BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24594_g12_i1 len=1922 path=[68996:0-30 20436:31-54 20460:55-1085
21491:1086-1250 21656:1251-1284 36788:1285-1292 36796:1293-1316
36820:1317-1334 36838:1335-1423 9282:1424-1449 9308:1450-1921]

Length=1922
                                                                      Score     E

ref|XP_009798741.1|  PREDICTED: uncharacterized protein LOC104244922    343   6e-108   
ref|XP_009607036.1|  PREDICTED: uncharacterized protein LOC104101294    326   2e-101   
ref|XP_004235796.1|  PREDICTED: uncharacterized protein LOC101251666    322   7e-100   
ref|XP_006341541.1|  PREDICTED: A-agglutinin anchorage subunit-like     322   8e-100   
ref|XP_002279751.1|  PREDICTED: uncharacterized protein LOC100245764    272   4e-81    Vitis vinifera
ref|XP_009610828.1|  PREDICTED: uncharacterized protein LOC104104449    271   8e-81    
ref|XP_011097006.1|  PREDICTED: uncharacterized protein LOC105176030    266   9e-79    
emb|CAN83633.1|  hypothetical protein VITISV_023360                     255   2e-75    Vitis vinifera
ref|XP_009785230.1|  PREDICTED: uncharacterized protein LOC104233526    252   1e-73    
ref|XP_008461518.1|  PREDICTED: uncharacterized protein LOC103500...    247   1e-71    
ref|XP_008240226.1|  PREDICTED: uncharacterized protein LOC103338758    246   3e-71    
ref|XP_004167533.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    245   7e-71    
ref|XP_004137488.1|  PREDICTED: uncharacterized protein LOC101216634    245   8e-71    
ref|XP_008461442.1|  PREDICTED: uncharacterized protein LOC103500...    243   8e-70    
ref|XP_008461578.1|  PREDICTED: uncharacterized protein LOC103500...    241   2e-69    
ref|XP_010264981.1|  PREDICTED: uncharacterized protein LOC104602578    239   8e-69    
ref|XP_007209246.1|  hypothetical protein PRUPE_ppa007205mg             239   2e-68    
ref|XP_010279369.1|  PREDICTED: uncharacterized protein LOC104613300    236   1e-67    
gb|EYU44114.1|  hypothetical protein MIMGU_mgv1a008514mg                234   1e-66    
ref|XP_003530938.1|  PREDICTED: uncharacterized protein LOC100819...    229   1e-64    
gb|KHN16504.1|  E3 ubiquitin ligase BIG BROTHER                         228   3e-64    
emb|CBI15498.3|  unnamed protein product                                224   3e-64    
ref|XP_008374789.1|  PREDICTED: uncharacterized protein LOC103438030    226   1e-63    
ref|XP_009347527.1|  PREDICTED: uncharacterized protein LOC103939191    225   3e-63    
ref|XP_009360124.1|  PREDICTED: uncharacterized protein LOC103950620    225   4e-63    
ref|XP_006584888.1|  PREDICTED: uncharacterized protein LOC100819...    223   2e-62    
ref|XP_007160476.1|  hypothetical protein PHAVU_002G325200g             220   2e-61    
gb|KHN21637.1|  E3 ubiquitin ligase BIG BROTHER                         219   5e-61    
ref|XP_011004080.1|  PREDICTED: uncharacterized protein LOC105110675    219   7e-61    
ref|XP_004299570.1|  PREDICTED: uncharacterized protein LOC101294661    217   2e-60    
ref|XP_002318535.1|  zinc finger family protein                         217   4e-60    Populus trichocarpa [western balsam poplar]
ref|XP_003525211.2|  PREDICTED: uncharacterized protein LOC100788837    218   5e-60    
ref|XP_010110091.1|  E3 ubiquitin ligase BIG BROTHER-related protein    216   7e-60    
gb|AGE09562.1|  ZNF1-like protein                                       213   1e-59    
gb|KCW83945.1|  hypothetical protein EUGRSUZ_B00829                     212   7e-59    
ref|XP_007036627.1|  RING/U-box superfamily protein, putative iso...    212   3e-58    
ref|XP_007036626.1|  RING/U-box superfamily protein, putative iso...    212   7e-58    
ref|XP_010032336.1|  PREDICTED: uncharacterized protein LOC104421887    210   8e-58    
gb|KDP35178.1|  hypothetical protein JCGZ_10712                         207   3e-56    
ref|XP_002524891.1|  ring finger containing protein, putative           206   1e-55    Ricinus communis
gb|AET05501.2|  C3HC4-type RING zinc finger protein                     197   3e-53    
gb|AFK43751.1|  unknown                                                 197   4e-53    
gb|KHN23749.1|  E3 ubiquitin ligase BIG BROTHER-related                 189   4e-50    
ref|XP_006442579.1|  hypothetical protein CICLE_v10020624mg             188   1e-49    
gb|KDO49792.1|  hypothetical protein CISIN_1g016946mg                   187   1e-49    
ref|XP_002321493.2|  hypothetical protein POPTR_0015s03970g             187   2e-49    Populus trichocarpa [western balsam poplar]
gb|KHG07597.1|  E3 ubiquitin ligase BIG BROTHER -like protein           186   3e-49    
gb|KHN44580.1|  E3 ubiquitin ligase BIG BROTHER-related                 180   5e-47    
ref|XP_010537465.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1        180   1e-46    
ref|XP_010428313.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...    179   1e-46    
ref|XP_003530039.1|  PREDICTED: uncharacterized protein LOC100807785    178   2e-46    
ref|NP_177517.1|  RING/U-box domain-containing protein                  178   3e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390510.1|  hypothetical protein EUTSA_v10018747mg             176   4e-46    
ref|XP_010667794.1|  PREDICTED: uncharacterized protein LOC104884795    176   2e-45    
ref|XP_006300512.1|  hypothetical protein CARUB_v10020494mg             175   3e-45    
ref|XP_006390512.1|  hypothetical protein EUTSA_v10018747mg             175   3e-45    
ref|XP_010428312.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...    174   8e-45    
ref|XP_010471444.1|  PREDICTED: uncharacterized protein LOC104751...    174   8e-45    
ref|XP_004512886.1|  PREDICTED: uncharacterized protein LOC101488257    174   1e-44    
ref|XP_010416197.1|  PREDICTED: uncharacterized protein LOC104702...    173   2e-44    
ref|XP_004503317.1|  PREDICTED: uncharacterized protein LOC101510...    172   2e-44    
gb|AES76636.2|  zinc finger, C3HC4 type (RING finger) protein           171   8e-44    
ref|XP_002888945.1|  hypothetical protein ARALYDRAFT_476516             170   1e-43    
ref|XP_010471443.1|  PREDICTED: uncharacterized protein LOC104751...    169   4e-43    
ref|XP_010416196.1|  PREDICTED: uncharacterized protein LOC104702...    169   6e-43    
ref|XP_008351879.1|  PREDICTED: uncharacterized protein LOC103415315    161   7e-41    
ref|XP_003620418.1|  RING finger protein                                161   2e-40    
emb|CDX73013.1|  BnaC06g34610D                                          156   7e-39    
ref|XP_009104796.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...    154   2e-38    
ref|XP_009106036.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1        155   3e-38    
emb|CDY60141.1|  BnaA07g39060D                                          153   8e-38    
gb|ADK63390.1|  C3HC4 type zinc finger protein                          152   1e-37    
ref|XP_004969621.1|  PREDICTED: uncharacterized protein LOC101777...    152   2e-37    
emb|CDY11092.1|  BnaC06g23440D                                          151   3e-37    
ref|XP_006416651.1|  hypothetical protein EUTSA_v10007935mg             152   4e-37    
dbj|BAD82497.1|  RING-H2 finger protein RHG1a-like                      150   7e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004503318.1|  PREDICTED: uncharacterized protein LOC101510...    148   1e-36    
ref|XP_008792828.1|  PREDICTED: uncharacterized protein LOC103709314    149   2e-36    
emb|CDX96741.1|  BnaA08g22840D                                          150   2e-36    
ref|XP_009110372.1|  PREDICTED: uncharacterized protein LOC103835...    149   2e-36    
ref|XP_010476962.1|  PREDICTED: uncharacterized protein LOC104756132    149   3e-36    
emb|CDX68213.1|  BnaA07g22530D                                          147   9e-36    
ref|XP_008810050.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...    147   1e-35    
ref|XP_008655106.1|  PREDICTED: protein binding protein isoform X1      148   1e-35    
emb|CDX83878.1|  BnaC08g17670D                                          147   1e-35    
ref|XP_009110371.1|  PREDICTED: uncharacterized protein LOC103835...    146   4e-35    
ref|NP_001148380.1|  LOC100281993                                       145   4e-35    Zea mays [maize]
ref|XP_010906978.1|  PREDICTED: uncharacterized protein LOC105033766    145   5e-35    
ref|XP_010922495.1|  PREDICTED: pre-mRNA-splicing ATP-dependent R...    145   6e-35    
ref|XP_003569602.1|  PREDICTED: uncharacterized protein LOC100824389    145   7e-35    
dbj|BAJ90838.1|  predicted protein                                      144   1e-34    
ref|XP_010314223.1|  PREDICTED: uncharacterized protein LOC101244...    143   1e-34    
ref|XP_006587489.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    142   3e-34    
ref|XP_010498176.1|  PREDICTED: uncharacterized protein LOC104775910    142   5e-34    
ref|XP_008393402.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    137   6e-34    
ref|XP_004252267.1|  PREDICTED: uncharacterized protein LOC101244...    141   6e-34    
ref|XP_006416652.1|  hypothetical protein EUTSA_v10007935mg             142   1e-33    
ref|XP_009396064.1|  PREDICTED: uncharacterized protein LOC103981...    141   1e-33    
ref|XP_006305158.1|  hypothetical protein CARUB_v10009526mg             141   2e-33    
ref|XP_009396063.1|  PREDICTED: uncharacterized protein LOC103981...    139   4e-33    
gb|KEH21403.1|  C3HC4-type RING zinc finger protein                     137   1e-32    
ref|XP_004969620.1|  PREDICTED: uncharacterized protein LOC101777...    137   4e-32    
ref|XP_010496040.1|  PREDICTED: uncharacterized protein LOC104773158    136   1e-31    
ref|XP_011008300.1|  PREDICTED: probable E3 ubiquitin-protein lig...    130   3e-31    
ref|XP_009418389.1|  PREDICTED: uncharacterized protein LOC103998607    133   7e-31    
ref|XP_009394645.1|  PREDICTED: uncharacterized protein LOC103980085    133   2e-30    
dbj|BAJ99022.1|  predicted protein                                      127   8e-29    
gb|KFK41819.1|  hypothetical protein AALP_AA2G175100                    127   1e-28    
dbj|BAJ89596.1|  predicted protein                                      127   1e-28    
ref|XP_002440194.1|  hypothetical protein SORBIDRAFT_09g027550          127   1e-28    Sorghum bicolor [broomcorn]
ref|XP_003567954.1|  PREDICTED: uncharacterized protein LOC100839508    126   3e-28    
ref|NP_173239.1|  RING/U-box superfamily protein                        125   7e-28    Arabidopsis thaliana [mouse-ear cress]
gb|EMT25614.1|  E3 ubiquitin-protein ligase RLIM                        124   7e-28    
gb|AAM63662.1|  zinc-finger protein (C-terminal), putative              125   1e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961323.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...    123   5e-27    
ref|NP_001152137.1|  protein binding protein                            118   7e-27    Zea mays [maize]
gb|AFK36484.1|  unknown                                                 117   8e-27    
gb|EEE64599.1|  hypothetical protein OsJ_19451                          120   4e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282898.1|  PREDICTED: uncharacterized protein LOC100252...    119   6e-26    Vitis vinifera
ref|XP_010664821.1|  PREDICTED: uncharacterized protein LOC100252...    119   7e-26    
gb|AFW79024.1|  putative RING zinc finger domain superfamily protein    119   9e-26    
emb|CDM83681.1|  unnamed protein product                                113   3e-25    
ref|NP_001172514.1|  Os01g0692700                                       114   4e-25    
ref|XP_008649966.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...    117   6e-25    
gb|EAY98923.1|  hypothetical protein OsI_20878                          116   7e-25    Oryza sativa Indica Group [Indian rice]
gb|AAF97276.1|AC034106_19  Contains similarity to RING-H2 finger ...    117   7e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890255.1|  hypothetical protein ARALYDRAFT_312759             116   8e-25    
gb|EEE55221.1|  hypothetical protein OsJ_03093                          110   4e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458351.1|  hypothetical protein SORBIDRAFT_03g031830          110   8e-24    Sorghum bicolor [broomcorn]
gb|EMS63205.1|  E3 ubiquitin ligase BIG BROTHER                         109   1e-23    
dbj|BAG89594.1|  unnamed protein product                                108   1e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655108.1|  PREDICTED: protein binding protein isoform X2      112   1e-23    
gb|AAT39263.1|  unknown protein                                         112   1e-23    Oryza sativa Japonica Group [Japonica rice]
gb|ACN31440.1|  unknown                                                 108   2e-23    Zea mays [maize]
ref|XP_006644545.1|  PREDICTED: uncharacterized protein LOC102715154    108   3e-23    
emb|CBI26972.3|  unnamed protein product                                107   1e-22    
ref|XP_003631025.1|  RING finger protein                                104   2e-22    
ref|XP_011070758.1|  PREDICTED: uncharacterized protein LOC105156351    106   1e-21    
ref|XP_009407296.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...    104   2e-21    
ref|XP_010271053.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...    102   2e-21    
ref|XP_009407279.1|  PREDICTED: uncharacterized protein LOC103990...    105   3e-21    
gb|KEH21404.1|  C3HC4-type RING zinc finger protein                     103   4e-21    
gb|ACU20643.1|  unknown                                                 100   4e-21    Glycine max [soybeans]
ref|XP_009630445.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...    104   5e-21    
gb|EYU30013.1|  hypothetical protein MIMGU_mgv1a010691mg                102   2e-20    
ref|XP_004507240.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  99.4    3e-20    
gb|EMS63498.1|  E3 ubiquitin ligase BIG BROTHER-related protein       98.6    5e-20    
ref|XP_010314224.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1 ...    100   6e-20    
gb|AGT16136.1|  hypothetical protein SHCRBa_127_N06_R_350             95.9    3e-19    
gb|AFK43700.1|  unknown                                               94.4    5e-19    
ref|XP_006344318.1|  PREDICTED: uncharacterized protein LOC102583267  97.4    1e-18    
ref|XP_010456473.1|  PREDICTED: uncharacterized RING finger prote...  99.0    3e-18    
ref|XP_009796804.1|  PREDICTED: uncharacterized protein LOC104243322  95.9    3e-18    
ref|XP_007152718.1|  hypothetical protein PHAVU_004G153500g           90.5    1e-17    
gb|KFK40799.1|  hypothetical protein AALP_AA2G042800                  90.5    2e-17    
ref|XP_004238892.1|  PREDICTED: uncharacterized protein LOC101243888  92.0    3e-17    
gb|AFW79025.1|  putative RING zinc finger domain superfamily protein  93.2    3e-17    
ref|XP_006655556.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.5    5e-17    
ref|XP_010246194.1|  PREDICTED: uncharacterized protein LOC104589...  86.7    3e-16    
emb|CDO98403.1|  unnamed protein product                              91.3    3e-16    
ref|XP_010246193.1|  PREDICTED: uncharacterized protein LOC104589...  85.9    8e-16    
gb|EPS72630.1|  hypothetical protein M569_02127                       79.0    1e-13    
ref|XP_001779244.1|  predicted protein                                75.5    2e-12    
ref|XP_001773380.1|  predicted protein                                75.1    3e-12    
ref|XP_007163853.1|  hypothetical protein PHAVU_L011000g              74.7    6e-12    
ref|XP_002988343.1|  hypothetical protein SELMODRAFT_447294           78.2    1e-11    
ref|XP_002991447.1|  hypothetical protein SELMODRAFT_448412           77.8    1e-11    
ref|XP_008646556.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    2e-11    
ref|XP_002976040.1|  hypothetical protein SELMODRAFT_104716           71.6    4e-11    
ref|XP_002968333.1|  hypothetical protein SELMODRAFT_89607            71.2    7e-11    
gb|AEX12881.1|  hypothetical protein CL1032Contig1_02                 70.5    8e-11    
ref|XP_006477772.1|  PREDICTED: serine/threonine-protein kinase p...  74.3    9e-11    
ref|XP_009417181.1|  PREDICTED: probable E3 ubiquitin-protein lig...  75.1    1e-10    
emb|CDP00670.1|  unnamed protein product                              71.6    2e-10    
ref|XP_009395494.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.3    2e-10    
ref|XP_006393660.1|  hypothetical protein EUTSA_v10011314mg           73.9    2e-10    
ref|XP_008666895.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.3    2e-10    
ref|NP_175132.1|  RING/U-box domain-containing protein                73.9    2e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645308.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.3    3e-10    
ref|NP_001053779.1|  Os04g0603200                                     71.6    4e-10    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003589164.1|  Zinc finger protein                              72.8    5e-10    
ref|XP_010929288.1|  PREDICTED: uncharacterized protein LOC105050...  72.4    6e-10    
gb|KDO84119.1|  hypothetical protein CISIN_1g005363mg                 72.4    6e-10    
emb|CAA85320.1|  C-terminal zinc-finger                               71.6    6e-10    Glycine max [soybeans]
ref|XP_003537281.2|  PREDICTED: uncharacterized protein LOC547939...  72.0    7e-10    
emb|CAE01827.2|  OSJNBa0041A02.20                                     71.2    8e-10    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011038595.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.2    8e-10    
ref|XP_003542508.1|  PREDICTED: uncharacterized protein LOC100786...  72.0    8e-10    
ref|XP_006594140.1|  PREDICTED: uncharacterized protein LOC100786...  71.6    9e-10    
ref|XP_010240527.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    1e-09    
emb|CDY17114.1|  BnaC06g00470D                                        71.6    1e-09    
ref|XP_009119409.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1      71.6    1e-09    
ref|XP_010110816.1|  E3 ubiquitin ligase BIG BROTHER                  71.6    1e-09    
ref|XP_010922541.1|  PREDICTED: probable E3 ubiquitin-protein lig...  71.2    1e-09    
gb|AAC69857.1|  RING-H2 finger protein RHG1a                          68.2    1e-09    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351924.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  66.2    2e-09    
ref|NP_001045903.1|  Os02g0150700                                     70.9    2e-09    Oryza sativa Japonica Group [Japonica rice]
ref|NP_199108.1|  RING/U-box domain-containing protein                71.2    2e-09    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432474.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  70.9    2e-09    
ref|XP_002883900.1|  zinc finger family protein                       70.9    2e-09    
ref|XP_010484880.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.6    2e-09    
emb|CDY22376.1|  BnaA06g36980D                                        70.5    3e-09    
gb|KDO84114.1|  hypothetical protein CISIN_1g005363mg                 70.5    3e-09    
gb|KDO59741.1|  hypothetical protein CISIN_1g004784mg                 70.5    3e-09    
ref|XP_009101822.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  70.5    3e-09    
gb|KDO84118.1|  hypothetical protein CISIN_1g005363mg                 70.5    3e-09    
gb|KDO84113.1|  hypothetical protein CISIN_1g005363mg                 70.5    3e-09    
gb|KDO59743.1|  hypothetical protein CISIN_1g004784mg                 70.5    3e-09    
ref|XP_006434732.1|  hypothetical protein CICLE_v10000459mg           70.5    3e-09    
ref|XP_004290596.1|  PREDICTED: uncharacterized protein LOC101296252  70.5    3e-09    
ref|XP_006434731.1|  hypothetical protein CICLE_v10000459mg           70.5    3e-09    
ref|XP_006473300.1|  PREDICTED: uncharacterized protein LOC102629...  70.5    3e-09    
ref|XP_006473298.1|  PREDICTED: uncharacterized protein LOC102629...  70.5    3e-09    
ref|XP_010437680.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  70.1    3e-09    
ref|XP_010437676.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  70.1    4e-09    
tpg|DAA35698.1|  TPA: putative RING zinc finger domain superfamil...  66.2    4e-09    
emb|CDY62314.1|  BnaCnng39930D                                        70.1    4e-09    
ref|XP_010488964.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  66.2    4e-09    
ref|NP_001174121.1|  Os04g0648800                                     69.3    4e-09    
ref|XP_009123238.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  69.7    4e-09    
ref|XP_003581618.1|  PREDICTED: uncharacterized RING finger prote...  68.9    5e-09    
ref|NP_195130.1|  RING/U-box superfamily protein                      69.7    5e-09    Arabidopsis thaliana [mouse-ear cress]
gb|EEE56307.1|  hypothetical protein OsJ_05392                        70.5    5e-09    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283256.1|  hypothetical protein CARUB_v10004296mg           69.7    5e-09    
gb|KHN12795.1|  E3 ubiquitin ligase BIG BROTHER                       69.7    5e-09    
ref|XP_004291092.1|  PREDICTED: uncharacterized protein LOC101300206  69.7    5e-09    
ref|XP_002867137.1|  zinc finger family protein                       69.7    5e-09    
ref|XP_006283257.1|  hypothetical protein CARUB_v10004296mg           69.7    5e-09    
ref|XP_011040965.1|  PREDICTED: uncharacterized RING finger prote...  69.3    5e-09    
tpg|DAA60535.1|  TPA: putative clathrin heavy chain family protein    68.2    5e-09    
emb|CDY37230.1|  BnaA09g08510D                                        69.3    5e-09    
ref|XP_010538110.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  69.7    5e-09    
emb|CDY32973.1|  BnaA09g16200D                                        68.9    6e-09    
ref|XP_006412283.1|  hypothetical protein EUTSA_v10024583mg           69.7    6e-09    
emb|CDY43590.1|  BnaC09g17290D                                        68.9    6e-09    
ref|XP_009114020.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.6    6e-09    
ref|XP_010906570.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    6e-09    
ref|XP_008364450.1|  PREDICTED: uncharacterized protein DDB_G0271...  69.3    6e-09    
ref|XP_010028452.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  69.3    6e-09    
ref|XP_009114022.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.6    6e-09    
ref|XP_008373127.1|  PREDICTED: uncharacterized protein DDB_G0271670  69.3    6e-09    
ref|XP_010028444.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  69.3    6e-09    
ref|XP_002451554.1|  hypothetical protein SORBIDRAFT_04g003650        68.9    6e-09    Sorghum bicolor [broomcorn]
ref|XP_009341337.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  69.3    6e-09    
ref|XP_006386504.1|  hypothetical protein POPTR_0002s12590g           69.3    7e-09    
gb|AES60749.2|  zinc finger, C3HC4 type (RING finger) protein         69.3    7e-09    
ref|XP_003580695.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.3    7e-09    
ref|XP_006409547.1|  hypothetical protein EUTSA_v10022580mg           69.3    7e-09    
ref|XP_010447158.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.9    7e-09    
ref|XP_009418514.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.9    8e-09    
ref|XP_003590498.1|  RING finger protein                              69.3    8e-09    
ref|XP_011017179.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.9    8e-09    
ref|XP_011017177.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.9    8e-09    
emb|CBI21404.3|  unnamed protein product                              65.1    8e-09    
ref|XP_010061732.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.9    8e-09    
emb|CDY63645.1|  BnaC07g50990D                                        68.6    8e-09    
ref|XP_010526271.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  68.6    8e-09    
ref|XP_010929285.1|  PREDICTED: uncharacterized protein LOC105050...  68.9    8e-09    
sp|Q7XTV7.2|HIP1_ORYSJ  RecName: Full=Probable E3 ubiquitin-prote...  68.9    9e-09    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006280120.1|  hypothetical protein CARUB_v10026015mg           68.9    9e-09    
ref|XP_010321163.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  63.2    9e-09    
emb|CBI25581.3|  unnamed protein product                              64.7    9e-09    
ref|NP_179155.1|  RING/U-box domain-containing protein                68.9    9e-09    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304899.1|  hypothetical protein CARUB_v100085910mg          67.8    9e-09    
ref|XP_009621989.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.9    1e-08    
ref|XP_006403323.1|  hypothetical protein EUTSA_v10003162mg           68.6    1e-08    
ref|XP_009414799.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.2    1e-08    
gb|EMT27530.1|  RING finger protein 165                               68.6    1e-08    
ref|XP_008795882.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.9    1e-08    
gb|ABC47867.1|  zinc finger protein                                   68.9    1e-08    Glycine max [soybeans]
ref|XP_008219940.1|  PREDICTED: uncharacterized protein DDB_G0271...  68.2    1e-08    
ref|XP_002523615.1|  conserved hypothetical protein                   64.7    1e-08    Ricinus communis
ref|XP_010525881.1|  PREDICTED: uncharacterized protein LOC104803...  68.2    1e-08    
ref|XP_009413348.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.6    1e-08    
emb|CDP01312.1|  unnamed protein product                              68.2    1e-08    
ref|XP_002301172.2|  zinc finger family protein                       68.6    1e-08    Populus trichocarpa [western balsam poplar]
emb|CAI30139.1|  RING-finger domain protein                           67.8    1e-08    Zinnia violacea [garden zinnia]
ref|NP_001189530.1|  RING/U-box domain-containing protein             68.2    1e-08    
gb|KDO59730.1|  hypothetical protein CISIN_1g0024832mg                64.7    1e-08    
ref|XP_011017180.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.2    1e-08    
ref|XP_006487049.1|  PREDICTED: cell wall protein AWA1-like isofo...  68.2    1e-08    
ref|XP_006487051.1|  PREDICTED: cell wall protein AWA1-like isofo...  68.2    1e-08    
gb|EMT18074.1|  RING finger protein 165                               65.5    1e-08    
ref|XP_007136694.1|  hypothetical protein PHAVU_009G066000g           68.2    1e-08    
gb|KDO59744.1|  hypothetical protein CISIN_1g004784mg                 68.2    2e-08    
ref|XP_002863715.1|  zinc finger family protein                       68.2    2e-08    
ref|XP_009377764.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.2    2e-08    
ref|XP_009341966.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  68.2    2e-08    
ref|XP_010247703.1|  PREDICTED: uncharacterized protein LOC104590678  67.8    2e-08    
ref|XP_009417184.1|  PREDICTED: probable E3 ubiquitin-protein lig...  68.2    2e-08    
ref|XP_007042456.1|  RING/U-box superfamily protein, putative iso...  68.2    2e-08    
gb|KDO59742.1|  hypothetical protein CISIN_1g004784mg                 68.2    2e-08    
gb|KDO59740.1|  hypothetical protein CISIN_1g004784mg                 68.2    2e-08    
gb|EYU36345.1|  hypothetical protein MIMGU_mgv1a005432mg              67.4    2e-08    
gb|EYU36346.1|  hypothetical protein MIMGU_mgv1a005432mg              67.4    2e-08    
ref|XP_007042453.1|  Binding protein, putative isoform 1              67.8    2e-08    
ref|XP_010112096.1|  E3 ubiquitin ligase BIG BROTHER                  67.8    2e-08    
ref|XP_010442096.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.8    2e-08    
emb|CBI32388.3|  unnamed protein product                              64.3    2e-08    
ref|XP_010481923.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.8    2e-08    
ref|XP_006399562.1|  hypothetical protein EUTSA_v10013256mg           67.4    2e-08    
ref|XP_007225192.1|  hypothetical protein PRUPE_ppa002107mg           67.8    2e-08    
ref|XP_008220246.1|  PREDICTED: uncharacterized protein LOC103320352  67.8    2e-08    
ref|XP_006378757.1|  hypothetical protein POPTR_0010s22750g           67.4    2e-08    
gb|EMS57300.1|  E3 ubiquitin ligase BIG BROTHER-related protein       67.8    2e-08    
ref|XP_006304873.1|  hypothetical protein CARUB_v10012632mg           67.4    2e-08    
ref|XP_010525883.1|  PREDICTED: uncharacterized protein LOC104803...  67.4    2e-08    
ref|XP_010647735.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  67.8    2e-08    
ref|XP_007009794.1|  RING/U-box domain-containing protein, putati...  67.4    2e-08    
ref|XP_010250396.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  67.0    2e-08    
ref|XP_004244491.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2   67.4    2e-08    
ref|XP_010270243.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.4    3e-08    
ref|XP_007145231.1|  hypothetical protein PHAVU_007G221700g           67.0    3e-08    
ref|XP_006342634.1|  PREDICTED: protein adg3-like isoform X1          67.4    3e-08    
emb|CBI21406.3|  unnamed protein product                              62.8    3e-08    
gb|AFK36630.1|  unknown                                               64.3    3e-08    
ref|XP_002300224.2|  hypothetical protein POPTR_0001s31240g           67.4    3e-08    
ref|XP_009380751.1|  PREDICTED: uncharacterized protein LOC103969059  67.0    3e-08    
ref|XP_008663067.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  63.5    3e-08    
ref|XP_010927431.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  67.4    3e-08    
ref|XP_002510189.1|  protein binding protein, putative                67.4    3e-08    
gb|EYU25442.1|  hypothetical protein MIMGU_mgv11b002235mg             67.0    3e-08    
ref|XP_007011597.1|  RING/U-box superfamily protein, putative iso...  66.6    3e-08    
ref|XP_009407288.1|  PREDICTED: uncharacterized protein LOC103990...  65.5    3e-08    
ref|XP_002891317.1|  zinc finger family protein                       67.0    4e-08    
ref|XP_010263494.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.0    4e-08    
ref|XP_010263499.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.0    4e-08    
ref|XP_006652769.1|  PREDICTED: uncharacterized protein LOC102712...  65.9    4e-08    
ref|XP_010263498.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.0    4e-08    
ref|XP_010263497.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.0    4e-08    
ref|XP_010263495.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  67.0    4e-08    
ref|XP_010263493.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.0    4e-08    
emb|CAN72909.1|  hypothetical protein VITISV_018846                   66.2    4e-08    
ref|XP_002447219.1|  hypothetical protein SORBIDRAFT_06g030650        67.0    4e-08    
ref|XP_010656530.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.2    4e-08    
ref|XP_006280121.1|  hypothetical protein CARUB_v10026015mg           66.6    4e-08    
ref|XP_010652801.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  64.7    4e-08    
gb|EMS53269.1|  E3 ubiquitin ligase BIG BROTHER-related protein       65.5    4e-08    
ref|XP_008788840.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.0    4e-08    
ref|XP_010549234.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.6    4e-08    
ref|XP_009414783.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.2    4e-08    
ref|XP_008361933.1|  PREDICTED: cell wall protein AWA1-like           66.6    4e-08    
ref|XP_004291245.1|  PREDICTED: uncharacterized protein LOC101297110  66.6    4e-08    
gb|KDP41705.1|  hypothetical protein JCGZ_16112                       66.6    5e-08    
emb|CAN68213.1|  hypothetical protein VITISV_022802                   66.2    5e-08    
ref|XP_010530763.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2      66.6    5e-08    
ref|XP_011082723.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1      66.2    5e-08    
ref|XP_010549238.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.6    5e-08    
ref|XP_010028453.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  66.6    5e-08    
gb|EMS68907.1|  E3 ubiquitin-protein ligase Arkadia                   66.2    5e-08    
ref|XP_010028451.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  66.6    5e-08    
emb|CAN71989.1|  hypothetical protein VITISV_037727                   65.1    5e-08    
ref|XP_010447551.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.9    5e-08    
emb|CDY43220.1|  BnaC08g04930D                                        66.2    5e-08    
gb|EMS47545.1|  E3 ubiquitin ligase BIG BROTHER-related protein       66.2    5e-08    
ref|XP_010652800.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.1    5e-08    
ref|XP_009396260.1|  PREDICTED: probable E3 ubiquitin-protein lig...  66.2    5e-08    
ref|XP_010461481.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.2    6e-08    
ref|XP_009396259.1|  PREDICTED: probable E3 ubiquitin-protein lig...  66.2    6e-08    
ref|XP_010517398.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1 ...  66.2    6e-08    
ref|XP_011074392.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  66.2    6e-08    
gb|EMT09077.1|  RING finger protein 165                               66.2    6e-08    
emb|CDP05971.1|  unnamed protein product                              65.9    6e-08    
ref|XP_010488963.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  66.2    6e-08    
ref|XP_008809995.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.9    7e-08    
emb|CDY46757.1|  BnaA03g17010D                                        65.9    7e-08    
emb|CDY13429.1|  BnaA03g51470D                                        63.9    7e-08    
emb|CAA85321.1|  protein containing C-terminal RING-finger            65.9    7e-08    
ref|XP_010928342.1|  PREDICTED: probable E3 ubiquitin-protein lig...  66.2    7e-08    
ref|XP_002282377.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  66.2    7e-08    
ref|XP_010684116.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  65.9    7e-08    
ref|XP_006578032.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  62.4    7e-08    
ref|XP_009133121.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.9    7e-08    
ref|XP_010239610.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.9    8e-08    
ref|XP_010517416.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1 ...  65.9    8e-08    
ref|XP_004172392.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    8e-08    
ref|XP_006652918.1|  PREDICTED: uncharacterized protein LOC102709835  65.9    8e-08    
ref|XP_003580036.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.9    8e-08    
gb|EMT32688.1|  hypothetical protein F775_43216                       62.8    8e-08    
ref|XP_004142868.1|  PREDICTED: uncharacterized protein LOC101203243  65.9    8e-08    
ref|NP_001169344.1|  uncharacterized LOC100383211                     65.9    8e-08    
ref|XP_009138009.1|  PREDICTED: uncharacterized protein LOC103862052  65.5    8e-08    
emb|CDY13433.1|  BnaA03g51510D                                        65.5    8e-08    
ref|XP_011082077.1|  PREDICTED: uncharacterized RING finger prote...  65.5    8e-08    
ref|NP_001052192.1|  Os04g0185500                                     65.9    8e-08    
emb|CAE02518.2|  OSJNBb0003A12.5                                      65.9    8e-08    
emb|CAH65886.1|  OSIGBa0148J22.5                                      65.9    8e-08    
ref|XP_004499047.1|  PREDICTED: uncharacterized protein LOC101503203  65.9    9e-08    
ref|XP_010928690.1|  PREDICTED: uncharacterized protein LOC105050...  65.5    9e-08    
ref|XP_002448469.1|  hypothetical protein SORBIDRAFT_06g027620        64.7    9e-08    
ref|XP_006856472.1|  hypothetical protein AMTR_s00046p00058640        65.5    9e-08    
gb|EMT13059.1|  E3 ubiquitin-protein ligase Arkadia                   65.1    9e-08    
ref|NP_001056239.2|  Os05g0550000                                     60.5    9e-08    
ref|XP_006283613.1|  hypothetical protein CARUB_v10004669mg           65.1    1e-07    
ref|XP_002873468.1|  zinc finger family protein                       65.1    1e-07    
ref|XP_002440253.1|  hypothetical protein SORBIDRAFT_09g028550        62.4    1e-07    
ref|XP_006487048.1|  PREDICTED: nucleoporin NUP100/NSP100-like        65.9    1e-07    
ref|XP_010928687.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  65.5    1e-07    
gb|KHG25461.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  65.5    1e-07    
gb|AES60746.2|  RING zinc finger protein, putative                    65.1    1e-07    
emb|CBI31479.3|  unnamed protein product                              65.5    1e-07    
ref|XP_010908847.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  65.1    1e-07    
ref|XP_008648034.1|  PREDICTED: uncharacterized LOC100381884 isof...  65.1    1e-07    
ref|XP_011000117.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.5    1e-07    
gb|KDP31952.1|  hypothetical protein JCGZ_12413                       65.5    1e-07    
ref|XP_010928343.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.5    1e-07    
ref|XP_011069665.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.5    1e-07    
ref|XP_010529737.1|  PREDICTED: probable E3 ubiquitin-protein lig...  65.1    1e-07    
ref|XP_002274580.2|  PREDICTED: uncharacterized protein LOC100249661  65.1    1e-07    
ref|XP_011069666.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.5    1e-07    
ref|XP_008648033.1|  PREDICTED: uncharacterized LOC100381884 isof...  65.1    1e-07    
ref|XP_008801560.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  64.7    1e-07    
ref|XP_010500194.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.1    1e-07    
gb|KHN04492.1|  E3 ubiquitin ligase BIG BROTHER-related               65.5    1e-07    
ref|NP_001168137.1|  uncharacterized LOC100381884                     65.1    1e-07    
ref|XP_008444602.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  65.1    1e-07    
ref|NP_001132824.1|  uncharacterized LOC100194314                     64.3    1e-07    
ref|XP_010526953.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.1    1e-07    
gb|EYU22070.1|  hypothetical protein MIMGU_mgv1a005125mg              64.7    1e-07    
ref|XP_010540364.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.1    1e-07    
ref|XP_010540360.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  65.1    1e-07    
emb|CDO97191.1|  unnamed protein product                              64.7    1e-07    
ref|XP_008801559.1|  PREDICTED: uncharacterized protein LOC103715...  64.7    1e-07    
ref|XP_011082069.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  64.7    1e-07    
ref|XP_007160866.1|  hypothetical protein PHAVU_001G023300g           65.1    1e-07    
ref|XP_010548008.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  64.7    2e-07    
ref|XP_006652112.1|  PREDICTED: uncharacterized serine-rich prote...  64.7    2e-07    
ref|XP_008805566.1|  PREDICTED: uncharacterized protein LOC103718487  64.7    2e-07    
emb|CAC08239.1|  Pspzf zinc finger protein-like                       64.3    2e-07    
ref|XP_010107559.1|  E3 ubiquitin ligase BIG BROTHER-related protein  64.7    2e-07    
ref|XP_010048396.1|  PREDICTED: uncharacterized protein LOC104437196  64.7    2e-07    
ref|XP_010509375.1|  PREDICTED: uncharacterized protein LOC104785800  64.7    2e-07    
ref|XP_004252761.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  64.7    2e-07    
ref|XP_003607933.1|  RING finger protein                              64.7    2e-07    
ref|XP_002278073.1|  PREDICTED: uncharacterized protein LOC100247468  62.4    2e-07    
emb|CDY17061.1|  BnaA08g04250D                                        64.7    2e-07    
dbj|BAH19781.1|  AT5G10650                                            64.3    2e-07    
ref|XP_008801552.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  64.7    2e-07    
ref|NP_196626.2|  RING/U-box superfamily protein                      64.3    2e-07    
gb|AAM20531.1|  Pspzf zinc finger protein-like                        64.3    2e-07    
dbj|BAJ94022.1|  predicted protein                                    64.7    2e-07    
ref|XP_003607932.1|  RING finger protein                              64.3    2e-07    
gb|KDO51090.1|  hypothetical protein CISIN_1g0163051mg                61.6    2e-07    
ref|XP_006287356.1|  hypothetical protein CARUB_v10000556mg           64.3    2e-07    
emb|CBI21403.3|  unnamed protein product                              61.2    2e-07    
ref|XP_004253058.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      64.3    2e-07    
ref|XP_009107452.1|  PREDICTED: probable E3 ubiquitin-protein lig...  64.3    2e-07    
ref|XP_010438037.1|  PREDICTED: uncharacterized protein LOC104721...  64.3    2e-07    
ref|XP_011076797.1|  PREDICTED: uncharacterized RING finger prote...  64.3    2e-07    
ref|XP_006422985.1|  hypothetical protein CICLE_v10027894mg           64.7    2e-07    
ref|XP_010438036.1|  PREDICTED: uncharacterized protein LOC104721...  64.3    2e-07    
ref|XP_010491743.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  64.3    2e-07    
gb|KHG02826.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  64.3    2e-07    
ref|XP_011088238.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2      64.7    2e-07    
ref|XP_010438035.1|  PREDICTED: uncharacterized protein LOC104721...  64.3    2e-07    
ref|XP_003590495.1|  RING finger protein                              64.7    2e-07    
ref|XP_006342462.1|  PREDICTED: uncharacterized protein DDB_G0271...  64.3    2e-07    
ref|XP_002515338.1|  ring finger protein, putative                    64.3    2e-07    
gb|ABC47850.1|  zinc finger protein 2                                 64.3    2e-07    
ref|XP_006422986.1|  hypothetical protein CICLE_v10027894mg           64.3    2e-07    
ref|XP_003607931.1|  RING finger protein                              64.3    2e-07    
ref|XP_006357056.1|  PREDICTED: uncharacterized protein DDB_G0271...  63.9    2e-07    
gb|KHN09488.1|  E3 ubiquitin ligase BIG BROTHER-related               64.3    2e-07    
ref|XP_010675444.1|  PREDICTED: probable E3 ubiquitin-protein lig...  64.3    2e-07    
ref|XP_003521382.1|  PREDICTED: cell wall protein IFF6-like isofo...  64.3    2e-07    
ref|XP_010037942.1|  PREDICTED: uncharacterized protein LOC104426...  64.3    2e-07    
ref|NP_001148112.1|  C-terminal zinc-finger                           63.9    2e-07    
ref|XP_010652798.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  63.2    2e-07    
ref|XP_006480619.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.9    2e-07    
ref|XP_006578031.1|  PREDICTED: E3 ubiquitin-protein ligase Arkad...  64.3    2e-07    
ref|XP_008793364.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.9    2e-07    
gb|KHG28619.1|  E3 ubiquitin ligase BIG BROTHER                       64.3    3e-07    
emb|CAN72494.1|  hypothetical protein VITISV_037014                   62.8    3e-07    
emb|CBI19496.3|  unnamed protein product                              61.2    3e-07    
ref|XP_010422822.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.9    3e-07    
ref|XP_010037951.1|  PREDICTED: uncharacterized protein LOC104426...  63.9    3e-07    
ref|XP_006428815.1|  hypothetical protein CICLE_v10011412mg           63.9    3e-07    
ref|XP_003563478.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  63.9    3e-07    
ref|XP_006480629.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  63.9    3e-07    
ref|XP_008662034.1|  PREDICTED: zinc finger, C3HC4 type family pr...  63.2    3e-07    
gb|KHG27085.1|  E3 ubiquitin-protein ligase arkadia                   60.1    3e-07    
ref|XP_010037944.1|  PREDICTED: uncharacterized protein LOC104426...  63.9    3e-07    
gb|KHN04493.1|  E3 ubiquitin ligase BIG BROTHER-related               64.3    3e-07    
dbj|BAE98648.1|  hypothetical protein                                 63.5    3e-07    
ref|XP_010107917.1|  RING finger protein 165                          63.9    3e-07    
ref|XP_007199723.1|  hypothetical protein PRUPE_ppa002397mg           63.9    3e-07    
ref|NP_001151400.1|  zinc finger, C3HC4 type family protein           63.2    3e-07    
ref|XP_002867302.1|  zinc finger family protein                       63.5    3e-07    
ref|XP_004304414.1|  PREDICTED: uncharacterized protein LOC101306447  63.9    3e-07    
emb|CAB45904.1|  putative protein                                     63.5    3e-07    
ref|NP_567877.1|  RING-finger domain-containing protein               63.5    3e-07    
ref|XP_002311101.2|  hypothetical protein POPTR_0008s04080g           63.2    3e-07    
ref|XP_007047307.1|  RING/U-box superfamily protein, putative         63.9    3e-07    
ref|XP_004951884.1|  PREDICTED: serine/arginine repetitive matrix...  63.5    3e-07    
ref|XP_009359854.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.9    3e-07    
ref|XP_009359841.1|  PREDICTED: probable E3 ubiquitin-protein lig...  63.9    3e-07    
ref|XP_008236473.1|  PREDICTED: uncharacterized protein LOC103335241  62.8    3e-07    
ref|XP_010432858.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  63.5    3e-07    
emb|CDX79718.1|  BnaC03g20540D                                        63.5    3e-07    
ref|XP_008654929.1|  PREDICTED: C-terminal zinc-finger isoform X1     63.5    3e-07    



