF 
Sbjct  30    LSHNRSVSRTSETGSSDPSVQVGRHAGVELSM---------RETRRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             ++NLIG G FG V+ GFL DG +VAIK R   P Q+F  EV  LS  QHR++V LLGYCQ
Sbjct  81    DTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+ +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH
Sbjct  141   ENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+ + KVADAGI + L  +  D AGPS  +     F+ PEV +   FSE
Sbjct  201   KDFKTANVLVDEDLLAKVADAGIRNFLGRV--DIAGPSSQVTADEMFLAPEVREFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAE  497
              SDIY FGVFL EL++GREA  +    SNQ +++WV+    + +   +++ RL   ++ E
Sbjct  259   KSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              M   I L MRC     + RP M  V +E +RI EKEI  +T MGE  +T+  GSQLF
Sbjct  319   AMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKEISLTTIMGEGPSTVIPGSQLF  376



>ref|XP_008802108.1| PREDICTED: receptor-like protein kinase THESEUS 1 isoform X2 
[Phoenix dactylifera]
Length=303

 Score =   313 bits (803),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 195/276 (71%), Gaps = 3/276 (1%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             +L  +  +NR+S+T SSDP   +E   GG ++S         +GAR F  +EL QATKNF
Sbjct  30    ILHRRTCANRSSETGSSDPPT-IEWTRGGRITSAGGGHATEHQGARQFTFEELSQATKNF  88

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             +ESNL+G GSFGLV+KG L DGTIVAIK R   P Q+F EEV RLS   HRNLV L+GYC
Sbjct  89    NESNLVGSGSFGLVYKGLLLDGTIVAIKRRRGAPLQEFVEEVKRLSEICHRNLVTLIGYC  148

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE G Q+LV E+LPNG++  HLY + R   T+LEFKQRLS+A G AKGL HLH   P VV
Sbjct  149   QEGGLQMLVFEHLPNGSISRHLYDIARGPVTRLEFKQRLSVAIGAAKGLAHLHNLVPQVV  208

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FK+ NVLVDENFI KVADAGI+ LL+ +  + AGPS S   + F DPEV + G  SE
Sbjct  209   HKDFKSSNVLVDENFIAKVADAGIAQLLQRL--EDAGPSQSSGGNVFQDPEVEEFGALSE  266

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV  560
             ASD+Y FGVFL ELITGREAAH    GS++++ QWV
Sbjct  267   ASDVYSFGVFLLELITGREAAHFFSPGSDESLAQWV  302



>ref|XP_006291298.1| hypothetical protein CARUB_v10017433mg [Capsella rubella]
 gb|EOA24196.1| hypothetical protein CARUB_v10017433mg [Capsella rubella]
Length=380

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 227/367 (62%), Gaps = 15/367 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             LF+      +  ++  +R S+T SSDPS    Q+       L++        AR F M+E
Sbjct  21    LFVFLLWFCVFRRKNLSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEE  71

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRN
Sbjct  72    LAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRN  131

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL H
Sbjct  132   LVTLLGYCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAH  191

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   P ++H +FKT NVLVDENFI KVADAG+ + L     +    SH +    F+ PE
Sbjct  192   LHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REEVGTSSHIVADQIFLSPE  249

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEH  524
             V +   FSE SD+Y FGVFL EL++GREA+      S QT+++W++      D   +++ 
Sbjct  250   VQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSAQTLVEWMQKLTDYADIPMMIDE  309

Query  523   RLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATL  344
             RL G Y+AEG+ +LI L +RC     ++RP M  V  E ER+L+KE+  +T MGE + T+
Sbjct  310   RLGGTYTAEGVEELITLTLRCVDVSSEKRPTMSYVVTELERVLDKEVSLTTVMGEGTPTV  369

Query  343   TLGSQLF  323
             TLGSQLF
Sbjct  370   TLGSQLF  376



>ref|XP_008365347.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
 ref|XP_008365348.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
Length=398

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 214/350 (61%), Gaps = 15/350 (4%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R S+T SSDPS  V +  G  +S             R F M+EL  ATK+F + NLIG G
Sbjct  56    RTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLATKHFSDKNLIGQG  106

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV
Sbjct  107   KFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQXLV  166

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH +FKT NV
Sbjct  167   YEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSPRLVHKDFKTANV  226

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDIYGFG  644
             LVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE SD+Y FG
Sbjct  227   LVDENFIAKVADAGIRNFLGRV--DIAGSSSQVXADEMFLAPEVREFRXFSEKSDVYSFG  284

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRL  473
             VFL EL++GREA       SNQ M++WV       +   +++ RL   ++ E M  LI+L
Sbjct  285   VFLLELVSGREARDFASSDSNQNMVEWVXNIQEGSNVSCIIDERLGNSFTGEAMEGLIQL  344

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              MRC     + RP+M  V  E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  345   IMRCVEXXSERRPSMSNVVTELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  394



>ref|XP_006844647.1| hypothetical protein AMTR_s00016p00235240 [Amborella trichopoda]
 gb|ERN06322.1| hypothetical protein AMTR_s00016p00235240 [Amborella trichopoda]
Length=388

 Score =   316 bits (809),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 236/365 (65%), Gaps = 18/365 (5%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP-----EGARVFRMQELEQ  1223
             +   +   +  S+  SSD S  V       +    L  G  P     + AR FR++EL+ 
Sbjct  30    IFRKRNIPSNTSENGSSDTSVQVSHDRSIEI----LLTGHTPLASDSQEARHFRLEELDL  85

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF+E NLIG G FGLV+KG L DGT+VAIK R APP+Q+F +EV +L   +HRNLV+
Sbjct  86    ATKNFNEKNLIGEGRFGLVYKGLLHDGTVVAIKRRHAPPKQKFIDEVRQLCSIRHRNLVS  145

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLG CQE G Q+L+ EY+PNG++  HLY   +   TKLEFK RL IA G A+GL HLH  
Sbjct  146   LLGCCQERGQQMLIYEYIPNGSVSRHLY--EQHPQTKLEFKHRLLIALGAARGLDHLHAM  203

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQS  683
              PP+VH +FKT NVLVDENFI KVAD G+S +L+ +N   AGPS  +    F+DPEV + 
Sbjct  204   NPPMVHKDFKTHNVLVDENFIAKVADFGVSDMLERVND--AGPSQMMGVDTFMDPEVRKL  261

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMG  512
             G  S+ SD+Y FGVFL EL++GREA   +   +  +++Q  +  L S+D   +++  +  
Sbjct  262   GRLSDKSDVYSFGVFLLELLSGREAVKPQFPNNGPSLVQMAKTCLESEDITSIIDPGMGE  321

Query  511   KYSAEGMRDLIRLAMRCTSFPGKE-RPNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
              ++AEG++++I LA+ C  +P +E RP M  V  E +RILEKE+  +T MGEA+  + LG
Sbjct  322   SFTAEGIKEMINLAIICV-YPSRERRPMMHDVMAELDRILEKEMSLTTIMGEATPIVILG  380

Query  334   SQLFT  320
             SQLFT
Sbjct  381   SQLFT  385



>ref|XP_008379039.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
 ref|XP_008379040.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Malus 
domestica]
Length=398

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 214/350 (61%), Gaps = 15/350 (4%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R S+T SSDPS  V +  G  +S             R F M+EL  ATK+F + NLIG G
Sbjct  56    RTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLATKHFSDKNLIGQG  106

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV
Sbjct  107   KFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQXLV  166

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH +FKT NV
Sbjct  167   YEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSPRLVHKDFKTANV  226

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDIYGFG  644
             LVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE SD+Y FG
Sbjct  227   LVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPEVREFRXFSEKSDVYSFG  284

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRL  473
             VFL EL++GREA       SNQ M++WV       +   +++ RL   ++ E M  LI+L
Sbjct  285   VFLLELVSGREARDFASSDSNQNMVEWVXNIQEGSNVSCIIDERLGNSFTGEAMEGLIQL  344

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              MRC     + RP+M  V  E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  345   IMRCVEXXSERRPSMSNVVTELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  394



>ref|NP_189304.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE77201.1| protein kinase family protein [Arabidopsis thaliana]
Length=380

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 226/367 (62%), Gaps = 15/367 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             LF+      +  ++  +R S+T SSDPS    Q+       L++        AR F M+E
Sbjct  21    LFVFLLWFCVFRRKNLSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEE  71

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRN
Sbjct  72    LAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRN  131

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLG+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL H
Sbjct  132   LVTLLGFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAH  191

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  192   LHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEH  524
             V +   FSE SD+Y FGVFL EL++GREA+      S QT++ W++      D   +++ 
Sbjct  250   VQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVDWMQNLTDYADIPMMIDE  309

Query  523   RLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATL  344
             RL G Y+AEG+ +LI L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+
Sbjct  310   RLGGTYTAEGVEELITLTLRCVDVSSEKRPTMSFVVTELERILDKEVSLTTVMGEGTPTV  369

Query  343   TLGSQLF  323
             TLGSQLF
Sbjct  370   TLGSQLF  376



>ref|XP_006645278.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Oryza brachyantha]
Length=364

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 210/316 (66%), Gaps = 11/316 (3%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT+NF   NLIG G FG V+KG L DGTIVAIK R +PP  +F  EV
Sbjct  53    QGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEV  112

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
               LS  +HRNLVNLLGYCQE+G Q+LV EY+PNG++  HL+G       KLEFKQRLSIA
Sbjct  113   NYLSSIRHRNLVNLLGYCQEDGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIA  172

Query  901   SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  722
              G AKGL HLH   PP +H NFKT NVLVDE+FIPKVADAGI  LL  +    AGPS   
Sbjct  173   HGAAKGLSHLHSLTPPAIHMNFKTANVLVDEDFIPKVADAGIRGLLDRLG--GAGPSSRT  230

Query  721   QPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS  542
                PF+DP + +S  FS  SD+Y FGVFL EL++G+ A       S+Q++++WV+ +  S
Sbjct  231   SNDPFLDPWMRESINFSVQSDVYSFGVFLVELLSGQRAL------SDQSIIRWVQNYQQS  284

Query  541   DD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGST  371
              D   + ++R+   Y++  MR+ +RL   C +   + RP+M +V  E  RI E+E+  +T
Sbjct  285   SDISAIADNRMASGYTSGSMREFLRLTSWCVNPTIEHRPSMSLVEAEINRIREQEMRLTT  344

Query  370   AMGEASATLTLGSQLF  323
              M E++ T+TLGSQLF
Sbjct  345   IMPESTPTVTLGSQLF  360



>ref|XP_008341211.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Malus 
domestica]
Length=380

 Score =   315 bits (807),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 215/347 (62%), Gaps = 15/347 (4%)
 Frame = -2

Query  1351  DTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSFG  1172
             +T SSDPS  V +  G  +S             R F+M+EL  ATKNF + NLIG G FG
Sbjct  41    ETGSSDPSVQVGRHGGVELS---------MRETRRFQMEELSLATKNFSDKNLIGQGKFG  91

Query  1171  LVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEY  992
              V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV EY
Sbjct  92    EVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQFLVYEY  151

Query  991   LPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVD  812
             + +G++ +HLYG G+ S  KLEFK RL+IA G AKGL HLH   P +VH +FKT NVLVD
Sbjct  152   IHSGSVSSHLYGTGQHSREKLEFKNRLTIAQGAAKGLAHLHSLSPRLVHKDFKTANVLVD  211

Query  811   ENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDIYGFGVFL  635
             ENFI KVADAGI + L  +  D AG S  +     F+ PEV + G FSE SD+Y FGVFL
Sbjct  212   ENFIAKVADAGIRNFLGXV--DIAGSSSQVTADEMFLAPEVREFGRFSEKSDVYSFGVFL  269

Query  634   WELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRLAMR  464
              EL++GREA       S Q M++WV+      +   +++ RL   ++ E M  LI+L MR
Sbjct  270   LELVSGREARDFASSDSTQNMVEWVQNIQEGSNVSCIIDERLGNSFTGEAMEGLIQLIMR  329

Query  463   CTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             C     + RP M  V +E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  330   CVEASSERRPGMSHVVMELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  376



>ref|XP_008365349.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Malus 
domestica]
Length=393

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 214/350 (61%), Gaps = 15/350 (4%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R S+T SSDPS  V +  G  +S             R F M+EL  ATK+F + NLIG G
Sbjct  51    RTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLATKHFSDKNLIGQG  101

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV
Sbjct  102   KFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQXLV  161

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH +FKT NV
Sbjct  162   YEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSPRLVHKDFKTANV  221

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDIYGFG  644
             LVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE SD+Y FG
Sbjct  222   LVDENFIAKVADAGIRNFLGRV--DIAGSSSQVXADEMFLAPEVREFRXFSEKSDVYSFG  279

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRL  473
             VFL EL++GREA       SNQ M++WV       +   +++ RL   ++ E M  LI+L
Sbjct  280   VFLLELVSGREARDFASSDSNQNMVEWVXNIQEGSNVSCIIDERLGNSFTGEAMEGLIQL  339

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              MRC     + RP+M  V  E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  340   IMRCVEXXSERRPSMSNVVTELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  389



>ref|XP_008379041.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Malus 
domestica]
Length=393

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 214/350 (61%), Gaps = 15/350 (4%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R S+T SSDPS  V +  G  +S             R F M+EL  ATK+F + NLIG G
Sbjct  51    RTSETGSSDPSIQVGRHGGVELS---------MRETRCFHMEELSLATKHFSDKNLIGQG  101

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V+ GFL DG +VAIK R     Q+F  EV  LS  QHRN+V LLGYCQEN  Q LV
Sbjct  102   KFGEVYMGFLQDGMLVAIKKRPGTASQEFINEVHYLSAIQHRNIVTLLGYCQENNLQXLV  161

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY  +G++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P +VH +FKT NV
Sbjct  162   YEYJHSGSVSSHLYGTGQHSREKLEFKNRLSIAQGAAKGLAHLHSLSPRLVHKDFKTANV  221

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDIYGFG  644
             LVDENFI KVADAGI + L  +  D AG S  +     F+ PEV +   FSE SD+Y FG
Sbjct  222   LVDENFIAKVADAGIRNFLGRV--DIAGSSSQVTADEMFLAPEVREFRXFSEKSDVYSFG  279

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIRL  473
             VFL EL++GREA       SNQ M++WV       +   +++ RL   ++ E M  LI+L
Sbjct  280   VFLLELVSGREARDFASSDSNQNMVEWVXNIQEGSNVSCIIDERLGNSFTGEAMEGLIQL  339

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              MRC     + RP+M  V  E +RI+EKE+  +T MGE ++T+  GSQLF
Sbjct  340   IMRCVEXXSERRPSMSNVVTELDRIVEKEMSLTTIMGEGTSTVIPGSQLF  389



>dbj|BAC43728.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAO63400.1| At3g26700 [Arabidopsis thaliana]
Length=380

 Score =   315 bits (807),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 226/367 (62%), Gaps = 15/367 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             LF+      +  ++  +R S+T SSDPS    Q+       L++        AR F M+E
Sbjct  21    LFVFLLWFCVFRRKNLSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEE  71

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRN
Sbjct  72    LAQATKSFTNKSLIGIGKFGGVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRN  131

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLG+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL H
Sbjct  132   LVTLLGFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAH  191

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  192   LHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEH  524
             V +   FSE SD+Y FGVFL EL++GREA+      S QT++ W++      D   +++ 
Sbjct  250   VQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVDWMQNLTDYADIPMMIDE  309

Query  523   RLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATL  344
             RL G Y+AEG+ +LI L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+
Sbjct  310   RLGGTYTAEGVEELITLTLRCVDVSSEKRPTMSFVVTELERILDKEVSLTTVMGEGTPTV  369

Query  343   TLGSQLF  323
             TLGSQLF
Sbjct  370   TLGSQLF  376



>ref|XP_011024761.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Populus euphratica]
Length=377

 Score =   315 bits (806),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 226/358 (63%), Gaps = 17/358 (5%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  K+  +R S+T SS+ S    +  G  +SS         + AR F M+EL  ATK F 
Sbjct  29    LYHKKTVSRTSETGSSETSVQ-GRHAGIELSS---------QEARRFEMEELGLATKGFS  78

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             E NLIG G FG V+KG L +G IVAIK R   P  +F +EV  LS  QHRNLV LLGYCQ
Sbjct  79    EKNLIGLGKFGEVYKGLLNNGMIVAIKKRPGAPSPEFVDEVRYLSPIQHRNLVTLLGYCQ  138

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+ +G++ NHLYG+G+    KLEFK RLSIA G AKGL HLH Q P +VH
Sbjct  139   ENNMQFLVYEYISSGSVSNHLYGVGQTLDGKLEFKHRLSIALGAAKGLAHLHSQTPRLVH  198

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ + L  +  D AGPS  +     F+ PEV +   FSE
Sbjct  199   KNFKTANVLVDENFIAKVADAGLRNFLGRV--DVAGPSTQVTADEIFLAPEVREFRQFSE  256

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA---HLSSDDLVEHRLMGKYSAE  497
              SD++ FGVFL EL++G+EA       ++Q +++WV+    + +   +V+HR+   ++AE
Sbjct  257   KSDVFSFGVFLLELLSGKEATE-PSPETSQNLVEWVQKTQDYTNFSTIVDHRMGSSFTAE  315

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L ++C       RP M  V +E +RILEKE   +T MGE + T+TLGSQLF
Sbjct  316   GMEEFIQLMLQCVEPSSDRRPIMSYVVMELDRILEKERNLTTVMGEGTPTVTLGSQLF  373



>ref|XP_002875333.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51592.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=380

 Score =   315 bits (806),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 227/367 (62%), Gaps = 15/367 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             LF+      +  ++  +R S+T SSDPS    Q+       L++        AR F M+E
Sbjct  21    LFVFLLWFCVFRRKNLSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEE  71

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRN
Sbjct  72    LAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRN  131

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLG+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL H
Sbjct  132   LVTLLGFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAH  191

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   P ++H +FKT NVLVDENFI KVADAG+ + L     +    SH +    F+ PE
Sbjct  192   LHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REEVGTSSHIVADQIFLSPE  249

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEH  524
             V +   FSE SD+Y FGVFL EL++GREA+      S QT+++W++      D   +++ 
Sbjct  250   VQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQNLTDYADIPVMIDE  309

Query  523   RLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATL  344
             RL G Y+AEG+ +LI L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+
Sbjct  310   RLGGTYTAEGVEELITLTLRCVDVSSEKRPTMSFVVTELERILDKEVSLTTVMGEGTPTV  369

Query  343   TLGSQLF  323
             TLGSQLF
Sbjct  370   TLGSQLF  376



>ref|XP_007161600.1| hypothetical protein PHAVU_001G083100g [Phaseolus vulgaris]
 gb|ESW33594.1| hypothetical protein PHAVU_001G083100g [Phaseolus vulgaris]
Length=377

 Score =   314 bits (805),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 224/364 (62%), Gaps = 29/364 (8%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGG---VPEGARVFRMQELEQATK  1214
             L+ +R  +R S+T SSDPS               + R G   +P   R F M+EL  ATK
Sbjct  29    LSRQRNVSRTSETGSSDPSQ--------------VGRHGAIELPRDTRRFEMEELSLATK  74

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             +F E NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LLG
Sbjct  75    SFSEKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSAIHHRNLVSLLG  134

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             YCQEN  Q L+ EY+PNG++ +HLYG G+ S  KLEFK RLSIA G AKGL HLH   P 
Sbjct  135   YCQENSLQFLIYEYVPNGSVSSHLYGAGQQSREKLEFKHRLSIAQGAAKGLAHLHSLSPR  194

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAG-PSHSIQPSPFIDPEVNQSGV  677
             +VH NFKT NVLVDENFI KVADAG+ + L +I  D AG  S +     F+  EV +   
Sbjct  195   LVHKNFKTANVLVDENFISKVADAGLRNFLGKI--DIAGSSSQAATDEIFLASEVREFRR  252

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLM  515
             FSE SD Y FGVFL EL++G+EA       SNQ +++WV   LS++D       ++  L 
Sbjct  253   FSEKSDAYSFGVFLLELLSGKEATGSPFPDSNQNLVEWV---LSNEDRGMMSYTIDRTLE  309

Query  514   GKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
                + EGM D I L +RC     ++RP M  V +E +RILEKE+  +T MGE + T+TLG
Sbjct  310   SSCTPEGMEDYIMLMIRCIDPSSEKRPAMSYVEMELDRILEKEMNLTTIMGEGTPTVTLG  369

Query  334   SQLF  323
             SQLF
Sbjct  370   SQLF  373



>ref|XP_009129490.1| PREDICTED: nodulation receptor kinase-like [Brassica rapa]
 ref|XP_009129491.1| PREDICTED: nodulation receptor kinase-like [Brassica rapa]
Length=374

 Score =   314 bits (805),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 224/353 (63%), Gaps = 17/353 (5%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             R+ N +  T SSDPS+   Q+       L++        +R F M+EL QATK+F   +L
Sbjct  32    RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFEMEELAQATKSFTHKSL  82

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+KG L DG +VAIK R+  P Q+F  EV  LS  +HRNLV LLGYCQE+  
Sbjct  83    IGVGKFGEVYKGLLQDGVLVAIKRRTGLPTQEFVNEVRYLSAIKHRNLVTLLGYCQESNM  142

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q LV EY+PNG++ NHLYG G    ++LEF+ RL+I+ G AKGL HLH   P ++H +FK
Sbjct  143   QFLVYEYVPNGSVSNHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSPRLIHKDFK  199

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDENFI KVADAG+ + L     DA   SH +    F+ PEV +   FSE SD+Y
Sbjct  200   TANVLVDENFIAKVADAGVRNFLG--REDAGISSHVVADHIFLSPEVQEFRSFSEKSDVY  257

Query  652   GFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDL  482
              FGVFL EL++GREA+      S QT+++W++      +   +++ RL G Y+AEG+ ++
Sbjct  258   AFGVFLLELVSGREASEPSPSSSTQTLVEWMQNITDYTEIPAMIDERLGGTYTAEGVEEV  317

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  318   ITLTLICLDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  370



>emb|CAA66819.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB01733.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
Length=374

 Score =   314 bits (805),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 224/364 (62%), Gaps = 15/364 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             LF+      +  ++  +R S+T SSDPS    Q+       L++        AR F M+E
Sbjct  21    LFVFLLWFCVFRRKNLSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEE  71

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRN
Sbjct  72    LAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRN  131

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLG+CQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL H
Sbjct  132   LVTLLGFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAH  191

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   P ++H +FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PE
Sbjct  192   LHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPE  249

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLM  515
             V +   FSE SD+Y FGVFL EL++GREA+      S QT++ WV  H  +     +RL 
Sbjct  250   VQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVDWVCNHTQNR---ANRLG  306

Query  514   GKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
             G Y+AEG+ +LI L +RC     ++RP M  V  E ERIL+KE+  +T MGE + T+TLG
Sbjct  307   GTYTAEGVEELITLTLRCVDVSSEKRPTMSFVVTELERILDKEVSLTTVMGEGTPTVTLG  366

Query  334   SQLF  323
             SQLF
Sbjct  367   SQLF  370



>ref|XP_006338747.1| PREDICTED: nodulation receptor kinase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338748.1| PREDICTED: nodulation receptor kinase-like isoform X2 [Solanum 
tuberosum]
Length=380

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/355 (48%), Positives = 221/355 (62%), Gaps = 15/355 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             KR  +  SDT SSDPS  V +  G  ++S         + AR F ++EL  ATK F + +
Sbjct  33    KRTISTTSDTGSSDPSVQVGKNAGVELTS---------QDARPFHIEELSLATKGFSDKS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK RSA   Q+F +EV  LS  QHRNLV LLGYCQEN 
Sbjct  84    LIGQGKFGEVYKGLLHDGMLVAIKRRSAVASQEFIDEVRYLSSIQHRNLVTLLGYCQEND  143

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              Q LV EY+PNG++  HLYG G  +  KLEFK RLSIA G AKGL HLH   P ++H +F
Sbjct  144   QQNLVYEYIPNGSVSIHLYGGGHVTQEKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDF  203

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASD  659
             KT NVLVDENFI KVADAG+ + L     + AGPS  +     F+ PEV +   FSE SD
Sbjct  204   KTANVLVDENFIAKVADAGLRNFLGRF--EVAGPSSRVAADEIFLAPEVREFRRFSEKSD  261

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
              Y FG+FL EL++G EA  +     N  +++WVE +  S +   +++ RL   ++ E M 
Sbjct  262   AYSFGIFLLELVSGHEAMDLLSSDLNVNIVEWVENNQDSGNISAIIDPRLGNSFTTESME  321

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             + ++L +RC     + RP M  V +E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  322   EFMQLTVRCVDPSSERRPTMSYVVMELDRILEKEMSLTTIMGEGTPVVTLGSQLF  376



>emb|CDY48978.1| BnaA02g28180D [Brassica napus]
Length=374

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 223/353 (63%), Gaps = 17/353 (5%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             R+ N +  T SSDPS+   Q+       L++        +R F M+EL QATK+F   +L
Sbjct  32    RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFEMEELAQATKSFTHKSL  82

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQE+  
Sbjct  83    IGTGKFGEVYKGLLQDGVLVAIKRRHGLPTQEFVNEVRYLSSIKHRNLVTLLGYCQESNM  142

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q LV EY+PNG++ NHLYG G    ++LEF+ RL+I+ G AKGL HLH   P ++H +FK
Sbjct  143   QFLVYEYVPNGSVSNHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSPRLIHKDFK  199

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDENFI KVADAG+ + L     DA   SH +    F+ PEV +   FSE SD+Y
Sbjct  200   TANVLVDENFIAKVADAGVRNFLG--REDAGTSSHVVADHIFLSPEVQEFRSFSEKSDVY  257

Query  652   GFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDL  482
              FGVFL EL++GREA+      S QT+++W++      +   +++ RL G Y+AEG+ ++
Sbjct  258   AFGVFLLELVSGREASEPSPSSSTQTLVEWMQNITDYTEIPAMIDERLGGTYTAEGVEEV  317

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  318   ITLTLICLDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  370



>ref|XP_011098971.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
 ref|XP_011098972.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
 ref|XP_011098973.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
Length=379

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 218/348 (63%), Gaps = 15/348 (4%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             S+T SSDPS  V    GG V      R      AR F M+E+  ATKNF + +LIG G F
Sbjct  39    SETGSSDPSVQV----GGAVGIEFTLRD-----ARRFEMEEMSLATKNFSDKSLIGQGKF  89

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             G V+KG L DG +VAIK R  PP Q+F +EV  LS  QHRNLV+LLGYCQE+  QILV E
Sbjct  90    GEVYKGLLHDGMLVAIKKRPGPPSQEFIDEVRYLSSIQHRNLVSLLGYCQESDLQILVYE  149

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             Y+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P ++H +FKT NVLV
Sbjct  150   YIPNGSVSIHLYGAGQVSQEKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDFKTANVLV  209

Query  814   DENFIPKVADAGISSLLKEINHDAAGP-SHSIQPSPFIDPEVNQSGVFSEASDIYGFGVF  638
             DENFI KVADAG+ + L     D AGP S       F+ PEV++   FS+ SD Y FGVF
Sbjct  210   DENFIAKVADAGLRNFLGRF--DYAGPSSQDAADEIFLAPEVSEFRRFSDKSDAYSFGVF  267

Query  637   LWELITGREAAHIRGLGSNQTMLQWVEAHLSS---DDLVEHRLMGKYSAEGMRDLIRLAM  467
             L EL++G+EA  +     N  +++WV     S     +++ RL   ++ EGM + ++L +
Sbjct  268   LLELVSGQEARGLLSSDVNHNLVEWVHNLQDSGSISSIIDQRLGNSFTTEGMEEFLQLIV  327

Query  466   RCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              C +   + RP M  V  E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  328   HCVNPSSERRPAMSYVVTELDRILEKEMSLTTIMGEGTPVVTLGSQLF  375



>ref|XP_010090930.1| Nodulation receptor kinase [Morus notabilis]
 gb|EXB41415.1| Nodulation receptor kinase [Morus notabilis]
Length=401

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 227/355 (64%), Gaps = 17/355 (5%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L+  R  +R S+T SSDPS    +  G  +    L R       R F+M+EL  ATKNF 
Sbjct  30    LSHHRSLSRTSETGSSDPSIQAGRHAGVEL----LIRE-----TRRFQMEELSHATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK RS  P Q+F +EV  LS  QHRNLV LLGYCQ
Sbjct  81    DKNLIGQGKFGEVYKGLLHDGMLVAIKKRSGAPTQEFIDEVHYLSPIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+PNG++ +HLYG G+ S  +LEFK RLSIA G AKGL  LH Q P ++H
Sbjct  141   ENNLQFLVYEYIPNGSVSSHLYGAGQHSRERLEFKHRLSIALGAAKGLAFLHSQSPRLLH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENFI KVADAG+ + L  ++   AGPS  +     F+ PEV +   FSE
Sbjct  201   KDFKTANVLVDENFIAKVADAGLRNFLGRVS--IAGPSSQVTADEIFLAPEVKEFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW---VEAHLSSDDLVEHRLMGKYSAE  497
              SD+Y FGVFL EL++G+EA       S+Q +++W   VE + +   +++ R+   ++AE
Sbjct  259   KSDVYSFGVFLLELVSGQEATEAALSNSSQNLVEWVQNVEDNSNMSSIIDERMGNSFTAE  318

Query  496   GMRDLIRLAMRCTSFPGKER-PNMDMVAVEAERILEKEIMGSTAMGEASATLTLG  335
             GM ++I L ++C   P  ER P M  V ++ ++ILEKE+  +T MGEA+ T+ LG
Sbjct  319   GMEEVIELIIQCVQ-PSSERLPVMSYVVMQIDKILEKEMSLTTVMGEATPTVILG  372



>gb|KHG04671.1| Proline-rich receptor-like protein kinase PERK8 [Gossypium arboreum]
Length=389

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 229/372 (62%), Gaps = 38/372 (10%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  KR  +R S+T SSDPS  V+ +  G   SL          AR F ++EL  ATKNF 
Sbjct  34    LFHKRGVSRTSETGSSDPS--VQGRHIGVQLSL--------REARRFELRELSLATKNFS  83

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R+  P Q+F +E        HRNLV LLGYCQ
Sbjct  84    DRNLIGEGKFGEVYKGLLQDGMLVAIKKRAGAPSQEFIDE--------HRNLVTLLGYCQ  135

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q LV EY+PNG++  HLYG+G+ S+ K+EFK RLSIA G AKGL HLH   P +VH
Sbjct  136   ENNQQFLVYEYIPNGSVSIHLYGVGQVSAQKIEFKHRLSIALGAAKGLAHLHSLSPRLVH  195

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENFI KVADAG+ + L  I  D AGPS  +     F+ PEV +   FSE
Sbjct  196   KDFKTANVLVDENFIAKVADAGLRNFLGRI--DVAGPSSQVTADEIFLAPEVREFRRFSE  253

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL-----------SSDD-----  536
              SD+Y FGVFL EL++GREA+ +    S + +++W  A+            +S D     
Sbjct  254   KSDVYSFGVFLLELVSGREASELPSSNSTENLVEWGFANAMDWRCYELLVQNSHDYSNIS  313

Query  535   -LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGE  359
              +++ RL   ++AEGM + IRL +RC     + RP M  V  E +RIL+KE+  +T MGE
Sbjct  314   SIIDPRLGSSFTAEGMEEFIRLTVRCLEPSSERRPTMSYVVAELDRILDKEMSLTTVMGE  373

Query  358   ASATLTLGSQLF  323
              S T+TLGSQLF
Sbjct  374   GSPTVTLGSQLF  385



>ref|XP_004143767.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus]
 ref|XP_004171662.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus]
 gb|KGN51138.1| hypothetical protein Csa_5G466350 [Cucumis sativus]
Length=379

 Score =   313 bits (802),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 222/366 (61%), Gaps = 15/366 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             + IL R   L   R + R S+T SSDPS  V +  G  ++            AR F M E
Sbjct  22    IIILLR--FLARSRNTARTSETGSSDPSVQVGRHVGIELT---------LRDARRFEMAE  70

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L  AT +F + NLIG G FG V+KG L DG  VAIK R   P Q F +EV  LS  QHRN
Sbjct  71    LVLATNDFSDKNLIGEGKFGEVYKGMLQDGMFVAIKKRHGAPSQDFVDEVHYLSSIQHRN  130

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHL  872
             LV LLGYCQEN  Q L+ +Y+PNG++ +H+YG  + S+ KLEFK RLSIA G AKGL HL
Sbjct  131   LVTLLGYCQENNLQFLIFDYIPNGSVSSHIYGTEQRSAEKLEFKIRLSIALGAAKGLSHL  190

Query  871   HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEV  692
             H   P + H NFKT NVLVDENFI KVADAG+ ++++  +  +   S +     F+ PEV
Sbjct  191   HSMSPRLTHRNFKTSNVLVDENFIAKVADAGLHNVMRRFDV-SESSSRATADEIFLAPEV  249

Query  691   NQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHR  521
              +   FSE SD+Y FGVFL EL++G++A        N T++ W++ +    D   + + R
Sbjct  250   KEFRQFSEKSDVYSFGVFLLELVSGQKATDAPVSNPNYTLVDWIQNNQRKSDIGSITDPR  309

Query  520   LMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLT  341
             L   ++ EGM +L+ L ++C  +  + RP M  V  E ERILEKE+  +T MGE S T+T
Sbjct  310   LGKSFTEEGMGELMDLILQCVEYSSERRPVMSYVVTELERILEKEMNLTTVMGEGSPTVT  369

Query  340   LGSQLF  323
             LGSQLF
Sbjct  370   LGSQLF  375



>emb|CDY13653.1| BnaA06g32700D [Brassica napus]
Length=377

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 225/366 (61%), Gaps = 16/366 (4%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQEL  1229
             F L    +   K  S  + +T SSDPS      T G   ++ L+       AR F M+EL
Sbjct  23    FFLIWFCIFRRKNASRTSDETGSSDPS------TQGRNVAIELSM----REARRFEMEEL  72

Query  1228  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  1049
              QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNL
Sbjct  73    AQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNL  132

Query  1048  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHL  872
             V LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HL
Sbjct  133   VTLLGYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISIGAAKGLAHL  192

Query  871   HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEV  692
             H   P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PEV
Sbjct  193   HSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPEV  250

Query  691   NQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHR  521
              +   FSE SD+Y FGVFL EL++GREA+ +    S QT+++W++      +   +++ R
Sbjct  251   QEFRRFSEKSDVYAFGVFLLELVSGREASELSPSSSTQTLVEWMQNITDYTEIPGMIDER  310

Query  520   LMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLT  341
             L G Y+AEG+ ++I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+T
Sbjct  311   LGGTYTAEGVEEVITLTLTCLDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVT  370

Query  340   LGSQLF  323
             LGSQLF
Sbjct  371   LGSQLF  376



>ref|XP_010037055.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Eucalyptus grandis]
 ref|XP_010037064.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Eucalyptus grandis]
Length=317

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 199/278 (72%), Gaps = 4/278 (1%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT+ FDESNLIG
Sbjct  37    ANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELATRQFDESNLIG  96

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LLGYC ENG Q+
Sbjct  97    HGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLLGYCLENGCQM  156

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   PP+VH NFKT 
Sbjct  157   LVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRPPLVHKNFKTA  216

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE  + G FSE SD Y F
Sbjct  217   NVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPEAGELGGFSEMSDAYSF  275

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL  533
             GVFL EL+TG EAA    L  +++++QW++ +  S DL
Sbjct  276   GVFLLELVTG-EAAPNMILSGHESLIQWLQNY--SKDL  310



>ref|XP_010682892.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   313 bits (801),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 226/361 (63%), Gaps = 21/361 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R ++R S+T SS+PS  V  K+GG   S+          AR F  +EL  ATKNF 
Sbjct  30    LFHSRSASRTSETGSSEPSYQV-GKSGGIELSI--------REARRFSWEELSAATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             E +LIG G FG V+KG L +G +VAIK R   P Q+F EEV  LS  QHRN+V LLGYCQ
Sbjct  81    EQSLIGVGKFGEVYKGLLTEGVLVAIKKRPVAPTQEFVEEVRYLSSIQHRNIVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E   QILV EY+PNG++ +HLYG G  S  KLEFK RLSIA G AKGL HLH   P ++H
Sbjct  141   EKDQQILVYEYVPNGSVSSHLYGPGHGSREKLEFKHRLSIALGAAKGLAHLHSISPRLLH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENF+ KVADAGI + L     D  GPS  ++    F+ PEV +   FSE
Sbjct  201   KDFKTSNVLVDENFVAKVADAGIRNFLG--RSDVVGPSSQVEADEVFLAPEVKEFRQFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLMGKY  506
              SD+Y FGVFL EL+ G+EA       SNQT+++ V   L+ +D      +V+ RL  ++
Sbjct  259   KSDVYSFGVFLLELVCGQEARESYSPDSNQTLVERV---LNYNDFSTVSTMVDPRLGNRF  315

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM + ++L +RC     + RP +  V  E + ILEKE+  +T MGE + T+TLGSQL
Sbjct  316   TVEGMEEFVQLIVRCIDPSSELRPGISYVVSELDGILEKEMNLTTGMGEGTPTVTLGSQL  375

Query  325   F  323
             F
Sbjct  376   F  376



>ref|XP_006598688.1| PREDICTED: protein kinase family protein isoform X5 [Glycine 
max]
Length=378

 Score =   312 bits (799),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 220/361 (61%), Gaps = 23/361 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L+ +R  +R S+T SSDPS         P+              R F M+EL  ATKNF 
Sbjct  30    LSRQRNVSRTSETGSSDPSQGRHGAMELPIRD-----------TRRFEMEELSLATKNFS  78

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LLGYCQ
Sbjct  79    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNLVSLLGYCQ  138

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH   P +VH
Sbjct  139   ENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLHSLSPRLVH  198

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +     F+  EV +   FSE
Sbjct  199   KNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQVATDEIFLASEVREFRRFSE  256

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLMGKY  506
              SD+Y FGVFL EL++G++A       SNQ +++WV   LS+ D      +++ RL   +
Sbjct  257   KSDVYSFGVFLLELLSGKQATESPFPDSNQNLVEWV---LSNQDRGMMSYIIDRRLESSF  313

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             +AEGM + I L +RC     + RP M  V +E  RIL+KE+  +T MGE + T+TLGSQL
Sbjct  314   TAEGMEEYIMLIIRCLDPSSERRPAMSYVEMELVRILDKEMNLTTIMGEGTPTVTLGSQL  373

Query  325   F  323
             F
Sbjct  374   F  374



>ref|XP_010682893.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=379

 Score =   311 bits (798),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 226/361 (63%), Gaps = 22/361 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R ++R S+T SS+PS   + K+GG   S+          AR F  +EL  ATKNF 
Sbjct  30    LFHSRSASRTSETGSSEPS--YQGKSGGIELSI--------REARRFSWEELSAATKNFS  79

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             E +LIG G FG V+KG L +G +VAIK R   P Q+F EEV  LS  QHRN+V LLGYCQ
Sbjct  80    EQSLIGVGKFGEVYKGLLTEGVLVAIKKRPVAPTQEFVEEVRYLSSIQHRNIVTLLGYCQ  139

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E   QILV EY+PNG++ +HLYG G  S  KLEFK RLSIA G AKGL HLH   P ++H
Sbjct  140   EKDQQILVYEYVPNGSVSSHLYGPGHGSREKLEFKHRLSIALGAAKGLAHLHSISPRLLH  199

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDENF+ KVADAGI + L     D  GPS  ++    F+ PEV +   FSE
Sbjct  200   KDFKTSNVLVDENFVAKVADAGIRNFLG--RSDVVGPSSQVEADEVFLAPEVKEFRQFSE  257

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLMGKY  506
              SD+Y FGVFL EL+ G+EA       SNQT+++ V   L+ +D      +V+ RL  ++
Sbjct  258   KSDVYSFGVFLLELVCGQEARESYSPDSNQTLVERV---LNYNDFSTVSTMVDPRLGNRF  314

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
             + EGM + ++L +RC     + RP +  V  E + ILEKE+  +T MGE + T+TLGSQL
Sbjct  315   TVEGMEEFVQLIVRCIDPSSELRPGISYVVSELDGILEKEMNLTTGMGEGTPTVTLGSQL  374

Query  325   F  323
             F
Sbjct  375   F  375



>gb|KHN46840.1| Putative receptor-like protein kinase [Glycine soja]
Length=379

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 222/365 (61%), Gaps = 30/365 (8%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQELEQAT  1217
             L+ +R  +R S+T SSDPS               + R G  E      R F M+EL  AT
Sbjct  30    LSRQRNVSRTSETGSSDPSQ--------------VGRHGAMELPIRDTRRFEMEELSLAT  75

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             KNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LL
Sbjct  76    KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNLVSLL  135

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQEN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH   P
Sbjct  136   GYCQENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLHSLSP  195

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSG  680
              +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +     F+  EV +  
Sbjct  196   RLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQVATDEIFLASEVREFR  253

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRL  518
              FSE SD+Y FGVFL EL++G++A       SNQ +++WV   LS+ D      +++ RL
Sbjct  254   RFSEKSDVYSFGVFLLELLSGKQATESPFPDSNQNLVEWV---LSNQDRGMMSYIIDRRL  310

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTL  338
                ++AEGM + I L +RC     + RP M  V +E  RIL+KE+  +T MGE + T+TL
Sbjct  311   ESSFTAEGMEEYIMLIIRCLDPSSERRPAMSYVEMELVRILDKEMNLTTIMGEGTPTVTL  370

Query  337   GSQLF  323
             GSQLF
Sbjct  371   GSQLF  375



>ref|NP_001235374.1| protein kinase family protein [Glycine max]
 ref|XP_006598684.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
 ref|XP_006598685.1| PREDICTED: protein kinase family protein isoform X2 [Glycine 
max]
 ref|XP_006598686.1| PREDICTED: protein kinase family protein isoform X3 [Glycine 
max]
 ref|XP_006598687.1| PREDICTED: protein kinase family protein isoform X4 [Glycine 
max]
 gb|ACM89566.1| protein kinase family protein [Glycine max]
Length=379

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 222/365 (61%), Gaps = 30/365 (8%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE----GARVFRMQELEQAT  1217
             L+ +R  +R S+T SSDPS               + R G  E      R F M+EL  AT
Sbjct  30    LSRQRNVSRTSETGSSDPSQ--------------VGRHGAMELPIRDTRRFEMEELSLAT  75

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             KNF + NLIG G FG V+KG L DG +VAIK R     Q+F +EV  LS   HRNLV+LL
Sbjct  76    KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRRGLASQEFVDEVRYLSSIHHRNLVSLL  135

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQEN  Q L+ EY+PNG++ +HLYG G+    KLEFK RL IA G AKGL HLH   P
Sbjct  136   GYCQENNLQFLIYEYVPNGSVSSHLYGAGQQPREKLEFKHRLPIAQGAAKGLAHLHSLSP  195

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSG  680
              +VH NFKT NVLVDENFI KVADAG+ + L  +  D AG S  +     F+  EV +  
Sbjct  196   RLVHKNFKTANVLVDENFIAKVADAGLRNFLGRV--DIAGSSSQVATDEIFLASEVREFR  253

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRL  518
              FSE SD+Y FGVFL EL++G++A       SNQ +++WV   LS+ D      +++ RL
Sbjct  254   RFSEKSDVYSFGVFLLELLSGKQATESPFPDSNQNLVEWV---LSNQDRGMMSYIIDRRL  310

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTL  338
                ++AEGM + I L +RC     + RP M  V +E  RIL+KE+  +T MGE + T+TL
Sbjct  311   ESSFTAEGMEEYIMLIIRCLDPSSERRPAMSYVEMELVRILDKEMNLTTIMGEGTPTVTL  370

Query  337   GSQLF  323
             GSQLF
Sbjct  371   GSQLF  375



>ref|XP_002459027.1| hypothetical protein SORBIDRAFT_03g044740 [Sorghum bicolor]
 gb|EES04147.1| hypothetical protein SORBIDRAFT_03g044740 [Sorghum bicolor]
Length=366

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 212/319 (66%), Gaps = 13/319 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT+NF  +NLIG G+FG V+KG L DGT+VA+K R +PP Q+F +EV
Sbjct  53    QGARSLTLEELNFATRNFSNANLIGQGTFGEVYKGLLQDGTVVAVKRRHSPPSQEFIQEV  112

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
               L+   HRNLV LLGYCQENG Q+LV EY+PNG++  HL+G    +  +LEFKQRLSIA
Sbjct  113   NYLASLCHRNLVKLLGYCQENGMQMLVYEYIPNGSVSTHLHGNSHATGLRLEFKQRLSIA  172

Query  901   SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  722
              GTAKGL HLH   PP +H NFKT NVLVDE+F+PKVAD GI  +L  +     G S   
Sbjct  173   HGTAKGLSHLHSLTPPAIHMNFKTSNVLVDEDFVPKVADTGIPGMLDRLG--VTGLSSRT  230

Query  721   QPSPFIDPEVNQSG--VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
                PF+DP + ++    FS  SD+Y FGVFL EL++GR+        S+Q+++QWV+   
Sbjct  231   STDPFVDPRMKEAMNLNFSIQSDVYSFGVFLLELVSGRKVV------SDQSIIQWVQNFQ  284

Query  547   SSDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMG  377
              S D   + ++R+   +++E M++L+RL   C +    +RP+M +V  E  RI E+EI  
Sbjct  285   ESSDISAIADNRMASGFTSESMKELLRLTSWCVNPMNDQRPSMSLVEAEIHRIREQEISL  344

Query  376   STAMGEASATLTLGSQLFT  320
             +T M E + T+TLGSQLFT
Sbjct  345   TTVMTEGTPTVTLGSQLFT  363



>ref|XP_010514329.1| PREDICTED: nodulation receptor kinase-like [Camelina sativa]
Length=380

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 220/351 (63%), Gaps = 15/351 (4%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+T SSDPS    Q+       L++        AR F M+EL QATK+F   +LIG 
Sbjct  37    SRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQATKSFTNKSLIGI  87

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LLGYCQE+  Q L
Sbjct  88    GKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLLGYCQESNTQFL  147

Query  1003  VLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             V EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P ++H +FKT 
Sbjct  148   VYEYVPNGSVSSHLYGAGGKVPGNRLEFRHRLAISIGAAKGLAHLHSLSPRLIHKDFKTA  207

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+ + L     D    SH +    F+ PEV +   FSE SD+Y F
Sbjct  208   NVLVDENFIAKVADAGVRNFLG--REDVGTSSHIVADQIFLSPEVQEFRRFSEKSDVYAF  265

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDLIR  476
             GVFL EL++GREA+      S +T+++W++      D   +++ RL G Y+AEG+ +LI 
Sbjct  266   GVFLLELVSGREASEPSPSSSTKTLVEWMQNLKDYADIPMMIDERLGGTYTAEGVEELIT  325

Query  475   LAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  326   LTLICVDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  376



>gb|EYU31881.1| hypothetical protein MIMGU_mgv1a023868mg [Erythranthe guttata]
Length=380

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 220/353 (62%), Gaps = 11/353 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             +R  +  S+T SSDPS  V    G   +            AR + M EL  AT+NF E +
Sbjct  33    RRNVSGTSETGSSDPSIQVGTSVGTEFT---------LRDARRYEMGELSLATRNFSEQS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK R   P Q+F +EV  LS  QHRNLV LLGYCQEN 
Sbjct  84    LIGQGKFGEVYKGLLHDGILVAIKKRPGTPTQEFVDEVRYLSSIQHRNLVTLLGYCQEND  143

Query  1015  YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNF  836
              QI+V EY+PNG++  HLYG G+ S  KLEFK RLSIA G AKGL HLH   P ++H +F
Sbjct  144   LQIIVYEYIPNGSVSVHLYGAGQVSQVKLEFKHRLSIALGAAKGLAHLHSLSPRLIHKDF  203

Query  835   KTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDI  656
             KT NVLVDENFI KVADAG+ + L + +++    S       F+ PEV +   FS+ SD+
Sbjct  204   KTSNVLVDENFIAKVADAGLRNFLGKFDYEGPSSSELTADRIFLAPEVTEFKRFSDKSDV  263

Query  655   YGFGVFLWELITGREAAHI-RGLGSNQTMLQWVEAHLS-SDDLVEHRLMGKYSAEGMRDL  482
             Y FGVFL EL++G+EA  +     ++Q+++ WV+ +      +++ RL   ++ EGM +L
Sbjct  264   YSFGVFLLELVSGQEARELMSSSNADQSLVDWVQNNQECGSSMIDGRLGNSFTREGMEEL  323

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I+L + C +   + RP M  +  E +RILEKE+  +T MGE +  +TLGSQLF
Sbjct  324   IQLIVHCLNPSSERRPPMSYLVTELDRILEKEMSLTTIMGEGTPVVTLGSQLF  376



>ref|XP_009121453.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
Length=399

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 229/373 (61%), Gaps = 13/373 (3%)
 Frame = -2

Query  1417  SNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRM  1238
             S L +      +  ++ ++R S++ SSDPS    +     +S            AR F+M
Sbjct  36    SALLVFLLWFCIFRRKNASRTSESGSSDPSTQERRSVAMDLSM---------REARSFKM  86

Query  1237  QELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQH  1058
             +EL QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   H
Sbjct  87    EELAQATKSFTNKSLIGTGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINH  146

Query  1057  RNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGL  881
             RNLV LLGYCQEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL
Sbjct  147   RNLVTLLGYCQENNTQFLVYEYVPNGSVSSHLYGGGDKVSGNRLEFRNRLAISIGAAKGL  206

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFID  701
              HLH   P ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ 
Sbjct  207   AHLHSLSPRLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLS  266

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LV  530
             PEV +   FSE SD+Y FGVFL EL++G+EA+      S QT+++W++      D   ++
Sbjct  267   PEVQEFRRFSEKSDVYAFGVFLLELVSGKEASEPSPSSSTQTLVEWMQNIRDYKDIPMMI  326

Query  529   EHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASA  350
             + RL G Y+AEG+ ++I L +RC +   ++RP M  V  E ERIL+KE+  +T MGE + 
Sbjct  327   DERLGGTYTAEGVEEVITLTLRCLNVSSEKRPAMSYVLTELERILDKEVSLTTVMGEGTP  386

Query  349   TLTLGSQLFTN*D  311
             T+TLGSQLF + D
Sbjct  387   TVTLGSQLFKSSD  399



>ref|XP_006395532.1| hypothetical protein EUTSA_v10004401mg [Eutrema salsugineum]
 gb|ESQ32818.1| hypothetical protein EUTSA_v10004401mg [Eutrema salsugineum]
Length=380

 Score =   310 bits (795),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/355 (47%), Positives = 222/355 (63%), Gaps = 15/355 (4%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESN  1196
             ++  +R S+T SSDPS    Q+       L++        AR F M+EL QATK+F   +
Sbjct  33    RKNVSRTSETGSSDPST---QEGRNVAIELSMRE------ARRFEMEELAQATKSFTNKS  83

Query  1195  LIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENG  1016
             LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNLV LLGYCQE+ 
Sbjct  84    LIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSIHHRNLVTLLGYCQESN  143

Query  1015  YQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
              Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HLH   P ++H +
Sbjct  144   TQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRNRLAISIGAAKGLAHLHSLSPRLIHKD  203

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASD  659
             FKT NVLVDENFI KVADAG+ + L     D    SH +    F+ PEV +   FSE SD
Sbjct  204   FKTANVLVDENFIAKVADAGVRNFLG--RDDVGTSSHVVADQNFLSPEVQEFRRFSEKSD  261

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
             +Y FGVFL EL++GREA+      S QT+++W++      D   +++ RL G Y+AEG+ 
Sbjct  262   VYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQNITDYTDIPEMIDERLGGTYTAEGVE  321

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             ++I L + C     ++RP M  V  E ERIL+KE+  +T +GE + T+TLGSQLF
Sbjct  322   EVITLTLSCLDVSSEKRPTMSYVVTELERILDKEVSLTTVLGEGTPTVTLGSQLF  376



>ref|XP_004971158.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X1 [Setaria italica]
 ref|XP_004971159.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
isoform X2 [Setaria italica]
Length=366