>ref|XP_009798741.1| PREDICTED: uncharacterized protein LOC104244922 [Nicotiana sylvestris]
Length=377

 Score =   343 bits (879),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 247/340 (73%), Gaps = 22/340 (6%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV S+SS +    +Q RY   R+QN  Q +   DP P L SS+RSK TIS+LLLAPFS
Sbjct  1     MPVVFSESSNIS---DQIRYRKSRTQNQQQDL---DPIPILSSSTRSKPTISSLLLAPFS  54

Query  294   PASPTHDPPITLTP-------KKKNFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkk  452
             P SPTH+ P T +        KKKNFTTFRGLGCTASSQVSVPAVIR+SADWDS R  KK
Sbjct  55    PTSPTHENPTTTSTTSTVISTKKKNFTTFRGLGCTASSQVSVPAVIRTSADWDSKRVKKK  114

Query  453   kklrskkkALNSVSAA--GDVGGNNVNILSNPPAASS------DVWCGPGIGFATDAASV  608
             K+  +K K++NS      G +G NN+N++ N  ++SS      DVWCGPGIG  TDAASV
Sbjct  115   KQNSNKNKSVNSAVNVNGGGIGCNNINVVLNNTSSSSSCVGVPDVWCGPGIGLTTDAASV  174

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS  788
              CVVSRR  S RG+++ D V PRERS   +RRMV PEDNPFLD +++ G+ RS++++  S
Sbjct  175   DCVVSRRPVSGRGRIENDKVTPRERSTYPVRRMVSPEDNPFLDMESSLGVPRSQVELFAS  234

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             RHHR+SR+G+PEGLAE+VMLQ+ LM G + G DRYRD RLDVD+MSYEELLELGD+IG+V
Sbjct  235   RHHRHSRHGYPEGLAEIVMLQNSLMGGRTVGLDRYRDLRLDVDNMSYEELLELGDKIGYV  294

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TGLREDEI R VR+T+ P      S    E ERKCS+CQ
Sbjct  295   NTGLREDEIARCVRRTR-PFFLNNFSLIRTELERKCSICQ  333


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHI CIKQWL+ KN+CP+CKS A
Sbjct  334   EEYEAEDEMGKLDCGHFYHIRCIKQWLMQKNSCPVCKSAA  373



>ref|XP_009607036.1| PREDICTED: uncharacterized protein LOC104101294 [Nicotiana tomentosiformis]
Length=377

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 200/340 (59%), Positives = 237/340 (70%), Gaps = 22/340 (6%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV S+SS +    +Q RY   R+QN  Q I   DP P L SS+RSK TIS+LLLAPFS
Sbjct  1     MPVVFSESSAIS---DQIRYRKSRTQNQQQDI---DPIPILSSSTRSKPTISSLLLAPFS  54

Query  294   PASPTHDPPITLTP-------KKKNFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkk  452
             P SPTH+ P T T        KKKNFTTFRGLGCTASSQVSVPAVIR+SADWDS R  KK
Sbjct  55    PTSPTHENPTTTTSTSTAISTKKKNFTTFRGLGCTASSQVSVPAVIRTSADWDSKRVKKK  114

Query  453   kklrskkkALNSVSAAGDVGGNNVNILSNPPAASS--------DVWCGPGIGFATDAASV  608
             K+  +K K++NS       G    N        SS        DVWCGPGIG  TDAASV
Sbjct  115   KQNSNKNKSVNSSVNVNGGGIGCNNNNGIQNNTSSSSSCVGVPDVWCGPGIGLTTDAASV  174

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS  788
              CVVSRR  S RG+++ D V PRERS C +RRMV PEDNPFLD +++  + RS++++  S
Sbjct  175   DCVVSRRPVSGRGRIENDKVTPRERSTCPVRRMVSPEDNPFLDIESSLSVPRSQVELFAS  234

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             RHHR+SR+G+PEGLAE+VMLQ+ LM G + G DRYRD RLDVD+MSYEELLELGD+IG+V
Sbjct  235   RHHRHSRHGYPEGLAEIVMLQNSLMGGRTVGLDRYRDLRLDVDNMSYEELLELGDKIGYV  294

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TGLRED+I R VR+TK P      S    E ERKCS+CQ
Sbjct  295   NTGLREDDICRCVRRTK-PFFLNNFSLIRTELERKCSICQ  333


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHI CIKQWL+ KN+CP+CKS A
Sbjct  334   EEYEAEDEMGKLDCGHFYHIRCIKQWLMQKNSCPVCKSAA  373



>ref|XP_004235796.1| PREDICTED: uncharacterized protein LOC101251666 [Solanum lycopersicum]
Length=387

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 235/352 (67%), Gaps = 36/352 (10%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV S+SS V     Q RY  PR+QN  +     D +P   SS  +K TIS+LLLAPFS
Sbjct  1     MPVVFSESSTVS---EQIRYRKPRTQNQQET---QDMDPVSSSSRSTKPTISSLLLAPFS  54

Query  294   PASPTHDPPIT------LTPKKKNFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkk  455
             P SP H+   T       + KKKNF TFRGLGCTAS QVSVPAVIR+SADWDS R  KKK
Sbjct  55    PTSPIHENSTTPSASTVFSTKKKNFATFRGLGCTASPQVSVPAVIRTSADWDSKRIKKKK  114

Query  456   klrskkkALNSVSAAGDVGGNNVNILSNPP---------------------AASSDVWCG  572
             +  +K K+LNS    G  GG ++   SN                        A  DVWCG
Sbjct  115   QNSNKNKSLNSAVNVG--GGVSIGCSSNSVQNNNPSSSSSSSGPLSLSSSCVAVPDVWCG  172

Query  573   PGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTAS  752
             PGIG  TDAASV CVVSRR  S RG+++ D   PRERSAC +RRMV PEDNPFLD +++ 
Sbjct  173   PGIGLTTDAASVDCVVSRRPVSGRGRIESDKATPRERSACPIRRMVSPEDNPFLDIESSL  232

Query  753   GMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYE  932
             G+ RS++++  SRHHR+SR+G+ EGLAE+VMLQ+ LM G ++G DRYR+WRLDVD+MSYE
Sbjct  233   GIPRSQIELFASRHHRHSRHGYSEGLAEIVMLQNSLMGGRTDGLDRYRNWRLDVDNMSYE  292

Query  933   ELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ELLELGDRIG+V+TGLREDEI R VR+TK P      S    E ER+C++CQ
Sbjct  293   ELLELGDRIGYVNTGLREDEIARCVRRTK-PFFLSNLSLIRTELERQCTICQ  343


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHI CIKQWL  KN+CP+CKS A
Sbjct  344   EEYEAEDEMGKLDCGHFYHIRCIKQWLSQKNSCPVCKSAA  383



>ref|XP_006341541.1| PREDICTED: A-agglutinin anchorage subunit-like [Solanum tuberosum]
Length=388

 Score =   322 bits (825),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 234/351 (67%), Gaps = 33/351 (9%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV S+SS V     Q RY  PR+QN  Q   + DP     SS  +K TIS+LLLAPFS
Sbjct  1     MPVVFSESSTVS---EQIRYRKPRTQNQ-QETQDMDPISSSSSSRSTKPTISSLLLAPFS  56

Query  294   PASPTHDPPIT------LTPKKKNFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkk  455
             P SPTH+   T       + KKKNF TFRGLGCTAS QVSVPAVIR+SADWD  R  KKK
Sbjct  57    PTSPTHENSTTPTASTVFSTKKKNFATFRGLGCTASPQVSVPAVIRTSADWDPKRVKKKK  116

Query  456   klrskkkALNSVSAAGDVGGNNVNILSNPP--------------------AASSDVWCGP  575
             +  +K K+L S    G  GG ++   ++                       A  DVWCGP
Sbjct  117   QNSNKNKSLTSAVNVG--GGVSIGCSNSLQNNNPSSSSSSSAPLSLSSSCVAVPDVWCGP  174

Query  576   GIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASG  755
             GIG  TDAASV CVVSRR  S RG+++ D   PRERSAC +RRMV PEDNPFLD +++ G
Sbjct  175   GIGLTTDAASVDCVVSRRPVSGRGRIESDKATPRERSACPIRRMVSPEDNPFLDIESSLG  234

Query  756   MTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEE  935
             + RS++++  SRHHR+SR+G+ EGLAE+VMLQ+ LM G ++G DRYR+WRLDVD+MSYEE
Sbjct  235   IPRSQIELFASRHHRHSRHGYSEGLAEIVMLQNSLMGGRTDGLDRYRNWRLDVDNMSYEE  294

Query  936   LLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             LLELGD+IG+V+TGLREDEI R VR+TK P      S    E ER+C++CQ
Sbjct  295   LLELGDKIGYVNTGLREDEIARCVRRTK-PFFLSNLSLIRTELERQCTICQ  344


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHI CIKQWL  KN+CP+CKS A
Sbjct  345   EEYEAEDEMGKLDCGHFYHIRCIKQWLSQKNSCPVCKSAA  384



>ref|XP_002279751.1| PREDICTED: uncharacterized protein LOC100245764 [Vitis vinifera]
Length=371

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 222/339 (65%), Gaps = 26/339 (8%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLA  284
             MPVV   S+   AEH   R   PRSQ    PI + DPNP +   I S+R KS+IS+LLL+
Sbjct  1     MPVVAEGSTV--AEH--IRLRRPRSQ----PIPDTDPNPQIPSIIQSTRCKSSISSLLLS  52

Query  285   PFSP--ASPTHDPPITLTPKKKNFTT--FRGLGCTASSQVSVPAVIRSSADWDssrrvkk  452
              FS   A+       T   +KKNF +  FRGLGC ASSQVSVPAVIR+SADW + +  KK
Sbjct  53    TFSNTNANTNEGSNNTSGGRKKNFASAKFRGLGCAASSQVSVPAVIRTSADWQAKKVRKK  112

Query  453   kklrskkkALNSVSAAGDVGGNNVNILS-NPPAASS-----DVWCGPGIGFATDAASVGC  614
             K+   +++      +    G   VN ++ NPPAAS      DVWC PGIGF+ DAASV C
Sbjct  113   KQRSLQQQQQQQKKS----GNKGVNAVAPNPPAASVECVVPDVWCAPGIGFSADAASVDC  168

Query  615   VVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRH  794
             VV+RR AS RGKVDGD +  RER++C  RR    E   F DSD   GM R   DV G R+
Sbjct  169   VVARRPASGRGKVDGDKINQRERASCPTRRATNSEHISFHDSDPTIGMMRPGSDVFGPRY  228

Query  795   HRYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVS  971
             +R+ R+  PEGLAE+V+ +S  + GG S G DRYRDWRLDVD+MSYEELLELGDRIG+VS
Sbjct  229   YRHVRHRSPEGLAEIVLFESNFLMGGRSNGHDRYRDWRLDVDNMSYEELLELGDRIGYVS  288

Query  972   TGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             TGL+EDEI R +RK+KL +  +LS+H   E + KCS+CQ
Sbjct  289   TGLQEDEIGRCLRKSKLSILDELSAHLPTELDWKCSICQ  327


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+DDEMGKL CGH YHI CIKQWL  KN+CP+CK+TA+
Sbjct  328   EEYEADDEMGKLECGHGYHIDCIKQWLGQKNSCPVCKATAA  368



>ref|XP_009610828.1| PREDICTED: uncharacterized protein LOC104104449 [Nicotiana tomentosiformis]
Length=352

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 219/314 (70%), Gaps = 14/314 (4%)
 Frame = +3

Query  159   NQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHDPPITLTPK  338
             NQ+R T  R+Q   +PI+E DP   +  S+RSKSTI +LL  PFSP +PT    I    K
Sbjct  5     NQTRNTNSRNQKKQKPISETDPMYSINPSTRSKSTIFSLLHTPFSPTNPT--AQIFSKKK  62

Query  339   KKNFTTFRGLGCTA--SSQVSVP-AVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KK FT+FRGLGC A  S QVS+P A+IR+SADW+SS+  KKKK +     LN V     +
Sbjct  63    KKKFTSFRGLGCKAATSQQVSLPSAIIRTSADWESSKVKKKKKNK----TLNFVGGDSSI  118

Query  510   GGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVS-RRTASRRGKVDGDTVRPRERS  686
               NN++  S+  AA +DVWCGPGIG  TDAASV  +VS RR  S RG+ D + + PRERS
Sbjct  119   IDNNLS--SSCLAAPTDVWCGPGIGLTTDAASVDFLVSTRRPLSARGRGDIEKITPRERS  176

Query  687   ACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLME  866
             + + RRM+ PED+PFLD++T   M  SR +  G RHHR+S YGFPEGLAE+VMLQ+ LM 
Sbjct  177   SSSARRMMNPEDDPFLDTETLE-MQSSRANWFGFRHHRHSHYGFPEGLAEIVMLQNSLMG  235

Query  867   GGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSS  1046
             G + G DRYR WRLDVD+MSYEELLELGDRIG+VSTGLR+DEI R VR+TK P      S
Sbjct  236   GRTNGLDRYRSWRLDVDNMSYEELLELGDRIGYVSTGLRQDEITRCVRRTK-PFFLNNLS  294

Query  1047  HFLAETERKCSVCQ  1088
             H   E E+KCS+CQ
Sbjct  295   HLRTEMEKKCSICQ  308


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHIHCIKQWL+HKN+CP+CKS A
Sbjct  309   EEYEAEDEMGKLGCGHFYHIHCIKQWLMHKNSCPVCKSAA  348



>ref|XP_011097006.1| PREDICTED: uncharacterized protein LOC105176030 [Sesamum indicum]
Length=362

 Score =   266 bits (679),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 161/270 (60%), Positives = 194/270 (72%), Gaps = 20/270 (7%)
 Frame = +3

Query  330   TPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkA----LNSV  491
             T KKKNF+  TFRGLGCTASSQVSVPAVIR+SA+W++ +  KK+    K       +N+ 
Sbjct  49    TSKKKNFSSATFRGLGCTASSQVSVPAVIRTSANWEAKKLKKKRLKTKKSGNDKLPMNNN  108

Query  492   SAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAASVGCVVSRRTASRRGK  650
             S+A  +  +N +  S+   A S       DVWCGPG+G  TDAASV CVVSRR    RGK
Sbjct  109   SSAAAISNSNPSPQSSISLALSSSCVGVPDVWCGPGMGLTTDAASVDCVVSRRPP--RGK  166

Query  651   VDGDT---VRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFP  821
             VDG     +  RERS  T+RRMV PEDNPFL+S+TA G+ R R DV GSRHHR+ R+GF 
Sbjct  167   VDGVDRIFLGQRERSY-TVRRMVTPEDNPFLESETALGVPRIRSDVSGSRHHRHVRHGFR  225

Query  822   EGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
             EGLAE+VMLQ+ L+ GG S+G DRYRD RLDVD+MSYEELLELGDRIG+VSTGLREDEI 
Sbjct  226   EGLAEIVMLQNSLLMGGRSDGLDRYRDLRLDVDNMSYEELLELGDRIGYVSTGLREDEIA  285

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
               VR+TKL +   L  HF +E E+KCS+CQ
Sbjct  286   CCVRRTKLAMLDDLPLHFASEMEKKCSICQ  315


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE DDEMGKL CGHFYHI CI+QWL  KN+CPICK+ A
Sbjct  316   EEYELDDEMGKLNCGHFYHIDCIRQWLGQKNSCPICKTAA  355



>emb|CAN83633.1| hypothetical protein VITISV_023360 [Vitis vinifera]
Length=310

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 178/263 (68%), Gaps = 11/263 (4%)
 Frame = +3

Query  321   ITLTPKKKNFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
             + +  +  +  +FRGLGC ASSQVSVPAVIR+SADW + +  KKK+   +++      + 
Sbjct  8     VVVGRRTSHLPSFRGLGCAASSQVSVPAVIRTSADWQAKKVRKKKQRSLQQQQQQQKKS-  66

Query  501   GDVGGNNVNILS-NPPAASS-----DVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGD  662
                G   VN ++ NPPAAS      DVWC PGIGF+ D ASV CVV+RR AS RGKVDGD
Sbjct  67    ---GNKGVNAVAPNPPAASVECVVPDVWCAPGIGFSADXASVDCVVARRPASGRGKVDGD  123

Query  663   TVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVV  842
              +  RER +C  RR    E   F DSD   GM R   DV G R++R+ R+  PEGLAE+V
Sbjct  124   KINQRERXSCPTRRATNSEHISFHDSDPTIGMMRPGSDVFGPRYYRHVRHRSPEGLAEIV  183

Query  843   MLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK  1019
             + +S  + GG S G DRYRDWRLDVD+MSYEELLELGDRIG+VSTGL+EDEI R +RK+K
Sbjct  184   LFESNFLMGGRSNGHDRYRDWRLDVDNMSYEELLELGDRIGYVSTGLQEDEIGRCLRKSK  243

Query  1020  LPLSAKLSSHFLAETERKCSVCQ  1088
             L +  +LS+H   E + KCS+CQ
Sbjct  244   LSILDELSAHLPTELDWKCSICQ  266


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+DDEMGKL CGH YHI CIKQWL  KN+CP+CK+TA+
Sbjct  267   EEYEADDEMGKLECGHGYHIDCIKQWLGQKNSCPVCKATAA  307



>ref|XP_009785230.1| PREDICTED: uncharacterized protein LOC104233526 [Nicotiana sylvestris]
Length=355

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 214/318 (67%), Gaps = 19/318 (6%)
 Frame = +3

Query  159   NQSRYTTPRSQNHSQPIAEADP----NPHLIsssrskstisALLLAPFSPASPTHDPPIT  326
             NQ+R T PR+Q   +PI+E DP    NP   S+  SKSTIS+LL  PFSP SPT      
Sbjct  5     NQTRNTNPRNQKKQKPISETDPMYSINP---STRSSKSTISSLLHTPFSPTSPTAQIFSK  61

Query  327   LTPKKKNFTTFRGLGCTA--SSQVSVP-AVIRSSADWDssrrvkkkklrskkkALNSVSA  497
                 KK  +  +GL C A  S  VS+P A+IR+SADW+SS +VKKKK       LN V  
Sbjct  62    KKKMKKFTSF-KGLSCKAATSQHVSLPSAIIRTSADWESSNKVKKKKKNK---TLNFVGR  117

Query  498   AGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVS-RRTASRRGKVDGDTVRP  674
                +  NN++  S+   A +DVWCGPGIG  TDAASV  +VS RR  S RG+ D +   P
Sbjct  118   DSSIVDNNLS--SSYLTAPTDVWCGPGIGLTTDAASVDFLVSTRRPLSARGRGDIEKSTP  175

Query  675   RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQS  854
             RERS+ ++RRM+ PED+PFLD++T   M  SR +  G RHHR+S YGFPEGLAE+VMLQ+
Sbjct  176   RERSSSSVRRMLSPEDDPFLDTETLE-MQSSRANWFGFRHHRHSHYGFPEGLAEIVMLQN  234

Query  855   RLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSA  1034
              LM G + G DRYR WRLDVD+MSYEELLELGDRIG+VSTGLREDEI R VR+TK PL  
Sbjct  235   SLMGGRTNGLDRYRSWRLDVDNMSYEELLELGDRIGYVSTGLREDEITRCVRRTK-PLFL  293

Query  1035  KLSSHFLAETERKCSVCQ  1088
                SH   E E+KCS+CQ
Sbjct  294   NNLSHLRTEMEKKCSICQ  311


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DEMGKL CGHFYHI CIKQWL+HKN+CP+CKS A
Sbjct  312   EEYEAEDEMGKLGCGHFYHIPCIKQWLMHKNSCPVCKSAA  351



>ref|XP_008461518.1| PREDICTED: uncharacterized protein LOC103500009 isoform X2 [Cucumis 
melo]
Length=375

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 224/340 (66%), Gaps = 24/340 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLA  284
             MPVV      VG EH + R       + +QPI+E+DPNP +   I S+R KSTIS+LLL+
Sbjct  1     MPVVT-----VG-EHMKLRRPRSDLSHLNQPISESDPNPSIPSIIQSTRCKSTISSLLLS  54

Query  285   PFS---PASPTHDPP---ITLTPKKKNFT--TFRGLGCT--ASSQVSVPAVIRSSADWDs  434
              FS    + P    P   IT   KK NF+  T RGLGCT  AS QVSVPAVIR+SADW++
Sbjct  55    TFSNNTTSGPNESLPSSIITTNRKKNNFSSATLRGLGCTTAASQQVSVPAVIRTSADWEN  114

Query  435   srrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVG  611
              +  KKK+  SK K    V  A     N+ ++ S     + DVWCGPGIGF+ DAA SV 
Sbjct  115   KKTRKKKQKSSKNKTQQGVLDASHFQPNS-SMNSASCLDAQDVWCGPGIGFSADAAASVD  173

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSR  791
             CVV+RR AS RGK+D + +  RERS C  RR V PE   FLDSD+     RS +++  +R
Sbjct  174   CVVARRHASGRGKIDLEKINQRERS-CLGRRTVSPETLLFLDSDSDLSTARS-LELSRTR  231

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             ++R+ R+  P+GLAE++M QS L+ GG  +  D++R+ RLDVD+MSYEELLELG+RIGHV
Sbjct  232   YYRHVRHPSPDGLAEIMMFQSSLLMGGRFDLHDQFRELRLDVDNMSYEELLELGERIGHV  291

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             STGL+EDEI R +RK K  +  +L++H L++ +RKCS+CQ
Sbjct  292   STGLKEDEIGRCIRKMKPLVVNELTTHLLSQMDRKCSICQ  331


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+YE+DDEMGKL CGH YHI CIKQWL  KN CP+CK+ A
Sbjct  332   EDYEADDEMGKLECGHSYHIQCIKQWLAQKNTCPVCKTAA  371



>ref|XP_008240226.1| PREDICTED: uncharacterized protein LOC103338758 [Prunus mume]
Length=377

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 208/340 (61%), Gaps = 22/340 (6%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV ++SS   AEHN  ++  PRSQ  SQPI++ADP P +I S+R KSTIS+LLL+   
Sbjct  1     MPVV-TESSTTMAEHN--KWRRPRSQ-FSQPISDADPTPSIIQSTRCKSTISSLLLSS-F  55

Query  294   PASPTHDPPITLTPKKKNFT--TFRGLGC--TASSQVSVPAVIRSSADWD----------  431
               +     P +L  KK NF+  TFRGLGC  +AS QVSVPAVIR+SADW           
Sbjct  56    TTNTNETLPTSLNKKKTNFSSSTFRGLGCAASASQQVSVPAVIRNSADWQGKKVKKKKQK  115

Query  432   ssrrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATD-AASV  608
              +   K      K +  +     G V G +  + S       DVWCGPGIGF+ + A SV
Sbjct  116   KNINTKNNTRNDKNEYKDKTQHQGAVDGPSFGLNSATCMDFQDVWCGPGIGFSAETAGSV  175

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS  788
              CVV+RR  S RGK+DGD +       C  RR V PE   FLDS+     +R   +V G 
Sbjct  176   DCVVARRNVSGRGKIDGDKLSSHRERPCLARRTVSPETVSFLDSEPDFVTSRPESEVFGG  235

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             R +R+ R+  PEGLAE+++ QS L+ GG    DR+RDWRLDVD+MSYEELLELGDRIGHV
Sbjct  236   RCYRHVRHPSPEGLAEIMLFQSSLLMGGR--LDRFRDWRLDVDNMSYEELLELGDRIGHV  293

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             STGL+E EI   +RK KL + + LS H   + +RKC +CQ
Sbjct  294   STGLKEHEISCCLRKIKLSMLSDLSPHSSGQVDRKCIICQ  333


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE  D++G L CGH +H+ CIKQWL  KN CP CK  A
Sbjct  334   EEYEVADDLGSLHCGHNFHLQCIKQWLAQKNTCPFCKVEA  373



>ref|XP_004167533.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216634 
[Cucumis sativus]
Length=375

 Score =   245 bits (626),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 222/340 (65%), Gaps = 24/340 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLA  284
             MPVV      VG EH + R       + +QPI+E+DPNP +   I S+R KSTIS+LLL+
Sbjct  1     MPVVT-----VG-EHMKLRRPRSDLSHLNQPISESDPNPSIPSIIQSTRCKSTISSLLLS  54

Query  285   PFS---PASPTHDPP---ITLTPKKKNFT--TFRGLGCT--ASSQVSVPAVIRSSADWDs  434
              FS    + P    P   IT   KK NF+  T RGLGCT  AS QVSVPAVIR+SADW+ 
Sbjct  55    TFSNNTTSGPNESLPSSIITTNRKKNNFSSATLRGLGCTTAASQQVSVPAVIRTSADWEK  114

Query  435   srrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVG  611
                 +KK+  SK K    +  A     N+ ++ S     + DVWCGPGIGF+ DAA SV 
Sbjct  115   KXDEEKKQKSSKNKTQQGIVDASHFQPNS-SMNSASCLDAQDVWCGPGIGFSADAAASVD  173

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSR  791
             CVV+RR AS RGK+D + +  RERS C  RR V PE   FLDSD+     RS +++  SR
Sbjct  174   CVVARRHASGRGKIDLEKINQRERS-CLGRRTVSPETLLFLDSDSEIPTARS-LELSRSR  231

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             ++R+ R+  P+GLAE++M QS L+ GG  +  D++R+ RLDVD+MSYEELLELG+RIGHV
Sbjct  232   YYRHVRHPSPDGLAEIMMFQSSLLMGGRFDLHDQFRELRLDVDNMSYEELLELGERIGHV  291

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             STGL++DEI R +RK K  +  +L++H L++ +RKCS+CQ
Sbjct  292   STGLKDDEIGRCIRKMKPHVVNELTTHLLSQMDRKCSICQ  331