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 207/318 (65%), Gaps = 13/318 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT+NF  +NLIG G FG V+KG L DGTIVA+K R APP Q+F +EV
Sbjct  53    QGARCLTLEELNLATRNFSNANLIGQGMFGEVYKGLLQDGTIVAVKRRHAPPSQEFVQEV  112

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
               LS  QHRNLV LLGYCQEN  Q+LV EY+PNG++  HL+G       +LEFK RLSIA
Sbjct  113   NYLSSLQHRNLVKLLGYCQENVVQMLVYEYIPNGSVSTHLHGYSHAPGVRLEFKHRLSIA  172

Query  901   SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  722
              G AKGL HLH   PP +H NFKT NVLVDE+FIPKVAD GI  LL  +     G S   
Sbjct  173   HGAAKGLSHLHSLTPPAIHMNFKTSNVLVDEDFIPKVADTGIPGLLDRLG--VTGLSSRT  230

Query  721   QPSPFIDPEVNQSG--VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
                PF+DP + +S    FS  SD+Y FGVFL EL++GR A       S+Q ++QWV+   
Sbjct  231   PNDPFVDPRMRESMNLNFSIQSDVYSFGVFLVELVSGRRAV------SDQNIIQWVQNFQ  284

Query  547   SSDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMG  377
              S D   + ++R+   +++E M++L+RLA  C +   ++RP+M +V  E  RI E+EI  
Sbjct  285   ESSDISAIADNRMTSSFTSESMKELLRLASWCVNPMSEQRPSMSLVEAEIHRIREQEISL  344

Query  376   STAMGEASATLTLGSQLF  323
             +T M   + T+TLGSQLF
Sbjct  345   TTVMTGRTPTVTLGSQLF  362



>gb|EMT16217.1| Receptor-like protein kinase THESEUS 1 [Aegilops tauschii]
Length=404

 Score =   311 bits (796),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 199/303 (66%), Gaps = 11/303 (4%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLI  1190
             NR SDT SSDPS  VE   GG  SS        PE  GAR F ++EL QAT NF E+NL+
Sbjct  37    NRTSDTGSSDPSTLVEWGKGGRSSS-------APERQGARQFSLEELAQATNNFSEANLV  89

Query  1189  GCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQ  1010
             G GSFGLV+KG LFDG++VAIK R   PR +FS+EV RLS   HRN+V L+GYCQE G Q
Sbjct  90    GAGSFGLVYKGLLFDGSVVAIKRRMGAPRLEFSDEVRRLSEICHRNIVTLIGYCQEGGLQ  149

Query  1009  ILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKT  830
             +LV EY PNG +C+HLY  G+ S T+LEFKQRL+IA G AKGL HLH   PP++H NFKT
Sbjct  150   MLVFEYSPNGNVCSHLYDSGKGSMTRLEFKQRLAIAIGAAKGLNHLHSLMPPLIHKNFKT  209

Query  829   GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYG  650
              NVLVDENFI KVADAG+  LL+   H+  G SH    S + DPE +    FSE+SD+Y 
Sbjct  210   SNVLVDENFIAKVADAGLFRLLR--GHEDVGSSHGFSSSVYQDPEAHSVAQFSESSDVYS  267

Query  649   FGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLA  470
             FGVFL ELITGREAA ++   S +++  W  A +  D L    ++  Y       LI + 
Sbjct  268   FGVFLLELITGREAASLQPPESRESLAHWSPAAVVYDKLYRLCIVANYHVWLFFKLIMVV  327

Query  469   MRC  461
             + C
Sbjct  328   IFC  330



>ref|XP_002277073.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 ref|XP_010660662.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 ref|XP_010660663.1| PREDICTED: probable receptor-like protein kinase At1g30570 [Vitis 
vinifera]
 emb|CBI21260.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   310 bits (793),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 224/359 (62%), Gaps = 16/359 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L+  R  +R S+T SSDPS  V +  G     LAL        AR F M EL  ATKNF 
Sbjct  30    LSHNRSVSRTSETGSSDPSVQVGRNVG---VELALRE------ARHFEMAELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + +LIG G FG V+KG L DG  VAIK R   P Q F +EV  LS  +HRNLV LLGYCQ
Sbjct  81    DISLIGEGKFGEVYKGLLHDGMFVAIKKRFGGPSQDFVDEVRYLSAIEHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             ENG Q L+ E++P+G++ ++LYG   + S  KLEFK RL IA G AKGL HLH   P +V
Sbjct  141   ENGQQFLIYEHIPSGSISSYLYGTAAQVSQEKLEFKNRLQIALGAAKGLAHLHTLSPRLV  200

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFS  671
             H +FKT NVLVDENFIPKVADAG+ + L  I  D AGPS  +     F+ PEV +   FS
Sbjct  201   HKDFKTANVLVDENFIPKVADAGLRNFLGRI--DIAGPSSQVVADEIFLAPEVREFRRFS  258

Query  670   EASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDDLVEHRLMGKYSA  500
             + SD+Y FGVFL EL++G+EA  +    SN  +++ V   + H +   +++ RL  +++A
Sbjct  259   DKSDVYSFGVFLLELLSGQEANTLLSPDSNLNLVEMVQNYQDHSNISTIIDQRLGNRFTA  318

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             EGM + I+L +RC     + RP+M  V +E +RILEKE   +T +GE    + LGSQLF
Sbjct  319   EGMEEFIQLIIRCVDTSSERRPSMSYVLMELDRILEKETTLTTLVGEGIPNVILGSQLF  377



>ref|XP_004493092.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X1 [Cicer arietinum]
 ref|XP_004493093.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X2 [Cicer arietinum]
 ref|XP_004493094.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X3 [Cicer arietinum]
Length=381

 Score =   309 bits (792),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 218/353 (62%), Gaps = 18/353 (5%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+T SSDPS     + GG  S             R F M+EL  ATKNF++ NLIG 
Sbjct  37    SRTSETGSSDPSQDAVGRHGGIESQ--------TRDTRRFVMEELSIATKNFNDKNLIGE  88

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG L DG +VAIK R   P  +F +EV  LS  QHRNLV L+GYCQEN  Q L
Sbjct  89    GKFGEVYKGLLQDGMLVAIKKRRGVPTPEFVDEVRYLSSIQHRNLVTLIGYCQENNLQFL  148

Query  1003  VLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGN  824
             + EY+PNG++ +HLYG  +    K+EFK RLSIA G AKGL HLH   P +VH NFKT N
Sbjct  149   IYEYVPNGSVSSHLYGASQQPREKIEFKHRLSIAQGAAKGLAHLHSLSPRLVHKNFKTSN  208

Query  823   VLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFG  644
             VLVDENFI KVAD+G+ + L  ++  A+  S       F+ PEV +   FSE SD+Y FG
Sbjct  209   VLVDENFISKVADSGLRNFLGRVD-IASSSSQVASDEIFLAPEVREFRRFSEKSDVYSFG  267

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLMGKYSAEGMRDL  482
             VFL EL++G++A     + +NQ +   VE+ LS+ D      +++ R+   ++ E M + 
Sbjct  268   VFLLELLSGKQATESPSINTNQNL---VESVLSNQDSGILSTIIDQRMETSFTGESMENY  324

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I L ++C     + RP M  V +E +RILEKE+  +T MGE + T+TLGSQLF
Sbjct  325   ILLLIKCLDHSSERRPTMSYVEMELDRILEKEMNLTTMMGEGTPTVTLGSQLF  377



>ref|XP_006446906.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 ref|XP_006446907.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60146.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60147.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
Length=380

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 220/358 (61%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSGQAGRNVGIELS---------IREARRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  81    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  141   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D  GPS  +     F+ PEV +   FSE
Sbjct  201   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVVGPSSQVTADEIFLAPEVKEFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL   ++ E
Sbjct  259   KSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+ LGSQLF
Sbjct  319   GMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVILGSQLF  376



>emb|CDY28533.1| BnaC02g36270D [Brassica napus]
Length=374

 Score =   307 bits (787),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 222/353 (63%), Gaps = 17/353 (5%)
 Frame = -2

Query  1372  RYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNL  1193
             R+ N +  T SSDPS+   Q+       L++        +R F M+EL QATK+F   +L
Sbjct  32    RHKNASETTGSSDPSS---QEGRNVAMELSMRE------SRRFGMEELAQATKSFTSKSL  82

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQE+  
Sbjct  83    IGTGKFGEVYKGLLQDGVLVAIKRRHGLPTQEFVNEVRYLSSIKHRNLVTLLGYCQESNT  142

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q LV EY+PNG++  HLYG G    ++LEF+ RL+I+ G AKGL HLH   P ++H +FK
Sbjct  143   QFLVYEYVPNGSVSYHLYGAG---GSRLEFRNRLAISIGAAKGLAHLHSLSPRLIHKDFK  199

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDENFI KVADAG+ + L     DA   SH +    F+ PEV +   +SE SD+Y
Sbjct  200   TANVLVDENFIAKVADAGVRNFLG--REDAGTSSHVVADHIFLSPEVQEFRRYSEKSDVY  257

Query  652   GFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMRDL  482
              FGVFL EL++GREA+      S QT+++W++      +   +++ RL G Y+AEG+ ++
Sbjct  258   AFGVFLLELVSGREASEPSPSSSTQTLVEWMQNITDYTEIPAMIDERLGGTYTAEGVEEV  317

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+TLGSQLF
Sbjct  318   ITLTLICLDVSSEKRPAMSYVVTELERILDKEVSLTTVMGEGTPTVTLGSQLF  370



>emb|CAN73905.1| hypothetical protein VITISV_039777 [Vitis vinifera]
Length=414

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 227/368 (62%), Gaps = 16/368 (4%)
 Frame = -2

Query  1411  LFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQE  1232
             + IL     L+  R  +R S+T SSDPS  V +  G     LAL        AR F M E
Sbjct  54    IVILIIWFCLSHNRSVSRTSETGSSDPSVQVGRNVG---VELALRE------ARHFEMAE  104

Query  1231  LEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRN  1052
             L  ATKNF + +LIG G FG V+KG L DG  VAIK R   P Q F +EV  LS  +HRN
Sbjct  105   LSLATKNFSDISLIGEGKFGEVYKGLLHDGMFVAIKKRFGGPSQDFVDEVRYLSAIEHRN  164

Query  1051  LVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCH  875
             LV LLGYCQENG Q L+ E++P+G++ ++LYG   + S  KLEFK RL IA G AKGL H
Sbjct  165   LVTLLGYCQENGQQFLIYEHIPSGSISSYLYGTAAQVSQEKLEFKNRLQIALGAAKGLAH  224

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDP  698
             LH   P +VH +FKT NVLVDENFIPKVADAG+ + L  I  D AGPS  +     F+ P
Sbjct  225   LHTLSPRLVHKDFKTANVLVDENFIPKVADAGLRNFLGRI--DIAGPSSQVVADEIFLAP  282

Query  697   EVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDDLVE  527
             EV +   FS+ SD+Y FGVFL EL++G+EA  +    SN  +++ V   + H +   +++
Sbjct  283   EVREFRRFSDKSDVYSFGVFLLELLSGQEANTLLSPDSNLNLVEMVQNYQDHSNISTIID  342

Query  526   HRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASAT  347
              RL  +++AEGM + I+L +RC     + RP+M  V +E +RILEKE   +T +GE    
Sbjct  343   QRLGNRFTAEGMEEFIQLIIRCVDTSSERRPSMSYVLMELDRILEKETTLTTLVGEGIPN  402

Query  346   LTLGSQLF  323
             + LGSQLF
Sbjct  403   VILGSQLF  410



>ref|XP_009152029.1| PREDICTED: nodulation receptor kinase isoform X1 [Brassica rapa]
Length=377

 Score =   306 bits (784),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 225/366 (61%), Gaps = 16/366 (4%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQEL  1229
             F L    +   K  S  + +T SSDPS      T G   ++ L+       AR F M+EL
Sbjct  23    FFLIWFCIFRRKNASRTSDETGSSDPS------TQGRNVAIELSM----REARRFEMEEL  72

Query  1228  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  1049
              QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNL
Sbjct  73    AQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNL  132

Query  1048  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHL  872
             V LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HL
Sbjct  133   VTLLGYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISIGAAKGLAHL  192

Query  871   HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEV  692
             H   P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PEV
Sbjct  193   HSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPEV  250

Query  691   NQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHR  521
              +   FSE SD+Y FGVFL EL++GREA+      S QT+++W+++     +   +++ R
Sbjct  251   QEFRRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQSITDYTEIPGMIDER  310

Query  520   LMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLT  341
             L G Y+AEG+ ++I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+T
Sbjct  311   LGGTYTAEGVEEVITLTLTCLDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVT  370

Query  340   LGSQLF  323
             LGSQLF
Sbjct  371   LGSQLF  376



>emb|CDX83640.1| BnaC07g23800D [Brassica napus]
Length=377

 Score =   306 bits (784),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 224/366 (61%), Gaps = 16/366 (4%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQEL  1229
             F L    +   K  S  + +T SSDPS      T G   ++ L+       AR F M+EL
Sbjct  23    FFLIWFCIFRRKNASRTSDETGSSDPS------TQGINVAIELSM----REARRFEMEEL  72

Query  1228  EQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNL  1049
              QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   HRNL
Sbjct  73    AQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINHRNL  132

Query  1048  VNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTAKGLCHL  872
             V LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ G AKGL HL
Sbjct  133   VTLLGYCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLEFRNRLAISIGAAKGLAHL  192

Query  871   HGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEV  692
             H   P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ +    F+ PEV
Sbjct  193   HSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVADQIFLSPEV  250

Query  691   NQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHR  521
              +   FSE SD+Y FGVFL EL++GREA+      S QT+++W++      +   +++ R
Sbjct  251   QEFRRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQNITDYTEIPGMIDER  310

Query  520   LMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLT  341
             L G Y+AEG+ ++I L + C     ++RP M  V  E ERIL+KE+  +T MGE + T+T
Sbjct  311   LGGTYTAEGVEEVITLTLTCLDVSSEKRPTMSYVVTELERILDKEVSLTTVMGEGTPTVT  370

Query  340   LGSQLF  323
             LGSQLF
Sbjct  371   LGSQLF  376



>ref|XP_006468925.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X5 [Citrus sinensis]
Length=380

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 220/358 (61%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  81    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  141   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV +   FSE
Sbjct  201   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL   ++ E
Sbjct  259   KSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS LF
Sbjct  319   GMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLF  376



>gb|KDO45966.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45967.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45968.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=380

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 220/358 (61%), Gaps = 15/358 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  81    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  141   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV +   FSE
Sbjct  201   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL   ++ E
Sbjct  259   KSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNE  318

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS LF
Sbjct  319   GMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLF  376



>ref|XP_004493095.1| PREDICTED: probable receptor-like protein kinase At1g30570-like 
isoform X4 [Cicer arietinum]
Length=379

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 218/353 (62%), Gaps = 20/353 (6%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGC  1184
             +R S+T SSDPS     + GG  S             R F M+EL  ATKNF++ NLIG 
Sbjct  37    SRTSETGSSDPSQV--GRHGGIESQ--------TRDTRRFVMEELSIATKNFNDKNLIGE  86

Query  1183  GSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQIL  1004
             G FG V+KG L DG +VAIK R   P  +F +EV  LS  QHRNLV L+GYCQEN  Q L
Sbjct  87    GKFGEVYKGLLQDGMLVAIKKRRGVPTPEFVDEVRYLSSIQHRNLVTLIGYCQENNLQFL  146

Query  1003  VLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGN  824
             + EY+PNG++ +HLYG  +    K+EFK RLSIA G AKGL HLH   P +VH NFKT N
Sbjct  147   IYEYVPNGSVSSHLYGASQQPREKIEFKHRLSIAQGAAKGLAHLHSLSPRLVHKNFKTSN  206

Query  823   VLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFG  644
             VLVDENFI KVAD+G+ + L  ++  A+  S       F+ PEV +   FSE SD+Y FG
Sbjct  207   VLVDENFISKVADSGLRNFLGRVD-IASSSSQVASDEIFLAPEVREFRRFSEKSDVYSFG  265

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD------LVEHRLMGKYSAEGMRDL  482
             VFL EL++G++A     + +NQ +   VE+ LS+ D      +++ R+   ++ E M + 
Sbjct  266   VFLLELLSGKQATESPSINTNQNL---VESVLSNQDSGILSTIIDQRMETSFTGESMENY  322

Query  481   IRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             I L ++C     + RP M  V +E +RILEKE+  +T MGE + T+TLGSQLF
Sbjct  323   ILLLIKCLDHSSERRPTMSYVEMELDRILEKEMNLTTMMGEGTPTVTLGSQLF  375



>ref|XP_003624519.1| Nodulation receptor kinase [Medicago truncatula]
 gb|AES80737.1| tyrosine kinase family protein [Medicago truncatula]
Length=379

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/354 (47%), Positives = 219/354 (62%), Gaps = 22/354 (6%)
 Frame = -2

Query  1363  NRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQATKNFDESNL  1193
             +R S+T SSDPS     + G          GG+       R F M+EL  ATKNF++ NL
Sbjct  37    SRTSETGSSDPS-----QVG--------RHGGIELQMRDTRRFAMEELSHATKNFNDKNL  83

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             IG G FG V+KG L DG +VAIK R     Q+F +EV  LS  QHRNLV L+GYCQEN  
Sbjct  84    IGEGKFGEVYKGLLQDGMLVAIKKRRGVTSQEFVDEVRYLSSIQHRNLVTLIGYCQENNL  143

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             Q L+ EY+PNG++ +HLYG  +    KLEFK RLSIA G AKGL HLH   P +VH NFK
Sbjct  144   QFLIYEYVPNGSVSSHLYGASQQPREKLEFKHRLSIAQGAAKGLAHLHSLSPRLVHKNFK  203

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDI  656
             T NVLVDENFI KVADAG+ + L  +  +  G S  +     F+ PEV +   FSE SD 
Sbjct  204   TSNVLVDENFISKVADAGLRNFLARV--EIVGTSSQVATDEIFLAPEVREFRQFSEKSDA  261

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWV---EAHLSSDDLVEHRLMGKYSAEGMRD  485
             Y FGVFL EL++G+EA       +NQ +++ V   + + + + +++ R+  +++AEGM  
Sbjct  262   YSFGVFLLELLSGKEATESPHPNTNQNLVESVLSNQNNSTMNTIIDQRMECRFTAEGMES  321

Query  484   LIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              I L +RC     + RP M  V +E +RI+EKE+  +T MGE + T+TLGSQLF
Sbjct  322   YILLLIRCLDPSSERRPAMSYVEMELDRIIEKEMNLTTMMGERTPTVTLGSQLF  375



>ref|XP_010554147.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X3 [Tarenaya hassleriana]
Length=398

 Score =   305 bits (782),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 224/359 (62%), Gaps = 16/359 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QATK F 
Sbjct  47    LFGRRSVSRTSGTASSDPSL-----QAGRNVAMELSLGE----ARRFEMEELAQATKGFT  97

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
               +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQ
Sbjct  98    SKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALLGYCQ  157

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             EN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   P ++
Sbjct  158   ENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLSPRLI  217

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PEV +   FSE
Sbjct  218   HKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPEVQEFRRFSE  275

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL+TGREA+      S QT+++W++  +   +L   ++ R+ G Y+AE
Sbjct  276   KSDVYAFGVFLLELVTGREASEPPPSSSAQTLVEWMQNKVDYGNLSAVIDERMDGSYTAE  335

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG-EASATLTLGSQLF  323
             G+ +L+ L  RC      +RP M  V  E ERIL++E+  +T MG E + T+TLGSQLF
Sbjct  336   GLEELMVLTTRCLEVLSGKRPGMSYVVTELERILDREVRLTTLMGEEGTPTVTLGSQLF  394



>ref|XP_010037045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Eucalyptus grandis]
Length=328

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 183/253 (72%), Gaps = 1/253 (0%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT+ FDESNLIG
Sbjct  37    ANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELATRQFDESNLIG  96

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LLGYC ENG Q+
Sbjct  97    HGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLLGYCLENGCQM  156

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   PP+VH NFKT 
Sbjct  157   LVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRPPLVHKNFKTA  216

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE  + G FSE SD Y F
Sbjct  217   NVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPEAGELGGFSEMSDAYSF  275

Query  646   GVFLWELITGREA  608
             GVFL EL+TG  A
Sbjct  276   GVFLLELVTGEAA  288



>ref|XP_009152030.1| PREDICTED: nodulation receptor kinase isoform X2 [Brassica rapa]
Length=317

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 206/315 (65%), Gaps = 6/315 (2%)
 Frame = -2

Query  1255  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  1076
             AR F M+EL QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  
Sbjct  4     ARRFEMEELAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRY  63

Query  1075  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIAS  899
             LS   HRNLV LLGYCQE+  Q LV EY+PNG++ +HLYG  G+    +LEF+ RL+I+ 
Sbjct  64    LSSINHRNLVTLLGYCQESNTQFLVYEYVPNGSVSSHLYGDGGKVPGNRLEFRNRLAISI  123

Query  898   GTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ  719
             G AKGL HLH   P ++H +FKT NVLVDENFI KVADAG+ + L     D    S+ + 
Sbjct  124   GAAKGLAHLHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLG--REDVGTSSNVVA  181

Query  718   PSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD  539
                F+ PEV +   FSE SD+Y FGVFL EL++GREA+      S QT+++W+++     
Sbjct  182   DQIFLSPEVQEFRRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQSITDYT  241

Query  538   D---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
             +   +++ RL G Y+AEG+ ++I L + C     ++RP M  V  E ERIL+KE+  +T 
Sbjct  242   EIPGMIDERLGGTYTAEGVEEVITLTLTCLDVSSEKRPTMSYVVTELERILDKEVSLTTV  301

Query  367   MGEASATLTLGSQLF  323
             MGE + T+TLGSQLF
Sbjct  302   MGEGTPTVTLGSQLF  316



>ref|XP_010037037.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
Length=348

 Score =   303 bits (777),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 183/253 (72%), Gaps = 1/253 (0%)
 Frame = -2

Query  1366  SNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIG  1187
             +NRNS+T SSDPSA VE   GG   S        P G R F MQELE AT+ FDESNLIG
Sbjct  37    ANRNSETGSSDPSALVEWNRGGGSGSGVAPPLSWPHGPRQFTMQELELATRQFDESNLIG  96

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DGT+VAIK R+   + +F  EV+ LS  +HRNLV LLGYC ENG Q+
Sbjct  97    HGSFGLVYKGLLRDGTVVAIKRRTGVLQPEFVTEVSYLSEIRHRNLVTLLGYCLENGCQM  156

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV +YLPNG+MC+HLY  G++SSTKLEFKQR+SIA G AKGL HLH   PP+VH NFKT 
Sbjct  157   LVFDYLPNGSMCDHLYDRGQESSTKLEFKQRISIALGAAKGLSHLHSLRPPLVHKNFKTA  216

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG++  L++I  + AGPSH+   S F DPE  + G FSE SD Y F
Sbjct  217   NVLVDENFIAKVADAGLTKFLEKIKIEEAGPSHA-SVSVFQDPEAGELGGFSEMSDAYSF  275

Query  646   GVFLWELITGREA  608
             GVFL EL+TG  A
Sbjct  276   GVFLLELVTGEAA  288



>ref|XP_006468923.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Citrus sinensis]
Length=386

 Score =   304 bits (779),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 221/358 (62%), Gaps = 9/358 (3%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLATKNFS  86

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  87    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLLGYCQ  146

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  147   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  206

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV +   FSE
Sbjct  207   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEFRRFSE  264

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL   ++ E
Sbjct  265   KSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNE  324

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS LF
Sbjct  325   GMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLF  382



>gb|AAT58825.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV31240.1| putative protein kinase [Oryza sativa Japonica Group]
Length=303

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 187/269 (70%), Gaps = 12/269 (4%)
 Frame = -2

Query  1357  NSD-TASSDPSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNLIG  1187
             NSD T SSDPS  VE   GG  SS        PE  GAR F + EL QATK+F E+NL+G
Sbjct  39    NSDETGSSDPSTLVEWGKGGRSSS-------APEHQGARQFSLDELAQATKSFSEANLVG  91

Query  1186  CGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
              GSFGLV+KG L DG++VAIK R   PRQ+F+EEV +LS   HRN+V L+GYCQE G Q+
Sbjct  92    LGSFGLVYKGLLLDGSVVAIKKRIGAPRQEFAEEVRKLSEINHRNIVTLIGYCQEGGLQM  151

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTG  827
             LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++H +FKT 
Sbjct  152   LVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLIHKDFKTS  211

Query  826   NVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGF  647
             NVLVDENFI KVADAG+  LL+   ++   PSH    S + DPEV     FSE+SD+Y F
Sbjct  212   NVLVDENFIAKVADAGLVRLLR--GYEDVSPSHGFSSSVYQDPEVQSVLQFSESSDVYSF  269

Query  646   GVFLWELITGREAAHIRGLGSNQTMLQWV  560
             GVFL ELITGREAA +    S +++ QWV
Sbjct  270   GVFLLELITGREAACLISPDSRESLAQWV  298



>gb|KDO45964.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45965.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=386

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 221/358 (62%), Gaps = 9/358 (3%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLATKNFS  86

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  87    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQ  146

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  147   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  206

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV +   FSE
Sbjct  207   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEFRRFSE  264

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAE  497
              SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL   ++ E
Sbjct  265   KSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNE  324

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
             GM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS LF
Sbjct  325   GMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLF  382



>ref|XP_010554148.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X4 [Tarenaya hassleriana]
 ref|XP_010554150.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X4 [Tarenaya hassleriana]
Length=385

 Score =   302 bits (773),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 225/366 (61%), Gaps = 25/366 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QATK F 
Sbjct  29    LFGRRSVSRTSGTASSDPSL-----QAGRNVAMELSLGE----ARRFEMEELAQATKGFT  79

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
               +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQ
Sbjct  80    SKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALLGYCQ  139

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             EN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   P ++
Sbjct  140   ENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLSPRLI  199

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PEV +   FSE
Sbjct  200   HKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPEVQEFRRFSE  257

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA----------HLSSDDLVEHRL  518
              SD+Y FGVFL EL+TGREA+      S QT+++W  A          +LS+  +++ R+
Sbjct  258   KSDVYAFGVFLLELVTGREASEPPPSSSAQTLVEWFLALQMQNKVDYGNLSA--VIDERM  315

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG-EASATLT  341
              G Y+AEG+ +L+ L  RC      +RP M  V  E ERIL++E+  +T MG E + T+T
Sbjct  316   DGSYTAEGLEELMVLTTRCLEVLSGKRPGMSYVVTELERILDREVRLTTLMGEEGTPTVT  375

Query  340   LGSQLF  323
             LGSQLF
Sbjct  376   LGSQLF  381



>ref|XP_010554145.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 225/366 (61%), Gaps = 25/366 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QATK F 
Sbjct  47    LFGRRSVSRTSGTASSDPSL-----QAGRNVAMELSLGE----ARRFEMEELAQATKGFT  97

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
               +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQ
Sbjct  98    SKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALLGYCQ  157

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             EN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   P ++
Sbjct  158   ENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLSPRLI  217

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PEV +   FSE
Sbjct  218   HKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPEVQEFRRFSE  275

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA----------HLSSDDLVEHRL  518
              SD+Y FGVFL EL+TGREA+      S QT+++W  A          +LS+  +++ R+
Sbjct  276   KSDVYAFGVFLLELVTGREASEPPPSSSAQTLVEWFLALQMQNKVDYGNLSA--VIDERM  333

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG-EASATLT  341
              G Y+AEG+ +L+ L  RC      +RP M  V  E ERIL++E+  +T MG E + T+T
Sbjct  334   DGSYTAEGLEELMVLTTRCLEVLSGKRPGMSYVVTELERILDREVRLTTLMGEEGTPTVT  393

Query  340   LGSQLF  323
             LGSQLF
Sbjct  394   LGSQLF  399



>ref|XP_010554146.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X2 [Tarenaya hassleriana]
Length=402

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 225/366 (61%), Gaps = 26/366 (7%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L  +R  +R S TASSDPS        G   ++ L+ G     AR F M+EL QATK F 
Sbjct  47    LFGRRSVSRTSGTASSDPSLQ------GRNVAMELSLGE----ARRFEMEELAQATKGFT  96

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
               +LIG   FG  +KG L DG +VAIK R   P Q+F  EV  LS  +HRNLV LLGYCQ
Sbjct  97    SKSLIGVDKFGEAYKGLLQDGMLVAIKKRPGSPTQEFVNEVRYLSSIRHRNLVALLGYCQ  156

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRD-SSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             EN  Q LV EY+PNG++ +HLYG G + +  KLEF+ RL+I+ G AKGL HLH   P ++
Sbjct  157   ENNMQFLVYEYVPNGSVSSHLYGGGGNVAGQKLEFRNRLTISLGAAKGLAHLHSLSPRLI  216

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDEN+I KVADAG+ ++L     D    S ++    F+ PEV +   FSE
Sbjct  217   HKDFKTANVLVDENYIAKVADAGLCNVLG--REDVGPSSQTVAEDIFLAPEVQEFRRFSE  274

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA----------HLSSDDLVEHRL  518
              SD+Y FGVFL EL+TGREA+      S QT+++W  A          +LS+  +++ R+
Sbjct  275   KSDVYAFGVFLLELVTGREASEPPPSSSAQTLVEWFLALQMQNKVDYGNLSA--VIDERM  332

Query  517   MGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG-EASATLT  341
              G Y+AEG+ +L+ L  RC      +RP M  V  E ERIL++E+  +T MG E + T+T
Sbjct  333   DGSYTAEGLEELMVLTTRCLEVLSGKRPGMSYVVTELERILDREVRLTTLMGEEGTPTVT  392

Query  340   LGSQLF  323
             LGSQLF
Sbjct  393   LGSQLF  398



>ref|XP_006468924.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Citrus sinensis]
Length=385

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 220/363 (61%), Gaps = 20/363 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  81    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG-----LCHLHGQC  860
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKG     L HLH   
Sbjct  141   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGDPLQSLAHLHSLS  200

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQS  683
             P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV + 
Sbjct  201   PRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEF  258

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMG  512
               FSE SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL  
Sbjct  259   RRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWS  318

Query  511   KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGS  332
              ++ EGM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS
Sbjct  319   TFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGS  378

Query  331   QLF  323
              LF
Sbjct  379   HLF  381



>ref|XP_006446905.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 ref|XP_006446908.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60145.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
 gb|ESR60148.1| hypothetical protein CICLE_v10015605mg [Citrus clementina]
Length=312

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 200/310 (65%), Gaps = 6/310 (2%)
 Frame = -2

Query  1240  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  1061
             M+EL  ATKNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  Q
Sbjct  1     MEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQ  60

Query  1060  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  881
             HRNLV LLGYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL
Sbjct  61    HRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGL  120

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FI  704
              HLH   P VVH +FKT NVLVDE+FI KVADAG+ + L     D  GPS  +     F+
Sbjct  121   AHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVVGPSSQVTADEIFL  178

Query  703   DPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---  533
              PEV +   FSE SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   
Sbjct  179   APEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKI  238

Query  532   VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEAS  353
             ++ RL   ++ EGM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE +
Sbjct  239   LDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGT  298

Query  352   ATLTLGSQLF  323
              T+ LGSQLF
Sbjct  299   PTVILGSQLF  308



>ref|XP_010241794.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X4 [Nelumbo nucifera]
Length=318

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 196/275 (71%), Gaps = 7/275 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELEQATK+F 
Sbjct  34    KNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQATKHFS  92

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LLG+CQ
Sbjct  93    KSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLLGFCQ  152

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  PP+ H
Sbjct  153   EDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVPPLAH  212

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPEV +SG FS 
Sbjct  213   KNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPEVGESGKFSG  270

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW  563
              SD+Y FGVFL ELITG+EA  I  L S+++++QW
Sbjct  271   MSDVYSFGVFLLELITGQEALKINSLRSHESLIQW  305



>ref|XP_004962282.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Setaria italica]
Length=306

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 185/265 (70%), Gaps = 5/265 (2%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             SDT SSDPS  VE   GG  SSLA       + AR F ++EL QATKNF ++N++G GSF
Sbjct  42    SDTGSSDPSTLVEWGKGGR-SSLAPEPETEHQVARQFSLEELVQATKNFSDANIVGAGSF  100

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             GLV+ G L DGTIVAIK R    RQ+F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  101   GLVYMGLLLDGTIVAIKRRVGAARQEFADEVRWLSEIRHRNVVTLIGYCQEGGLQMLVYE  160

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             YLPNG++C HLYG G  S+ +LEFKQRLSIA G AKGL HLH +  P++H NFKT NVLV
Sbjct  161   YLPNGSVCGHLYGKG--STARLEFKQRLSIAIGAAKGLNHLHSRDVPLIHKNFKTNNVLV  218

Query  814   DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFL  635
             DENFI KVADAG+  LL+    D AGPSH    S + DPEV     FSE+SD+Y FGVFL
Sbjct  219   DENFIAKVADAGLVRLLR--GSDEAGPSHGFSSSVYQDPEVQSVAQFSESSDVYSFGVFL  276

Query  634   WELITGREAAHIRGLGSNQTMLQWV  560
              ELITGREAA +    S + +  WV
Sbjct  277   LELITGREAASLMPPESREYLAHWV  301



>ref|XP_006468921.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Citrus sinensis]
 ref|XP_006468922.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Citrus sinensis]
Length=391

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 221/363 (61%), Gaps = 14/363 (4%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    Q+    ++   +        AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSV---QRNICIIAGRNVGIELSIREARRFQMEELSLATKNFS  86

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  87    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVRFLASIQHRNLVTLLGYCQ  146

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKG-----LCHLHGQC  860
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKG     L HLH   
Sbjct  147   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGDPLQSLAHLHSLS  206

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQS  683
             P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV + 
Sbjct  207   PRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEF  264

Query  682   GVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMG  512
               FSE SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   ++ RL  
Sbjct  265   RRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWS  324

Query  511   KYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGS  332
              ++ EGM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE + T+TLGS
Sbjct  325   TFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGS  384

Query  331   QLF  323
              LF
Sbjct  385   HLF  387



>gb|KDO45970.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
 gb|KDO45971.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=312

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 200/310 (65%), Gaps = 6/310 (2%)
 Frame = -2

Query  1240  MQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQ  1061
             M+EL  ATKNF + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  Q
Sbjct  1     MEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQ  60

Query  1060  HRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGL  881
             HRNLV LLGYCQEN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL
Sbjct  61    HRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGL  120

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FI  704
              HLH   P VVH +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+
Sbjct  121   AHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFL  178

Query  703   DPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---  533
               EV +   FSE SD+Y FGVFL EL++GREA+      S+Q +++ V+      +L   
Sbjct  179   ASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKI  238

Query  532   VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEAS  353
             ++ RL   ++ EGM + I+L +RC     + RP+M  V  E +R L+KE+  +T MGE +
Sbjct  239   LDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGT  298

Query  352   ATLTLGSQLF  323
              T+TLGS LF
Sbjct  299   PTVTLGSHLF  308



>ref|XP_010911009.1| PREDICTED: proline-rich receptor-like protein kinase PERK13, 
partial [Elaeis guineensis]
Length=241

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 172/233 (74%), Gaps = 2/233 (1%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR F ++EL QATK+FDE NL+G GSFGLV+KG L DGTIVAIK R   P+ +F EEV
Sbjct  11    QGARQFTLEELSQATKSFDECNLVGSGSFGLVYKGLLLDGTIVAIKMRRGAPQPEFVEEV  70

Query  1081  ARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIA  902
              +LS   HRNLV+L+GYCQE G Q+LV EYLPNG++  HLY  GRD   +LEFKQRLSIA
Sbjct  71    KKLSEICHRNLVSLIGYCQEGGLQMLVFEYLPNGSISRHLYDTGRDQVIRLEFKQRLSIA  130

Query  901   SGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSI  722
              GTAKGL HLH   P VVH +FK+ NVLVDENFI KVADAG++ LL+ +  D AG S S 
Sbjct  131   IGTAKGLAHLHSLVPQVVHKDFKSSNVLVDENFIAKVADAGVAKLLQRL--DDAGRSWSS  188

Query  721   QPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW  563
               + F DPEV + G  SEASD+Y FGVFL ELITG+E AH+    S +++ QW
Sbjct  189   GGNVFQDPEVEEFGALSEASDVYSFGVFLLELITGQEVAHLFSPESEESLAQW  241



>ref|XP_010241801.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X5 [Nelumbo nucifera]
Length=304

 Score =   291 bits (745),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 195/274 (71%), Gaps = 7/274 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELEQATK+F 
Sbjct  34    KNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQATKHFS  92

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LLG+CQ
Sbjct  93    KSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLLGFCQ  152

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  PP+ H
Sbjct  153   EDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVPPLAH  212

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPEV +SG FS 
Sbjct  213   KNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPEVGESGKFSG  270

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQ  566
              SD+Y FGVFL ELITG+EA  I  L S+++++Q
Sbjct  271   MSDVYSFGVFLLELITGQEALKINSLRSHESLIQ  304



>ref|NP_001169946.1| uncharacterized LOC100383845 [Zea mays]
 ref|XP_008673228.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 ref|XP_008673229.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 ref|XP_008673231.1| PREDICTED: uncharacterized LOC100383845 isoform X1 [Zea mays]
 gb|ACN35326.1| unknown [Zea mays]
 gb|ACN36772.1| unknown [Zea mays]
 tpg|DAA55993.1| TPA: putative transmembrane protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA55994.1| TPA: putative transmembrane protein kinase family protein isoform 
2 [Zea mays]
Length=366

 Score =   293 bits (750),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 208/323 (64%), Gaps = 15/323 (5%)
 Frame = -2

Query  1270  GVPEG--ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQ  1097
              +PE   AR   ++EL  AT+NF   NLIG G+FG V+KG L DGTIVA+K R +PP Q+
Sbjct  48    ALPESQEARCLSLEELNFATRNFSNGNLIGQGTFGEVYKGLLQDGTIVAVKRRHSPPSQE  107

Query  1096  FSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQ  917
             F +EV  L+   H NLV LLGYCQE+G Q+LV EY+ NG++  HL+G      ++LEFK+
Sbjct  108   FIQEVNYLASLCHWNLVKLLGYCQEDGMQMLVYEYISNGSVSTHLHGNSHALGSRLEFKK  167

Query  916   RLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAG  737
             RLSIA GTAKGL HLH   PP VH NFKT NVLVDE+F PKVAD GI  +L  +     G
Sbjct  168   RLSIAHGTAKGLSHLHSLTPPAVHMNFKTSNVLVDEDFAPKVADTGIPGMLDRLG--VTG  225

Query  736   PSHSIQPSPFIDPEVNQSG--VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQW  563
              S      PF++P + ++    FS  SD+Y FGVFL ELI+GR+A       S+Q ++QW
Sbjct  226   LSSRTFNDPFVEPRMKEAMNLNFSIQSDVYSFGVFLLELISGRKAV------SDQCIIQW  279

Query  562   VEAHLSSDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE  392
              ++   S D   + + R+ G ++++ M++L+ L  RC +   ++RP+M  V  E +RI E
Sbjct  280   AQSFQESSDISVIADSRMAGGFTSQSMKELLSLTARCVNPTSEQRPSMSSVEAEIQRIRE  339

Query  391   KEIMGSTAMGEASATLTLGSQLF  323
             +EI  +  M E + T+TLGSQLF
Sbjct  340   QEISLTAVMAEGTPTVTLGSQLF  362



>ref|XP_010241787.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X3 [Nelumbo nucifera]
Length=355

 Score =   290 bits (743),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 195/274 (71%), Gaps = 7/274 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSA---PVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             K   N+NS+T SSDPSA    VE   GG  +S   +  G P+G + F ++ELEQATK+F 
Sbjct  34    KNLLNKNSETGSSDPSAQESTVEWNRGGGFTSGGTSLSG-PQGVKKFTLEELEQATKHFS  92

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             +SNLIG GSFGLV+KG L DGTIVA+K R    RQ F  EV  LS  +HR+LV LLG+CQ
Sbjct  93    KSNLIGEGSFGLVYKGLLCDGTIVAVKRRPGAARQDFVNEVLYLSEIRHRHLVTLLGFCQ  152

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             E+  Q+L+ EYLPNG++C+HLY  G+ S+T+LEFKQRLSIA G AKGLCHLHG  PP+ H
Sbjct  153   EDDSQMLIFEYLPNGSICSHLYDTGQGSTTQLEFKQRLSIALGAAKGLCHLHGLVPPLAH  212

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFI-DPEVNQSGVFSE  668
              NFKT NVLVDENFI KVADAG+ +LL+ I     GPS  +     + DPEV +SG FS 
Sbjct  213   KNFKTSNVLVDENFIAKVADAGVYNLLERIGD--PGPSSRMTGGNVLQDPEVGESGKFSG  270

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQ  566
              SD+Y FGVFL ELITG+EA  I  L S+++++Q
Sbjct  271   MSDVYSFGVFLLELITGQEALKINSLRSHESLIQ  304



>emb|CDY00187.1| BnaC09g01140D [Brassica napus]
Length=432

 Score =   293 bits (749),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 216/358 (60%), Gaps = 13/358 (4%)
 Frame = -2

Query  1417  SNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRM  1238
             S L +      +  ++ ++R S++ SSDPS    +     +S            AR F++
Sbjct  36    SALLVFLLWFCIIRRKNASRTSESGSSDPSTQEGRSVAMDLSM---------REARRFKV  86

Query  1237  QELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQH  1058
             +EL QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   H
Sbjct  87    EELAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINH  146

Query  1057  RNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGL  881
             RNLV LLGY QEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL
Sbjct  147   RNLVTLLGYSQENNTQFLVYEYVPNGSVSSHLYGAGDKVSGNRLEFRNRLAISIGAAKGL  206

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFID  701
              HLH   P ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ 
Sbjct  207   AHLHSLSPRLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLS  266

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LV  530
             PEV +   FSE SD+Y FGVFL EL++GREA+      S QT+++W++      D   +V
Sbjct  267   PEVQEFRRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVEWMQNIRDYKDIPMMV  326

Query  529   EHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             + RL G Y+AEG+ ++I L +RC +   ++RP M  V  E ERIL+KE+  +T MGE 
Sbjct  327   DERLGGTYTAEGVEEVITLTLRCLNVSSEKRPAMSYVVAELERILDKEVSLTTVMGEV  384



>ref|XP_008647498.1| PREDICTED: LOC100272541 isoform X1 [Zea mays]
 gb|AFW77616.1| putative transmembrane protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW77617.1| putative transmembrane protein kinase family protein isoform 
2 [Zea mays]
Length=305

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 181/265 (68%), Gaps = 5/265 (2%)
 Frame = -2

Query  1354  SDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGSF  1175
             SDT SSDPS  VE   GG  S   LA     + AR F +++L QATKNF ++N+IG GSF
Sbjct  41    SDTGSSDPSTLVEWGKGGRSS---LAPDLEHQVARQFSLEDLVQATKNFSDTNIIGAGSF  97

Query  1174  GLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLE  995
             GLV+ G L DGT+VAIK R     Q F++EV  LS  +HRN+V L+GYCQE G Q+LV E
Sbjct  98    GLVYMGLLLDGTVVAIKRRVGAATQVFADEVRLLSEIRHRNIVTLIGYCQEGGLQMLVYE  157

Query  994   YLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLV  815
             YLPNG++C HLY   + S+T+LEFKQRLSIA G AKGL HLH   PP++H +FKT NVLV
Sbjct  158   YLPNGSVCGHLYDNRKGSATRLEFKQRLSIAIGAAKGLNHLHSLDPPLIHKDFKTNNVLV  217

Query  814   DENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFL  635
             DENFI KVADAG+  L++    D AGPS     S + DPEV     FSE+SD+Y FGVFL
Sbjct  218   DENFIAKVADAGLVRLIR--GSDDAGPSRGFSNSVYQDPEVQSMTQFSESSDVYSFGVFL  275

Query  634   WELITGREAAHIRGLGSNQTMLQWV  560
              ELITGREAA +    S + +  WV
Sbjct  276   LELITGREAASLIPTESREYLAHWV  300



>ref|XP_002440989.1| hypothetical protein SORBIDRAFT_09g018470 [Sorghum bicolor]
 gb|EES19419.1| hypothetical protein SORBIDRAFT_09g018470 [Sorghum bicolor]
Length=256

 Score =   281 bits (719),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 185/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1087  EVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLS  908
             +V  LS  +HRN+V L+GYCQE G Q+LV EYLPNG++C HLY   + S+T+LEFKQRLS
Sbjct  2     QVRWLSEIRHRNIVTLIGYCQEGGLQMLVYEYLPNGSVCGHLYDTRKGSATRLEFKQRLS  61

Query  907   IASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  728
             IA G AKGL HLH   PP++H +FKT NVLVDENFI KVADAG+  L++    D AGPSH
Sbjct  62    IAIGAAKGLNHLHSLDPPLIHKDFKTNNVLVDENFIAKVADAGLVRLIR--GSDDAGPSH  119

Query  727   SIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
                 S + DPEV     FSE+SD+Y FGVFL ELITGREAA +    S + +  W+EAH 
Sbjct  120   GFSNSVYQDPEVQSMTQFSESSDVYSFGVFLLELITGREAASLIPTDSREYLAHWMEAHF  179

Query  547   SSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
             SS++L++ RL G ++AEGM++L+ LA +C +   + RP M +VA E +RILE E+  +T 
Sbjct  180   SSNELIDPRLAGNFTAEGMKELVGLAFQCLNPSSRRRPRMRLVATELDRILETEMSMTTF  239

Query  367   MGEASATLTLGSQLFTN  317
             MG+ +A +TLGSQLFT+
Sbjct  240   MGDGTAIVTLGSQLFTS  256



>ref|XP_010528127.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X4 [Tarenaya hassleriana]
Length=331

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 194/314 (62%), Gaps = 8/314 (3%)
 Frame = -2

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  16    FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  75

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  890
               HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  76    IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  135

Query  889   KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  710
             KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  136   KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  193

Query  709   FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL-  533
              + PEV +   FS+ SD+Y FGVFL EL+TGREA+      S+QT+L+W+  ++   DL 
Sbjct  194   LLAPEVQEFRRFSDKSDVYAFGVFLLELVTGREASEPSPSCSDQTLLEWMRNNVDYTDLS  253

Query  532   ---VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG  362
                ++ RL   Y+ EGM +LIRL   C     + RP M  V  E +RIL++E+  +T MG
Sbjct  254   VAVIDERLGSSYTEEGMEELIRLTAPCLEVSSERRPEMSYVVTELKRILDREVSLTTLMG  313

Query  361   -EASATLTLGSQLF  323
              E + T+TLGSQLF
Sbjct  314   EEGTPTVTLGSQLF  327



>ref|XP_009420341.1| PREDICTED: probable receptor-like protein kinase At1g30570 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=346

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/350 (47%), Positives = 213/350 (61%), Gaps = 47/350 (13%)
 Frame = -2

Query  1360  RNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCG  1181
             R+SDT SS+ S   EQ       ++ LA     +GARVF ++EL+ ATK+F   NLIG G
Sbjct  38    RSSDTNSSELSVQEEQ-------TIELA----FQGARVFTLKELDAATKDFSNINLIGYG  86

Query  1180  SFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILV  1001
              FG V KGFL DGTIVAIK R + P Q+F EEV  LS  +HRNLV LLGYCQEN  Q+LV
Sbjct  87    MFGEVNKGFLQDGTIVAIKRRVSAPSQEFIEEVCYLSSIRHRNLVRLLGYCQENDLQMLV  146

Query  1000  LEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFKTGNV  821
              EY+ NG++  HLYG  +  S KLEFK RLSIA G AK                      
Sbjct  147   YEYVSNGSVSTHLYGGNQVLSRKLEFKHRLSIAHGAAK----------------------  184

Query  820   LVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGVFSEASDIYGFG  644
               DE+FIPKVADAG+  LL   N   A PS  +    PF DPEV +SG FS  SD+Y FG
Sbjct  185   --DEDFIPKVADAGLRRLLNRTN--GASPSSRVTTDDPFHDPEVKESGGFSLKSDVYSFG  240

Query  643   VFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL---VEHRLMGKYSAEGMRDLIRL  473
             VFL EL+ GR+        S+Q +++W + +  S D+   ++ R++  +++EGM++ +RL
Sbjct  241   VFLMELLCGRDVR------SDQRLIEWAQNYEDSIDISTVIDPRMVSSFTSEGMKEFLRL  294

Query  472   AMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
                C +   + RP+MD V +E +RI EKE+  +T MGE + T+TLGSQLF
Sbjct  295   ITWCLNPSSERRPSMDYVEIELQRIREKELQLTTVMGEGTTTVTLGSQLF  344



>emb|CDY63200.1| BnaA09g52250D [Brassica napus]
Length=678

 Score =   292 bits (748),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 217/358 (61%), Gaps = 13/358 (4%)
 Frame = -2

Query  1417  SNLFILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRM  1238
             S L +      +  ++ ++R S++ SSDPS    +     +S            AR F+M
Sbjct  36    SALLVFLLWFCIFRRKNASRTSESGSSDPSTQERRSVAMDLSM---------REARSFKM  86

Query  1237  QELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQH  1058
             +EL QATK+F   +LIG G FG V+KG L DG +VAIK R   P Q+F  EV  LS   H
Sbjct  87    EELAQATKSFTNKSLIGTGKFGEVYKGLLQDGVLVAIKKRPGLPTQEFVNEVRYLSSINH  146

Query  1057  RNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMG-RDSSTKLEFKQRLSIASGTAKGL  881
             RNLV LLGYCQEN  Q LV EY+PNG++ +HLYG G + S  +LEF+ RL+I+ G AKGL
Sbjct  147   RNLVTLLGYCQENNTQFLVYEYVPNGSVSSHLYGGGDKVSGNRLEFRNRLAISIGAAKGL  206

Query  880   CHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFID  701
              HLH   P ++H +FKT NVLVDENFI +VADAG+ + L   +      S       F+ 
Sbjct  207   AHLHSLSPRLIHKDFKTANVLVDENFIARVADAGVRNFLGRDDVVVGTSSLDAADQIFLS  266

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LV  530
             PEV +   FSE SD+Y FGVFL EL++G+EA+      S QT+++W++      D   ++
Sbjct  267   PEVQEFRRFSEKSDVYAFGVFLLELVSGKEASEPSPSSSTQTLVEWMQNIRDYKDIPMMI  326

Query  529   EHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
             + RL G Y+AEG+ ++I L +RC +   ++RP M  V  E ERIL+KE+  +T MGE 
Sbjct  327   DERLGGTYTAEGVEEVITLTLRCLNVSSEKRPAMSYVLTELERILDKEVSLTTVMGEV  384



>ref|XP_010528125.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X2 [Tarenaya hassleriana]
Length=362

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 194/314 (62%), Gaps = 8/314 (3%)
 Frame = -2

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  47    FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  106

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  890
               HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  107   IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  166

Query  889   KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  710
             KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  167   KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  224

Query  709   FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL-  533
              + PEV +   FS+ SD+Y FGVFL EL+TGREA+      S+QT+L+W+  ++   DL 
Sbjct  225   LLAPEVQEFRRFSDKSDVYAFGVFLLELVTGREASEPSPSCSDQTLLEWMRNNVDYTDLS  284

Query  532   ---VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG  362
                ++ RL   Y+ EGM +LIRL   C     + RP M  V  E +RIL++E+  +T MG
Sbjct  285   VAVIDERLGSSYTEEGMEELIRLTAPCLEVSSERRPEMSYVVTELKRILDREVSLTTLMG  344

Query  361   -EASATLTLGSQLF  323
              E + T+TLGSQLF
Sbjct  345   EEGTPTVTLGSQLF  358



>ref|XP_010528121.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528122.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528123.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528124.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Tarenaya hassleriana]
Length=380

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 194/314 (62%), Gaps = 8/314 (3%)
 Frame = -2

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  65    FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  124

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  890
               HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  125   IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  184

Query  889   KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  710
             KGL HLH   P ++H +FKT NVL DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  185   KGLAHLHSLSPLLIHKDFKTTNVLADENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  242