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+YE DDEMGKL CGH YHIHCIKQWL  KN CP+CK+ A
Sbjct  332   EDYEPDDEMGKLECGHSYHIHCIKQWLAQKNTCPVCKTAA  371



>ref|XP_004137488.1| PREDICTED: uncharacterized protein LOC101216634 [Cucumis sativus]
 gb|KGN64150.1| hypothetical protein Csa_1G042600 [Cucumis sativus]
Length=375

 Score =   245 bits (626),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 223/340 (66%), Gaps = 24/340 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLA  284
             MPVV      VG EH + R       + +QPI+E+DPNP +   I S+R KSTIS+LLL+
Sbjct  1     MPVVT-----VG-EHMKLRRPRSDLSHLNQPISESDPNPSIPSIIQSTRCKSTISSLLLS  54

Query  285   PFS---PASPTHDPP---ITLTPKKKNFT--TFRGLGCT--ASSQVSVPAVIRSSADWDs  434
              FS    + P    P   IT   KK NF+  T RGLGCT  AS QVSVPAVIR+SADW+ 
Sbjct  55    TFSNNTTSGPNESLPSSIITTNRKKNNFSSATLRGLGCTTAASQQVSVPAVIRTSADWEK  114

Query  435   srrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVG  611
              +  KKK+  SK K    +  A     N+ ++ S     + DVWCGPGIGF+ DAA SV 
Sbjct  115   KKTRKKKQKSSKNKTQQGIVDASHFQPNS-SMNSASCLDAQDVWCGPGIGFSADAAASVD  173

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSR  791
             CVV+RR AS RGK+D + +  RERS C  RR V PE   FLDSD+     RS +++  SR
Sbjct  174   CVVARRHASGRGKIDLEKINQRERS-CLGRRTVSPETLLFLDSDSEIPTARS-LELSRSR  231

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             ++R+ R+  P+GLAE++M QS L+ GG  +  D++R+ RLDVD+MSYEELLELG+RIGHV
Sbjct  232   YYRHVRHPSPDGLAEIMMFQSSLLMGGRFDLHDQFRELRLDVDNMSYEELLELGERIGHV  291

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             STGL++DEI R +RK K  +  +L++H L++ +RKCS+CQ
Sbjct  292   STGLKDDEIGRCIRKMKPHVVNELTTHLLSQMDRKCSICQ  331


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+YE DDEMGKL CGH YHIHCIKQWL  KN CP+CK+ A
Sbjct  332   EDYEPDDEMGKLECGHSYHIHCIKQWLAQKNTCPVCKTAA  371



>ref|XP_008461442.1| PREDICTED: uncharacterized protein LOC103500009 isoform X1 [Cucumis 
melo]
Length=376

 Score =   243 bits (619),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 224/341 (66%), Gaps = 25/341 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLA  284
             MPVV      VG EH + R       + +QPI+E+DPNP +   I S+R KSTIS+LLL+
Sbjct  1     MPVVT-----VG-EHMKLRRPRSDLSHLNQPISESDPNPSIPSIIQSTRCKSTISSLLLS  54

Query  285   PFS---PASPTHDPP---ITLTPKKKNFT--TFRGLGCT--ASSQVSVPAVIRSSADWDs  434
              FS    + P    P   IT   KK NF+  T RGLGCT  AS QVSVPAVIR+SADW++
Sbjct  55    TFSNNTTSGPNESLPSSIITTNRKKNNFSSATLRGLGCTTAASQQVSVPAVIRTSADWEN  114

Query  435   srrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVG  611
              +  KKK+  SK K    V  A     N+ ++ S     + DVWCGPGIGF+ DAA SV 
Sbjct  115   KKTRKKKQKSSKNKTQQGVLDASHFQPNS-SMNSASCLDAQDVWCGPGIGFSADAAASVD  173

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSR  791
             CVV+RR AS RGK+D + +  RERS C  RR V PE   FLDSD+     RS +++  +R
Sbjct  174   CVVARRHASGRGKIDLEKINQRERS-CLGRRTVSPETLLFLDSDSDLSTARS-LELSRTR  231

Query  792   HHRYSRYGFPEGLAE-VVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGH  965
             ++R+ R+  P+GLAE ++M QS L+ GG  +  D++R+ RLDVD+MSYEELLELG+RIGH
Sbjct  232   YYRHVRHPSPDGLAEQIMMFQSSLLMGGRFDLHDQFRELRLDVDNMSYEELLELGERIGH  291

Query  966   VSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             VSTGL+EDEI R +RK K  +  +L++H L++ +RKCS+CQ
Sbjct  292   VSTGLKEDEIGRCIRKMKPLVVNELTTHLLSQMDRKCSICQ  332


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+YE+DDEMGKL CGH YHI CIKQWL  KN CP+CK+ A
Sbjct  333   EDYEADDEMGKLECGHSYHIQCIKQWLAQKNTCPVCKTAA  372



>ref|XP_008461578.1| PREDICTED: uncharacterized protein LOC103500009 isoform X3 [Cucumis 
melo]
Length=367

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 213/313 (68%), Gaps = 19/313 (6%)
 Frame = +3

Query  198   SQPIAEADPNPHL---IsssrskstisALLLAPFS---PASPTHDPP---ITLTPKKKNF  350
             +QPI+E+DPNP +   I S+R KSTIS+LLL+ FS    + P    P   IT   KK NF
Sbjct  14    NQPISESDPNPSIPSIIQSTRCKSTISSLLLSTFSNNTTSGPNESLPSSIITTNRKKNNF  73

Query  351   T--TFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGN  518
             +  T RGLGCT  AS QVSVPAVIR+SADW++ +  KKK+  SK K    V  A     N
Sbjct  74    SSATLRGLGCTTAASQQVSVPAVIRTSADWENKKTRKKKQKSSKNKTQQGVLDASHFQPN  133

Query  519   NVNILSNPPAASSDVWCGPGIGFATDAA-SVGCVVSRRTASRRGKVDGDTVRPRERSACT  695
             + ++ S     + DVWCGPGIGF+ DAA SV CVV+RR AS RGK+D + +  RERS C 
Sbjct  134   S-SMNSASCLDAQDVWCGPGIGFSADAAASVDCVVARRHASGRGKIDLEKINQRERS-CL  191

Query  696   LRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAE-VVMLQSRLMEGG  872
              RR V PE   FLDSD+     RS +++  +R++R+ R+  P+GLAE ++M QS L+ GG
Sbjct  192   GRRTVSPETLLFLDSDSDLSTARS-LELSRTRYYRHVRHPSPDGLAEQIMMFQSSLLMGG  250

Query  873   S-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSH  1049
               +  D++R+ RLDVD+MSYEELLELG+RIGHVSTGL+EDEI R +RK K  +  +L++H
Sbjct  251   RFDLHDQFRELRLDVDNMSYEELLELGERIGHVSTGLKEDEIGRCIRKMKPLVVNELTTH  310

Query  1050  FLAETERKCSVCQ  1088
              L++ +RKCS+CQ
Sbjct  311   LLSQMDRKCSICQ  323


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+YE+DDEMGKL CGH YHI CIKQWL  KN CP+CK+ A
Sbjct  324   EDYEADDEMGKLECGHSYHIQCIKQWLAQKNTCPVCKTAA  363



>ref|XP_010264981.1| PREDICTED: uncharacterized protein LOC104602578 [Nelumbo nucifera]
Length=363

 Score =   239 bits (611),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 204/334 (61%), Gaps = 24/334 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrs---kstisALLLA  284
             M VVV+++        Q R+  P++Q    PI   DP P + S+++    K++IS+L L+
Sbjct  1     MVVVVAENPTTA---EQIRFRRPKNQ----PITAPDPTPQISSTNQCTRGKTSISSLFLS  53

Query  285   PFSPASPTH----DPPITLTPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrv  446
              F+  + +     D    L  KKK+FT  TFRGLGCT++SQVS P  IRSSADW + +  
Sbjct  54    TFTSNNNSKKKGSDMSSALKDKKKSFTSATFRGLGCTSTSQVSAPEAIRSSADWQAKKVR  113

Query  447   kkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSR  626
             KKK+  +++K  + V+    +G               DVWC PGIGFA DAA + CVVSR
Sbjct  114   KKKQRNTQRKKSHHVTETTSMGNPTPV------VVVPDVWCSPGIGFAADAAPIDCVVSR  167

Query  627   RTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYS  806
             R  + RG++DG+ +  RER  C  RR    E    LDS     M RS  DV G+RH+R+ 
Sbjct  168   RPVAGRGRIDGERINHRER-PCNARRTAPLEQITVLDSPPTFEM-RSGSDVFGARHYRHF  225

Query  807   RYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLRE  986
             RY  P GL E++M QS L+ G S+  D+YRDWRLDVD+M+YEELLELGDRIG+V+TGLRE
Sbjct  226   RYRSPGGLTEIMMFQSLLLSGRSDVYDQYRDWRLDVDNMTYEELLELGDRIGYVNTGLRE  285

Query  987   DEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             DEI R +RK K      L SH   ET+RKCS+CQ
Sbjct  286   DEIFRCLRKIKHSFMDDLQSHIPTETDRKCSICQ  319


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+DDE+GKL CGH YH+ CIKQWLL KNACP+CK+  S
Sbjct  320   EEYEADDEVGKLDCGHDYHVFCIKQWLLQKNACPVCKAAVS  360



>ref|XP_007209246.1| hypothetical protein PRUPE_ppa007205mg [Prunus persica]
 gb|EMJ10445.1| hypothetical protein PRUPE_ppa007205mg [Prunus persica]
Length=378

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 205/340 (60%), Gaps = 21/340 (6%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVV   S+ V AEH   ++  PRSQ  S PI++ DP P +I S+R KSTIS+LLL+ F+
Sbjct  1     MPVVTESSTTV-AEH--IKWRRPRSQ-FSPPISDTDPTPSIIQSTRCKSTISSLLLSSFT  56

Query  294   PASPTHDPPITLTPKKKNFT--TFRGLGC--TASSQVSVPAVIRSSADWD----------  431
               +    P      KK NF+  TFRGLGC  +AS QVSVPAVIR+SADW           
Sbjct  57    TNTNETLPTSLNNKKKTNFSSSTFRGLGCAASASQQVSVPAVIRNSADWQGKKVKKKKQK  116

Query  432   ssrrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATD-AASV  608
              +   K      K +  +     G V G +  + S       DVWCGPGIGF+ + A SV
Sbjct  117   KNINTKNNTSNDKNEYKDKTQHQGAVDGPSFGLNSATCMDFQDVWCGPGIGFSAETAGSV  176

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS  788
              CVV+RR  S RGK+DGD +       C  RR V PE   FLDS+     +R   +V G 
Sbjct  177   DCVVARRNVSGRGKIDGDKLSSHRERPCLARRTVSPETVSFLDSEPDFVTSRPESEVFGG  236

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             R +R+ R+  PEGLAE+++ QS L+ GG    DR+RDWRLDVD+MSYEELLELGDRIGHV
Sbjct  237   RCYRHVRHPSPEGLAEIMLFQSSLLMGGR--LDRFRDWRLDVDNMSYEELLELGDRIGHV  294

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             STGL+E EI   +RK KL + + LS H L + +RKC +CQ
Sbjct  295   STGLKEHEISCCLRKIKLSMLSDLSPHSLGQVDRKCIICQ  334


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE  D++G L CGH +H+ CIKQWL  KN CP CK  A
Sbjct  335   EEYEVADDLGSLHCGHNFHLQCIKQWLAQKNTCPFCKVEA  374



>ref|XP_010279369.1| PREDICTED: uncharacterized protein LOC104613300 [Nelumbo nucifera]
Length=364

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/334 (47%), Positives = 201/334 (60%), Gaps = 26/334 (8%)
 Frame = +3

Query  120   VVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLLAPF  290
             VVV++++       Q R+  PRS +    I   DP P +     S+R K+TIS+L L+ F
Sbjct  2     VVVAENTTAA---EQIRFRRPRSPS----IIAPDPTPQIPSINQSTRGKTTISSLFLSTF  54

Query  291   SPASPTHDPPITLTP------KKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrv  446
             S  +   +    ++       KKKNFT  TFRGLGCT+S+QVS PAVIRSSADW + +  
Sbjct  55    STNNNNKNKSSDMSSAALKDNKKKNFTSATFRGLGCTSSAQVSAPAVIRSSADWQAKKVR  114

Query  447   kkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSR  626
             KKK    ++K    V+A   +G         P     DVWC PGIGFA DAA + CVVSR
Sbjct  115   KKKHTNPQRKKGQQVTATTTMGN------PTPAVVVPDVWCSPGIGFAADAAPIDCVVSR  168

Query  627   RTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYS  806
             R  + RG+VD + +  RERS C  RR    E    LDS +   M  S  DV G RH+R+ 
Sbjct  169   RPVAGRGRVDAERINHRERS-CNARRAAPFEQITGLDSPSTFEM-HSASDVFGGRHYRHL  226

Query  807   RYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLRE  986
             R+  P GLAE++M QS L+ G SE  D+YRDWRLDVD+M+YEELLELGD+IG+V+TGLRE
Sbjct  227   RHRSPGGLAEIMMFQSLLLGGRSEVYDQYRDWRLDVDNMTYEELLELGDKIGYVNTGLRE  286

Query  987   DEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +EI   +RK K      L SH   ET+ KCS+CQ
Sbjct  287   EEIFHCLRKIKHSFMEDLQSHIPTETDWKCSICQ  320


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEY +DDE+GKL CGH YHI CIKQWLL KNACP+CK+  +
Sbjct  321   EEYVADDEVGKLDCGHSYHIFCIKQWLLQKNACPVCKAAVA  361



>gb|EYU44114.1| hypothetical protein MIMGU_mgv1a008514mg [Erythranthe guttata]
Length=371

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 211/347 (61%), Gaps = 42/347 (12%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPVVV       A   Q R   PR+   +    E DPNP      R+K+TIS++L+    
Sbjct  1     MPVVVVADDPATAAGEQIRCRKPRTPPDN---PETDPNP-----IRTKTTISSILI----  48

Query  294   PASPTHDPPITLTPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrs  467
               S T++     T KKKNFT  TFRGLGC ASSQVSVPAVIR+SA+W+S +  KK+    
Sbjct  49    --SSTNET----TSKKKNFTSATFRGLGCAASSQVSVPAVIRTSANWESKKLKKKRLKTK  102

Query  468   kkkALNSVSAAGDVGGNNVNILSNPPAASS----------DVWCGPGIGFATDAASVGCV  617
                  N +     +  ++ +  +    + +          DVWCGPG+G  TDA+SV CV
Sbjct  103   INTNDNLLLPPPIISSDSSSRDNPSSISMALSSSSCVGVPDVWCGPGLGLVTDASSVDCV  162

Query  618   VSRRTASRRGKVDGD---TVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS  788
             VSRR A  RGKVD      +  RER   ++RRMV PE+NPF++SD+A G+ R R D  GS
Sbjct  163   VSRRPA--RGKVDAADRILLAQRERPYNSVRRMVSPEENPFIESDSAFGINRFRSDFSGS  220

Query  789   RHHRYSRY------GFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLEL  947
             RHH +  +       F  GLAE+VMLQS LM GG S+  DRYRD RLDVD+MSYEELL+L
Sbjct  221   RHHHHRHHHHLRHGAFHGGLAEIVMLQSNLMMGGRSDRLDRYRDLRLDVDNMSYEELLDL  280

Query  948   GDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             GDRIGHVSTGLREDEI   + KTKL +   LS HF  E ERKC++CQ
Sbjct  281   GDRIGHVSTGLREDEITGCLSKTKLAMFEDLSRHFATELERKCTICQ  327


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+ DE GKL CGH YHI+CI+QWL  KN CP+CK+ A
Sbjct  328   EEYEAGDETGKLKCGHSYHIYCIEQWLGRKNTCPVCKTPA  367



>ref|XP_003530938.1| PREDICTED: uncharacterized protein LOC100819907 isoform X1 [Glycine 
max]
Length=377

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 208/336 (62%), Gaps = 37/336 (11%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQ--NHSQPIAEADPNPHL---IsssrskstisALLLAPFSP-ASPTH  311
             AEH   ++  PR+Q  +H  PI+E DPNP +   I S+R KSTIS+LLL+ FS   S  +
Sbjct  12    AEH--IKWRRPRNQFNHHQHPISETDPNPQIPSIIQSTRCKSTISSLLLSTFSNNTSSNN  69

Query  312   DPPITL-----TPKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklr  464
             D P T      + KK NF+  TFRGLGCTA  S QVSVPAVIRSSADW   +  KKK  R
Sbjct  70    DTPTTFNATAHSKKKSNFSASTFRGLGCTAGASQQVSVPAVIRSSADWQGKKTRKKKHKR  129

Query  465   skkkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATDAA---SVGCVVSRRT  632
             S   + N     G + G      SNP      DVWCGPGIGF+TDAA   SV CVV+R+ 
Sbjct  130   SSSSSKNKTFHGGVLEG------SNPECVDFQDVWCGPGIGFSTDAAAAASVDCVVARKN  183

Query  633   -ASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMT-RSRMDVLGS-RHHRY  803
              +S RGK+D D +  RERS+   RR    E   FLDS      T RS  D  G+  ++R+
Sbjct  184   VSSARGKIDVDKITHRERSSYVGRRT---ETFTFLDSTDPDIFTPRSASDSYGTATYYRH  240

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
              R    +G AE++MLQ  L+ GG   S D ++DWRLDVD+MSYE+LLELG+RIGHV+TGL
Sbjct  241   VRDPSSDGFAEIMMLQGSLLMGGQLNSHDHFKDWRLDVDNMSYEQLLELGERIGHVNTGL  300

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +EDE+ R +RKT+L      S H   + +++CS+CQ
Sbjct  301   KEDEMGRNIRKTRLQFWDDTSKH---QVDKECSICQ  333


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ +E+G+L C H YH  CIKQW   KN CP+CK
Sbjct  334   EEYEAGNELGRLNCEHIYHFQCIKQWAAQKNFCPVCK  370



>gb|KHN16504.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=377

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 207/336 (62%), Gaps = 37/336 (11%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQ--NHSQPIAEADPNPHL---IsssrskstisALLLAPFSP-ASPTH  311
             AEH   ++  PR+Q  +H  PI+E DPNP +   I S+R KSTIS+LLL+ FS   S  +
Sbjct  12    AEH--IKWRRPRNQFNHHQHPISETDPNPQIPSIIQSTRCKSTISSLLLSTFSNNTSSNN  69

Query  312   DPPITL-----TPKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklr  464
             D P T      + KK NF+  TFRGLGCTA  S QVSVPAVIRSSADW   +  KKK  R
Sbjct  70    DTPTTFNATAHSKKKSNFSASTFRGLGCTAGASQQVSVPAVIRSSADWQGKKTRKKKHKR  129

Query  465   skkkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATDAA---SVGCVVSRRT  632
             S   + N     G + G      SNP      DVWCGPGIGF+TDAA   SV CVV+R+ 
Sbjct  130   SSSSSKNKTFHGGVLEG------SNPECVDFQDVWCGPGIGFSTDAAAAASVDCVVARKN  183

Query  633   -ASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMT-RSRMDVLGS-RHHRY  803
              +S RGK+D D +  RERS+   RR    E   FLDS      T RS  D  G+  ++R 
Sbjct  184   VSSARGKIDVDKITHRERSSYVGRRT---ETFTFLDSTDPDIFTPRSASDSYGTATYYRN  240

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
              R    +G AE++MLQ  L+ GG   S D ++DWRLDVD+MSYE+LLELG+RIGHV+TGL
Sbjct  241   VRDPSSDGFAEIMMLQGSLLMGGQLNSHDHFKDWRLDVDNMSYEQLLELGERIGHVNTGL  300

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +EDE+ R +RKT+L      S H   + +++CS+CQ
Sbjct  301   KEDEMGRNIRKTRLQFWDDTSKH---QVDKECSICQ  333


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ +E+G+L C H YH  CIKQW   KN CP+CK
Sbjct  334   EEYEAGNELGRLNCEHIYHFQCIKQWAAQKNFCPVCK  370



>emb|CBI15498.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 142/200 (71%), Gaps = 7/200 (4%)
 Frame = +3

Query  510   GGNNVNILS-NPPAASS-----DVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVR  671
             G   VN ++ NPPAAS      DVWC PGIGF+ DAASV CVV+RR AS RGKVDGD + 
Sbjct  32    GNKGVNAVAPNPPAASVECVVPDVWCAPGIGFSADAASVDCVVARRPASGRGKVDGDKIN  91

Query  672   PRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQ  851
              RER++C  RR    E   F DSD   GM R   DV G R++R+ R+  PEGLAE+V+ +
Sbjct  92    QRERASCPTRRATNSEHISFHDSDPTIGMMRPGSDVFGPRYYRHVRHRSPEGLAEIVLFE  151

Query  852   SRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPL  1028
             S  + GG S G DRYRDWRLDVD+MSYEELLELGDRIG+VSTGL+EDEI R +RK+KL +
Sbjct  152   SNFLMGGRSNGHDRYRDWRLDVDNMSYEELLELGDRIGYVSTGLQEDEIGRCLRKSKLSI  211

Query  1029  SAKLSSHFLAETERKCSVCQ  1088
               +LS+H   E + KCS+CQ
Sbjct  212   LDELSAHLPTELDWKCSICQ  231


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+DDEMGKL CGH YHI CIKQWL  KN+CP+CK+TA+
Sbjct  232   EEYEADDEMGKLECGHGYHIDCIKQWLGQKNSCPVCKATAA  272



>ref|XP_008374789.1| PREDICTED: uncharacterized protein LOC103438030 [Malus domestica]
Length=381

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 206/341 (60%), Gaps = 26/341 (8%)
 Frame = +3

Query  126   VSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADP--NPHLIsssrskstisALLLAPFSPA  299
             +++SS  GAEH   ++  PR+Q  +QPI+E DP  +P   +  +S  +   L     S  
Sbjct  3     LTESSTAGAEH--MKWRRPRTQ-FNQPISETDPATSPLQSTRCKSTISSLLLSSFTTSTT  59

Query  300   SPTHDPPITLTPKKK-NF--TTFRGLGC--TASSQVSVPAVIRSSADWDssrrvkkkklr  464
             +     P +LT KKK NF  ++FRGLGC  +AS QVSVP  IR+SADW   +  KKK+ +
Sbjct  60    NNNEALPTSLTIKKKTNFPSSSFRGLGCAASASQQVSVPEEIRNSADWKGKKVKKKKEKK  119

Query  465   skk---kALNSVSAAGDVG--GNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCVVSR  626
             S      A N  +   DVG  G  + I S       DVWCGPGIGF+ + A SV CVV+R
Sbjct  120   SAAAKGSASNEKNEYRDVGDGGPTIGINSATCVDFQDVWCGPGIGFSPETAGSVDCVVAR  179

Query  627   RTASRRGKVDGDTVR-------PRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLG  785
             R  S RGK+ GD  +        RER  C  RR V PE   FLDS+     +R   +V G
Sbjct  180   RNVSGRGKIYGDNNKMSSHMSSHRER-PCFARRNVSPETISFLDSEPDFVSSRPESEVFG  238