Query  709   FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL-  533
              + PEV +   FS+ SD+Y FGVFL EL+TGREA+      S+QT+L+W+  ++   DL 
Sbjct  243   LLAPEVQEFRRFSDKSDVYAFGVFLLELVTGREASEPSPSCSDQTLLEWMRNNVDYTDLS  302

Query  532   ---VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG  362
                ++ RL   Y+ EGM +LIRL   C     + RP M  V  E +RIL++E+  +T MG
Sbjct  303   VAVIDERLGSSYTEEGMEELIRLTAPCLEVSSERRPEMSYVVTELKRILDREVSLTTLMG  362

Query  361   -EASATLTLGSQLF  323
              E + T+TLGSQLF
Sbjct  363   EEGTPTVTLGSQLF  376



>ref|XP_010909093.1| PREDICTED: receptor-like protein kinase HERK 1 isoform X2 [Elaeis 
guineensis]
Length=349

 Score =   280 bits (715),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 215/358 (60%), Gaps = 50/358 (14%)
 Frame = -2

Query  1360  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  1199
             R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31    RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83    NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
               Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AK                
Sbjct  143   DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAK----------------  186

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGVFSEAS  662
                     DE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPEV +SG FS  S
Sbjct  187   --------DEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPEVKESGRFSVTS  236

Query  661   DIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD---LVEHRLMGKYSAEGM  491
             D+Y FGVFL EL++GREA       S+  +++  +++    +   LV+ R+   +++EGM
Sbjct  237   DVYSFGVFLMELVSGREAR------SDLHIIELAQSYQEPSNISTLVDQRMGSSFTSEGM  290

Query  490   RDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              + +RL   C +   + RP M+ V  E +RI EKE+  +T M E S T+TLGSQLFT 
Sbjct  291   SEFLRLIAWCLNPSSERRPPMNFVESELDRIREKEMSLTTIMPEGSTTVTLGSQLFTT  348



>ref|XP_010909095.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X4 [Elaeis guineensis]
 ref|XP_010909096.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X4 [Elaeis guineensis]
Length=292

 Score =   275 bits (702),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 177/258 (69%), Gaps = 17/258 (7%)
 Frame = -2

Query  1360  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  1199
             R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31    RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83    NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
               Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH   PP+VH N
Sbjct  143   DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLHSLNPPLVHMN  202

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQSGVFSEAS  662
             FKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPEV +SG FS  S
Sbjct  203   FKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPEVKESGRFSVTS  260

Query  661   DIYGFGVFLWELITGREA  608
             D+Y FGVFL EL++GREA
Sbjct  261   DVYSFGVFLMELVSGREA  278



>gb|EMT31170.1| Serine/threonine-protein kinase-like protein ACR4 [Aegilops tauschii]
Length=337

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 195/319 (61%), Gaps = 40/319 (13%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEV  1082
             +GAR   ++EL  AT NF  SNL+G G FG                            EV
Sbjct  53    QGARCMTLEELRSATNNFSSSNLVGHGMFG----------------------------EV  84

Query  1081  ARLS-MTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI  905
               LS + +H NLVNLLGYCQ+NG Q+LV +Y+PNG++  HL+G G   + +LEFKQRL+I
Sbjct  85    NYLSSIRRHPNLVNLLGYCQDNGMQMLVYQYVPNGSISAHLHGNGNSPTVRLEFKQRLAI  144

Query  904   ASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHS  725
             A GTAKGL HLH   PP VH NFKT NVLVD +F+PKVAD GI  LL  + +  AGP   
Sbjct  145   AHGTAKGLSHLHSMTPPAVHMNFKTANVLVDADFLPKVADTGIRGLLDRLGN--AGPPSM  202

Query  724   IQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLS  545
             I   PF+DP   +S +FS  SD+Y FGVFL ELI+GR AA      S+Q +++WV     
Sbjct  203   IFNDPFVDPRGKESMIFSIQSDVYSFGVFLVELISGRTAA------SDQGIIEWVRNFQE  256

Query  544   SDD---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
             S +   + + R+   ++ +GM++L+RLA RC +   ++RP+M +V  E  RI E+EI  +
Sbjct  257   SSEISAIADRRMTSGFTPQGMKELLRLASRCVNPRSEDRPSMSLVEAEIHRIREQEIRRT  316

Query  373   TAMGEASATLTLGSQLFTN  317
             TAM     T+TLGSQLFT+
Sbjct  317   TAMPVGDTTVTLGSQLFTS  335



>ref|XP_008810477.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X3 [Phoenix 
dactylifera]
Length=308

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 184/282 (65%), Gaps = 23/282 (8%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQ  1223
             L  KR  +R S T SS+PS     +E    G VS         P G   AR F ++EL  
Sbjct  30    LLRKRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLEELNV  81

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HRNLV+
Sbjct  82    ATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHRNLVS  141

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  LH  
Sbjct  142   LLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGFLHSM  201

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQ  686
              PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DPEV +
Sbjct  202   NPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDPEVKE  259

Query  685   SGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV  560
             SG FS  SD+Y FGVFL EL++GREA       S+Q +++ V
Sbjct  260   SGRFSVMSDVYSFGVFLMELVSGREAR------SDQRIIELV  295



>ref|XP_008810478.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X4 [Phoenix 
dactylifera]
Length=303

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 177/266 (67%), Gaps = 17/266 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQ  1223
             L  KR  +R S T SS+PS     +E    G VS         P G   AR F ++EL  
Sbjct  30    LLRKRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLEELNV  81

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HRNLV+
Sbjct  82    ATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHRNLVS  141

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  LH  
Sbjct  142   LLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGFLHSM  201

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQ  686
              PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DPEV +
Sbjct  202   NPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDPEVKE  259

Query  685   SGVFSEASDIYGFGVFLWELITGREA  608
             SG FS  SD+Y FGVFL EL++GREA
Sbjct  260   SGRFSVMSDVYSFGVFLMELVSGREA  285



>ref|XP_008810476.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Phoenix dactylifera]
Length=350

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 177/266 (67%), Gaps = 17/266 (6%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAP---VEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQ  1223
             L  KR  +R S T SS+PS     +E    G VS         P G   AR F ++EL  
Sbjct  30    LLRKRSVSRTSQTNSSEPSLQGQNIELSFSGGVS--------YPPGLQEARCFTLEELNV  81

Query  1222  ATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             ATKNF   NLIG G FG VFKG L  G IVAIK R + PRQ+F EEV  LS  +HRNLV+
Sbjct  82    ATKNFSNINLIGYGMFGEVFKGLLHGGMIVAIKRRPSAPRQEFVEEVHYLSTIRHRNLVS  141

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQ  863
             LLGYC+EN  Q+L+ EY+PNG++  HLYG G+  S +LEFK RL IA G AKGL  LH  
Sbjct  142   LLGYCRENDTQMLIYEYVPNGSVSTHLYGSGQVVSARLEFKHRLLIAHGAAKGLGFLHSM  201

Query  862   CPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPEVNQ  686
              PP+VH NFKT NVLVDE+FIPKV+DAG+ SLL  I  D AGPS+ +    PF+DPEV +
Sbjct  202   NPPLVHMNFKTENVLVDEDFIPKVSDAGLQSLLDRI--DDAGPSYRMTTDDPFLDPEVKE  259

Query  685   SGVFSEASDIYGFGVFLWELITGREA  608
             SG FS  SD+Y FGVFL EL++GREA
Sbjct  260   SGRFSVMSDVYSFGVFLMELVSGREA  285



>ref|XP_002990160.1| hypothetical protein SELMODRAFT_131164 [Selaginella moellendorffii]
 gb|EFJ08720.1| hypothetical protein SELMODRAFT_131164 [Selaginella moellendorffii]
Length=384

 Score =   270 bits (690),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 158/361 (44%), Positives = 224/361 (62%), Gaps = 21/361 (6%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  + + +  SDTASSDPSA    + G      A+A     + A+ F  QEL+ ATK F
Sbjct  38    LMRVRHWPSATSDTASSDPSA----QEG------AIAAAVEAQHAKQFAFQELDHATKGF  87

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             + SNLIG G FGLV+KG L DGTIVAIKTR++ P Q+F  EV  LS  +H+N+V+LLG+C
Sbjct  88    NPSNLIGRGRFGLVYKGLLEDGTIVAIKTRASAPTQEFVTEVVNLSQLRHKNVVSLLGFC  147

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE+ +Q+LV +YLPNG++ +HL     + + +L+FKQR++IA G A+GL +LH   PP V
Sbjct  148   QEHDHQMLVYDYLPNGSVSSHLCDPNGNPTGELDFKQRVAIALGAARGLEYLHSGNPPRV  207

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP-EVNQSGVFS  671
             H +FKT NVL+DEN + KV D G+S LL  +    A PS +   S F DP  V  +    
Sbjct  208   HQDFKTSNVLLDENLVAKVTDVGLSKLL--VTSHNAMPSANGSSSHFADPAAVYNTYRVD  265

Query  670   EASDIYGFGVFLWELITGREAAH-IRGLGSNQTMLQWV----EAHLSSDDLVEHRLMGKY  506
               SD+Y +GVFL ELI+GR+A +  R    +  +++W     E+  S + +V+  L+G  
Sbjct  266   PKSDVYSYGVFLLELISGRQAINRSRPAQPSPGIVEWARSLQESSSSMEGMVDKSLVG--  323

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
               E    L+ L + CT+   ++RP M  V+ + ERIL+KE  G  A GE +  +TLGS+L
Sbjct  324   -TEEAGTLLLLGLHCTAQSPEKRPTMSQVSQQVERILDKERGGIVAAGEGATVVTLGSEL  382

Query  325   F  323
             F
Sbjct  383   F  383



>ref|XP_002992529.1| hypothetical protein SELMODRAFT_162409 [Selaginella moellendorffii]
 gb|EFJ06467.1| hypothetical protein SELMODRAFT_162409 [Selaginella moellendorffii]
Length=384

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/361 (44%), Positives = 223/361 (62%), Gaps = 21/361 (6%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  + + +  SDTASSDPSA    + G      A+A     + A+ F  QEL+ ATK F
Sbjct  38    LMRVRHWPSATSDTASSDPSA----QEG------AIAAAVEAQHAKQFAFQELDHATKGF  87

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
             + SNLIG G FGLV+KG L DGTIVAIKTR++ P Q+F  EV  LS  +H+N+V+LLG+C
Sbjct  88    NPSNLIGRGRFGLVYKGLLEDGTIVAIKTRASAPTQEFVTEVVNLSQLRHKNVVSLLGFC  147

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE+ +Q+LV +YLPNG++ +HL     + + +L+FKQR++IA G A+GL +LH   PP V
Sbjct  148   QEHDHQMLVYDYLPNGSVSSHLCDPNGNPTGELDFKQRVAIALGAARGLEYLHSGNPPRV  207

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDP-EVNQSGVFS  671
             H +FKT NVL+DEN + KV D G+S LL  +    A PS +   S F DP  V  +    
Sbjct  208   HQDFKTSNVLLDENLVAKVTDVGLSKLL--VTSHNAMPSANGSSSHFADPAAVYNTYRVD  265

Query  670   EASDIYGFGVFLWELITGREAAH-IRGLGSNQTMLQWV----EAHLSSDDLVEHRLMGKY  506
               SD+Y +GVFL ELI+GR+A +  R    +  +++W     E+  S + +V+  L+G  
Sbjct  266   PKSDVYSYGVFLLELISGRQAINRSRPAQPSPGIVEWARSLQESSSSMEGMVDKSLVG--  323

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
               E    L+ L + CT+   ++RP M  V+ + ERIL+KE  G  A GE    +TLGS+L
Sbjct  324   -TEEAGTLLLLGLHCTAQSPEKRPTMSQVSQQVERILDKERGGIVAAGEGPTVVTLGSEL  382

Query  325   F  323
             F
Sbjct  383   F  383



>ref|XP_010651159.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010651160.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI16311.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   265 bits (676),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 215/359 (60%), Gaps = 13/359 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR+  R S+TASS PS PVE    G  +SL  A    P G    R   + ELE AT
Sbjct  171   LMRVKRFIRRTSETASSVPSPPVEWD--GRNTSLQ-ASALSPYGTTHLRQLTIMELEHAT  227

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
              NF ++N+IG G FGLV+KG L DG+IVAIK R   P Q F+ EV R++  QH++LV L+
Sbjct  228   CNFSQNNIIGEGGFGLVYKGLLLDGSIVAIKRRLHTPTQFFAHEVKRIARVQHKHLVKLI  287

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYC+EN  Q+LV +YL NG + NHLY        +LE  QRLSIA G AKGL HLH   P
Sbjct  288   GYCEENHQQLLVNDYLQNGNVGNHLYDSEGLPMGRLEIWQRLSIALGAAKGLEHLHSLVP  347

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
               +H +F+T NVLVDENF  KV+D G+S LL E     AG S +I    F+DPE+  S  
Sbjct  348   SFLHMHFRTSNVLVDENFTAKVSDFGLSRLLAE--GARAGSSSAI--DCFLDPELRSSKD  403

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y +GVFL ELI+GREA       S Q ++         ++ V+ + +G ++ +
Sbjct  404   FSETSDVYSYGVFLLELISGREAHGRDEPNSQQNLVLHARCINDLNNFVD-KTLGDHTMD  462

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA-MGEASATLTLGSQLF  323
              +++++ LA+ C     + RP M  V  E ERI  +EI    A +GE    +TLGS+LF
Sbjct  463   AVKEMMELALACVDISVR-RPTMKKVVEELERIQHREIGHLQAQLGEEIGVVTLGSELF  520



>dbj|BAF79953.1| receptor-like kinase [Marchantia polymorpha]
Length=632

 Score =   266 bits (679),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/376 (43%), Positives = 216/376 (57%), Gaps = 18/376 (5%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTG--GPVSSLALARGGVPEG----ARV  1247
              +L    LL +K + +  SDT SSDPSA V+   G  GP+     AR   PE     AR 
Sbjct  262   IVLVSCCLLRAKSWPSATSDTGSSDPSAQVDWAKGPEGPI-----ARSVAPESDTSKARY  316

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F ++ELE ATK F  +N IG G FG V+KG L DGTIVA+K R     Q F   V  LS 
Sbjct  317   FSLEELEHATKKFSANNKIGRGGFGEVYKGLLEDGTIVAVKGRQGAATQDFQAAVEFLSR  376

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
              +H++LVN+LG+CQEN  QI+V +YLPNG++C HLY        KL+F+QRL+IA G AK
Sbjct  377   MRHKHLVNVLGFCQENDQQIVVYDYLPNGSVCGHLYDDNGAPVGKLDFRQRLAIALGAAK  436

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQ----  719
             GL +LH   P ++H +FKT NVL+D   + KV D G+S LL E  H   GP  S      
Sbjct  437   GLEYLHTTTPKLIHRDFKTSNVLLDAYLVAKVTDFGLSLLLAEGPHPQEGPVLSSLNGDG  496

Query  718   PSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD  539
              + F+DPE   +   +E SD+Y FGVFL EL++GREA       S  ++++W  + L + 
Sbjct  497   TAGFLDPEYYTTQRLTEKSDVYSFGVFLLELVSGREAISQDRPRSEWSLVEWGRSLLQAG  556

Query  538   D---LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
             D   LV+  L   +    MR ++ +   C    G  RP+M  V  E E  LEKE   ++ 
Sbjct  557   DLGALVDRTLGSSFMEVAMRKMVEVGFHCVEETGDRRPSMAEVVKELEEALEKERGLTSG  616

Query  367   MGEASATLTLGSQLFT  320
              GE + T+TLGS+LFT
Sbjct  617   GGEGATTVTLGSELFT  632



>dbj|BAK07663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 166/251 (66%), Gaps = 11/251 (4%)
 Frame = -2

Query  1363  NRNSDTASSD-PSAPVEQKTGGPVSSLALARGGVPE--GARVFRMQELEQATKNFDESNL  1193
             +R SDTAS + P    E    G  SS        P+  GAR F ++E+  ATKNF ++NL
Sbjct  37    SRTSDTASDETPPTLAEWGRCGRTSS-------APDYQGARRFTLEEMSHATKNFSDANL  89

Query  1192  IGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGY  1013
             +G G+FG V+ G L DGT+VAIK R  PPRQ F +EV R S   HRN+V L+GYCQ+ G 
Sbjct  90    VGAGTFGKVYMGLLLDGTVVAIKRRVGPPRQDFVDEVRRQSEIWHRNVVTLIGYCQDGGL  149

Query  1012  QILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             ++LV E+LPNG++C HLY  G++S T+LEFKQRLSIA G AKGL HLH   PP++H  FK
Sbjct  150   EMLVFEHLPNGSVCGHLYDTGKESMTRLEFKQRLSIAIGAAKGLDHLHSLAPPLIHKGFK  209

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIY  653
             T NVLVDENFI KV+DAG+  LL+ +  D   P +  +   + DPE +     S +SD+Y
Sbjct  210   TSNVLVDENFIAKVSDAGVDRLLRGLE-DPGSPLNGFRSGVYQDPEAHSLAQLSASSDVY  268

Query  652   GFGVFLWELIT  620
              FGVFL ELIT
Sbjct  269   SFGVFLLELIT  279



>gb|KDO45969.1| hypothetical protein CISIN_1g016626mg [Citrus sinensis]
Length=302

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 165/260 (63%), Gaps = 12/260 (5%)
 Frame = -2

Query  1384  LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFD  1205
             L   R  +R S+T SS+PS    +  G  +S            AR F+M+EL  ATKNF 
Sbjct  30    LYRNRSVSRTSETGSSEPSVQPGRNVGIELS---------IREARRFQMEELSLATKNFS  80

Query  1204  ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQ  1025
             + NLIG G FG V+KG L DG +VAIK R   P Q+F +EV  L+  QHRNLV LLGYCQ
Sbjct  81    DKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQ  140

Query  1024  ENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVH  845
             EN  Q L+ EY+PNG++  HLYG  + S  KLEFK RLSIA G AKGL HLH   P VVH
Sbjct  141   ENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVH  200

Query  844   GNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSE  668
              +FKT NVLVDE+FI KVADAG+ + L     D AGPS  +     F+  EV +   FSE
Sbjct  201   KDFKTANVLVDEDFIAKVADAGLRNFLGRT--DVAGPSSQVTADEIFLASEVKEFRRFSE  258

Query  667   ASDIYGFGVFLWELITGREA  608
              SD+Y FGVFL EL++GREA
Sbjct  259   KSDVYSFGVFLLELVSGREA  278



>ref|XP_007205462.1| hypothetical protein PRUPE_ppa007926mg [Prunus persica]
 gb|EMJ06661.1| hypothetical protein PRUPE_ppa007926mg [Prunus persica]
Length=351

 Score =   246 bits (628),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/354 (43%), Positives = 205/354 (58%), Gaps = 10/354 (3%)
 Frame = -2

Query  1375  KRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV-PEGARVFRMQELEQATKNFDES  1199
             KR+  R S+T SS PS  VE + G  +S  A+A      +  R   + ELEQAT NF+E 
Sbjct  4     KRFIRRTSETGSSAPSPSVEWERGN-MSPYAVALSLYNTQNLRQLTILELEQATCNFNEI  62

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             N+IG   FGLV+KG L DG+IVAIK R   P Q F  EV R++   H +++ L+GYCQ+ 
Sbjct  63    NIIGQCRFGLVYKGLLQDGSIVAIKRRLHAPTQYFFHEVKRIAHVNHVHVLRLIGYCQDA  122

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
               Q+LV EYLPNG + NHLY        KL  +QRLSIA G AKGL HLH   PP++H  
Sbjct  123   SQQLLVYEYLPNGNVGNHLYDAEGLPIGKLGIRQRLSIALGAAKGLAHLHNLVPPLLHMY  182

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASD  659
             F+T NVL+DENF  KV+D G++ LL + +H  AG S +I    F DPE++ S  FSE SD
Sbjct  183   FRTSNVLLDENFTAKVSDYGLTKLLVKGHH--AGSSSTI--DYFRDPELDLSKKFSEKSD  238

Query  658   IYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMRDLI  479
             +Y FGVFL ELI+GREA     L S   ++   +        V+ + +G  S +  + ++
Sbjct  239   VYSFGVFLLELISGREANGRIQLSSGDNLILQAKGCNDLGRFVD-KTLGDNSMQAAKQMM  297

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMG--STAMGEASATLTLGSQLF  323
              LA+ C     ++R  M +V  E ERI     +      + E    +TLGS+LF
Sbjct  298   ELALMCID-ASQQRLQMQIVVEELERIHRASEISHFHVKVDEEIGAVTLGSELF  350



>ref|XP_009367078.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=524

 Score =   251 bits (640),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 208/360 (58%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQAT
Sbjct  174   LMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQAT  230

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ L+
Sbjct  231   RNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILRLI  290

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH   P
Sbjct  291   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSLVP  350

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE++ S  
Sbjct  351   PLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPELDSSKK  405

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL ELI+GREA     L S   ++   +     D  V+ + +G  S +
Sbjct  406   FSERSDVYSFGVFLLELISGREANARNQLNSGDNLILQAKDCKDLDRFVD-KTLGDMSRQ  464

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE--KEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI +  +       + E    +TLGS+LF
Sbjct  465   TAKQMMELALMCVD-GSERRPQMQIVVEELERIRQGRESNHFHVEVDEEIGAVTLGSELF  523



>ref|XP_009367079.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Pyrus x bretschneideri]
Length=521

 Score =   250 bits (639),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 208/360 (58%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQAT
Sbjct  171   LMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQAT  227

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ L+
Sbjct  228   RNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILRLI  287

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH   P
Sbjct  288   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSLVP  347

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE++ S  
Sbjct  348   PLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPELDSSKK  402

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL ELI+GREA     L S   ++   +     D  V+ + +G  S +
Sbjct  403   FSERSDVYSFGVFLLELISGREANARNQLNSGDNLILQAKDCKDLDRFVD-KTLGDMSRQ  461

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE--KEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI +  +       + E    +TLGS+LF
Sbjct  462   TAKQMMELALMCVD-GSERRPQMQIVVEELERIRQGRESNHFHVEVDEEIGAVTLGSELF  520



>ref|XP_009367077.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=546

 Score =   250 bits (639),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 208/360 (58%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQAT
Sbjct  196   LMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQAT  252

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ L+
Sbjct  253   RNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILRLI  312

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH   P
Sbjct  313   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSLVP  372

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE++ S  
Sbjct  373   PLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAV--DCFLDPELDSSKK  427

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL ELI+GREA     L S   ++   +     D  V+ + +G  S +
Sbjct  428   FSERSDVYSFGVFLLELISGREANARNQLNSGDNLILQAKDCKDLDRFVD-KTLGDMSRQ  486

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE--KEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI +  +       + E    +TLGS+LF
Sbjct  487   TAKQMMELALMCVD-GSERRPQMQIVVEELERIRQGRESNHFHVEVDEEIGAVTLGSELF  545



>ref|XP_008225618.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=515

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 208/358 (58%), Gaps = 10/358 (3%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGV-PEGARVFRMQELEQATKN  1211
             L+  KR+  R S+T SS PS PVE + G  +S  A+A      +  R   + ELEQAT N
Sbjct  164   LMRVKRFIRRTSETESSVPSPPVEWERGN-MSPYAVALSVYNTQNLRQLTVLELEQATCN  222

Query  1210  FDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGY  1031
             F+E N+IG   FGLV+KG L DG+IVAIK R   P Q F  EV R++   H +++ L+GY
Sbjct  223   FNEINIIGQCRFGLVYKGLLQDGSIVAIKRRRHAPTQYFFHEVKRIAHVNHVHVLRLIGY  282

Query  1030  CQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPV  851
             CQ+   Q+LV EYLPNG + NHLY        KL  +QRLSIA G AKGL HLH   PP+
Sbjct  283   CQDASQQLLVYEYLPNGNVGNHLYDAEGLPIGKLGIRQRLSIALGAAKGLAHLHNLVPPL  342

Query  850   VHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFS  671
             +H  F+T NVL+DENF  KV+D G++ LL + +H  AG S +I    F+DPE++ S  FS
Sbjct  343   LHMYFRTSNVLLDENFTAKVSDYGLTKLLVKGHH--AGSSSAI--DYFLDPELDLSKKFS  398

Query  670   EASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGM  491
             E SD+Y FGVFL ELI+GREA     L S   ++   +        V+ + +G  S +  
Sbjct  399   EKSDVYSFGVFLLELISGREANGRIQLSSGDNLILQAKGCNDLGRFVD-KTLGDNSMQAA  457

Query  490   RDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS--TAMGEASATLTLGSQLF  323
             + ++ LA+ C     ++R  M +V  E ERI     +      + E    + LGS+LF
Sbjct  458   KQMMELALMCID-ASQQRLQMQIVDEELERIHRASEISQFPVEVDEEIGAVVLGSELF  514



>ref|XP_008359242.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Malus domestica]
Length=499

 Score =   247 bits (631),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 157/360 (44%), Positives = 206/360 (57%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+TASS PS P  Q   G  S  A+A    P  A   R   + ELEQAT
Sbjct  149   LMRVKRLTRRTSETASSPPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTILELEQAT  205

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L+
Sbjct  206   RNFNEINIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHVHILRLI  265

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  K RLSIA G AKGL HLH   P
Sbjct  266   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKHRLSIALGAAKGLAHLHSLVP  325

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F T NVL+DE+F  KV+D G++ LL  + H  AG S ++    F DPE++ S  
Sbjct  326   PLLHMHFGTSNVLLDESFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFRDPELDSSKK  380

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL ELI+GREA     L S   ++   +     D  V+  L G  S +
Sbjct  381   FSEISDVYSFGVFLLELISGREANARNQLNSGDNLILQAKDCKDLDRFVDETL-GGMSRQ  439

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI    +       + E    +TLGS+LF
Sbjct  440   TAKQMMELALMCXD-GSERRPQMQIVVEELERIRRGRESNHFHIEVDEEIGAVTLGSELF  498



>ref|XP_008359234.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Malus domestica]
Length=521

 Score =   247 bits (630),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 157/360 (44%), Positives = 206/360 (57%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+TASS PS P  Q   G  S  A+A    P  A   R   + ELEQAT
Sbjct  171   LMRVKRLTRRTSETASSPPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTILELEQAT  227

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L+
Sbjct  228   RNFNEINIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHVHILRLI  287

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  K RLSIA G AKGL HLH   P
Sbjct  288   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKHRLSIALGAAKGLAHLHSLVP  347

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F T NVL+DE+F  KV+D G++ LL  + H  AG S ++    F DPE++ S  
Sbjct  348   PLLHMHFGTSNVLLDESFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFRDPELDSSKK  402

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL ELI+GREA     L S   ++   +     D  V+  L G  S +
Sbjct  403   FSEISDVYSFGVFLLELISGREANARNQLNSGDNLILQAKDCKDLDRFVDETL-GGMSRQ  461

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI    +       + E    +TLGS+LF
Sbjct  462   TAKQMMELALMCXD-GSERRPQMQIVVEELERIRRGRESNHFHIEVDEEIGAVTLGSELF  520



>ref|XP_008349748.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Malus domestica]
Length=505

 Score =   244 bits (624),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 207/360 (58%), Gaps = 15/360 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + + S+T SS PS PV+ + G   S  A A    P  A   R   + ELEQAT
Sbjct  155   LMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAXAHS--PYSAPNLRQLTILELEQAT  211

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
              NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L+
Sbjct  212   CNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRLI  271

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRLSIA G AKGL HL    P
Sbjct  272   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLSIALGAAKGLAHLRSLVP  331

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S  
Sbjct  332   PLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSKK  386

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAE  497
             FSE SD+Y FGVFL EL++GREA     L S   ++   +     D  V+ + +G  S +
Sbjct  387   FSERSDVYSFGVFLLELVSGREANARNQLNSVDNLILQAKDCKDLDRFVD-KTLGDKSRQ  445

Query  496   GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQLF  323
               + ++ LA+ C     + RP M +V  E ERI    +       + E    +TLGS+LF
Sbjct  446   TAKQMMELALMCVD-GSERRPQMQIVVEELERIHRGRESSHFHIEVDEEIGAVTLGSELF  504



>ref|NP_001045323.2| Os01g0935800 [Oryza sativa Japonica Group]
 dbj|BAD87254.1| nodulation receptor kinase-like [Oryza sativa Japonica Group]
 dbj|BAF07237.2| Os01g0935800 [Oryza sativa Japonica Group]
Length=234

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 163/234 (70%), Gaps = 3/234 (1%)
 Frame = -2

Query  1009  ILVLEYLPNGTMCNHLYG-MGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGNFK  833
             +LV EYLPNG++C HLY   G++S T+LEFKQRLSIA G AKGL HLH   PP++H  FK
Sbjct  1     MLVFEYLPNGSVCGHLYANTGKESMTRLEFKQRLSIAIGAAKGLNHLHSLVPPLIHKGFK  60

Query  832   TGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP-FIDPEVNQSGVFSEASDI  656
             T NVLVDENFI KVADAGI  LL+  +  A     S   S  + DPEV+     SE+SD+
Sbjct  61    TSNVLVDENFIAKVADAGIDRLLRGFDGAAPSHHPSSSCSSIYQDPEVHSLAQLSESSDV  120

Query  655   YGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS-DDLVEHRLMGKYSAEGMRDLI  479
             Y FGVFL ELITG+EAA +      + ++ W+E+H SS +++ + RL G +++EGM++L+
Sbjct  121   YSFGVFLLELITGKEAASLISSEPREPLVHWMESHFSSNNEVTDPRLGGSFTSEGMKELV  180

Query  478   RLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLFTN  317
              L ++C S   + RP M ++A E +RILEKE+  +T MG+ +A +TLGSQLFT+
Sbjct  181   GLTLQCVSTSARRRPKMRLIAAELDRILEKEMSLTTVMGDGTAIVTLGSQLFTS  234



>ref|XP_010528126.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X3 [Tarenaya hassleriana]
Length=356

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 178/314 (57%), Gaps = 32/314 (10%)
 Frame = -2

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F + EL QAT  F   +LIG G FG V+KG L DG +VAIK R   P Q+F  E+   S 
Sbjct  65    FELDELTQATNGFTSKSLIGEGKFGEVYKGLLQDGMLVAIKKRPGSPTQEFINEIRYQSS  124

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM-GRDSSTKLEFKQRLSIASGTA  890
               HRN+V LLGYCQEN  Q LV EY+ NG++ +HLYG  G+    KLEF+ RL I+ G A
Sbjct  125   IHHRNIVTLLGYCQENNMQFLVYEYIHNGSVSSHLYGDGGKGPGQKLEFRHRLMISLGAA  184

Query  889   KGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP  710
             K                        DENF  K+AD+G+ +LL     DA   S  +    
Sbjct  185   K------------------------DENFTAKIADSGLCTLLD--TEDAGSSSRMVADEI  218

Query  709   FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL-  533
              + PEV +   FS+ SD+Y FGVFL EL+TGREA+      S+QT+L+W+  ++   DL 
Sbjct  219   LLAPEVQEFRRFSDKSDVYAFGVFLLELVTGREASEPSPSCSDQTLLEWMRNNVDYTDLS  278

Query  532   ---VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMG  362
                ++ RL   Y+ EGM +LIRL   C     + RP M  V  E +RIL++E+  +T MG
Sbjct  279   VAVIDERLGSSYTEEGMEELIRLTAPCLEVSSERRPEMSYVVTELKRILDREVSLTTLMG  338

Query  361   -EASATLTLGSQLF  323
              E + T+TLGSQLF
Sbjct  339   EEGTPTVTLGSQLF  352



>ref|XP_007016735.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
2 [Theobroma cacao]
 gb|EOY34354.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
2 [Theobroma cacao]
Length=475

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 206/358 (58%), Gaps = 14/358 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+NF
Sbjct  128   LMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQNF  184

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+GYC
Sbjct  185   SQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVGYC  244

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
               +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP++
Sbjct  245   GNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPPLL  304

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE+  S  FS 
Sbjct  305   HMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPELYSSKKFSV  360

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE--HRLMGKYSAEG  494
              SD+Y FGVFL EL +GRE AH R   + +  L  +   + +++LVE     +G  S  G
Sbjct  361   QSDVYSFGVFLLELASGRE-AHCRDQSNPEPSL--IMQAMENNNLVEFVDETLGDKSMSG  417

Query  493   MRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASATLTLGSQLF  323
              + ++ LA++C     + RP+M  +  + ERI EKEI      +GE    +TLGS+LF
Sbjct  418   AKQVVELALQCLDISPR-RPSMKRIVQDLERIQEKEIGRLHLELGEEIGAVTLGSELF  474



>ref|XP_007016734.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY34353.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
1 [Theobroma cacao]
Length=517

 Score =   243 bits (619),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 206/358 (58%), Gaps = 14/358 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+NF
Sbjct  170   LMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQNF  226

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+GYC
Sbjct  227   SQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVGYC  286

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
               +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP++
Sbjct  287   GNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPPLL  346

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE+  S  FS 
Sbjct  347   HMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPELYSSKKFSV  402

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE--HRLMGKYSAEG  494
              SD+Y FGVFL EL +GRE AH R   + +  L  +   + +++LVE     +G  S  G
Sbjct  403   QSDVYSFGVFLLELASGRE-AHCRDQSNPEPSL--IMQAMENNNLVEFVDETLGDKSMSG  459

Query  493   MRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASATLTLGSQLF  323
              + ++ LA++C     + RP+M  +  + ERI EKEI      +GE    +TLGS+LF
Sbjct  460   AKQVVELALQCLDISPR-RPSMKRIVQDLERIQEKEIGRLHLELGEEIGAVTLGSELF  516



>ref|XP_010909097.1| PREDICTED: serine/threonine-protein kinase CDG1-like isoform 
X5 [Elaeis guineensis]
Length=275

 Score =   235 bits (599),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 154/229 (67%), Gaps = 17/229 (7%)
 Frame = -2

Query  1360  RNSDTASSDPS---APVEQKTGGPVSSLALARGGVPEG---ARVFRMQELEQATKNFDES  1199
             R S T SS+PS     +E   GG VS         P G   AR F ++EL  ATKNF   
Sbjct  31    RRSVTNSSEPSLQGQSIEMSFGGGVS--------YPPGLQEARRFTLEELNVATKNFGNI  82

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQEN  1019
             NLIG G FG V+KG L DG IVAIK R + PRQ+F EEV  LS  +HRNLV+LLGYCQEN
Sbjct  83    NLIGYGMFGEVYKGLLHDGMIVAIKIRPSAPRQEFVEEVHYLSSIRHRNLVSLLGYCQEN  142

Query  1018  GYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVVHGN  839
               Q+L+ EY+PNG++  HLYG G+ ++++LEFK RLSIA G AKGL  LH   PP+VH N
Sbjct  143   DLQMLIYEYIPNGSVSTHLYGSGQVATSRLEFKHRLSIAHGAAKGLGFLHSLNPPLVHMN  202

Query  838   FKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP-SPFIDPE  695
             FKT NVLVDE+FIPKVADAG+ SLL  I  D AGPS  +    PF+DPE
Sbjct  203   FKTANVLVDEDFIPKVADAGLRSLLDRI--DDAGPSSRMTTDDPFLDPE  249



>ref|XP_009335090.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X4 [Pyrus x bretschneideri]
Length=524

 Score =   239 bits (610),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 226/421 (54%), Gaps = 22/421 (5%)
 Frame = -2

Query  1549  HNQPYCTWESSIQRATNQHCPPVPVSN-KAYEACKPSTGKKVN-VGSNLFILQRSML---  1385
             H++P     ++I    N      PV   +   + KP     +  V + L ++   ML   
Sbjct  113   HHKPRSRRIAAIVDGDNGTPTLTPVEKVRGNHSTKPKVAAIIGGVAATLLVIIVVMLIYM  172

Query  1384  --LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQA  1220
               +  KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQA
Sbjct  173   CLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQA  229

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             T NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L
Sbjct  230   TSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRL  289

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             +GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL    
Sbjct  290   IGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSLV  349

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSG  680
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S 
Sbjct  350   PPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSK  404

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
              FSE SD+Y FGVFL EL++GREA     L S   ++   +        V+ + +G  S 
Sbjct  405   KFSERSDVYSFGVFLLELVSGREANARNQLNSVDNLILQAKDCKDLGRFVD-KTLGDKSW  463

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQL  326
             +  + ++ LA+ C     + RP M +V    ERI    +       + E    +TLGS+L
Sbjct  464   QTAKQMMELALMCVD-GSERRPQMQIVVEVLERIHRGRESSHFHIEVDEEIGAVTLGSEL  522

Query  325   F  323
             F
Sbjct  523   F  523



>ref|XP_010253665.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253666.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253667.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010253668.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nelumbo 
nucifera]
Length=524

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 208/357 (58%), Gaps = 9/357 (3%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+ +KR   R S+T SS PS  VE         +  +     +  R   + EL++AT NF
Sbjct  174   LMRAKRIVRRTSETGSSVPSPLVELAREHCSPHIVASSLFEQQNIRQLSIVELKEATSNF  233

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              +SN+IG G FGLV+KG L DG+++AIK R   P + F +E+  +    HR+LV L+GYC
Sbjct  234   SQSNIIGEGGFGLVYKGLLQDGSMIAIKRRFHDPSRYFVQEIENIGHVCHRHLVKLIGYC  293

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE   Q+LV EYLP G + N+LY        KL+ + RLS+A G AKGL +LH   PP +
Sbjct  294   QEIHQQLLVYEYLPYGNIGNYLYDRDGFPIGKLDIQGRLSMALGAAKGLEYLHSMVPPFL  353

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +F+T NVLVDENF+ KV+D G+S LL E +   AG S +I    F+DPE+  S  FSE
Sbjct  354   HMHFRTSNVLVDENFVAKVSDFGLSRLLDESSR--AGSSAAI--DCFLDPELRLSPDFSE  409

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMR  488
              SD+Y FGVFL EL++GRE A  R L  ++  L  +   +S  + +  + +   + + ++
Sbjct  410   RSDVYSFGVFLLELVSGRE-AFCRNLAESEQNLVSLAKDISDLNWLVDKTLRNGAEDAIQ  468

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMG--STAMGEASATLTLGSQLF  323
              ++ LA++C       RP M  V  E E ++++ +MG     M E    +TLGS+LF
Sbjct  469   RMVNLALQCLG-NSVRRPTMKRVVRELE-VIQERVMGHQHADMVEDIGVVTLGSELF  523



>ref|XP_009335089.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X3 [Pyrus x bretschneideri]
Length=527

 Score =   238 bits (607),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 226/421 (54%), Gaps = 22/421 (5%)
 Frame = -2

Query  1549  HNQPYCTWESSIQRATNQHCPPVPVSN-KAYEACKPSTGKKVN-VGSNLFILQRSML---  1385
             H++P     ++I    N      PV   +   + KP     +  V + L ++   ML   
Sbjct  116   HHKPRSRRIAAIVDGDNGTPTLTPVEKVRGNHSTKPKVAAIIGGVAATLLVIIVVMLIYM  175

Query  1384  --LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQA  1220
               +  KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQA
Sbjct  176   CLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQA  232

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             T NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L
Sbjct  233   TSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRL  292

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             +GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL    
Sbjct  293   IGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSLV  352

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSG  680
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S 
Sbjct  353   PPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSK  407

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
              FSE SD+Y FGVFL EL++GREA     L S   ++   +        V+ + +G  S 
Sbjct  408   KFSERSDVYSFGVFLLELVSGREANARNQLNSVDNLILQAKDCKDLGRFVD-KTLGDKSW  466

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQL  326
             +  + ++ LA+ C     + RP M +V    ERI    +       + E    +TLGS+L
Sbjct  467   QTAKQMMELALMCVD-GSERRPQMQIVVEVLERIHRGRESSHFHIEVDEEIGAVTLGSEL  525

Query  325   F  323
             F
Sbjct  526   F  526



>ref|XP_009335088.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X2 [Pyrus x bretschneideri]
Length=544

 Score =   238 bits (608),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 226/421 (54%), Gaps = 22/421 (5%)
 Frame = -2

Query  1549  HNQPYCTWESSIQRATNQHCPPVPVSN-KAYEACKPSTGKKVN-VGSNLFILQRSML---  1385
             H++P     ++I    N      PV   +   + KP     +  V + L ++   ML   
Sbjct  133   HHKPRSRRIAAIVDGDNGTPTLTPVEKVRGNHSTKPKVAAIIGGVAATLLVIIVVMLIYM  192

Query  1384  --LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQA  1220
               +  KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQA
Sbjct  193   CLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQA  249

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             T NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L
Sbjct  250   TSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRL  309

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             +GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL    
Sbjct  310   IGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSLV  369

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSG  680
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S 
Sbjct  370   PPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSK  424

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
              FSE SD+Y FGVFL EL++GREA     L S   ++   +        V+ + +G  S 
Sbjct  425   KFSERSDVYSFGVFLLELVSGREANARNQLNSVDNLILQAKDCKDLGRFVD-KTLGDKSW  483

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQL  326
             +  + ++ LA+ C     + RP M +V    ERI    +       + E    +TLGS+L
Sbjct  484   QTAKQMMELALMCVD-GSERRPQMQIVVEVLERIHRGRESSHFHIEVDEEIGAVTLGSEL  542

Query  325   F  323
             F
Sbjct  543   F  543



>ref|XP_009335087.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 isoform 
X1 [Pyrus x bretschneideri]
Length=546

 Score =   238 bits (608),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 226/421 (54%), Gaps = 22/421 (5%)
 Frame = -2

Query  1549  HNQPYCTWESSIQRATNQHCPPVPVSN-KAYEACKPSTGKKVN-VGSNLFILQRSML---  1385
             H++P     ++I    N      PV   +   + KP     +  V + L ++   ML   
Sbjct  135   HHKPRSRRIAAIVDGDNGTPTLTPVEKVRGNHSTKPKVAAIIGGVAATLLVIIVVMLIYM  194

Query  1384  --LTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQA  1220
               +  KR + + S+T SS PS PV+ + G   S  A+A    P  A   R   + ELEQA
Sbjct  195   CLMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAVAHS--PYSAPNLRQLTILELEQA  251

Query  1219  TKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNL  1040
             T NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L
Sbjct  252   TSNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRL  311

Query  1039  LGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC  860
             +GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRL IA G AKGL HL    
Sbjct  312   IGYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLLIALGAAKGLAHLRSLV  371

Query  859   PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSG  680
             PP++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S 
Sbjct  372   PPLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSK  426

Query  679   VFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
              FSE SD+Y FGVFL EL++GREA     L S   ++   +        V+ + +G  S 
Sbjct  427   KFSERSDVYSFGVFLLELVSGREANARNQLNSVDNLILQAKDCKDLGRFVD-KTLGDKSW  485

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL--EKEIMGSTAMGEASATLTLGSQL  326
             +  + ++ LA+ C     + RP M +V    ERI    +       + E    +TLGS+L
Sbjct  486   QTAKQMMELALMCVD-GSERRPQMQIVVEVLERIHRGRESSHFHIEVDEEIGAVTLGSEL  544

Query  325   F  323
             F
Sbjct  545   F  545



>ref|XP_006406269.1| hypothetical protein EUTSA_v10021237mg [Eutrema salsugineum]
 gb|ESQ47722.1| hypothetical protein EUTSA_v10021237mg [Eutrema salsugineum]
Length=297

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 180/311 (58%), Gaps = 26/311 (8%)
 Frame = -2

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
             F ++E++QAT NF ESNLIG GSFG V+ G + D  I+AIK       ++F   V +LS 
Sbjct  8     FSLEEIKQATNNFGESNLIGYGSFGPVYLGLIRD-RILAIKRMPDSLHRRFMAMVTKLSK  66

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
              +H NLVNL GYC E G+Q+L+ EYL NG M +HLY      S  L FK+R+ IA G AK
Sbjct  67    IRHCNLVNLFGYCCETGHQMLIYEYLANGNMQDHLY-----DSIDLNFKKRIYIALGAAK  121

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPF  707
             GL HLH   PP+ H  FK   VL+D +F  KV  +G+S LL E+  + A           
Sbjct  122   GLQHLHSLNPPLTHNRFKMSKVLLDADFNAKV--SGLSRLL-EMRKEEAN---------V  169

Query  706   IDPEV--NQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL  533
              DP V  +    F+E SD+Y FG+FL ELITG E    + L SN  M+QW+   + SD  
Sbjct  170   YDPVVGLDNQETFNETSDVYSFGLFLLELITGEEP---KPLTSNDEMIQWLGPRICSDRF  226

Query  532   VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEAS  353
             V+ ++ G ++ E +  ++++ ++C  FP  ERP M+ V  E E+I   +  G     E S
Sbjct  227   VDQKMNGTFTREALNSVVKIMLKCLKFPAIERPKMEEVVTELEKIYNNDFTGEE---EGS  283

Query  352   ATLTLGSQLFT  320
                +LGS+LFT
Sbjct  284   TKFSLGSELFT  294



>gb|EYU22372.1| hypothetical protein MIMGU_mgv1a014227mg [Erythranthe guttata]
Length=197

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = -2

Query  913  LSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
            +SIA G AKGL HLHG  PP++HGNF+T NVLVDENFI KVADAG+  LL+ I  + A  
Sbjct  1    MSIAIGAAKGLSHLHGLRPPLIHGNFRTANVLVDENFIAKVADAGVLKLLERI--EDASS  58

Query  733  SHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA  554
            S +   + F DPE+ Q GV  E +D Y FG+FL EL++G+EA +     SN T LQWV+ 
Sbjct  59   SSTSSFNAFKDPELGQHGVLHETNDTYSFGIFLLELLSGKEATYQEAFRSNDTTLQWVQE  118

Query  553  HLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGS  374
             +SS++LV+HRL G ++ EGMRD I++ ++C SFP  +RP M+ V  E ++IL+ EI  +
Sbjct  119  EISSNNLVDHRLSGSFTEEGMRDFIKIMIKCVSFPSGDRPRMEYVVSELDQILDCEITRT  178

Query  373  TAMGEASATLTLGSQLFTN  317
            T MGE +AT+TLGSQLFTN
Sbjct  179  TVMGEGTATVTLGSQLFTN  197



>ref|XP_004293053.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like 
[Fragaria vesca subsp. vesca]
Length=544

 Score =   232 bits (592),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 180/290 (62%), Gaps = 7/290 (2%)
 Frame = -2

Query  1252  RVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARL  1073
             R   + ELEQAT NF+E+N+IG G FGLV+KG L DGTIVAIK R   P Q F +EV  +
Sbjct  217   RQLTILELEQATSNFNENNIIGQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFQEVKHI  276

Query  1072  SMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGT  893
             +   H +++ L+GYCQ++  Q+LV +YLPNG + NHLY        KL  +QRLS+A G 
Sbjct  277   ARVNHVHILRLIGYCQDSSQQLLVYDYLPNGNVGNHLYDAEGLPIGKLNLRQRLSVALGA  336

Query  892   AKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS  713
             AKGL HLH   PP++H NF+T NVL+D+NF  KV+D G++ LL +  +   G S +I   
Sbjct  337   AKGLAHLHSLVPPLLHMNFRTSNVLLDDNFTAKVSDYGLTRLLNKAPY--TGSSSAI--D  392

Query  712   PFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL  533
              F+DPE++    FSE  D+Y FGVFL ELI+G EA     L S   ++   +     +  
Sbjct  393   CFLDPELDSLNKFSERGDVYSFGVFLLELISGCEANGRYQLNSGDNLVLQAKDCEDLERF  452

Query  532   VEHRLMGKYSAE-GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKE  386
             V+ + +G+YS +   + ++ LA+ C     ++RP+M +V  E ERI  +E
Sbjct  453   VD-KTLGEYSMQAATKQMMELALMCID-ASEQRPHMKIVVQELERIQARE  500



>ref|XP_007150206.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 ref|XP_007150207.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 gb|ESW22200.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
 gb|ESW22201.1| hypothetical protein PHAVU_005G135500g [Phaseolus vulgaris]
Length=473

 Score =   228 bits (582),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 204/357 (57%), Gaps = 14/357 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  K+   + S+ ASS PS  VE          A +    P+  R   + ELEQAT+NF
Sbjct  128   LMRVKKSMRQTSEVASSMPSPTVEMGRVNTQHVTAFS----PQNTRQLTILELEQATRNF  183

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
               +N+IG G FG+V+KG L DG+IVAIK R       F  EV +++   H +LV L+GY 
Sbjct  184   SHNNIIGEGGFGVVYKGLLQDGSIVAIKRRLFALTPDFVVEVKQIAHIHHIHLVKLIGYY  243

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             ++N  Q+LV EYLPN  + +HLY        +L   +RLSIA G +KG+ HLH   PP+V
Sbjct  244   EDNHQQLLVYEYLPNSNVGSHLYDSEGLPVGRLNLWRRLSIALGASKGVEHLHSLVPPLV  303

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H NF+T NVL+DEN+  KV+D G   L  ++  D AG S ++    F+DPE+N    +SE
Sbjct  304   HTNFRTSNVLLDENYTAKVSDYGFCKLQAQV--DRAGSSSNV--DCFLDPELNIPQNYSE  359

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEGMR  488
              SD+Y FGVFL ELI+G EA +   L  ++ ++   +  +  D  V+  L G     G R
Sbjct  360   KSDVYSFGVFLLELISGSEAHNKNMLHPDENIVFQAKNSVDLDKFVDITL-GYQEKNGAR  418

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI--MGSTAMGEASATLTLGSQLF  323
              ++ LA+ C     + RP+M  + +E ERI ++EI  M S    E  A +TLGS+LF
Sbjct  419   QILMLALLCVDVTFR-RPSMAQIVLELERI-QREIAPMYSQFNDEIGA-VTLGSELF  472



>ref|XP_002530283.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF32090.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=518

 Score =   229 bits (584),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 143/362 (40%), Positives = 211/362 (58%), Gaps = 19/362 (5%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFR---MQELEQAT  1217
             L+  K+     S+TASS PS+P +   G   +    A    P  AR  R   + E+E AT
Sbjct  168   LMRIKKVLRHRSETASSMPSSPSDLARG---NIFPYAAAQSPFNARDLRQLSIVEVEHAT  224

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
              NF +SN+IG GSFG  +KG L DG+IVAIK     P Q F  EV  ++   H++LV+L+
Sbjct  225   HNFSQSNIIGEGSFGFAYKGLLLDGSIVAIKRCLHKPVQDFVHEVKHIASVHHKHLVDLI  284

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYC++   + LV +Y+ NG + ++LYG+      KL+ +QRLSIA G AKGL +LH   P
Sbjct  285   GYCEDTHQKFLVYDYISNGNVGSYLYGL---PIGKLDMRQRLSIALGAAKGLQYLHSMVP  341

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F++ NVL+ +N I KV+D G+  L  E +   AG S +I    F+DPE++ S  
Sbjct  342   PLLHMHFRSSNVLLGDNIIAKVSDYGLLKLAMESHR--AGTSSAID--YFLDPELSLSKN  397

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEA---HLSSDDLVEHRLMGKY  506
             FSE SD+Y FGVFL ELI+G EA       S   ++Q V       + ++ ++ R +G+ 
Sbjct  398   FSERSDVYSFGVFLLELISGHEARGRYMSISGHNLIQEVNKTSLECNLENFID-RTLGER  456

Query  505   SAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA-MGEASATLTLGSQ  329
             + +  + L+ LA++C     K RP+M  +  E E+I  +EI  S A   E   ++TLGS+
Sbjct  457   TIQAAKPLMELALQCIDVSMK-RPSMTRIVQEIEQIQGREIRYSQAEFDEEIGSVTLGSE  515

Query  328   LF  323
             LF
Sbjct  516   LF  517



>ref|XP_008349749.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Malus domestica]
Length=434

 Score =   225 bits (574),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 166/263 (63%), Gaps = 11/263 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + + S+T SS PS PV+ + G   S  A A    P  A   R   + ELEQAT
Sbjct  155   LMRVKRLTRQTSETVSSAPSPPVQWERGD-ASPYAXAHS--PYSAPNLRQLTILELEQAT  211

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
              NF E+N+I  G FGLV+KG L DGTIVAIK R   P Q F  EV  ++   H +++ L+
Sbjct  212   CNFSETNIISQGRFGLVYKGLLQDGTIVAIKRRLHAPTQYFFHEVKHVARVNHMHILRLI  271