Query  786   SRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGH  965
             SR  R+ R+  PEGLAE+++ QS LM GG    DR+RDWRLDVD MSYE+LLELG+RIG+
Sbjct  239   SRCFRHVRHPSPEGLAEIMLFQSSLMMGGR--MDRFRDWRLDVDSMSYEQLLELGERIGN  296

Query  966   VSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             VSTGL+EDEI+  +RK KLP S+  +SH  A+ E KC +CQ
Sbjct  297   VSTGLKEDEINHCLRKIKLPTSSDATSHSSAKVESKCIICQ  337


 Score = 72.0 bits (175),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +H+ C+KQWL  KN CP CK  A
Sbjct  338   EEYEADDEMGKLHCGHNFHLQCVKQWLTQKNTCPFCKVEA  377



>ref|XP_009347527.1| PREDICTED: uncharacterized protein LOC103939191 [Pyrus x bretschneideri]
Length=377

 Score =   225 bits (574),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 215/337 (64%), Gaps = 22/337 (7%)
 Frame = +3

Query  126   VSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASP  305
             +++SS  GAEH   ++  PR+Q  +QPI+E DP    + S+R KSTIS+LLL+ F+ ++ 
Sbjct  3     LTESSTAGAEH--MKWRRPRTQ-FTQPISETDPATSPLQSTRCKSTISSLLLSSFTTSTN  59

Query  306   THDP--PITLTPKKK-NF--TTFRGLGC--TASSQVSVPAVIRSSADWDssrrvkkkklr  464
              ++   P +LT KKK NF  ++FR +GC  +AS QVSVP  IR+SADW   +  KKK+ +
Sbjct  60    NNNEGLPTSLTIKKKTNFPSSSFRSMGCAASASQQVSVPEEIRNSADWKGKKVKKKKEKK  119

Query  465   skk---kALNSVSAAGDVG--GNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCVVSR  626
             S      A N  +   DVG  G  + I S       DVWCGPGIGF+ + A SV CVV+R
Sbjct  120   SAAAKGSASNEKNEYRDVGDGGPTIGINSATCMDFQDVWCGPGIGFSPETAGSVDCVVAR  179

Query  627   RTASRRGKVDGDTVR---PRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHH  797
             R  S RGK+ GD  +    RER  C  RR V PE   FLDS+     +    +V GSR  
Sbjct  180   RNVSGRGKIYGDNNKMSSHRER-PCFARRNVSPETISFLDSEPDFVSSHPESEVFGSRCF  238

Query  798   RYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTG  977
             R+ R+  PEGLAE+++ QS LM GG    DR+RDWRLDVD MSYE+LLELG+RIGHVSTG
Sbjct  239   RHVRHPSPEGLAEIMLFQSSLMMGGR--MDRFRDWRLDVDSMSYEQLLELGERIGHVSTG  296

Query  978   LREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             L+EDEI+  +RK KLP+S+  +SH   + E KC +CQ
Sbjct  297   LKEDEINHCLRKIKLPMSSDAASHSSGKVESKCIICQ  333


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +H+ CIKQWL  KN CP CK  A
Sbjct  334   EEYEADDEMGKLHCGHNFHLQCIKQWLTQKNTCPFCKVEA  373



>ref|XP_009360124.1| PREDICTED: uncharacterized protein LOC103950620 [Pyrus x bretschneideri]
Length=379

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 210/342 (61%), Gaps = 24/342 (7%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrsk---stisALLLA  284
             MP++ ++SS  GAEH   ++  PR+Q   QPI+E DP   L+ S+R K   S++      
Sbjct  1     MPIL-TESSTAGAEH--MKWRRPRTQ-FIQPISETDPATSLLQSTRCKPTISSLLLSSFT  56

Query  285   PFSPASPTHDPPITLTPKKK-NF--TTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvk  449
               +  +     P +LT KKK NF  +TFRGLGC A  S QVSVP VIR+SADW   +  K
Sbjct  57    TTTTTNNNEALPSSLTIKKKTNFPSSTFRGLGCAAAASQQVSVPEVIRNSADWKGKKVKK  116

Query  450   kkklrskk---kALNSVSAAGDVG--GNNVNILSNPPAASSDVWCGPGIGFATD-AASVG  611
             KK+ +S      A N  +   DVG  G    I S       DVWCGPGIGF+ + A SV 
Sbjct  117   KKQKKSAAAKGSASNEKNEYRDVGDGGPTFGINSATRMDFQDVWCGPGIGFSAETAGSVD  176

Query  612   CVVSRRTASRRGKVDGDTVR---PRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVL  782
             CVV+RR  S RGK+D D  +    RER  C+ RR V PE   FLDS+     +R   +V 
Sbjct  177   CVVARRNVSGRGKIDADNNKMSSHRER-PCSARRNVSPETLSFLDSEPDFVSSRRETEVF  235

Query  783   GSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIG  962
             GSR  R+ R+  PE LAE+++ QS LM GG    DR+RDWRLDVD MSYE+LLELG+RIG
Sbjct  236   GSRCFRHVRHPSPEDLAEIMLFQSSLMMGGR--LDRFRDWRLDVDSMSYEQLLELGERIG  293

Query  963   HVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +VSTGL EDEI+R +RKTKLP+S+  SSH   + + KC +CQ
Sbjct  294   YVSTGLTEDEINRCLRKTKLPMSSDASSHSSGKGDSKCIICQ  335


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +H+ CIKQWL  KN CP CK  A
Sbjct  336   EEYEADDEMGKLHCGHNFHLQCIKQWLAQKNTCPFCKVEA  375



>ref|XP_006584888.1| PREDICTED: uncharacterized protein LOC100819907 isoform X2 [Glycine 
max]
Length=383

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 208/342 (61%), Gaps = 43/342 (13%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQ--NHSQPIAEADPNPHL---IsssrskstisALLLAPFSP-ASPTH  311
             AEH   ++  PR+Q  +H  PI+E DPNP +   I S+R KSTIS+LLL+ FS   S  +
Sbjct  12    AEH--IKWRRPRNQFNHHQHPISETDPNPQIPSIIQSTRCKSTISSLLLSTFSNNTSSNN  69

Query  312   DPPITL-----TPKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklr  464
             D P T      + KK NF+  TFRGLGCTA  S QVSVPAVIRSSADW   +  KKK  R
Sbjct  70    DTPTTFNATAHSKKKSNFSASTFRGLGCTAGASQQVSVPAVIRSSADWQGKKTRKKKHKR  129

Query  465   skkkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATDAA---SVGCVVSRRT  632
             S   + N     G + G      SNP      DVWCGPGIGF+TDAA   SV CVV+R+ 
Sbjct  130   SSSSSKNKTFHGGVLEG------SNPECVDFQDVWCGPGIGFSTDAAAAASVDCVVARKN  183

Query  633   -ASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMT-RSRMDVLGS-RHHRY  803
              +S RGK+D D +  RERS+   RR    E   FLDS      T RS  D  G+  ++R+
Sbjct  184   VSSARGKIDVDKITHRERSSYVGRRT---ETFTFLDSTDPDIFTPRSASDSYGTATYYRH  240

Query  804   SRYGFPEGLAEV------VMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIG  962
              R    +G AEV      +MLQ  L+ GG   S D ++DWRLDVD+MSYE+LLELG+RIG
Sbjct  241   VRDPSSDGFAEVASNIHIMMLQGSLLMGGQLNSHDHFKDWRLDVDNMSYEQLLELGERIG  300

Query  963   HVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             HV+TGL+EDE+ R +RKT+L      S H   + +++CS+CQ
Sbjct  301   HVNTGLKEDEMGRNIRKTRLQFWDDTSKH---QVDKECSICQ  339


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ +E+G+L C H YH  CIKQW   KN CP+CK
Sbjct  340   EEYEAGNELGRLNCEHIYHFQCIKQWAAQKNFCPVCK  376



>ref|XP_007160476.1| hypothetical protein PHAVU_002G325200g [Phaseolus vulgaris]
 gb|ESW32470.1| hypothetical protein PHAVU_002G325200g [Phaseolus vulgaris]
Length=375

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 205/333 (62%), Gaps = 34/333 (10%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQ---NHSQPIAEADPNPHL---IsssrskstisALLLAPFSPASPTH  311
             AEH   ++  PR+Q   +H  PI E+DPNP +   I S+R KSTIS+LLL+ FS  + + 
Sbjct  13    AEH--IKWRRPRNQFSHHHHHPILESDPNPQIPSIIQSARGKSTISSLLLSTFSNNTSSS  70

Query  312   D---PPITLT---PKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkkl  461
                 P I  T    KK NF+  T RGLGCTA  S QVSVPAVIRSSADW   +  KKK  
Sbjct  71    SNDTPTINGTAQSKKKSNFSAATLRGLGCTAGASQQVSVPAVIRSSADWQGKKTRKKKHK  130

Query  462   rskkkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATD-AASVGCVVSRRTA  635
             R+     N     G + G      SNP      DVWCGPGIGF+ D AASV CVV+R+  
Sbjct  131   RATSGGKNKTFHGGILEG------SNPGCVDFQDVWCGPGIGFSADTAASVDCVVARKNV  184

Query  636   SRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRY  812
             S RGK+D D +  RERS+   RR    E   FLD+D+     RS  D  G+  ++R+ R 
Sbjct  185   SARGKIDVDKITHRERSSYAGRR---TETYTFLDTDSDIFTPRSASDSYGTATYYRHVRD  241

Query  813   GFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLRED  989
                +G AE++MLQ  L+ GG   S D++RDWRLDVD+MSYE+LLELG+RIGHV+TGL+ED
Sbjct  242   PSSDGFAEIMMLQGSLLMGGQLNSHDQFRDWRLDVDNMSYEQLLELGERIGHVNTGLKED  301

Query  990   EIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E+ R +RK +L +    S H   + +++CS+CQ
Sbjct  302   EMGRNIRKARLQIWDDTSKH---QIDKECSICQ  331


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ DE+G+L C H YH  CIKQWL  KN CP+CK
Sbjct  332   EEYEAGDELGRLNCEHSYHFQCIKQWLSQKNFCPVCK  368



>gb|KHN21637.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=371

 Score =   219 bits (557),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 205/332 (62%), Gaps = 35/332 (11%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQNHSQ------PIAEADPNPHL---IsssrskstisALLLAPFSPAS  302
             AEH   ++  PR+Q +        PI+E DPNP +   I S+R KSTIS+LLL+ FS  +
Sbjct  12    AEH--IKWRRPRNQFNHHHHHHHHPISETDPNPQIPSIIQSTRCKSTISSLLLSTFS--N  67

Query  303   PTHDPPITLTPKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrsk  470
              T +     + KK NF+  TFRGLGCTA  S QVSVPAVIRSSADW   +  KKK  RS 
Sbjct  68    NTSNNATAHSKKKSNFSASTFRGLGCTAGSSQQVSVPAVIRSSADWQGKKTRKKKHKRSN  127

Query  471   kkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATDAA-SVGCVVSRRT-ASR  641
             + + N     G + G      SNP      DVWCGPGIGF+TDAA SV CVV+R+  +S 
Sbjct  128   RSSKNKTFHGGVLEG------SNPGCVDFQDVWCGPGIGFSTDAAASVDCVVARKNVSSA  181

Query  642   RGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMT-RSRMDVLGS-RHHRYSRYG  815
             RGK+D D +  RERS+   RR    E   FLDS      T RS  D  G+  ++R+ R  
Sbjct  182   RGKIDVDKITHRERSSYVGRRT---ETFTFLDSTDPDIFTPRSASDTYGTATYYRHVRDP  238

Query  816   FPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDE  992
               +G AE++MLQ  L+ GG   S D +RDWRLDVD+MSYE+LLELG+RIGHV+TGL+EDE
Sbjct  239   SSDGFAEIMMLQGSLLMGGQLNSHDHFRDWRLDVDNMSYEQLLELGERIGHVNTGLKEDE  298

Query  993   IDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             + R +RKT++      S     + +++CS+CQ
Sbjct  299   MGRNIRKTRIQFWDDTSK---LQVDKECSICQ  327


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ DE+G+L C H YH  CIKQW+  KN CP+CK
Sbjct  328   EEYEAGDELGRLNCEHSYHFQCIKQWVAQKNFCPVCK  364



>ref|XP_011004080.1| PREDICTED: uncharacterized protein LOC105110675 [Populus euphratica]
Length=388

 Score =   219 bits (558),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 203/359 (57%), Gaps = 49/359 (14%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIA-EADPNPHLIsssrskstisALLLAPF  290
             MPV   +SS   A  +Q +   PRSQ+  QPI+ E DPNPH   SS+S + IS+L  +  
Sbjct  1     MPVFAENSSAPAAIADQIKLRKPRSQHELQPISTETDPNPHASKSSKSNTIISSLFHSHS  60

Query  291   SPASPTHDPPITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWD--------ssr  440
             S   P           KK   TFRGLGCTA  + QVSVPAVIRSSADW+           
Sbjct  61    STTPPDQ--------SKKKGATFRGLGCTAGAAQQVSVPAVIRSSADWEGKKVKKKKGHP  112

Query  441   rvkkkklrskkkALNSVSAAGDVGG--NNVNILSNPPAASSDVWCGPGIGFATDAASVG-  611
             + KK+ L+      N+ ++ GDV G  N  N +        DVWCGPG+G +   A VG 
Sbjct  113   KRKKESLKLCSDNNNTSNSNGDVNGDGNFANCM-----VMQDVWCGPGMGLSGADAVVGS  167

Query  612   --CVVSRRTAS-RRGKVDGDTVRPRERSA----------------CTLRRMVI-PEDNPF  731
               CVV+RR  S  RGK+DG     +                    C +RR  + PE   F
Sbjct  168   VDCVVARRNVSIGRGKIDGGEKINQRERERERERERDRERERERPCIVRRAAVNPETLSF  227

Query  732   LDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLD  911
             LD+D A   +R  ++V G+R++R+ R+  P+GLAE++MLQ+  + GG    DR+ +WRLD
Sbjct  228   LDTDPAFITSRPELEVFGTRYYRHMRHPSPDGLAEIMMLQNSFIMGGR--LDRFSNWRLD  285

Query  912   VDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +DHM+YE+LL+LGDRIG+V+TGL+EDEI R V+K       +LSSH     E+KCS+CQ
Sbjct  286   IDHMTYEQLLDLGDRIGYVNTGLKEDEISRCVKKINPSFIKELSSHLPMVLEKKCSICQ  344


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             ++YE D E+GKL CGH +HI CIKQWL  KN CP+CK+
Sbjct  345   DDYEEDGEVGKLDCGHGFHIQCIKQWLGQKNTCPVCKT  382



>ref|XP_004299570.1| PREDICTED: uncharacterized protein LOC101294661 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 214/341 (63%), Gaps = 33/341 (10%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPN-----PHLIsssrskstisALL  278
             MPV+ S+SS    EH   ++  PRSQ   QPI+E DP      P ++ S+R KSTIS+LL
Sbjct  1     MPVL-SESS----EH--MKWRRPRSQ-LIQPISETDPYVPNPAPSILQSTRCKSTISSLL  52

Query  279   LAPFSPASPTHDPPITLTPKKK-NF---TTFRGLGCTASS--QVSVPAVIRSSADWDssr  440
             L+ F+  +       +LT KKK NF     FRGLGCTAS+  QVSVPAVIRSSADW+  +
Sbjct  53    LSSFTTTNEASSSSSSLTNKKKTNFPSSAKFRGLGCTASASQQVSVPAVIRSSADWEGEK  112

Query  441   rvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCV  617
             +VKKKK +   ++     +    G + +N  S       DVWCGPGIGF+ + A SV CV
Sbjct  113   KVKKKKKKKNVRSEYKDKSQNQGGVDGLN--SVACMDFQDVWCGPGIGFSAETAGSVDCV  170

Query  618   VSRRTASRRGKVDGDTVR----PRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLG  785
             V+RR  S RGK+DGD +R     RER     RR V P+   FLDS+    ++R   +V G
Sbjct  171   VARRNVSGRGKIDGDHIRMNSHHRERPYLA-RRTVSPDTISFLDSEPEFLISRPGSEVFG  229

Query  786   SRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGH  965
             SR +R+ R+  PEGLAE++M QS LM GG    DRYR+WRLDVD+M+YE+LLELG+RIG+
Sbjct  230   SRCYRHVRHASPEGLAEIMMFQSSLMMGGRSDMDRYREWRLDVDNMTYEQLLELGERIGY  289

Query  966   VSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             VSTGL ++EI R V+K KL + +  S H       KC +CQ
Sbjct  290   VSTGLTKEEIRRCVQKIKLSMLSDQSQHV------KCIICQ  324


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 4/44 (9%)
 Frame = +3

Query  1338  EEYESDD---EMGKLV-CGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DD   EMGK++ CGH +H  CI+QWL HKN CP CK  A
Sbjct  325   EEYEADDVADEMGKVLNCGHVFHFECIEQWLAHKNTCPFCKVEA  368



>ref|XP_002318535.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE96755.1| zinc finger family protein [Populus trichocarpa]
Length=389

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 201/360 (56%), Gaps = 50/360 (14%)
 Frame = +3

Query  114   MPVVV-SDSSRVGAEHNQSRYTTPRSQNHSQPIA-EADPNPHLIsssrskstisALLLAP  287
             MPV   S SS   A  +Q +   PRSQ   QPI+ E DPNPH   SS+S + IS+L  + 
Sbjct  1     MPVFAESSSSTPAAIADQIKLRKPRSQQELQPISTETDPNPHASKSSKSNTIISSLFHSH  60

Query  288   FSPASPTHDPPITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWD--------ss  437
             FS   P           KK   TFRGLGCTA  + QVSVPAVIRSSADW+          
Sbjct  61    FSTTPPDQ--------SKKKGATFRGLGCTAGAAQQVSVPAVIRSSADWEGKKVKKKKGH  112

Query  438   rrvkkkklrskkkALNSVSAAGDVGG--NNVNILSNPPAASSDVWCGPGIGFATDAASVG  611
              + KK+ L+      N+ ++ GDV G  N  N +        DVWCGPG+G +   A VG
Sbjct  113   PKRKKESLKLCSDNNNTSNSNGDVNGDGNFANCM-----VMQDVWCGPGMGLSGADAVVG  167

Query  612   ---CVVSRRTAS-RRGKVDG----------------DTVRPRERSACTLRRMVI-PEDNP  728
                CVV+RR  S  RGK+DG                          C +RR  + PE   
Sbjct  168   SVDCVVARRNVSIGRGKIDGGEKINQRERERERERERDRERERERPCIVRRAAVNPETLS  227

Query  729   FLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRL  908
             FLD+D A   +R   +V G+R++R+ R+  P+GLAE++MLQ+  + GG    DR+ +WRL
Sbjct  228   FLDTDPAFITSRPEPEVFGTRYYRHIRHPSPDGLAEIMMLQNSFIMGGR--MDRFSNWRL  285

Query  909   DVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             D+DHM+YE+LL+LGDRIG+V+TGL+EDEI R V+K       +LSSH     E+KCS+CQ
Sbjct  286   DIDHMTYEQLLDLGDRIGYVNTGLKEDEISRCVKKINPSFIKELSSHLPMVLEKKCSICQ  345


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             ++YE D E+GKL CGH +HI CIKQWL  KN CP+CK+
Sbjct  346   DDYEEDGEVGKLDCGHGFHIQCIKQWLGQKNTCPVCKT  383



>ref|XP_003525211.2| PREDICTED: uncharacterized protein LOC100788837 [Glycine max]
Length=431

 Score =   218 bits (555),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 205/332 (62%), Gaps = 35/332 (11%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQNHSQ------PIAEADPNPHL---IsssrskstisALLLAPFSPAS  302
             AEH   ++  PR+Q +        PI+E DPNP +   I S+R KSTIS+LLL+ FS  +
Sbjct  72    AEH--IKWRRPRNQFNHHHHHHHHPISETDPNPQIPSIIQSTRCKSTISSLLLSTFS--N  127

Query  303   PTHDPPITLTPKKKNFT--TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrsk  470
              T +     + KK NF+  TFRGLGCTA  S QVSVPAVIRSSADW   +  KKK  RS 
Sbjct  128   NTSNNATAHSKKKSNFSASTFRGLGCTAGSSQQVSVPAVIRSSADWQGKKTRKKKHKRSN  187

Query  471   kkALNSVSAAGDVGGNNVNILSNPPAAS-SDVWCGPGIGFATDAA-SVGCVVSRR-TASR  641
             + + N     G + G      SNP      DVWCGPGIGF+TDAA SV CVV+R+  +S 
Sbjct  188   RSSKNKTFHGGVLEG------SNPGCVDFQDVWCGPGIGFSTDAAASVDCVVARKNVSSA  241

Query  642   RGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMT-RSRMDVLGS-RHHRYSRYG  815
             RGK+D D +  RERS+   RR    E   FLDS      T RS  D  G+  ++R+ R  
Sbjct  242   RGKIDVDKITHRERSSYVGRRT---ETFTFLDSTDPDIFTPRSASDTYGTATYYRHVRDP  298

Query  816   FPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDE  992
               +G AE++MLQ  L+ GG   S D +RDWRLDVD+MSYE+LLELG+RIGHV+TGL+EDE
Sbjct  299   SSDGFAEIMMLQGSLLMGGQLNSHDHFRDWRLDVDNMSYEQLLELGERIGHVNTGLKEDE  358

Query  993   IDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             + R +RKT++      S     + +++CS+CQ
Sbjct  359   MGRNIRKTRIQFWDDTSK---LQVDKECSICQ  387


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE+ DE+G+L C H YH  CIKQW+  KN CP+CK
Sbjct  388   EEYEAGDELGRLNCEHSYHFQCIKQWVAQKNFCPVCK  424



>ref|XP_010110091.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
 gb|EXC25178.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
Length=374

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 206/327 (63%), Gaps = 33/327 (10%)
 Frame = +3

Query  180   PRSQNHSQPIAEADPNPH-------LIsssrskstisALLLAPFSPASPTHDP-PITLTP  335
             PRSQ  ++ I+E DPNP        +I S+R KSTIS+LLL+ FS ++       +    
Sbjct  13    PRSQ-FAELISETDPNPSQTQQIPSIIQSTRGKSTISSLLLSTFSNSNGNETAMAMNSVK  71

Query  336   KKKNFTT--FRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAG  503
             KK NF++  FRG+GC+A  S QVSVPAVIR+SADW+  +  KKK+        ++     
Sbjct  72    KKNNFSSASFRGMGCSAGSSQQVSVPAVIRTSADWEGKKVRKKKQ------KNSNKKNKS  125

Query  504   DVGGNNVNILSNPPAASS-----DVWCGPGIGFATDAA-SVGCVV-SRRTAS--RRGKVD  656
               GG + N L +     +     DVWCGPGIGF+ DAA SV CVV +RR A+   RGK+D
Sbjct  126   KEGGKDRNALLDGGGQQNCVDFQDVWCGPGIGFSADAAASVDCVVATRRNAAGGSRGKID  185

Query  657   GD--TVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGL  830
             G+  T   RERS    RR VIPE  PF D+++     R   +V G+R+ R+ R+  PEGL
Sbjct  186   GEKMTSGHRERSYLA-RRAVIPEPTPFFDTESDFLSERPGSEVFGARYFRHVRHPSPEGL  244