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        +L  +QRLSIA G AKGL HL    P
Sbjct  272   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGRLGIRQRLSIALGAAKGLAHLRSLVP  331

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H +F+T NVL+DENF  KV+D G++ LL  + H  AG S ++    F+DPE++ S  
Sbjct  332   PLLHMHFRTSNVLLDENFTAKVSDYGLTKLL--VGHH-AGSSSAV--DCFVDPELDSSKK  386

Query  676   FSEASDIYGFGVFLWELITGREA  608
             FSE SD+Y FGVFL EL++GREA
Sbjct  387   FSERSDVYSFGVFLLELVSGREA  409



>ref|XP_006488101.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Citrus sinensis]
Length=415

 Score =   223 bits (569),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 183/305 (60%), Gaps = 7/305 (2%)
 Frame = -2

Query  1234  ELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHR  1055
             EL+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++   HR
Sbjct  116   ELKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIARVHHR  175

Query  1054  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCH  875
             +LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AKGL H
Sbjct  176   HLVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAKGLEH  235

Query  874   LHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             LH   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F+DPE
Sbjct  236   LHSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCFLDPE  291

Query  694   VNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLM  515
             +N S  +S  SD+Y FGVFL ELI+GREA       S+Q ++  V+        V+ + +
Sbjct  292   LNLSKNYSAGSDVYSFGVFLLELISGREAHGRNHSNSDQNLILQVKRSCDLGKYVD-KTL  350

Query  514   GKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASATLTL  338
             G+ +     +++ LA++C     + RP+M  +A E E I E+EI    +  GE    + L
Sbjct  351   GEQTVGAATEMMELALQCVDVSSR-RPSMRQIAGELEGIQEREIGRLHSEFGEEIDAVKL  409

Query  337   GSQLF  323
             GS+LF
Sbjct  410   GSELF  414



>gb|KDO73271.1| hypothetical protein CISIN_1g009644mg [Citrus sinensis]
Length=530

 Score =   226 bits (575),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/369 (38%), Positives = 206/369 (56%), Gaps = 19/369 (5%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARV  1247
             F++   + L   +   R S+  SS PS   E + G      G VS +        +  + 
Sbjct  173   FVVFVYICLMCVKRRIRRSEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQ  226

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
               + EL+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++ 
Sbjct  227   LTILELKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLQTQIQNFLHEVKHIAR  286

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
               HR+LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AK
Sbjct  287   VHHRHLVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAK  346

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPF  707
             GL HLH   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F
Sbjct  347   GLEHLHSLVPPLFHMHFRTSNVLLEENYTAKVSDYGLLKLVTGSHH--AGSTSAV--DCF  402

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE  527
             +DPE+N S  +S  SD+Y FGVFL ELI+GREA       S+Q ++  V+        V+
Sbjct  403   LDPELNLSKNYSAGSDVYSFGVFLLELISGREAHGRNHSNSDQNLILQVKRSCDLGKYVD  462

Query  526   HRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASA  350
              + +G+ +     +++ LA++C     + RP+M  +A E E I E+EI    +  GE   
Sbjct  463   -KTLGEQTVGAATEMMELALQCVDVSSR-RPSMRQIAGELEGIQEREIGRLHSEFGEEID  520

Query  349   TLTLGSQLF  323
              + LGS+LF
Sbjct  521   AVKLGSELF  529



>ref|XP_006424580.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 ref|XP_006424581.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 ref|XP_006488098.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Citrus sinensis]
 ref|XP_006488099.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Citrus sinensis]
 gb|ESR37820.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
 gb|ESR37821.1| hypothetical protein CICLE_v10028221mg [Citrus clementina]
Length=514

 Score =   225 bits (573),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/369 (38%), Positives = 206/369 (56%), Gaps = 19/369 (5%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARV  1247
             F++   + L   +   R S+  SS PS   E + G      G VS +        +  + 
Sbjct  157   FVVFVYICLMCVKRRIRRSEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQ  210

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
               + EL+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++ 
Sbjct  211   LTILELKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIAR  270

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
               HR+LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AK
Sbjct  271   VHHRHLVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAK  330

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPF  707
             GL HLH   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F
Sbjct  331   GLEHLHSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCF  386

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE  527
             +DPE+N S  +S  SD+Y FGVFL ELI+GREA       S+Q ++  V+        V+
Sbjct  387   LDPELNLSKNYSAGSDVYSFGVFLLELISGREAHGRNHSNSDQNLILQVKRSCDLGKYVD  446

Query  526   HRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASA  350
              + +G+ +     +++ LA++C     + RP+M  +A E E I E+EI    +  GE   
Sbjct  447   -KTLGEQTVGAATEMMELALQCVDVSSR-RPSMRQIAGELEGIQEREIGRLHSEFGEEID  504

Query  349   TLTLGSQLF  323
              + LGS+LF
Sbjct  505   AVKLGSELF  513



>ref|XP_006488100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Citrus sinensis]
Length=510

 Score =   225 bits (573),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/369 (38%), Positives = 206/369 (56%), Gaps = 19/369 (5%)
 Frame = -2

Query  1408  FILQRSMLLTSKRYSNRNSDTASSDPSAPVEQKTG------GPVSSLALARGGVPEGARV  1247
             F++   + L   +   R S+  SS PS   E + G      G VS +        +  + 
Sbjct  153   FVVFVYICLMCVKRRIRRSEGESSVPSPSAELERGDISPYPGAVSPID------TQNLKQ  206

Query  1246  FRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSM  1067
               + EL+ AT NF E N+IG GSFGL +KG L DG++V IK       Q F  EV  ++ 
Sbjct  207   LTILELKHATNNFSEINIIGEGSFGLAYKGLLQDGSLVVIKRHLHTQIQNFLHEVKHIAR  266

Query  1066  TQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAK  887
               HR+LV L+G+C+EN  Q+L+ +Y+PNG + NHLY        KL  +QRLSIA G AK
Sbjct  267   VHHRHLVKLVGFCEENHQQLLIYDYIPNGNVQNHLYDSEGLPIGKLTMRQRLSIALGAAK  326

Query  886   GLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPF  707
             GL HLH   PP+ H +F+T NVL++EN+  KV+D G+  L+   +H  AG + ++    F
Sbjct  327   GLEHLHSLVPPLFHMHFRTSNVLLEENYSAKVSDYGLLKLVTGSHH--AGSTSAV--DCF  382

Query  706   IDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE  527
             +DPE+N S  +S  SD+Y FGVFL ELI+GREA       S+Q ++  V+        V+
Sbjct  383   LDPELNLSKNYSAGSDVYSFGVFLLELISGREAHGRNHSNSDQNLILQVKRSCDLGKYVD  442

Query  526   HRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEI-MGSTAMGEASA  350
              + +G+ +     +++ LA++C     + RP+M  +A E E I E+EI    +  GE   
Sbjct  443   -KTLGEQTVGAATEMMELALQCVDVSSR-RPSMRQIAGELEGIQEREIGRLHSEFGEEID  500

Query  349   TLTLGSQLF  323
              + LGS+LF
Sbjct  501   AVKLGSELF  509



>gb|KHN11203.1| Proline-rich receptor-like protein kinase PERK15 [Glycine soja]
Length=452

 Score =   219 bits (558),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 204/359 (57%), Gaps = 14/359 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE---GARVFRMQELEQAT  1217
             L+  KR+  + S+ ASS PS  VE    G V++        P      R   + ELEQAT
Sbjct  103   LMRVKRFMRQTSEAASSMPSPTVEM---GRVNNTQNVNAFPPHYTLNTRQLTILELEQAT  159

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF  SN+I  G FG V+KG L DG+IVAIK R     Q F  EV +++   H +LV L+
Sbjct  160   RNFSHSNIISEGGFGFVYKGLLQDGSIVAIKRRLFALTQDFVLEVNQIAHIHHTHLVKLI  219

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIA G +KG+ HLH   P
Sbjct  220   GYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIALGASKGVEHLHSLVP  279

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P+VH NF+T NVL+DEN+  KVA  G   L  ++  D AG S  +    F+DPE++    
Sbjct  280   PLVHTNFRTSNVLLDENYTAKVAVYGFCKLQTQV--DNAGSSSHV--DCFLDPELSFPQN  335

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGS-NQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
             +SE SD++ FGVFL ELI+G E AH + L + ++ ++   +  +  D+ V+  L G+   
Sbjct  336   YSEKSDVHSFGVFLLELISGCE-AHRKSLSNPDENIVFKAKNSVDLDNFVDITL-GEQEK  393

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              G R +++LA+ C     + RP+M  +  E E+I  +     +   E    +TLGS+LF
Sbjct  394   HGARRMMKLALLCVDVTSR-RPSMAQIVQELEQIQREIAPVYSQFNEEIGAVTLGSELF  451



>gb|KHN21520.1| Proline-rich receptor-like protein kinase PERK9, partial [Glycine 
soja]
Length=450

 Score =   219 bits (557),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 202/357 (57%), Gaps = 11/357 (3%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQATK  1214
             L+  KR+  + S+ ASS PS  VE  +     V++ +          R   + ELEQAT+
Sbjct  102   LMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILELEQATR  158

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L+G
Sbjct  159   NFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKLIG  218

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             Y +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   PP
Sbjct  219   YYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLVPP  278

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVF  674
             ++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE++    +
Sbjct  279   LIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPELSFPQNY  334

Query  673   SEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEG  494
             +E SD+Y FGVFL ELI G EA +      ++ ++   +  +  D  V+  L G+    G
Sbjct  335   TEKSDVYSFGVFLLELICGCEAQNKSMSNPDENIVFQAKNSVDLDKFVDITL-GEQEKHG  393

Query  493   MRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              R +++LA+ C     + RP+M  +  E E+I  +     +   E    +TLGS+LF
Sbjct  394   ARRVMKLALLCVDVTSR-RPSMAQIVHELEQIQREIAPMYSQFNEEIGAVTLGSELF  449



>ref|XP_006594983.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X5 [Glycine max]
Length=418

 Score =   218 bits (555),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 132/357 (37%), Positives = 202/357 (57%), Gaps = 11/357 (3%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQATK  1214
             L+  KR+  + S+ ASS PS  VE  +     V++ +          R   + E+EQAT+
Sbjct  70    LMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILEVEQATR  126

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L+G
Sbjct  127   NFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKLIG  186

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             Y +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   PP
Sbjct  187   YYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLVPP  246

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVF  674
             ++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE++    +
Sbjct  247   LIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPELSFPQNY  302

Query  673   SEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEG  494
             +E SD+Y FGVFL ELI G EA +      ++ ++   +  +  D  V+  L G+    G
Sbjct  303   TEKSDVYSFGVFLLELICGCEAQNKSMSNPDENIVFQAKNSVDLDKFVDITL-GEQEKHG  361

Query  493   MRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              R +++LA+ C     + RP+M  +  E E+I  +     +   E    +TLGS+LF
Sbjct  362   ARRVMKLALLCVDVTSR-RPSMAQIVHELEQIQREIAPMYSQFNEEIGAVTLGSELF  417



>ref|XP_006592693.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 ref|XP_006592694.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
 ref|XP_006592695.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Glycine max]
 ref|XP_006592696.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Glycine max]
Length=474

 Score =   219 bits (558),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 204/359 (57%), Gaps = 14/359 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPE---GARVFRMQELEQAT  1217
             L+  KR+  + S+ ASS PS  VE    G V++        P      R   + ELEQAT
Sbjct  125   LMRVKRFMRQTSEAASSMPSPTVEM---GRVNNTQNVNAFPPHYTLNTRQLTILELEQAT  181

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF  SN+I  G FG V+KG L DG+IVAIK R     Q F  EV +++   H +LV L+
Sbjct  182   RNFSHSNIISEGGFGFVYKGLLQDGSIVAIKRRLFALTQDFVLEVNQIAHIHHTHLVKLI  241

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GY +++  Q+LV EYLPNG + +HLY        +L+  +R+SIA G +KG+ HLH   P
Sbjct  242   GYYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIALGASKGVEHLHSLVP  301

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P+VH NF+T NVL+DEN+  KVA  G   L  ++  D AG S  +    F+DPE++    
Sbjct  302   PLVHTNFRTSNVLLDENYTAKVAVYGFCKLQTQV--DNAGSSSHV--DCFLDPELSFPQN  357

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGS-NQTMLQWVEAHLSSDDLVEHRLMGKYSA  500
             +SE SD++ FGVFL ELI+G E AH + L + ++ ++   +  +  D+ V+  L G+   
Sbjct  358   YSEKSDVHSFGVFLLELISGCE-AHRKSLSNPDENIVFKAKNSVDLDNFVDITL-GEQEK  415

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              G R +++LA+ C     + RP+M  +  E E+I  +     +   E    +TLGS+LF
Sbjct  416   HGARRMMKLALLCVDVTSR-RPSMAQIVQELEQIQREIAPVYSQFNEEIGAVTLGSELF  473



>ref|XP_007016736.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
3, partial [Theobroma cacao]
 gb|EOY34355.1| Leucine-rich repeat receptor-like protein kinase, putative isoform 
3, partial [Theobroma cacao]
Length=375

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 178/308 (58%), Gaps = 12/308 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNF  1208
             L+  KR   R S+TASS PS  VE    G V++   A    P+  R   M ELE AT+NF
Sbjct  78    LMRVKRLMRRTSETASSMPSPTVEL---GRVNTSHYADAPSPQNLRQLTMSELEHATQNF  134

Query  1207  DESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLGYC  1028
              +SN+IG G FGLV+KG L DG IVAIK         F  EV +++   H++LV L+GYC
Sbjct  135   SQSNIIGEGRFGLVYKGLLQDGAIVAIKRCLNTRHHCFLHEVKQIAQVNHKHLVKLVGYC  194

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
               +  Q LV +Y+PNG + NHLY      + KL  +QRL IA G AKGL +LH   PP++
Sbjct  195   GNSHQQFLVYDYIPNGNVGNHLYDSEGSPTGKLNMRQRLLIALGAAKGLEYLHSLAPPLL  254

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FK+ NVL+DEN   KV++ G+S L+ E    A+  +       F+DPE+  S  FS 
Sbjct  255   HMHFKSSNVLLDENITAKVSNYGLSKLVSEDRLHASSSAIDC----FLDPELYSSKKFSV  310

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVE--HRLMGKYSAEG  494
              SD+Y FGVFL EL +GRE AH R   + +  L  +   + +++LVE     +G  S  G
Sbjct  311   QSDVYSFGVFLLELASGRE-AHCRDQSNPEPSL--IMQAMENNNLVEFVDETLGDKSMSG  367

Query  493   MRDLIRLA  470
              + ++ LA
Sbjct  368   AKQVVELA  375



>ref|XP_006594979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 ref|XP_006594980.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
 ref|XP_006594981.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X3 [Glycine max]
 ref|XP_006594982.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X4 [Glycine max]
Length=476

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/357 (37%), Positives = 202/357 (57%), Gaps = 11/357 (3%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVE--QKTGGPVSSLALARGGVPEGARVFRMQELEQATK  1214
             L+  KR+  + S+ ASS PS  VE  +     V++ +          R   + E+EQAT+
Sbjct  128   LMRVKRFMRQTSEVASSMPSPTVEIGRVNNAHVNAFS---PHYTHNTRQLTILEVEQATR  184

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLLG  1034
             NF  SN+IG G FG V+KG L DG+IVAIK R     Q F  +V +++   H +LV L+G
Sbjct  185   NFSHSNIIGEGGFGFVYKGLLQDGSIVAIKRRLFVLTQDFVLKVKQIAHIHHNHLVKLIG  244

Query  1033  YCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPP  854
             Y +++  Q+LV EYLPNG + +HLY        +L+  +R+SIASG +KG+ HLH   PP
Sbjct  245   YYEDSYQQLLVYEYLPNGNVGSHLYDSEGLPIGRLDLWRRISIASGASKGVEHLHSLVPP  304

Query  853   VVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVF  674
             ++H NF+T NVL+DEN+  KV+D G  +   ++  D  G S ++    F+DPE++    +
Sbjct  305   LIHTNFRTSNVLLDENYTAKVSDYGFCNSKTQV--DNVGSSSNV--DCFLDPELSFPQNY  360

Query  673   SEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDLVEHRLMGKYSAEG  494
             +E SD+Y FGVFL ELI G EA +      ++ ++   +  +  D  V+  L G+    G
Sbjct  361   TEKSDVYSFGVFLLELICGCEAQNKSMSNPDENIVFQAKNSVDLDKFVDITL-GEQEKHG  419

Query  493   MRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQLF  323
              R +++LA+ C     + RP+M  +  E E+I  +     +   E    +TLGS+LF
Sbjct  420   ARRVMKLALLCVDVTSR-RPSMAQIVHELEQIQREIAPMYSQFNEEIGAVTLGSELF  475



>ref|XP_004487113.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Cicer arietinum]
Length=460

 Score =   212 bits (539),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 178/311 (57%), Gaps = 6/311 (2%)
 Frame = -2

Query  1255  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  1076
              R+  + ELEQAT NF +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +
Sbjct  155   TRLLTILELEQATGNFSQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQ  214

Query  1075  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  896
             ++   H NLV L+GY +++  Q+LV EYLPNG + NHLY        KL+ ++R+SIA G
Sbjct  215   IAHIHHINLVKLIGYYEDSYQQLLVYEYLPNGNVGNHLYDNEGLPIGKLDLRRRVSIALG  274

Query  895   TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  716
              +KGL HLH   PP+ H NF T NVL+DEN+  KV+D G   L  + N   AG S ++  
Sbjct  275   ASKGLEHLHSLVPPLFHRNFSTRNVLLDENYTAKVSDYGFCKLHTKFNQ--AGSSSNV--  330

Query  715   SPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD  536
               F DPE++ S  + E SD+Y FGVFL ELI+G +  H R + +    L +   + S  D
Sbjct  331   DCFHDPELSLSENYLEQSDVYSFGVFLLELISGCQ-VHNRNMPNPDENLVFQAKNRSGLD  389

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
                   +G+    G R +++LA+ C     + RP+M  +  E ERI        + + E 
Sbjct  390   KFVDTTLGEQEKNGGRRMMKLALVCVDVIHR-RPSMAHIVQELERIQRDIAPLYSQINEE  448

Query  355   SATLTLGSQLF  323
                +TLGS+LF
Sbjct  449   IGVVTLGSELF  459



>ref|XP_004487114.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Cicer arietinum]
Length=458

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 178/311 (57%), Gaps = 6/311 (2%)
 Frame = -2

Query  1255  ARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVAR  1076
              R+  + ELEQAT NF +SN+IG G FG V+KG L DG+ VAIK R     + F  EV +
Sbjct  153   TRLLTILELEQATGNFSQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQ  212

Query  1075  LSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASG  896
             ++   H NLV L+GY +++  Q+LV EYLPNG + NHLY        KL+ ++R+SIA G
Sbjct  213   IAHIHHINLVKLIGYYEDSYQQLLVYEYLPNGNVGNHLYDNEGLPIGKLDLRRRVSIALG  272

Query  895   TAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQP  716
              +KGL HLH   PP+ H NF T NVL+DEN+  KV+D G   L  + N   AG S ++  
Sbjct  273   ASKGLEHLHSLVPPLFHRNFSTRNVLLDENYTAKVSDYGFCKLHTKFNQ--AGSSSNV--  328

Query  715   SPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDD  536
               F DPE++ S  + E SD+Y FGVFL ELI+G +  H R + +    L +   + S  D
Sbjct  329   DCFHDPELSLSENYLEQSDVYSFGVFLLELISGCQ-VHNRNMPNPDENLVFQAKNRSGLD  387

Query  535   LVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEA  356
                   +G+    G R +++LA+ C     + RP+M  +  E ERI        + + E 
Sbjct  388   KFVDTTLGEQEKNGGRRMMKLALVCVDVIHR-RPSMAHIVQELERIQRDIAPLYSQINEE  446

Query  355   SATLTLGSQLF  323
                +TLGS+LF
Sbjct  447   IGVVTLGSELF  457



>ref|XP_003597233.1| Receptor-like protein kinase ANXUR2 [Medicago truncatula]
Length=945

 Score =   217 bits (552),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 200/358 (56%), Gaps = 14/358 (4%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVP---EGARVFRMQELEQAT  1217
             L   KR+  + SD+ASS PS  VE    G +++        P   +  R+  + E+EQAT
Sbjct  391   LRRCKRFKKQPSDSASSVPSQAVEM---GRINNSQYVNAFSPHYMQNTRLLTILEIEQAT  447

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
               F++SN+IG G FG V+KG L DG+ VAIK R     + F  EV +++   H +LV L+
Sbjct  448   GKFNQSNIIGEGRFGFVYKGLLQDGSFVAIKRRLFALTRDFIPEVKQIAQIHHIHLVKLI  507

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GY  ++  Q+LV EYLPNG + NHLY        KL  ++R+SIA G +KGL HLH   P
Sbjct  508   GYYDDSYQQLLVYEYLPNGNVGNHLYDSEGLPIGKLNLQRRVSIALGASKGLEHLHSLVP  567

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGV  677
             P++H NF T NVL+DEN+  KV+D G   L  EI  D AG S ++    F DPE++ S  
Sbjct  568   PLLHTNFSTRNVLLDENYTAKVSDYGFFKLQTEI--DQAGSSSNV--DYFHDPELSLSQN  623

Query  676   FSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSD-DLVEHRLMGKYSA  500
             +SE SD+Y FGVFL ELI+G EA +       ++++   EA  SSD +    + +G+   
Sbjct  624   YSEESDVYSFGVFLLELISGCEAYNRNMSNPYESLV--FEAKYSSDLEKFIDKALGEQEK  681

Query  499   EGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASATLTLGSQL  326
              G R +++LA+ C     + RP+M  +  E ERI        +   E    + LGS +
Sbjct  682   HGARRIMKLALLCVDVILR-RPSMAHIVQELERIQRDIAPLYSENNEEIGVVKLGSDV  738



>ref|XP_010098195.1| Proline-rich receptor-like protein kinase PERK8 [Morus notabilis]
 gb|EXB74651.1| Proline-rich receptor-like protein kinase PERK8 [Morus notabilis]
Length=496

 Score =   208 bits (529),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 181/311 (58%), Gaps = 7/311 (2%)
 Frame = -2

Query  1252  RVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARL  1073
             R   + E+EQAT NF ++N+IG G FGL +KG L DG+IVAIK R   P + F  +V ++
Sbjct  191   RELSILEVEQATCNFSQNNIIGEGRFGLAYKGMLQDGSIVAIKRRLQTPTRSFFHQVKQI  250

Query  1072  SMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGT  893
             +  QH +LV L+G+  ++   +L+ +YL NG + NHLY        KL  + R+SIA G 
Sbjct  251   ARVQHVHLVKLIGFYYDSYQHLLIYDYLLNGNVGNHLYDSEGLPIGKLGIRHRVSIALGA  310

Query  892   AKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPS  713
             AKGL HLH   PP +H NF+T NVL+DE F+ KV+D G+S LL E NH  AG S +I   
Sbjct  311   AKGLGHLHSLVPPQLHLNFRTRNVLLDETFMAKVSDYGLSKLLIEGNH--AGSSSAI--D  366

Query  712   PFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSSDDL  533
              F+DPE++     S+ SD+Y FGVFL ELI+GR A       S + ++   +     ++ 
Sbjct  367   CFLDPELDMPKNVSDRSDVYSFGVFLLELISGRGANVRNRSNSGENLVLQAKQTEDFEEF  426

Query  532   VEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKE-IMGSTAMGEA  356
             V+  L G+ +    + ++ LA+ C     + RP +  V  E ERI E E    S+ +   
Sbjct  427   VDKSL-GRQATGAAKQMMELALMCIDGSAR-RPPVKFVVEELERIQEGENARLSSELDLQ  484

Query  355   SATLTLGSQLF  323
                +TLGS+LF
Sbjct  485   IGAVTLGSELF  495



>ref|XP_002885440.1| hypothetical protein ARALYDRAFT_318885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61699.1| hypothetical protein ARALYDRAFT_318885 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 174/315 (55%), Gaps = 32/315 (10%)
 Frame = -2

Query  1264  PEGARVFRMQELEQATKNFD-ESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSE  1088
             P+    F M+EL QAT NFD ++N +G G +GLV+ G + D  IVAIK      + +F +
Sbjct  45    PQRLIEFSMEELRQATNNFDLDNNHLGFGCYGLVYTGLIGD-RIVAIKREWLHLQPRFLD  103

Query  1087  EVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLS  908
             EV+ +S  QH NLVNL+GYC E G Q+LV EY+  G + ++L       S+   FK+R+S
Sbjct  104   EVSYMSKIQHENLVNLIGYCCEEGNQLLVFEYMVKGNVRDYL-----GDSSDFTFKKRIS  158

Query  907   IASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  728
             +A   AKGL HLH   PPV H  F+TG VL+D +   KV+DAG+  LL++ +     P  
Sbjct  159   VALDAAKGLLHLHNLDPPVQHKRFRTGKVLLDADLNAKVSDAGMLGLLQDRDLRLLNP--  216

Query  727   SIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
                            G   E  D+Y FG+FL ELITG +   ++   S   ++QW+    
Sbjct  217   --------------RGGLEETIDVYSFGLFLLELITGEKPGLLQ---STFEIMQWILLRR  259

Query  547   SSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
             S++ L++  + G ++ + +   +++ + C ++P  +RP MDMV  E E I + E++    
Sbjct  260   STNTLLDDNMPGTFTNQSLEAYMKITIECLTYPAIDRPKMDMVVTELETIYQNEVINE--  317

Query  367   MGEASATLTLGSQLF  323
                    + LGS+LF
Sbjct  318   ----EHEVALGSELF  328



>ref|XP_002965380.1| hypothetical protein SELMODRAFT_24884, partial [Selaginella moellendorffii]
 gb|EFJ34218.1| hypothetical protein SELMODRAFT_24884, partial [Selaginella moellendorffii]
Length=308

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 173/299 (58%), Gaps = 13/299 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIK---TRSAPPRQQFS  1091
             +G + F + +L++A+ NF  ++LIG G +G V+KG L  G +VAIK     S    ++F 
Sbjct  11    KGCKWFTLDDLKKASDNFSSNHLIGVGGYGKVYKGQLHTGELVAIKRAEKESLQGLEEFR  70