Query  831   AEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             AE++ML + L+ GG  +  DR+RD RLDVD+MSYEELLELG+RIG+V+TGL+EDEI R +
Sbjct  245   AEIMMLHNGLLMGGRVDMHDRFRDMRLDVDNMSYEELLELGERIGYVNTGLKEDEIGRCI  304

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             RK KL + +   S    + +RKCS+CQ
Sbjct  305   RKIKLSIPSDW-SRLSTQADRKCSICQ  330


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DD++GKL CGH +HI CI+ WL HKN CP+CK+ A
Sbjct  331   EEYEADDDIGKLDCGHGFHIECIRHWLAHKNTCPVCKAEA  370



>gb|AGE09562.1| ZNF1-like protein, partial [Eucalyptus cladocalyx]
Length=321

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 200/331 (60%), Gaps = 28/331 (8%)
 Frame = +3

Query  150   AEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHDPPI  323
             +EH + R   PR+Q  N  Q  A+  P+P ++ +    +  S L        SP+   P 
Sbjct  1     SEHTKPR--RPRNQLCNPIQETADRSPSPFVLPNRAKPTISSFL-----HSESPSEHMPT  53

Query  324   TL-TPKKKNFTT--FRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrskkkALNS  488
             T+ + KKK+F +  FRGLGCTAS+  QVSVPAVIR+SADW+  +  KKK+ R        
Sbjct  54    TMNSAKKKHFASSRFRGLGCTASASQQVSVPAVIRASADWEKQKVKKKKQKRGGGGGGGG  113

Query  489   V----SAAGDVGGNNVNILSNPPAA--SSDVWCGPGIGF-ATDAASVGCVVSRRTASRRG  647
                  +   D GG++    ++  +   + D WCGPGIGF A DA  V  VV RR  S RG
Sbjct  114   GGGNPTVVVDGGGSSFGGCNSGSSCVVAEDAWCGPGIGFSAADADCV--VVGRRNMSARG  171

Query  648   KVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMD--VLGSRHHRYSRYGFP  821
              +DGD   PRER  C  RR V PE+   LDSD A G T S ++  V G R +R+ R+  P
Sbjct  172   TIDGDKFGPRERH-CVSRRTVNPEEF-ILDSDPAFGTTHSGLETYVPGPRRYRHIRHPSP  229

Query  822   EGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
             EGLAE++ML + L+ GG  +  DRYR WRLD+D+M+YE+LLELGDRIG+V+TGL+ D+I 
Sbjct  230   EGLAEIMMLHTSLLMGGRLDVLDRYRGWRLDIDNMTYEQLLELGDRIGYVNTGLKGDQIA  289

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQV  1091
               +RK KL     L+ HF A+ +RKCSVCQV
Sbjct  290   HCIRKIKLTNLNDLARHFSAKADRKCSVCQV  320



>gb|KCW83945.1| hypothetical protein EUGRSUZ_B00829 [Eucalyptus grandis]
Length=328

 Score =   212 bits (539),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 203/343 (59%), Gaps = 33/343 (10%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAP  287
             MPV+   S     EH + R   PR+Q  N  Q  A+  P+P ++ +    +  S L    
Sbjct  1     MPVLGESS-----EHTKPR--RPRNQLCNPIQETADRSPSPFVLPNRAKPTISSFL----  49

Query  288   FSPASPTHDPPITL-TPKKKNFTT--FRGLGC--TASSQVSVPAVIRSSADWDssrrvkk  452
                 SP+   P T+ + KKK+F +  FRGLGC  +AS QVSVPAVIR+SADW+  +  KK
Sbjct  50    -HSESPSEHMPTTMNSAKKKHFASSRFRGLGCAASASQQVSVPAVIRASADWEKRKVKKK  108

Query  453   kklrskkkALNSV----SAAGDVGGNNVNILSNPPAA--SSDVWCGPGIGF-ATDAASVG  611
             K+ R             +   D GG++    ++  +   + D WCGPGIGF A DA  V 
Sbjct  109   KQKRGGGGGGGGGGGNPTVVVDGGGSSFGGCNSGSSCVVAEDAWCGPGIGFSAADADCV-  167

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMD--VLG  785
              VV RR  S RG +DGD   PRER  C  RR V PE+   LDSD A G T S ++  V G
Sbjct  168   -VVGRRNMSARGTIDGDKFGPRER-LCVSRRTVNPEEF-ILDSDPAFGTTHSGLETYVPG  224

Query  786   SRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIG  962
              R +R+ R+  PEGLAE++ML + L+ GG  +  DRYR WRLD+D+M+YE+LLELGDRIG
Sbjct  225   PRRYRHIRHPSPEGLAEIMMLHTSLLMGGRLDVLDRYRGWRLDIDNMTYEQLLELGDRIG  284

Query  963   HVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQV  1091
             +V+TGL+ D+I   +RK KL     L+ HF A+ +RKCS+CQV
Sbjct  285   YVNTGLKGDQIAHCIRKIKLTNLNDLARHFSAKADRKCSICQV  327



>ref|XP_007036627.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY21128.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=404

 Score =   212 bits (540),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 177/284 (62%), Gaps = 28/284 (10%)
 Frame = +3

Query  318   PITLTPKKKN---FTTFRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrskkkAL  482
             P T T KK N    +T RGLGCTAS+  QVSVPA+IR+SADW++ +  KKKK + +++  
Sbjct  78    PSTNTKKKANPFSQSTLRGLGCTASASQQVSVPAMIRTSADWEAKKVKKKKKTQQQEQEK  137

Query  483   NSVSA----AGDVGGN---------NVNILSNPPAASS-------DVWCGPGIGFATDA-  599
                      +G + GN            ++ N  + ++       DVWCGPGIGF+ DA 
Sbjct  138   KKKKQKKKKSGKLVGNENSSNKVHHQQGVVLNEGSGNNISCGVIQDVWCGPGIGFSADAV  197

Query  600   ASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDV  779
              SV CVV+RR    RGK+D + V  RERS C  RR V PE   FLDSD+A        D 
Sbjct  198   GSVDCVVARRNVPARGKIDVEKVNHRERS-CIARRTVNPETLSFLDSDSALISAHPEPDF  256

Query  780   LGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDR  956
              G+R++R+ R+  PEGLAE++MLQ+ L+ GG  +  DR+ DWRLD+D MSYE+LLELGD+
Sbjct  257   FGARYYRHVRHPSPEGLAEIMMLQNNLLMGGRLDSHDRFSDWRLDIDSMSYEQLLELGDK  316

Query  957   IGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             IG+V+TGL+EDEI R +RK K  +  +L  +     ++KCS+CQ
Sbjct  317   IGYVNTGLKEDEISRCLRKIKGSIMNELPPNLHTHVDKKCSICQ  360


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+D+EMGKL CGH +HI CIKQWL+ KN CP+CK+ A+
Sbjct  361   EEYEADEEMGKLYCGHSFHIQCIKQWLVQKNTCPVCKTEAA  401



>ref|XP_007036626.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY21127.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=430

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 177/284 (62%), Gaps = 28/284 (10%)
 Frame = +3

Query  318   PITLTPKKKN---FTTFRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrskkkAL  482
             P T T KK N    +T RGLGCTAS+  QVSVPA+IR+SADW++ +  KKKK + +++  
Sbjct  78    PSTNTKKKANPFSQSTLRGLGCTASASQQVSVPAMIRTSADWEAKKVKKKKKTQQQEQEK  137

Query  483   NSVSA----AGDVGGN---------NVNILSNPPAASS-------DVWCGPGIGFATDAA  602
                      +G + GN            ++ N  + ++       DVWCGPGIGF+ DA 
Sbjct  138   KKKKQKKKKSGKLVGNENSSNKVHHQQGVVLNEGSGNNISCGVIQDVWCGPGIGFSADAV  197

Query  603   -SVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDV  779
              SV CVV+RR    RGK+D + V  RERS C  RR V PE   FLDSD+A        D 
Sbjct  198   GSVDCVVARRNVPARGKIDVEKVNHRERS-CIARRTVNPETLSFLDSDSALISAHPEPDF  256

Query  780   LGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDR  956
              G+R++R+ R+  PEGLAE++MLQ+ L+ GG  +  DR+ DWRLD+D MSYE+LLELGD+
Sbjct  257   FGARYYRHVRHPSPEGLAEIMMLQNNLLMGGRLDSHDRFSDWRLDIDSMSYEQLLELGDK  316

Query  957   IGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             IG+V+TGL+EDEI R +RK K  +  +L  +     ++KCS+CQ
Sbjct  317   IGYVNTGLKEDEISRCLRKIKGSIMNELPPNLHTHVDKKCSICQ  360


 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPI  1442
             EEYE+D+EMGKL CGH +HI CIKQWL+ KN CP+
Sbjct  361   EEYEADEEMGKLYCGHSFHIQCIKQWLVQKNTCPV  395



>ref|XP_010032336.1| PREDICTED: uncharacterized protein LOC104421887 [Eucalyptus grandis]
 gb|KCW83944.1| hypothetical protein EUGRSUZ_B00829 [Eucalyptus grandis]
Length=370

 Score =   210 bits (535),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 202/342 (59%), Gaps = 33/342 (10%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAP  287
             MPV+   S     EH + R   PR+Q  N  Q  A+  P+P ++ +    +  S L    
Sbjct  1     MPVLGESS-----EHTKPR--RPRNQLCNPIQETADRSPSPFVLPNRAKPTISSFL----  49

Query  288   FSPASPTHDPPITL-TPKKKNFTT--FRGLGC--TASSQVSVPAVIRSSADWDssrrvkk  452
                 SP+   P T+ + KKK+F +  FRGLGC  +AS QVSVPAVIR+SADW+  +  KK
Sbjct  50    -HSESPSEHMPTTMNSAKKKHFASSRFRGLGCAASASQQVSVPAVIRASADWEKRKVKKK  108

Query  453   kklrskkkALNSV----SAAGDVGGNNVNILSNPPAA--SSDVWCGPGIGF-ATDAASVG  611
             K+ R             +   D GG++    ++  +   + D WCGPGIGF A DA  V 
Sbjct  109   KQKRGGGGGGGGGGGNPTVVVDGGGSSFGGCNSGSSCVVAEDAWCGPGIGFSAADADCV-  167

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMD--VLG  785
              VV RR  S RG +DGD   PRER  C  RR V PE+   LDSD A G T S ++  V G
Sbjct  168   -VVGRRNMSARGTIDGDKFGPRER-LCVSRRTVNPEEF-ILDSDPAFGTTHSGLETYVPG  224

Query  786   SRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIG  962
              R +R+ R+  PEGLAE++ML + L+ GG  +  DRYR WRLD+D+M+YE+LLELGDRIG
Sbjct  225   PRRYRHIRHPSPEGLAEIMMLHTSLLMGGRLDVLDRYRGWRLDIDNMTYEQLLELGDRIG  284

Query  963   HVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +V+TGL+ D+I   +RK KL     L+ HF A+ +RKCS+CQ
Sbjct  285   YVNTGLKGDQIAHCIRKIKLTNLNDLARHFSAKADRKCSICQ  326


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EE+E  DE+GKL CGH YH+ CIK WL  KN+CP+CKS A
Sbjct  327   EEFEVGDELGKLNCGHGYHMECIKHWLGQKNSCPVCKSEA  366



>gb|KDP35178.1| hypothetical protein JCGZ_10712 [Jatropha curcas]
Length=396

 Score =   207 bits (526),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 154/351 (44%), Positives = 201/351 (57%), Gaps = 53/351 (15%)
 Frame = +3

Query  138   SRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHDP  317
             SR    HNQ +   P        + E DP PH+  S  SKSTIS+L L+PFS  +     
Sbjct  23    SRNHFYHNQQQGEIP------TILTETDPTPHI--SRSSKSTISSLFLSPFSTNTTETTS  74

Query  318   PITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSV  491
                 TP       FRGLGCTA  + QVSVPAVIRSSA+W+  R  KKK  + +K+   S+
Sbjct  75    KKKTTP-------FRGLGCTAGAAQQVSVPAVIRSSAEWEGKRVKKKKSQQQQKRKKESI  127

Query  492   ----------------------SAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDA--  599
                                   + + D G  + N  S       DVWCGPGIGF+ DA  
Sbjct  128   RVFSESNNNNGEGNSSNNNNGGNVSSDNGNGSFN--SGSCMVIQDVWCGPGIGFSADAVV  185

Query  600   ASVGCVVSRR-TASRRGKVDGDTVRP------RERSACTLRRMVI-PEDNPFLDSDTASG  755
              SV CVV+RR  AS RGK+DG+ +        RER+ C  RR  + PE   FLD+D A  
Sbjct  186   GSVDCVVARRNNASGRGKIDGEKINQRERERERERAFCLGRRATVNPETLSFLDTDPAFV  245

Query  756   MTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEE  935
              +R   +V GSR++R+ R+  P+GLAE+++LQ+  M GG    DR+ +WRLD+D MSYE+
Sbjct  246   SSRPEPEVFGSRYYRHVRHPSPDGLAEIMLLQNSFMMGGR--VDRFHEWRLDIDDMSYEQ  303

Query  936   LLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             LLELGDRIG+VSTGL++DEI R VRK KL +  +LSS      ++KCS+CQ
Sbjct  304   LLELGDRIGYVSTGLKDDEIGRCVRKIKLSIINELSSQLPLIPDKKCSICQ  354


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             E+YE DDE+GKL CGH +HI CIKQWL  K  CP+CK+
Sbjct  355   EDYELDDELGKLDCGHGFHIQCIKQWLAQKKMCPVCKT  392



>ref|XP_002524891.1| ring finger containing protein, putative [Ricinus communis]
 gb|EEF37515.1| ring finger containing protein, putative [Ricinus communis]
Length=411

 Score =   206 bits (523),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 203/381 (53%), Gaps = 70/381 (18%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQ----PIA----EADPNPHLIsssrskstis  269
             M V    +S       Q +   PR+Q H Q    PI+    E DPNP +  S  SKSTIS
Sbjct  1     MSVFTETNSSTSTIAEQIKLRRPRNQFHHQQQEMPISTTETETDPNPQM--SRSSKSTIS  58

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWDssrr  443
             +L L+PFS    T          KK  T FRGLGCTA  + QVSVPAVIRSSA+W+  R 
Sbjct  59    SLFLSPFSTEPTT----------KKKGTAFRGLGCTAGAAQQVSVPAVIRSSAEWEGKRV  108

Query  444   vkkkklrskkkALNSVSAAGDVGGNNVNIL-------------------------SNPPA  548
              KKK  + +++      +      N + I                          S    
Sbjct  109   KKKKNQQHQRQQKMKKESIQICSENMLQINVGDHSISNTDNSNNNNNSNGIGSFNSGNCM  168

Query  549   ASSDVWCGPGIGFATDA--ASVGCVVSRR--------TASRRGKVDGDTV----------  668
                DVWCGPGIGF+ DA   SV CVV+ R        ++  RGK D D +          
Sbjct  169   VMQDVWCGPGIGFSADAVVGSVDCVVAARRINNNNYASSGSRGKNDVDKIIQRERERERE  228

Query  669   RPRERSACTLRRMVI-PEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVM  845
             R RER++C  RR  + PE   FLDSD A   +R   +V GSR++R+ R+  P+GLAE++M
Sbjct  229   RERERASCLGRRAAVNPETFSFLDSDPAFITSRPEPEVFGSRYYRHVRHPSPDGLAEMMM  288

Query  846   LQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLP  1025
             LQ+  M GG    DRY DWRLD+DHMSYE+LLELG+RIG+VSTGL+EDEI R VRK K  
Sbjct  289   LQNSFMMGGR--FDRYSDWRLDIDHMSYEQLLELGERIGYVSTGLKEDEIGRCVRKIKPS  346

Query  1026  LSAKLSSHFLAETERKCSVCQ  1088
             +   LSS      ++KCS+CQ
Sbjct  347   IYNDLSSRLPMILDKKCSICQ  367


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EE+ESDDE+GKL CGH +HI CIKQWL  KN CP+CK
Sbjct  368   EEFESDDELGKLDCGHGFHIQCIKQWLTQKNTCPVCK  404



>gb|AET05501.2| C3HC4-type RING zinc finger protein [Medicago truncatula]
Length=354

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 178/332 (54%), Gaps = 36/332 (11%)
 Frame = +3

Query  126   VSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAPFSPA  299
             V+  ++   +H + R   PR+Q  N ++PI+E DPN   I      +   + + +     
Sbjct  4     VTQETKTEQQHMKWR-KPPRNQINNKNKPISETDPNTKQIQPIIQSTRSKSTISSLLLSN  62

Query  300   SPTHDPPITLTPKKKNFT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkkl  461
               T   PI    KK NF+    TFRGLGCTA  S QVSVPAVIR+SADW           
Sbjct  63    ETTSQQPIN---KKINFSSAAATFRGLGCTAGASQQVSVPAVIRASADWPHQ--------  111

Query  462   rskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVGCVVSRRTAS  638
                       +       +N    S+      DVWCGPGIGF+ DAA SV CVVS++  S
Sbjct  112   -------GKKTRKKKHKNSNDGSSSSSCVDFQDVWCGPGIGFSADAAASVDCVVSKKNVS  164

Query  639   RRGKVDGDTVRPRERSACTLRRM-VIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYG  815
              R K+D D +  RE S+   RR  V PE   F D+D       S       RH R     
Sbjct  165   SRAKIDVDKITHREPSSSFRRRTAVYPETFSFPDTDPDIFTACSFGTATYPRHIRDLS--  222

Query  816   FPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDE  992
               +  +E++ LQ R++ GG   S D YRDWRLDVD+MSYE+LLEL +RIG+V+TGL+EDE
Sbjct  223   -SDDFSEIMALQGRILMGGRFNSRDLYRDWRLDVDNMSYEQLLELSERIGYVNTGLKEDE  281

Query  993   IDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             I+ Y+RKTKL  S   S H   + ++KCS+CQ
Sbjct  282   IEPYIRKTKLQFSDDASKH---QVDKKCSICQ  310


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EE+E+DDE+G+L C H YH  CI+QW+ HKN CP+CK
Sbjct  311   EEFEADDELGRLNCDHLYHFQCIQQWVAHKNFCPVCK  347



>gb|AFK43751.1| unknown [Medicago truncatula]
Length=354

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 178/332 (54%), Gaps = 36/332 (11%)
 Frame = +3

Query  126   VSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAPFSPA  299
             V+  ++   +H + R   PR+Q  N ++PI+E DPN   I      +   + + +     
Sbjct  4     VTQETKTEQQHMKWR-KPPRNQINNKNKPISETDPNTKQIQPIIQSTRSKSTISSLLLSN  62

Query  300   SPTHDPPITLTPKKKNFT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkkl  461
               T   PI    KK NF+    TFRGLGCTA  S QVSVPAVIR+SADW           
Sbjct  63    ETTSQQPIN---KKINFSSAAATFRGLGCTAGASQQVSVPAVIRASADWPHQ--------  111

Query  462   rskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCVVSRRTAS  638
                       +       +N    S+      DVWCGPGIGF+ D AASV CVVS++  S
Sbjct  112   -------GKKTRKKKHKNSNDGSSSSSCVDFQDVWCGPGIGFSADTAASVDCVVSKKNVS  164

Query  639   RRGKVDGDTVRPRERSACTLRRM-VIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYG  815
              R K+D D +  RE S+   RR  V PE   F D+D       S       RH R     
Sbjct  165   SRAKIDVDKITHREPSSSFRRRTAVYPETFSFPDTDPDIFTACSFGTATYPRHIRDLS--  222

Query  816   FPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDE  992
               +  +E++ LQ R++ GG   S D YRDWRLDVD+MSYE+LLEL +RIG+V+TGL+EDE
Sbjct  223   -SDDFSEIMALQGRILMGGRFNSRDLYRDWRLDVDNMSYEQLLELSERIGYVNTGLKEDE  281

Query  993   IDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             I+ Y+RKTKL  S   S H   + ++KCS+CQ
Sbjct  282   IEPYIRKTKLQFSDDASKH---QVDKKCSICQ  310


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EE+E+DDE+G+L C H YH  CI+QW+ HKN CP+CK
Sbjct  311   EEFEADDELGRLNCDHLYHFQCIQQWVAHKNFCPVCK  347



>gb|KHN23749.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=367

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 159/255 (62%), Gaps = 21/255 (8%)
 Frame = +3

Query  354   TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGD----VGG  515
             TFRG GCTA  S +VSVPAVIRSSADW+  R  KK   R      NS +   D     GG
Sbjct  80    TFRGFGCTAGSSQKVSVPAVIRSSADWEGKRNRKKNHRRKSNSNGNSGNNTCDDDDVSGG  139

Query  516   NNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVD--GDTVRPRERSA  689
               V+          DV CGPGIGF+TDAASV C V+R+  S RGK+D   + V  RERS+
Sbjct  140   TFVDF--------QDVSCGPGIGFSTDAASVECAVARKNVSSRGKLDVVEERVTHRERSS  191

Query  690   CTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRYGFPEGLAEVVMLQSRLME  866
                RR V PE   FLD +      R  ++  G+ R +R+  +  P+GLAE+++++ R+M 
Sbjct  192   YFGRRTVKPESFSFLDDEPDIFAARPGLEPFGTARFYRHVPHPSPDGLAEIMIIRGRIMM  251

Query  867   GGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLS  1043
             GG   S D++RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE+   +RK K   S   S
Sbjct  252   GGRFNSHDQFRDWRLDVDNMSYEQLLELGERIGYVNTGLKEDEMGLNIRKVKPSSSNDTS  311

Query  1044  SHFLAETERKCSVCQ  1088
              H L   ++KCSVCQ
Sbjct  312   KHQL---DKKCSVCQ  323


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYESDDE+G+L C H YH  CIK WL HKN CP+CK 
Sbjct  324   EEYESDDELGRLKCDHSYHFQCIKHWLEHKNFCPVCKQ  361



>ref|XP_006442579.1| hypothetical protein CICLE_v10020624mg [Citrus clementina]
 gb|ESR55819.1| hypothetical protein CICLE_v10020624mg [Citrus clementina]
Length=378

 Score =   188 bits (477),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 133/297 (45%), Positives = 171/297 (58%), Gaps = 44/297 (15%)
 Frame = +3

Query  327   LTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
             LTPKKK   TFRG GCTA  S QVS+PAVIRSSADWD+ +  KKK   S KK+ +S S  
Sbjct  39    LTPKKKLNNTFRGFGCTAAASQQVSLPAVIRSSADWDAKKVKKKKHKNSSKKSSSSNSNC  98

Query  501   GDVGGNNVNILSNPP-----------------AASSDVWCGPGIGFATDAASVG---CVV  620
              +  G+N N ++                      + DVWCGPGIGF+   A VG   CVV
Sbjct  99    NNDYGSNNNHINISSSSSSNNNNNPNNSLSSCGVAQDVWCGPGIGFSASDAVVGSVDCVV  158

Query  621   S--RRTASRRGKVDGD------------------TVRPRERSACTLRRMVIPEDNPFLDS  740
             +  R     RGK+D                      R R+R  C  RR +  E  PF D 
Sbjct  159   TTRRNVVPGRGKIDNHHQRERERERERDRDRDRERERERDRERCLARRTMNSE-FPFPDF  217

Query  741   DTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVD  917
             D+   + R  +DV G R++R+ R+  P+GLAE++MLQ+ L+ GG  +  D + DWRLDVD
Sbjct  218   DSPFALARPELDVFGPRYYRHVRHPSPDGLAEMMMLQNSLLMGGRVDSHDHFSDWRLDVD  277

Query  918   HMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +MSYEELLELGDRIG+VSTGL+EDEI R +RK K  +   LSSH     ++KC++CQ
Sbjct  278   NMSYEELLELGDRIGYVSTGLKEDEIGRCLRKLKNSIINDLSSHLPLHVDKKCTICQ  334


 Score = 73.9 bits (180),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +HI CIKQWL  KNACP+CK+  
Sbjct  335   EEYEADDEMGKLDCGHSFHIQCIKQWLSQKNACPVCKAAV  374



>gb|KDO49792.1| hypothetical protein CISIN_1g016946mg [Citrus sinensis]
Length=380

 Score =   187 bits (476),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 173/298 (58%), Gaps = 45/298 (15%)
 Frame = +3

Query  327   LTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
             LTPKKK   TFRG GCTA  S QVS+PAVIRSSADWD+ +  KKK   S KK+ +S S  
Sbjct  40    LTPKKKLNNTFRGFGCTAAASQQVSLPAVIRSSADWDAKKVKKKKHKNSSKKSSSSNSNC  99

Query  501   GDVGGNNVNILSNPP-----------------AASSDVWCGPGIGF-ATDA--ASVGCVV  620
              +  G+N N ++                      + DVWCGPGIGF A+DA   SV CVV
Sbjct  100   NNDYGSNNNHINISSSSSSNNNNNPNNSLSSCGVAQDVWCGPGIGFSASDAVVGSVDCVV  159

Query  621   S--RRTASRRGKVDGD-------------------TVRPRERSACTLRRMVIPEDNPFLD  737
             +  R     RGK+D                       R R+R  C  RR +  E  PF D
Sbjct  160   TTRRNVVPGRGKIDNHHQRERERERKKRDRDRDRERERERDRERCLARRTMNSE-FPFPD  218

Query  738   SDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDV  914
              D+   + R  +DV G R++R+ R+  P+GLAE++MLQ+ L+ GG  +  D + DWRLDV
Sbjct  219   FDSPFALARPELDVFGPRYYRHVRHPSPDGLAEMMMLQNSLLMGGRVDSHDHFSDWRLDV  278

Query  915   DHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             D+MSYEELLELGDRIG+VSTGL+EDEI R +RK K  +   LSSH     ++KC++CQ
Sbjct  279   DNMSYEELLELGDRIGYVSTGLKEDEIGRCLRKLKNSIINDLSSHLPLHVDKKCTICQ  336


 Score = 73.9 bits (180),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +HI CIKQWL  KNACP+CK+  
Sbjct  337   EEYEADDEMGKLDCGHSFHIQCIKQWLSQKNACPVCKAAV  376



>ref|XP_002321493.2| hypothetical protein POPTR_0015s03970g [Populus trichocarpa]
 gb|EEF05620.2| hypothetical protein POPTR_0015s03970g [Populus trichocarpa]
Length=378

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 188/356 (53%), Gaps = 53/356 (15%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIA-EADPNPHLIsssrskstisALLLAPF  290
             MPV    S+   A+         R     QPIA E DPNPH+  +S+S + IS+L  + F
Sbjct  1     MPVFAESSNTTIADQ-----IKLRKHRELQPIATETDPNPHISRTSKSNTIISSLFHSHF  55

Query  291   SPASPTHDPPITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWD-----------  431
             +   P           KK   TFRGLGCTA  + QVSVPAVIRSSA W+           
Sbjct  56    TATPPDQ--------TKKKGATFRGLGCTAGAAQQVSVPAVIRSSAGWEGKRVKKKKGHQ  107

Query  432   ----ssrrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGF----  587
                  S ++      +   +      +GD    N  ++        DVWCGPGIGF    
Sbjct  108   KRKKESLKLSSDNNNNSNNSNGDGDLSGDGNLGNCMVMQ-------DVWCGPGIGFSGAD  160

Query  588   ATDAASVGCVVSRRTASRRGKVD-GDTVRPRERSA-------CTLRRMVI-PEDNPFLDS  740
             A   +    VV R  +S RGK+D G+    RER         C  RR  + PE   FLD+
Sbjct  161   AVVGSVDCVVVRRNASSGRGKIDEGEKFNQRERERGRERERPCLSRRAAVNPETPSFLDT  220

Query  741   DTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDH  920
             D A   +R  ++V G+R++R+ R+  P+GLA ++MLQ+  + GG    DR+ +WRLD+DH
Sbjct  221   DPAFVTSRPEIEVFGTRYYRHIRHPSPDGLARMMMLQNSFIMGGR--LDRFSNWRLDIDH  278

Query  921   MSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             M+YE+LL+LGDRIG+V+TGL+EDEI   V+K    +  +L SH     E+KCS+CQ
Sbjct  279   MTYEQLLDLGDRIGYVNTGLKEDEISSCVKKINPSIIEELPSHLHMTLEKKCSICQ  334


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +E+E  DE+GKL CGH +HI CIK+WL  KN CP+CK+
Sbjct  335   DEFEEADELGKLDCGHGFHIQCIKKWLAQKNTCPVCKT  372



>gb|KHG07597.1| E3 ubiquitin ligase BIG BROTHER -like protein [Gossypium arboreum]
Length=361

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 185/331 (56%), Gaps = 52/331 (16%)
 Frame = +3

Query  213   EADPNP-----HLIsssrskstisALLLAPFSPASPTHDPPITLTPKKKNFTTFRGLGCT  377
             E DP+P      LI S+RSKSTIS+L L+  +  +     P + +         RGLGCT
Sbjct  41    ETDPDPVSEIPSLIQSTRSKSTISSLFLSSNNDTTKKKTNPFSQS-------ALRGLGCT  93

Query  378   ASS--QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGD----------VGGNN  521
             AS+  QVSVPA+IR+SADW++ +  KKKK + +++                    V GN 
Sbjct  94    ASTSQQVSVPAMIRTSADWETKKVKKKKKTQQQQQQQQQEQEKKKKKKKKKSSKLVVGNE  153

Query  522   VN-------------ILSNPPAASS-------DVWCGPGIGFATDA-ASVGCVVSRRTAS  638
              N             +L N  +  +       DVWCGPGIGF+ DA  SV  V +RR   
Sbjct  154   SNNSHKVHHHHHQQGVLLNEGSGYNISCGVIQDVWCGPGIGFSADAVGSVDRVATRRNVP  213

Query  639   RRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGF  818
              RGK+D       E+ +   RR V  E   FLDSD+A   +R   D  GSR++R++R+  
Sbjct  214   ARGKID------VEKPSYIARRTVNSETLSFLDSDSAFISSRPEPDFFGSRYYRHARHPS  267

Query  819   PEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             PEGLAE++MLQ+  + GG   S DR+ DWRLD+D MSYE+LLELG++IGHV+TGL+EDEI
Sbjct  268   PEGLAEIMMLQNNFLVGGRLDSRDRFSDWRLDIDSMSYEQLLELGEKIGHVNTGLKEDEI  327

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
              R +RK K  +   L        +RKCS+CQ
Sbjct  328   SRCLRKMKGSVMNDLPVSVNMNVDRKCSICQ  358



>gb|KHN44580.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=354

 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 158/255 (62%), Gaps = 30/255 (12%)
 Frame = +3

Query  354   TFRGLGCTA--SSQVSVP--AVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNN  521
             TFRG GCTA  S +VSVP  AVIRSSAD +     KKK  R      NS S      GN 
Sbjct  76    TFRGFGCTAGASQKVSVPVPAVIRSSADREGKSSRKKKHRR------NSNS------GN-  122

Query  522   VNILSNPPAASSDVWCGPGIGFATD--AASVGCVVSRRTASRRGKVD--GDTVRPRERSA  689
                 S       DVWCGPGIGF+TD  AASV CVV+R+  S RGK+D   D V  RERS+
Sbjct  123   ----STSDDDDDDVWCGPGIGFSTDAAAASVECVVARKNVSARGKLDVVEDRVTHRERSS  178

Query  690   CTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRYGFPEGLAEVVMLQSRLME  866
                RR V PE   FL+ +      R  ++  G+ R +R+  +  P+GLAE+++LQ R+M 
Sbjct  179   YFGRRTVKPESFSFLEDEPDIFAARPGLEPFGTARFYRHVPHPSPDGLAEIMILQGRIMM  238

Query  867   GGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLS  1043
             GG  +  D++RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE+   +RK K   S   S
Sbjct  239   GGRFDSHDQFRDWRLDVDNMSYEQLLELGERIGYVNTGLKEDEMGLNIRKVKPSSSNDAS  298

Query  1044  SHFLAETERKCSVCQ  1088
              H L   ++KCSVCQ
Sbjct  299   KHQL---DKKCSVCQ  310


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+G+L C H YH  CIK WL HKN CP+CK
Sbjct  311   EEYESDDELGRLKCDHSYHFQCIKHWLEHKNFCPVCK  347



>ref|XP_010537465.1| PREDICTED: E3 ubiquitin-protein ligase MBR1 [Tarenaya hassleriana]
Length=393

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 138/358 (39%), Positives = 190/358 (53%), Gaps = 55/358 (15%)
 Frame = +3

Query  129   SDSSRVGAEHNQSRYTTPRSQNHSQPI-----AEADPNPHLIsssrs----kstisALLL  281
             S SS+   EH + R    ++  H +PI     A+A P  H++ ++        +  +L L
Sbjct  8     SSSSKTIGEHIKLRRPRNQTSRHIRPICSTVAADAPPLTHVVPTAAQPTRLCKSAMSLFL  67

Query  282   APFSPAS---PTHDPPITLTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWDssrrv  446
              P +  +   PT   PI  +       +FRGLGCTA  S QVSVPAVIRSSA+W   ++ 
Sbjct  68    VPTTSNNTSLPTRKKPIGFS----QAASFRGLGCTAAASQQVSVPAVIRSSAEWGEEKKA  123

Query  447   kkkklrskkkALNSVSAAGDVGGNNVNILSN---------PPAASSDVWCGPGIGFATDA  599
             K K+ ++  K  N     G     ++ ILS             A  DVWCGPGIGF+TDA
Sbjct  124   KDKRKKNSNKKKNGGGFNG----GSIKILSESRGGGVDGGGCVAIPDVWCGPGIGFSTDA  179

Query  600   ASVGCV------VSRRTASRRGKVDGD--------TVRPRERSACTLRRMVIPEDNPFLD  737
                G V       SRR    R K+DGD            RE S+   RR    E  PF D
Sbjct  180   VVGGSVDPVVSGPSRRNLPARRKIDGDRSNSSSNNNYNHRESSSVLPRRSPNQEFPPFWD  239

Query  738   SDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDV  914
             SD     +R    +  +R HR+ R+ + EGLAE++MLQ+  + GG  +  D +RD RLDV
Sbjct  240   SDPTFVTSRPEPTLFPNRQHRHFRHPYAEGLAEIMMLQNGFVMGGVFDSHDHFRDLRLDV  299

Query  915   DHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             D+MSYE+LLELGDRIG+V+TGL+E+EI+R +RK K  +S         + ++KCS+CQ
Sbjct  300   DNMSYEQLLELGDRIGYVNTGLKEEEINRCLRKIKPSIS---------DADKKCSICQ  348


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV*L  1472
             EEY  D+E GKL CGH +H+ C+KQWL  KNACP+CK+ A+ V L
Sbjct  349   EEYGIDEETGKLNCGHSFHVECVKQWLSRKNACPVCKTEANPVDL  393



>ref|XP_010428313.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 184/353 (52%), Gaps = 51/353 (14%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPV    SS    +H   R   PR+  + QP       P L     S++  S  LL    
Sbjct  1     MPVSAEASSTTIGQH--IRLQRPRNHRNLQPTTSTADEPLLPKPPSSRAMSSFFLL----  54

Query  294   PASPTHDPPITLTPKKKNFT---TFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkk  458
                PT +   T   K   FT   +FR LGCT  AS QVSVPAVIRSSADWD+      K 
Sbjct  55    ---PTTNE--TTRKKPNGFTQTSSFRALGCTTSASQQVSVPAVIRSSADWDAPNSSNHKI  109

Query  459   lrskkkALNSVSAAGDVGGNNVNILSNPP-------AASSDVWCGPGIGFATDAASVGCV  617
              +  K    +  ++   GG ++ ILS          AA  DVWCGPG+GF+TDA   G V
Sbjct  110   KKKTKNKNKNKVSSSYNGGGSIKILSESTNSSGVGCAAIPDVWCGPGVGFSTDAVVSGSV  169

Query  618   VS------RRTASRRGKVDGDT-----VRPRERSACTLRRMVIPEDNPFLDSDTASGMTR  764
              +      RR    R K+DGD       + RE S+   RR +  E NP+ DSD+    +R
Sbjct  170   ETVESDPPRRNIPVRRKIDGDNKTSHNQQQREGSSLFPRRSLNQESNPYFDSDSTFLTSR  229

Query  765   SRMDVLGSRHHRYSRY-GFPEGLAEVVMLQSRLMEGGSEGSD-RYRDWRLDVDHMSYEEL  938
             +       R+HR+ R   +P+GLAE++MLQ+  + GG   SD R+RD RL+VD+M+YE+L
Sbjct  230   AEQ---SDRYHRHLRQPYYPDGLAEMMMLQNGFVMGGVVSSDDRFRDLRLNVDNMTYEQL  286

Query  939   LELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
             LELGDRIG+V+TGL E +I   +RK K          F  +T   +RKC +CQ
Sbjct  287   LELGDRIGYVNTGLSEKQIKSCLRKVK---------PFRLDTPVEDRKCIICQ  330


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +HIHC+KQWL+ KN+CP+CK+
Sbjct  331   DEYEVKDEVGKLKCGHRFHIHCVKQWLVRKNSCPVCKT  368



>ref|XP_003530039.1| PREDICTED: uncharacterized protein LOC100807785 [Glycine max]
Length=354

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 157/255 (62%), Gaps = 30/255 (12%)
 Frame = +3

Query  354   TFRGLGCTA--SSQVSVP--AVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNN  521
             TFRG GCTA  S +VSVP  AVIRSSAD +     KKK  R      NS S      GN 
Sbjct  76    TFRGFGCTAGASQKVSVPVPAVIRSSADREGKSSRKKKHRR------NSNS------GN-  122

Query  522   VNILSNPPAASSDVWCGPGIGFATD--AASVGCVVSRRTASRRGKVD--GDTVRPRERSA  689
                 S       DVWCGPGIGF+TD  AASV CVV+R+  S RGK+D   D V  RERS+
Sbjct  123   ----STSDDDDDDVWCGPGIGFSTDAAAASVECVVARKNVSARGKLDVVEDRVTHRERSS  178

Query  690   CTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRYGFPEGLAEVVMLQSRLME  866
                RR V PE   FL+ +      R  ++  G+ R +R+  +  P+GLAE+++LQ R+M 
Sbjct  179   YFGRRTVKPESFSFLEDEPDIFAARPGLEPFGTARFYRHVPHPSPDGLAEIMILQGRIMM  238

Query  867   GGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLS  1043
             GG  +  D++RDWRLDVD+MSYE+LLELG+RIG+ +TGL+EDE+   +RK K   S   S
Sbjct  239   GGRFDSHDQFRDWRLDVDNMSYEQLLELGERIGYANTGLKEDEMGLNIRKVKPSSSNDAS  298

Query  1044  SHFLAETERKCSVCQ  1088
              H L   ++KCSVCQ
Sbjct  299   KHQL---DKKCSVCQ  310


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+G+L C H YH  CIKQWL+HKN CP+CK
Sbjct  311   EEYESDDELGRLKCDHSYHFQCIKQWLVHKNFCPVCK  347



>ref|NP_177517.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAG52076.1|AC012679_14 putative RING zinc finger protein; 69105-67310 [Arabidopsis thaliana]
 gb|AEE35505.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=367

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 162/276 (59%), Gaps = 37/276 (13%)
 Frame = +3

Query  330   TPKKKNFT-TFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
             T KK N T +FRGLGCT  AS QVSVPAVIRSSADWD+S    KK         N    +
Sbjct  62    TKKKPNGTASFRGLGCTTSASQQVSVPAVIRSSADWDASNFKIKKTK-----KKNKNKGS  116

Query  501   GDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDA---ASVGCVVS---RRTASR  641
                 G ++ ILS    +SS       DVWCGPG+GF+TDA    S+  VVS   RR    
Sbjct  117   SSYNGGSIKILSEASTSSSVACAAIPDVWCGPGVGFSTDAVVGGSIDTVVSDPPRRNIPV  176

Query  642   RGKVDGDTVRP-----RERSACTL-RRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRY  803
             R K+DGD         RE S+  L RR +  E NP+ DSD++   +R+       R+HR+
Sbjct  177   RRKIDGDKTNSNSNNHREGSSSLLPRRSLNQESNPYFDSDSSFLTSRAEQT---DRYHRH  233

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
              R  +P+GLAE++M+Q+  + GG   S D++RD RL+VD+M+YE+LLELG+RIGHV+TGL
Sbjct  234   LRLPYPDGLAEMMMMQNGFVMGGVLSSFDQFRDMRLNVDNMTYEQLLELGERIGHVNTGL  293

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
              E +I   +RK K P     +       +RKC +CQ
Sbjct  294   TEKQIKSCLRKVK-PCRQDTTV-----ADRKCIICQ  323


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE+ DE+G+L CGH +HI C+ QWL+ KN+CP+CK+ A
Sbjct  324   DEYEAKDEVGELRCGHRFHIDCVNQWLVRKNSCPVCKTMA  363



>ref|XP_006390510.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
 ref|XP_006390511.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
 gb|ESQ27796.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
 gb|ESQ27797.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
Length=326

 Score =   176 bits (447),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 161/275 (59%), Gaps = 33/275 (12%)
 Frame = +3

Query  330   TPKKKNFTTFRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAG  503
             T +KK  ++FRGLGCTAS+  QVSVPAVIRSSADWD++    KK  +SKK    S S+  
Sbjct  60    TNRKKPNSSFRGLGCTASASQQVSVPAVIRSSADWDATNFKTKKTKKSKKTKSKSKSS--  117

Query  504   DVGGNNVNILSNPP---------AASSDVWCGPGIGFATDAASVGCVVS------RRTAS  638
                G +V ILS            AA  DVWCGPG+GF+TDA   G + S      RR   
Sbjct  118   -FNGGSVKILSEADRIVGGGTACAAIPDVWCGPGVGFSTDAVVGGTIESVETDPPRRNIP  176

Query  639   RRGKVDGDTVRP----RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYS  806
              R K+DGD        RE S+   RR +  E NP+ DSDT      SR +    R+HR+ 
Sbjct  177   ARRKIDGDKTNNNSNLREGSSLLPRRSLNQEPNPYFDSDT--NFLTSRAEQFSDRYHRHL  234

Query  807   RYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLR  983
             R  +P+GL+EV+MLQ+  + GG   S D +RD RL+VD M+YE+LLELGDRIG+V+TGL 
Sbjct  235   RQPYPDGLSEVMMLQNGFVMGGVISSYDHFRDLRLNVDDMTYEQLLELGDRIGYVNTGLT  294

Query  984   EDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E +    +RK K P         LA  +RKC +CQ
Sbjct  295   EKQSKSCLRKVK-PFRKNTP---LA--DRKCVICQ  323



>ref|XP_010667794.1| PREDICTED: uncharacterized protein LOC104884795 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 194/335 (58%), Gaps = 25/335 (7%)
 Frame = +3

Query  114   MPVVVSDSSR-VGAEHNQSRYTTPRSQNHSQPIAEADPNPHL---IsssrskstisALLL  281
             M  +VSD+S     EH   ++  PR ++ S+P    DPNP +   I S+R KSTIS+LLL
Sbjct  1     MAALVSDTSNSTIGEH--LKWRKPR-KHQSRP---TDPNPEMSSIIQSTRCKSTISSLLL  54

Query  282   APFSPASPTHDPPITLTPKKK-NFTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkk  458
             + F+    T +      PKK    +T RG GCTA  +V+VPAVIRSSADW+ +   +KKK
Sbjct  55    STFTNHENTRNKNY---PKKTLKSSTLRGFGCTAQPRVTVPAVIRSSADWEENEMKQKKK  111

Query  459   lrskkkALNSVSAAGDVGGNNVNIL--SNPPAASSDVWCGPGIGFATDAASVGCVVSRRT  632
              ++   + ++             I+  S       D+WCG     A+ AASV CV    +
Sbjct  112   NKNGGNSNSTKKKKKKSQQLQSVIMEESFGSVGVQDLWCGD----ASAAASVDCVRPVVS  167

Query  633   ASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRY  812
                RGK+D D +  RER A T R+ V  E       D+A  +     DV  +R++ + R 
Sbjct  168   GG-RGKIDLDKLHHRER-ASTSRQRVNAEHFAAPGLDSAFEIPSFGPDVFEARYYHHLRN  225

Query  813   GFPEGLAEVVMLQSRLMEG-GSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLRED  989
               PEGLAE+++ Q+ L+ G  S G DRY+DWRLDVD+M+YEELLELGDRIG+VSTGL +D
Sbjct  226   RSPEGLAEIILFQNGLLTGRRSGGHDRYQDWRLDVDNMTYEELLELGDRIGNVSTGLGDD  285

Query  990   EIDRYVRKTKLPLSAKL--SSHFLAETERKCSVCQ  1088
             +I R +RKTKL +  +L   +H   E E KCS+CQ
Sbjct  286   QIGRCLRKTKLSVLNELRAQAHISVEMEGKCSICQ  320


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  1365  GKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             GKL CGH YH+HCIKQWL+ KNACP+CK+ AS
Sbjct  330   GKLECGHGYHLHCIKQWLVRKNACPVCKAEAS  361



>ref|XP_006300512.1| hypothetical protein CARUB_v10020494mg [Capsella rubella]
 gb|EOA33410.1| hypothetical protein CARUB_v10020494mg [Capsella rubella]
Length=370

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 187/353 (53%), Gaps = 55/353 (16%)
 Frame = +3

Query  114   MPVVV---SDSSRVGAEHNQSRYTTPRSQNHSQPIAEAD----PNPHLIsssrskstisA  272
             MPV     S SS    +H   R   PR+  +  PI+ AD    P P  +S S       +
Sbjct  1     MPVSAEPYSSSSTTIGQH--IRLQRPRNPRNPHPISTADEPLLPKPSRVSKSAMS----S  54

Query  273   LLLAPFSPASPTHDPPITLTPKKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrv  446
               L P  PAS       T T K     +FRGLGCT  AS QVSVPAVIRSSADWD+S   
Sbjct  55    FFLLP--PASSND----TTTRKPTQTASFRGLGCTTSASQQVSVPAVIRSSADWDASDYK  108

Query  447   kkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAAS  605
              KK         +  + AG     +V IL+   ++S+       DVWCGPG+GF+TDA  
Sbjct  109   TKKT------KKDKKNKAGRYNAGSVRILTETSSSSNIGCSAIPDVWCGPGVGFSTDAVV  162