Query  1090  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  911
              E+   S   H+NLVNL+G+C ++G Q+LV E++PN T+ +HLY     +   L +K RL
Sbjct  71    TEIELFSRLHHKNLVNLIGFCTDDGQQMLVYEFMPNRTLRDHLYA-SNTAEQALNWKTRL  129

Query  910   SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
             SIA G+AKGL +LH    PP++H + K+ N+L+DEN + KVAD G+S L    + +    
Sbjct  130   SIALGSAKGLEYLHELADPPIIHRDVKSSNILLDENLVAKVADLGLSKLAPTCSDEKTYS  189

Query  733   SHSIQPS-PFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTM--LQW  563
             S  ++ +  ++DPE       S  SD+Y FGV L E+ITG++          +    + W
Sbjct  190   SVQVKGTLGYLDPEYYAYHQLSAKSDVYSFGVVLIEIITGKQPIDNGSFIVKEIKESVAW  249

Query  562   --VEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE  392
               V + LS    V+ RL+ K + E ++   RLA++C    G++RP M+ V  + E I++
Sbjct  250   GGVASLLS---FVDKRLLDKTTVEQVKKYFRLALQCVEDSGQDRPKMNEVVKKLEEIIK  305



>gb|ABR25410.1| phytosulfokine receptor precursor [Oryza sativa Indica Group]
Length=159

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -2

Query  1027  QENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCPPVV  848
             QE G Q+LV EYLPNG++  HLY  G+ S T+LEFKQRLSIA G AKGL HLH   PP++
Sbjct  1     QEGGLQMLVYEYLPNGSVSRHLYDTGKSSMTRLEFKQRLSIAIGAAKGLNHLHTLVPPLI  60

Query  847   HGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSE  668
             H +FKT NVLVDENFI KVADAG+  LL+   ++  GPSH    S + DPEV     FSE
Sbjct  61    HKDFKTSNVLVDENFIAKVADAGLVRLLR--GYEDVGPSHGFSSSVYQDPEVQSVLQFSE  118

Query  667   ASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWV  560
             +SD+Y FGVFL ELITGREAA +    S +++ QWV
Sbjct  119   SSDVYSFGVFLLELITGREAACLISPDSRESLAQWV  154



>ref|XP_008353259.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 [Malus 
domestica]
Length=284

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 147/264 (56%), Gaps = 37/264 (14%)
 Frame = -2

Query  1054  NLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSI----------  905
             NL   + + Q+NGY  +           N  Y + R+    L+F + L+           
Sbjct  39    NLAEFVTFLQQNGYGWIGR---------NFFYDLDRNLVGGLDFHEVLTFYYIIKTRNLW  89

Query  904   ASGTAKGLCHLHGQCPPVVHG---NFK------TGNVLVDENFIPKVADAGISSLLKEIN  752
                    L  L+  C     G   N+       + NVLVDENFI KVADAGIS LL++I 
Sbjct  90    CRRCGVWLTGLYFTCVECFDGAPDNYDLCSGCYSANVLVDENFIAKVADAGISKLLEKIE  149

Query  751   HDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTM  572
                A  +               SGV SE SD+Y FGVF  EL+TG+EA HI  LGSN+++
Sbjct  150   EAEANNAC---------DRAGASGVTSEMSDVYSFGVFALELLTGQEAVHIGSLGSNESL  200

Query  571   LQWVEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE  392
              QWVE+ LSS++LV+ RL G ++AEGMRDLIRL ++C SFP K RP M+MV  E ERI E
Sbjct  201   FQWVESRLSSNNLVDRRLAGSFTAEGMRDLIRLTLQCMSFPAKRRPKMEMVVAELERIQE  260

Query  391   KEIMGSTAMGEASATLTLGSQLFT  320
             KE+  +T MGE + T+TLGS LFT
Sbjct  261   KEMAMTTVMGEGTDTITLGSVLFT  284



>ref|XP_010248070.1| PREDICTED: wall-associated receptor kinase 5-like, partial [Nelumbo 
nucifera]
Length=364

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 172/294 (59%), Gaps = 14/294 (5%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPR---QQFS  1091
             E A++F  +EL++AT N+DES ++GCG +G V+KG L +  IVAIK          +QF 
Sbjct  51    EVAKIF-AEELKRATNNYDESRILGCGGYGTVYKGILPNNKIVAIKKSKIVDESQVEQFI  109

Query  1090  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  911
              EV  LS   H+N+V LLG C E+   +LV E++ NGT+ +H++  G  SS  + +  RL
Sbjct  110   NEVVILSQINHKNVVKLLGCCLESEVPLLVYEFITNGTLSHHIHDEGHQSS--ISWDNRL  167

Query  910   SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
              IA+ TA  L ++H    PP+ H + K  N+L+D+N+I KV+D G S L   +  D    
Sbjct  168   RIATETASALAYMHSTASPPIFHRDVKPSNILLDDNYIAKVSDFGASRL---VPLDQTQL  224

Query  733   SHSIQPSP-FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE  557
             +  +Q +  ++DPE  Q+   +E SD+Y FG+ L EL+TGR+A         + +  +  
Sbjct  225   TTLVQGTMGYLDPEYFQTSRLTEKSDVYSFGIVLAELLTGRKALEFNRPEKEKNLALYFI  284

Query  556   AHLSSD---DLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAE  404
               ++ D   D++E R++ + + + +R++ +LA RC +  G+ERP M  VA E +
Sbjct  285   TSMAEDNVLDILEERVVYEATMDQLREITKLAKRCLNMTGEERPPMKEVATELD  338



>gb|EPS71974.1| hypothetical protein M569_02784 [Genlisea aurea]
Length=426

 Score =   192 bits (489),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 122/334 (37%), Positives = 177/334 (53%), Gaps = 29/334 (9%)
 Frame = -2

Query  1336  DPSAPVE-------QKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDESNLIGCGS  1178
             DPS PV+       QK+G  +      R    E A  F + E+E+AT NF+    IG G 
Sbjct  54    DPSKPVKPPDDWFSQKSGSAL------RDPGAEAAHCFILPEIEEATMNFERR--IGSGG  105

Query  1177  FGLVFKGFLFDGTIVAIKT---RSAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQI  1007
             FG+V+ G L D   +A+K     S   +++F  EV+ LS   HRNLV  LGYCQE+G  I
Sbjct  106   FGVVYYGILKDKREIAVKVLTNDSFQGKREFVNEVSLLSRIHHRNLVQFLGYCQEDGKNI  165

Query  1006  LVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQC-PPVVHGNFKT  830
             LV E++ NGT+  HLYG     +  + + QRL IA+  AKG+ +LH  C P ++H + KT
Sbjct  166   LVYEFMHNGTLKEHLYGPKTQGTRSMNWIQRLEIAADAAKGIEYLHTGCVPSIIHRDLKT  225

Query  829   GNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP--FIDPEVNQSGVFSEASDI  656
              N+L+D N   KV+D G+S L      D A    SI      ++DPE   S   +E SD+
Sbjct  226   SNILLDRNMRAKVSDFGLSKLAV----DGASHVSSIVRGTVGYLDPEYYISQQLTEKSDV  281

Query  655   YGFGVFLWELITGREAAHIRGLGSN-QTMLQWVEAHLSSDD---LVEHRLMGKYSAEGMR  488
             Y FGV L ELI+ +EA      G+N + ++QW + H+ S D   +++  L  +Y  + M 
Sbjct  282   YSFGVILLELISAQEAISSESFGNNCRNIVQWAKMHIESGDIQGIIDPSLHEEYDIQSMW  341

Query  487   DLIRLAMRCTSFPGKERPNMDMVAVEAERILEKE  386
              +   A+ C    G  RP++  V  + +  L  E
Sbjct  342   KIAERALMCVQPHGSMRPSISEVIKDVQDALAIE  375



>ref|XP_002977227.1| hypothetical protein SELMODRAFT_24883, partial [Selaginella moellendorffii]
 gb|EFJ21836.1| hypothetical protein SELMODRAFT_24883, partial [Selaginella moellendorffii]
Length=308

 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 172/299 (58%), Gaps = 13/299 (4%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIK---TRSAPPRQQFS  1091
             +G + F + +L +A+ NF  ++LIG G +G V+KG L  G +VAIK     S    ++F 
Sbjct  11    KGCKWFTLDDLRKASDNFSSNHLIGVGGYGKVYKGQLHTGELVAIKRAEKESFQGLEEFR  70

Query  1090  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  911
              E+   S   H+NLVNL+G+C ++G Q+LV E++PN T+ +HLY     +   L +K RL
Sbjct  71    TEIELFSRLHHKNLVNLIGFCTDDGQQMLVYEFMPNRTLRDHLYA-SNTAEQALNWKTRL  129

Query  910   SIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
             SIA G+AKGL +LH    PP++H + K+ N+L+DEN + KVAD G+S L    + +    
Sbjct  130   SIALGSAKGLEYLHELADPPIIHRDVKSSNILLDENLVAKVADLGLSKLAPTCSDEKTYS  189

Query  733   SHSIQPS-PFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTM--LQW  563
             S  ++ +  ++DPE       S  SD+Y FGV L E+ITG++          +    + W
Sbjct  190   SVQVKGTLGYLDPEYYAYHQLSAKSDVYSFGVVLIEIITGKQPIDNGSFIVKEIKESVAW  249

Query  562   --VEAHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILE  392
               V + LS    V+ RL+ + + E ++   RLA++C    G++RP M+ V  + E I++
Sbjct  250   GGVASLLS---FVDKRLLDETTVEQVKKYFRLALQCVEDSGQDRPKMNEVVKKLEEIIK  305



>ref|XP_006299329.1| hypothetical protein CARUB_v10015486mg [Capsella rubella]
 gb|EOA32227.1| hypothetical protein CARUB_v10015486mg [Capsella rubella]
Length=284

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/311 (36%), Positives = 165/311 (53%), Gaps = 27/311 (9%)
 Frame = -2

Query  1267  VPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSE  1088
             +P+G   F ++EL  AT  FD   +I  G FG V+ G + D  IVA+K R      +F  
Sbjct  1     MPQGVTEFSVEELRLATNGFD---MIAYGWFGSVYSGLIGD-MIVAVKRRIGSLHPRFLA  56

Query  1087  EVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLS  908
             EV+ +S  +H NLVNL+GYC E+G Q+LV EYL N  +  +L     +    L FK+R+ 
Sbjct  57    EVSYISRIRHSNLVNLVGYCCEDGDQMLVYEYLLNSNLREYL-----EDHRDLTFKKRIY  111

Query  907   IASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSH  728
             IA G AKGL +LH   PP+ H  F    VL+D N   K++DAG+  + +E++        
Sbjct  112   IALGAAKGLQYLHNSTPPLQHKRFSMSKVLLDVNLNAKISDAGMYGMFQELD-------S  164

Query  727   SIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHL  548
             S++P+       N  G   E  D++ FG+FL ELITG E    R   SN  ++QW+   +
Sbjct  165   SLRPN-------NPKGGLEETIDVFSFGLFLLELITGAEP---REFKSNFQIIQWIAPRI  214

Query  547   SSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTA  368
              S+ L + R+ G +  E +   I++ ++C  +P   R  MD V  E E I + E     A
Sbjct  215   FSNSLWDERMTGTFKIESIHSFIKITLKCLKYPAIHRAKMDEVVTELENIYQNE-DNPFA  273

Query  367   MGEASATLTLG  335
             +G    T+T+ 
Sbjct  274   LGGNGFTITIA  284



>ref|XP_010466386.1| PREDICTED: probable receptor-like protein kinase At2g47060 isoform 
X2 [Camelina sativa]
Length=345

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 164/297 (55%), Gaps = 25/297 (8%)
 Frame = -2

Query  1267  VPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQ-QFS  1091
             +PEG   F  +E+ QAT ++DE NLIG G +GLV+ G + D  +V IKT     R   F 
Sbjct  62    MPEGLIKFTSEEVRQATNDYDEDNLIGFGCYGLVYSGLIGDMPVV-IKTGIGYYRHPTFL  120

Query  1090  EEVARLS-MTQHRNLVNLLGYCQENG-YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQ  917
              EV+ +S  TQH N+VNL+GYC  +G Y++LV EYL NG + ++L          L FKQ
Sbjct  121   AEVSYMSSKTQHNNVVNLVGYCYNDGEYEVLVYEYLINGNVQDYL-----REHADLTFKQ  175

Query  916   RLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAG  737
             R+SIA G A+GL HLH   PP+ H  F T  VL+D N   KV+DAG+S  ++E+      
Sbjct  176   RVSIALGAARGLQHLHNLNPPLQHKRFTTNKVLLDANLNAKVSDAGMSGFVQEL------  229

Query  736   PSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE  557
                 + P  F D   N  G   E  D+Y FG+FL EL TG E    +   SN  ++ W+ 
Sbjct  230   ---PVVPL-FFD---NDKGGSEETVDVYSFGMFLLELFTGEEPEEFK---SNLDLVIWIV  279

Query  556   AHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKE  386
               + SD + + R+ G +    +  L+ + ++C  +P   R NMD V  E E I++ E
Sbjct  280   ERVYSDTMNDERMTGTFKKHSLMSLMLIMVKCMKYPPAIRVNMDGVVRELEEIVQIE  336



>ref|XP_010466385.1| PREDICTED: probable receptor-like protein kinase At2g47060 isoform 
X1 [Camelina sativa]
Length=346

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 164/297 (55%), Gaps = 25/297 (8%)
 Frame = -2

Query  1267  VPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQ-QFS  1091
             +PEG   F  +E+ QAT ++DE NLIG G +GLV+ G + D  +V IKT     R   F 
Sbjct  63    MPEGLIKFTSEEVRQATNDYDEDNLIGFGCYGLVYSGLIGDMPVV-IKTGIGYYRHPTFL  121

Query  1090  EEVARLS-MTQHRNLVNLLGYCQENG-YQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQ  917
              EV+ +S  TQH N+VNL+GYC  +G Y++LV EYL NG + ++L          L FKQ
Sbjct  122   AEVSYMSSKTQHNNVVNLVGYCYNDGEYEVLVYEYLINGNVQDYL-----REHADLTFKQ  176

Query  916   RLSIASGTAKGLCHLHGQCPPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAG  737
             R+SIA G A+GL HLH   PP+ H  F T  VL+D N   KV+DAG+S  ++E+      
Sbjct  177   RVSIALGAARGLQHLHNLNPPLQHKRFTTNKVLLDANLNAKVSDAGMSGFVQEL------  230

Query  736   PSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE  557
                 + P  F D   N  G   E  D+Y FG+FL EL TG E    +   SN  ++ W+ 
Sbjct  231   ---PVVPL-FFD---NDKGGSEETVDVYSFGMFLLELFTGEEPEEFK---SNLDLVIWIV  280

Query  556   AHLSSDDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKE  386
               + SD + + R+ G +    +  L+ + ++C  +P   R NMD V  E E I++ E
Sbjct  281   ERVYSDTMNDERMTGTFKKHSLMSLMLIMVKCMKYPPAIRVNMDGVVRELEEIVQIE  337



>ref|XP_011025559.1| PREDICTED: serine/threonine-protein kinase PBS1 [Populus euphratica]
 ref|XP_011025566.1| PREDICTED: serine/threonine-protein kinase PBS1 [Populus euphratica]
Length=361

 Score =   189 bits (479),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 180/331 (54%), Gaps = 21/331 (6%)
 Frame = -2

Query  1378  SKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATKNFDES  1199
             +KR  N++ D +      PVE       ++    RG    G+ VF ++E+E+AT +F E 
Sbjct  10    NKRRRNKSQDHSDPWVYKPVEFWQLEDQATQTTKRG---HGSSVFTLKEMEEATCSFSEK  66

Query  1198  NLIGCGSFGLVFKGFLFDGTIVAIKTRSAPP------RQQFSEEVARLSMTQHRNLVNLL  1037
             NL+G G FG V++G L  G +VAIK    P        ++F  EV  LS  +H NLV+L+
Sbjct  67    NLLGKGGFGRVYRGILRSGEVVAIKKMDLPTFKEAEGEREFRVEVDILSRLEHPNLVSLI  126

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYC +  ++ LV EYL NG + +HL G G+    K+++  RL +A G A+GL +LH    
Sbjct  127   GYCADGKHRFLVYEYLQNGNLQDHLNGFGK---AKVDWPSRLKVALGAARGLAYLHSSSD  183

Query  856   ---PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPEVNQ  686
                P+VH +FK+ N+L++ENF  K++D G++ L+ E   +    +  +    + DPE   
Sbjct  184   VGIPIVHRDFKSTNILLNENFEAKISDFGLAKLMPE-GQETFVTARVLGTFGYFDPEYTS  242

Query  685   SGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVEAHLSS----DDLVEHRL  518
             +G  +  SD+Y FGV L EL+TGR A  +    S+Q ++  V  +L+       +++ +L
Sbjct  243   TGNLTLQSDVYAFGVVLLELLTGRRAVDLNQGPSDQNLVLQVRHNLNDRKKLRKVIDPKL  302

Query  517   -MGKYSAEGMRDLIRLAMRCTSFPGKERPNM  428
               G Y+ E +     LA RC      ERP+M
Sbjct  303   SRGSYTLESVAMFANLASRCIRIESSERPSM  333



>ref|XP_002963090.1| hypothetical protein SELMODRAFT_78793, partial [Selaginella moellendorffii]
 gb|EFJ36553.1| hypothetical protein SELMODRAFT_78793, partial [Selaginella moellendorffii]
Length=301

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 177/309 (57%), Gaps = 19/309 (6%)
 Frame = -2

Query  1261  EGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIK---TRSAPPRQQFS  1091
             + A  F   EL +AT+NF    ++G GSFG VF+G L D T VAIK   + + P  QQF 
Sbjct  1     QNATFFSFDELSRATQNFKAELMLGTGSFGTVFQGVLDDDTPVAIKKANSTTGPRIQQFL  60

Query  1090  EEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRL  911
              EV  LS   HRNLV LLG C E    +LV E++PNGT+  HL    R SS  L +++RL
Sbjct  61    NEVTILSQVNHRNLVKLLGCCLETDVPLLVFEFVPNGTLFEHL--QHRRSSI-LSWERRL  117

Query  910   SIASGTAKGLCHLHGQCP-PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGP  734
              IA  TA+ + +LH     P+ H + K+ N+L+DE F  KVAD GIS L   ++ +A   
Sbjct  118   QIAIETAEAISYLHSSAAQPIYHRDVKSTNILLDEKFTAKVADFGISKL---VSLEATHV  174

Query  733   SHSIQPSP-FIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSNQTMLQWVE  557
             S ++  +P +IDP+  Q+   ++ SD+Y FGV L ELITG++        S++ +  +  
Sbjct  175   STTVHGTPGYIDPQYQQNYQLTDKSDVYSFGVVLLELITGQKPVDFSRNSSDKNLTAFSL  234

Query  556   AHLSS---DDLVEHRL-MGKYSAE--GMRDLIRLAMRCTSFPGKERPNMDMVAVEAERIL  395
             A++ S   +D+++  L +G   A+   ++++  LA+RC  F  + RP M  VA E  +I 
Sbjct  235   AYIQSSRIEDIIDKGLELGDERAKISSIQEVANLAIRCLEFDRENRPAMRSVAEELMKI-  293

Query  394   EKEIMGSTA  368
              K I+ + +
Sbjct  294   -KHILSAAS  301



>dbj|BAB02941.1| somatic embryogenesis receptor kinase-like protein [Arabidopsis 
thaliana]
Length=458

 Score =   191 bits (484),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 174/318 (55%), Gaps = 23/318 (7%)
 Frame = -2

Query  1300  PVSSLALARG-GVPEGARVFRMQELEQATKNFDESNLIGCGSFGLVFKGFLFDGTIVAIK  1124
             P  S  LA G G+ +G   F  +EL +AT  F E+NL+G G FG VFKG L +G  VA+K
Sbjct  66    PPPSPGLALGLGIYQG--TFNYEELSRATNGFSEANLLGQGGFGYVFKGMLRNGKEVAVK  123

Query  1123  TR---SAPPRQQFSEEVARLSMTQHRNLVNLLGYCQENGYQILVLEYLPNGTMCNHLYGM  953
                  S+   ++F  EV  +S   HR+LV L+GYC  +  ++LV E++PN T+  HL+G 
Sbjct  124   QLKEGSSQGEREFQAEVGIISRVHHRHLVALVGYCIADAQRLLVYEFVPNNTLEFHLHGK  183

Query  952   GRDSSTKLEFKQRLSIASGTAKGLCHLHGQC-PPVVHGNFKTGNVLVDENFIPKVADAGI  776
             GR +   +E+  RL IA G+AKGL +LH  C P ++H + K  N+L+D  F  KVAD G+
Sbjct  184   GRPT---MEWSSRLKIAVGSAKGLSYLHENCNPKIIHRDIKASNILIDFKFEAKVADFGL  240

Query  775   SSLLKEINHDAAGPSHSIQPSPFIDPEVNQSGVFSEASDIYGFGVFLWELITGREAAHIR  596
             + +  + N   +  +  +    ++ PE   SG  +E SD++ FGV L ELITGR    + 
Sbjct  241   AKIASDTNTHVS--TRVMGTFGYLAPEYASSGKLTEKSDVFSFGVVLLELITGRRPIDVN  298

Query  595   GLGSNQTMLQWVEAHLSS-------DDLVEHRLMGKYSAEGMRDLIRLAMRCTSFPGKER  437
              + ++ +++ W    L+        + +V+ +L  +Y  E M  ++  A  C       R
Sbjct  299   NVHADNSLVDWARPLLNQVSELGNFEVVVDKKLNNEYDKEEMARMVACAAACVRSTAPRR  358

Query  436   PNMDMVAVEAERILEKEI  383
             P MD VA    R+LE  I
Sbjct  359   PRMDQVA----RVLEGNI  372



>ref|XP_009367080.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Pyrus x bretschneideri]
Length=435

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 143/234 (61%), Gaps = 11/234 (5%)
 Frame = -2

Query  1387  LLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGA---RVFRMQELEQAT  1217
             L+  KR + R S+T SS PS P  Q   G  S  A+A    P  A   R   M ELEQAT
Sbjct  196   LMRVKRLTRRTSETVSSAPS-PTVQWERGDTSPYAVAHS--PYSAPNLRQLTMLELEQAT  252

Query  1216  KNFDESNLIGCGSFGLVFKGFLFDGTIVAIKTRSAPPRQQFSEEVARLSMTQHRNLVNLL  1037
             +NF+E N+IG G FGLV+KG L DGTIVA+K R   P Q F  EV  ++   H +++ L+
Sbjct  253   RNFNEINIIGQGRFGLVYKGLLQDGTIVAVKRRLHAPTQYFFHEVKHVARVNHMHILRLI  312

Query  1036  GYCQENGYQILVLEYLPNGTMCNHLYGMGRDSSTKLEFKQRLSIASGTAKGLCHLHGQCP  857
             GYCQ+   Q+LV +YLPNG + NHLY        KL  KQRLSIA G AKGL HLH   P
Sbjct  313   GYCQDATQQLLVYDYLPNGNVGNHLYDAEGLPIGKLGIKQRLSIALGAAKGLAHLHSLVP  372

Query  856   PVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSPFIDPE  695
             P++H +F T NVL+DE+   KV+D G++ LL  + H  AG S ++    F+DPE
Sbjct  373   PLLHMHFCTSNVLLDESITAKVSDYGLTKLL--VGHH-AGSSSAVD--CFLDPE  421



>gb|EYU41638.1| hypothetical protein MIMGU_mgv1a0021482mg, partial [Erythranthe 
guttata]
Length=527

 Score =   191 bits (486),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 191/360 (53%), Gaps = 31/360 (9%)
 Frame = -2

Query  1393  SMLLTSKRYSNRNSDTASSDPSAPVEQKTGGPVSSLALARGGVPEGARVFRMQELEQATK  1214
             S L+ SKR   +NS            QK    +S  A       E A  F + E+E+ATK
Sbjct  148   SFLIMSKR--KKNSSKQGKFQHGFHAQKLTSSLSDTA------TEAAHYFPLFEIEEATK  199

Query  1213  NFDESNLIGCGSFGLVFKGFLFDGTIVAIK---TRSAPPRQQFSEEVARLSMTQHRNLVN  1043
             NF++   IG G FG+V+ G L DG  +A+K     S   +++FS EV+ LS   HRNLV 
Sbjct  200   NFEKK--IGSGGFGVVYYGILKDGREIAVKILTNDSFQGKREFSNEVSLLSRIHHRNLVQ  257

Query  1042  LLGYCQENGYQILVLEYLPNGTMCNHLYG---MGRDSSTKLEFKQRLSIASGTAKGLCHL  872
              LGYCQE+G  ILV E++ NGT+  HLYG    GR     + + +RL IA  +AKG+ +L
Sbjct  258   FLGYCQEDGKSILVYEFMHNGTLKEHLYGPLTHGR----VINWIKRLEIAEDSAKGIEYL  313

Query  871   HGQC-PPVVHGNFKTGNVLVDENFIPKVADAGISSLLKEINHDAAGPSHSIQPSP--FID  701
             H  C P ++H + KT N+L+D+N   KV+D G+S L      D A    SI      ++D
Sbjct  314   HTGCVPSIIHRDLKTSNILLDKNTRAKVSDFGLSKLAV----DGASHVSSIVRGTVGYLD  369

Query  700   PEVNQSGVFSEASDIYGFGVFLWELITGREAAHIRGLGSN-QTMLQWVEAHLSSDDL--V  530
             PE   S   ++ SD+Y FGV L ELI+G+EA      GSN + ++QW + H+ S D+  +
Sbjct  370   PEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGSNCRNIVQWAKLHIESGDIQGI  429

Query  529   EHRLMGKYSAEGMRDLIRLAMRCTSFPGKERPNMDMVAVEAERILEKEIMGSTAMGEASA  350
                 +  Y  + M  +   A+ C    G  RP++  V  E +  L  E  G+  + EAS+
Sbjct  430   IDPSLHDYDIQSMWKIAEKALMCVQPHGSMRPSISEVIKEIQDALAIE-KGAENVREASS  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5916198060420