Query  606   VGCVVS------RRTASRRGKVDGDTVR-----PRERSACTLRRMVIPEDNPFLDSDTAS  752
              G + +      RR    R K+DGD         RE S+   RR +  E NP+ DS +  
Sbjct  163   GGSIDTVESDPPRRNIPVRRKIDGDKTNSSYNNQREGSSLLPRRSLNQESNPYFDSHSTF  222

Query  753   GMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSY  929
               +R+       R+HR+    +P+GLAE++M+Q+ ++ GG   S D +RD RL+VD+M+Y
Sbjct  223   LTSRAER---SERYHRHLLQPYPDGLAEMMMMQNGVVMGGVVSSNDHFRDLRLNVDNMTY  279

Query  930   EELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E+LLELGDRIGHV+TGL E +I   +RK K P   +  + F    +RKC +CQ
Sbjct  280   EQLLELGDRIGHVNTGLNEKQIKSCLRKVK-PF--RFDTPF---EDRKCIICQ  326


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEYE+ DE+GKL CGH +HI C+KQWL  KN+CPICK+T
Sbjct  327   EEYEAKDEVGKLGCGHRFHIQCVKQWLARKNSCPICKTT  365



>ref|XP_006390512.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
 gb|ESQ27798.1| hypothetical protein EUTSA_v10018747mg [Eutrema salsugineum]
Length=367

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 157/275 (57%), Gaps = 33/275 (12%)
 Frame = +3

Query  330   TPKKKNFTTFRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAG  503
             T +KK  ++FRGLGCTAS+  QVSVPAVIRSSADWD++    KK  +S         +  
Sbjct  60    TNRKKPNSSFRGLGCTASASQQVSVPAVIRSSADWDATNFKTKKTKKS---KKTKSKSKS  116

Query  504   DVGGNNVNILSNPP---------AASSDVWCGPGIGFATDAASVGCVVS------RRTAS  638
                G +V ILS            AA  DVWCGPG+GF+TDA   G + S      RR   
Sbjct  117   SFNGGSVKILSEADRIVGGGTACAAIPDVWCGPGVGFSTDAVVGGTIESVETDPPRRNIP  176

Query  639   RRGKVDGDTVRP----RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYS  806
              R K+DGD        RE S+   RR +  E NP+ DSDT      SR +    R+HR+ 
Sbjct  177   ARRKIDGDKTNNNSNLREGSSLLPRRSLNQEPNPYFDSDT--NFLTSRAEQFSDRYHRHL  234

Query  807   RYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLR  983
             R  +P+GL+EV+MLQ+  + GG   S D +RD RL+VD M+YE+LLELGDRIG+V+TGL 
Sbjct  235   RQPYPDGLSEVMMLQNGFVMGGVISSYDHFRDLRLNVDDMTYEQLLELGDRIGYVNTGLT  294

Query  984   EDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E +    +RK K P         LA  +RKC +CQ
Sbjct  295   EKQSKSCLRKVK-PFRKNTP---LA--DRKCVICQ  323


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE  DE+GKL CGH +HIHC+KQWL  KN+CP+CK+
Sbjct  324   EEYEVKDEVGKLRCGHRFHIHCVKQWLSRKNSCPVCKT  361



>ref|XP_010428312.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   174 bits (441),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 184/355 (52%), Gaps = 53/355 (15%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPV    SS    +H   R   PR+  + QP       P L     S++  S  LL    
Sbjct  1     MPVSAEASSTTIGQH--IRLQRPRNHRNLQPTTSTADEPLLPKPPSSRAMSSFFLL----  54

Query  294   PASPTHDPPITLTPKKKNFT---TFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkk  458
                PT +   T   K   FT   +FR LGCT  AS QVSVPAVIRSSADWD+      K 
Sbjct  55    ---PTTNE--TTRKKPNGFTQTSSFRALGCTTSASQQVSVPAVIRSSADWDAPNSSNHKI  109

Query  459   lrskkkALNSVSAAGDVGGNNVNILSNPP-------AASSDVWCGPGIGFATDAASVGCV  617
              +  K    +  ++   GG ++ ILS          AA  DVWCGPG+GF+TDA   G V
Sbjct  110   KKKTKNKNKNKVSSSYNGGGSIKILSESTNSSGVGCAAIPDVWCGPGVGFSTDAVVSGSV  169

Query  618   VS------RRTASRRGKVDGDT-----VRPRERSACTLRRMVIPEDNPFLDSDTASGMTR  764
              +      RR    R K+DGD       + RE S+   RR +  E NP+ DSD+    +R
Sbjct  170   ETVESDPPRRNIPVRRKIDGDNKTSHNQQQREGSSLFPRRSLNQESNPYFDSDSTFLTSR  229

Query  765   SRMDVLGSRHHRYSRY-GFPEGLAEV--VMLQSRLMEGGSEGSD-RYRDWRLDVDHMSYE  932
             +       R+HR+ R   +P+GLAE+  +MLQ+  + GG   SD R+RD RL+VD+M+YE
Sbjct  230   AEQ---SDRYHRHLRQPYYPDGLAELQMMMLQNGFVMGGVVSSDDRFRDLRLNVDNMTYE  286

Query  933   ELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
             +LLELGDRIG+V+TGL E +I   +RK K          F  +T   +RKC +CQ
Sbjct  287   QLLELGDRIGYVNTGLSEKQIKSCLRKVK---------PFRLDTPVEDRKCIICQ  332


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +HIHC+KQWL+ KN+CP+CK+
Sbjct  333   DEYEVKDEVGKLKCGHRFHIHCVKQWLVRKNSCPVCKT  370



>ref|XP_010471444.1| PREDICTED: uncharacterized protein LOC104751232 isoform X2 [Camelina 
sativa]
Length=377

 Score =   174 bits (441),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 136/353 (39%), Positives = 185/353 (52%), Gaps = 48/353 (14%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEAD----PNPHLIsssrskstisALLL  281
             MPV    SS    +H   +   PR+  + QP + AD    P P      +S  +   LL 
Sbjct  1     MPVSAEASSTTIGQH--IKLQRPRNHRNLQPTSTADEPLLPKPPSSRVCKSAMSSFFLLP  58

Query  282   APFSPASPTHDPPITLTPKKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkk  455
                +    T   P   T       +FR LGCT  AS QVSVPAVIRSSADWD++    K 
Sbjct  59    TTTTTNETTRKKPNGFT----QTASFRALGCTTSASQQVSVPAVIRSSADWDANSSNHKI  114

Query  456   klrskkkALNSVSAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAASVGC  614
             K   KK      S+    GG ++ ILS   ++S+       DVWCGPG+GF+TDA   G 
Sbjct  115   KKTKKKNKNKGNSSYN--GGGSIKILSESTSSSNVGCAAIPDVWCGPGVGFSTDAVVSGS  172

Query  615   VVS------RRTASRRGKVDGDTV----RPRERSACTLRRMVIPEDNPFLDSDTASGMTR  764
             V +      RR    R K+DGD      + RE S+   RR +  E NP+ DSD+    +R
Sbjct  173   VETVESDPPRRNIPVRRKIDGDNKTSHNQQREGSSLLPRRSLNQESNPYFDSDSTFLTSR  232

Query  765   SRMDVLGSRHHRYSRY-GFPEGLAEVVMLQSRLMEGGSEG-SDRYRDWRLDVDHMSYEEL  938
             +       R+HR+ R   +P+GLAE++MLQ+  + GG    +DR+RD RL+VD+M+YE+L
Sbjct  233   AEQ---SDRYHRHLRQPYYPDGLAEMMMLQNGFVMGGVVSLNDRFRDLRLNVDNMTYEQL  289

Query  939   LELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
             LELGDRIG+V+ GL E +I   +RK K          F  +T   +RKC +CQ
Sbjct  290   LELGDRIGYVNNGLNEKQIKSCLRKVK---------PFRLDTPVEDRKCIICQ  333


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +H HC+KQWL+ KN+CP+CK+
Sbjct  334   DEYEVKDEVGKLKCGHRFHTHCVKQWLVRKNSCPVCKT  371



>ref|XP_004512886.1| PREDICTED: uncharacterized protein LOC101488257 [Cicer arietinum]
Length=372

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 158/262 (60%), Gaps = 30/262 (11%)
 Frame = +3

Query  357   FRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNVNI  530
             FRGLGCT   S QVSVPAVI SS DW   +  KKK  R+    +N              +
Sbjct  79    FRGLGCTTGTSHQVSVPAVISSSEDWQGKKNRKKKHRRNSNSKINKTCHG---------V  129

Query  531   LSNPPAASS------------DVWCGPGIGFATDAASVG--CVVSRRTASRRGKVDGDTV  668
             + + P  SS            DVWCGPGIGF++DA+SV   CVV+R+  S RGK+DG+ +
Sbjct  130   VDDVPFQSSSSFGATTCVDFQDVWCGPGIGFSSDASSVSVDCVVARKNLSSRGKLDGERI  189

Query  669   RPRERSACTLRRMVIPEDNPFLDSDTASGMTRSR-MDVLGS-RHHRYSRYGFPEGLAEVV  842
               RERS+   RR V PE+  FLD D +        ++  G+ R  R++ +   +GLAE++
Sbjct  190   THRERSSYFGRRSVNPENLSFLDDDDSDVFLAQHGLESFGNGRFFRHASHNSSDGLAEIM  249

Query  843   MLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             ++Q RLM G     D++RDWRLDVD+MSYE+LLELG+RIG+V TGL+EDE+   +RK KL
Sbjct  250   IIQGRLMGGRFNSRDQFRDWRLDVDNMSYEQLLELGERIGYVKTGLKEDEMRHNIRKIKL  309

Query  1023  PLSAKLSSHFLAETERKCSVCQ  1088
              +S   S     + ++KCS+CQ
Sbjct  310   LISNDTSKQ---QIDKKCSICQ  328


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE DDE+G+L C H YH HCIKQWL+ KN CP+CK   +
Sbjct  329   EEYELDDELGRLNCEHSYHFHCIKQWLVLKNFCPVCKQEVA  369



>ref|XP_010416197.1| PREDICTED: uncharacterized protein LOC104702079 isoform X2 [Camelina 
sativa]
Length=376

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 195/359 (54%), Gaps = 61/359 (17%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEAD----PNPHLIsssrskstisALLL  281
             MPV    SS    +H   +   PR+  + QP + AD    P P   SS   KS +S+  L
Sbjct  1     MPVSAEPSSTTIGQH--IKLQRPRNHRNLQPTSTADEPLLPKP---SSRVCKSAMSSFFL  55

Query  282   APFSPASPTHDPPITLTPKKKN-FT---TFRGLGCT--ASSQVSVPAVIRSSADWDssrr  443
              P +  +         T KK N FT   +FR LGCT  AS  VSVPAVIRSSADWD++  
Sbjct  56    LPTTNET---------TRKKPNGFTQTASFRALGCTTSASQHVSVPAVIRSSADWDANSS  106

Query  444   vkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAA  602
               K K   KKK  N  +++ + GG ++ ILS    +SS       DVWCGPG+GF+TDA 
Sbjct  107   NHKIKKTKKKKNKNKGNSSYN-GGGSIKILSESTNSSSVGCAAIPDVWCGPGVGFSTDAV  165

Query  603   SVGCVVS------RRTASRRGKVDGDT------VRPRERSACTLRRMVIPEDNPFLDSDT  746
               G V +      RR    R K+DGD       ++ RE S+    R +  E NP+ DSD+
Sbjct  166   VSGSVETVESDPPRRNIPVRRKIDGDNKTSHNQLQQREVSSLLPIRSLNQESNPYFDSDS  225

Query  747   ASGMTRSRMDVLGSRHHRYSRY-GFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDH  920
                 +R+       R+HR+ R   +P+GLAE++MLQ+  + GG   S DR+RD RL+VD+
Sbjct  226   TFLTSRAEQ---SDRYHRHLRQPYYPDGLAEMMMLQNGFVMGGVVSSYDRFRDLRLNVDN  282

Query  921   MSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
             M+YE+LLELGDRIG+V TGL E +I   +RK K          F  +T   +RKC +CQ
Sbjct  283   MTYEQLLELGDRIGYVKTGLNEKQIKSCLRKVK---------PFRLDTPVEDRKCIICQ  332


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +HIHC+KQWL+ KN+CP+CK+
Sbjct  333   DEYEVKDEVGKLKCGHRFHIHCVKQWLVRKNSCPVCKT  370



>ref|XP_004503317.1| PREDICTED: uncharacterized protein LOC101510167 isoform X1 [Cicer 
arietinum]
Length=327

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/319 (40%), Positives = 179/319 (56%), Gaps = 56/319 (18%)
 Frame = +3

Query  168   RYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHDPPITLTPKKKN  347
             ++  PR   +++P++E D  P ++ S+R KSTIS+LLL+ FS  +         T KK N
Sbjct  9     KWRRPR---NNKPVSETDTRP-ILQSTRCKSTISSLLLSTFSNET---------TNKKTN  55

Query  348   FT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             F+    TFRGLGC+A  S QVSVPAVIR+SADW+                          
Sbjct  56    FSAAAATFRGLGCSAGASEQVSVPAVIRASADWEM-----------------KKKKKKTK  98

Query  510   GGNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCVVSRR----TASRRGKVDGDTVRP  674
                      N      DVWC PGIGF+ D AASV CVVS+R    +++ R K+D   +  
Sbjct  99    KKKQKRKSKNDGVDFQDVWCAPGIGFSPDVAASVDCVVSKRNVNVSSTSRPKIDLHKITH  158

Query  675   RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHH-RYSRYGFPEGLAEVVMLQ  851
              + S+   RR V PE   F D+D       S    LG+  H R+ R    +  +E+++LQ
Sbjct  159   TQPSSSFRRRTVYPETFSFPDTDPDIFTACS----LGTAAHPRHIRDPSSDDFSEIMVLQ  214

Query  852   SRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLS  1031
               ++ GG    D +RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE++ Y+ KTKL +S
Sbjct  215   GSILMGGRR--DLFRDWRLDVDNMSYEQLLELGERIGNVNTGLKEDEMEPYITKTKLQIS  272

Query  1032  AKLSSHFLAETERKCSVCQ  1088
              ++        ++KCS+CQ
Sbjct  273   DQV--------DKKCSICQ  283


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE DD++G+L C H YH  CI+QW+ HKN CP+CK
Sbjct  284   EEYEVDDKLGRLNCDHLYHFQCIQQWVAHKNFCPVCK  320



>gb|AES76636.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=360

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 157/256 (61%), Gaps = 33/256 (13%)
 Frame = +3

Query  351   TTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNV  524
             +TFR LGCTA  S QVSVPAVIRSSADW   +  KKK  R+K             G ++V
Sbjct  84    STFRSLGCTAGTSQQVSVPAVIRSSADWQGKKNRKKKNRRNKTCH----------GVDDV  133

Query  525   NILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRGKVD-GDTVRPRERSAC  692
             +          DVWCGPG GF +DAA   SV CVV+R+  S RGK+D G+ +  RERS+ 
Sbjct  134   DF--------QDVWCGPGTGFLSDAAADVSVDCVVARKNVSSRGKLDNGERIPHRERSSI  185

Query  693   TLRRMVI--PEDNPFLDSDTASGMTRSRMDVLG-SRHHRYSRYGFPEGLAEVVMLQ-SRL  860
               RR V    E   FL+ ++    TR  ++  G S  +R +     +G+AE++  + +RL
Sbjct  186   FGRRSVNLNQESLSFLEDNSDIFTTRPGLESFGNSGFYRNASNVSSDGIAEIMKFKGARL  245

Query  861   MEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKL  1040
             M G S   D++RDWRLDVD+MSYE+LLELG+RIG+V TGL+EDE+   +RK KL +S   
Sbjct  246   MGGRSR--DQFRDWRLDVDNMSYEQLLELGERIGYVKTGLKEDEMKNNIRKIKLLISNDS  303

Query  1041  SSHFLAETERKCSVCQ  1088
             S H   + ++KC++CQ
Sbjct  304   SKH---QIDKKCTICQ  316


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+G+L C H YH  CIKQWL+ KN CP+CK
Sbjct  317   EEYESDDELGRLHCEHSYHFQCIKQWLVLKNFCPVCK  353



>ref|XP_002888945.1| hypothetical protein ARALYDRAFT_476516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65204.1| hypothetical protein ARALYDRAFT_476516 [Arabidopsis lyrata subsp. 
lyrata]
Length=362

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 156/270 (58%), Gaps = 34/270 (13%)
 Frame = +3

Query  336   KKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KK    +FRGLGCT  AS QVSVPAVIR SADWD+S    KK         N    +   
Sbjct  64    KKPQTASFRGLGCTTSASQQVSVPAVIRCSADWDASNFKIKKTK-----KKNKNKGSSSY  118

Query  510   GGNNVNILSNPPAASS------DVWCGPGIGFATDAASVGCVVS---RRTASRRGKVDGD  662
              G ++ ILS   ++S       DVWCGPG+GF+TDA     VVS   RR    R K+DGD
Sbjct  119   NGGSIKILSEASSSSVACAAIPDVWCGPGVGFSTDAVVGDTVVSDHPRRNIPVRRKIDGD  178

Query  663   TVRP---RERSACTL---RRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPE  824
                     +R  C+    RR +  E NP+ DSD+A   ++S       R+HR+ R  +P+
Sbjct  179   KTNSSSNNQREFCSSLLPRRSLNQESNPYFDSDSAFLTSQSEQT---DRYHRHLRQSYPD  235

Query  825   GLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDR  1001
             GLAE++M+Q+  + GG   S D++ D RL+VD+M+YE+LLELG+RIGHV+TGL E +I  
Sbjct  236   GLAEMMMMQNGFVMGGVLSSFDQFHDMRLNVDNMTYEQLLELGERIGHVNTGLNEKQIKS  295

Query  1002  YVRKTK-LPLSAKLSSHFLAETERKCSVCQ  1088
              ++K K   L A ++       +RKC +CQ
Sbjct  296   CLQKVKPFRLDAPVA-------DRKCIICQ  318


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE+ DE+GKL CGH +HIHC+KQWL+ KN+CP+CK+
Sbjct  319   DEYEAKDEVGKLPCGHRFHIHCVKQWLVRKNSCPVCKT  356



>ref|XP_010471443.1| PREDICTED: uncharacterized protein LOC104751232 isoform X1 [Camelina 
sativa]
Length=379

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 185/355 (52%), Gaps = 50/355 (14%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEAD----PNPHLIsssrskstisALLL  281
             MPV    SS    +H   +   PR+  + QP + AD    P P      +S  +   LL 
Sbjct  1     MPVSAEASSTTIGQH--IKLQRPRNHRNLQPTSTADEPLLPKPPSSRVCKSAMSSFFLLP  58

Query  282   APFSPASPTHDPPITLTPKKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkk  455
                +    T   P   T       +FR LGCT  AS QVSVPAVIRSSADWD++    K 
Sbjct  59    TTTTTNETTRKKPNGFT----QTASFRALGCTTSASQQVSVPAVIRSSADWDANSSNHKI  114

Query  456   klrskkkALNSVSAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAASVGC  614
             K   KK      S+    GG ++ ILS   ++S+       DVWCGPG+GF+TDA   G 
Sbjct  115   KKTKKKNKNKGNSSYN--GGGSIKILSESTSSSNVGCAAIPDVWCGPGVGFSTDAVVSGS  172

Query  615   VVS------RRTASRRGKVDGDTV----RPRERSACTLRRMVIPEDNPFLDSDTASGMTR  764
             V +      RR    R K+DGD      + RE S+   RR +  E NP+ DSD+    +R
Sbjct  173   VETVESDPPRRNIPVRRKIDGDNKTSHNQQREGSSLLPRRSLNQESNPYFDSDSTFLTSR  232

Query  765   SRMDVLGSRHHRYSRY-GFPEGLAEV--VMLQSRLMEGGSEG-SDRYRDWRLDVDHMSYE  932
             +       R+HR+ R   +P+GLAE+  +MLQ+  + GG    +DR+RD RL+VD+M+YE
Sbjct  233   AEQ---SDRYHRHLRQPYYPDGLAELQMMMLQNGFVMGGVVSLNDRFRDLRLNVDNMTYE  289

Query  933   ELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
             +LLELGDRIG+V+ GL E +I   +RK K          F  +T   +RKC +CQ
Sbjct  290   QLLELGDRIGYVNNGLNEKQIKSCLRKVK---------PFRLDTPVEDRKCIICQ  335


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +H HC+KQWL+ KN+CP+CK+
Sbjct  336   DEYEVKDEVGKLKCGHRFHTHCVKQWLVRKNSCPVCKT  373



>ref|XP_010416196.1| PREDICTED: uncharacterized protein LOC104702079 isoform X1 [Camelina 
sativa]
Length=378

 Score =   169 bits (427),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 195/361 (54%), Gaps = 63/361 (17%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEAD----PNPHLIsssrskstisALLL  281
             MPV    SS    +H   +   PR+  + QP + AD    P P   SS   KS +S+  L
Sbjct  1     MPVSAEPSSTTIGQH--IKLQRPRNHRNLQPTSTADEPLLPKP---SSRVCKSAMSSFFL  55

Query  282   APFSPASPTHDPPITLTPKKKN-FT---TFRGLGCT--ASSQVSVPAVIRSSADWDssrr  443
              P +  +         T KK N FT   +FR LGCT  AS  VSVPAVIRSSADWD++  
Sbjct  56    LPTTNET---------TRKKPNGFTQTASFRALGCTTSASQHVSVPAVIRSSADWDANSS  106

Query  444   vkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASS-------DVWCGPGIGFATDAA  602
               K K   KKK  N  +++ + GG ++ ILS    +SS       DVWCGPG+GF+TDA 
Sbjct  107   NHKIKKTKKKKNKNKGNSSYN-GGGSIKILSESTNSSSVGCAAIPDVWCGPGVGFSTDAV  165

Query  603   SVGCVVS------RRTASRRGKVDGDT------VRPRERSACTLRRMVIPEDNPFLDSDT  746
               G V +      RR    R K+DGD       ++ RE S+    R +  E NP+ DSD+
Sbjct  166   VSGSVETVESDPPRRNIPVRRKIDGDNKTSHNQLQQREVSSLLPIRSLNQESNPYFDSDS  225

Query  747   ASGMTRSRMDVLGSRHHRYSRY-GFPEGLAEV--VMLQSRLMEGGSEGS-DRYRDWRLDV  914
                 +R+       R+HR+ R   +P+GLAE+  +MLQ+  + GG   S DR+RD RL+V
Sbjct  226   TFLTSRAEQ---SDRYHRHLRQPYYPDGLAELQMMMLQNGFVMGGVVSSYDRFRDLRLNV  282

Query  915   DHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET---ERKCSVC  1085
             D+M+YE+LLELGDRIG+V TGL E +I   +RK K          F  +T   +RKC +C
Sbjct  283   DNMTYEQLLELGDRIGYVKTGLNEKQIKSCLRKVK---------PFRLDTPVEDRKCIIC  333

Query  1086  Q  1088
             Q
Sbjct  334   Q  334


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +EYE  DE+GKL CGH +HIHC+KQWL+ KN+CP+CK+
Sbjct  335   DEYEVKDEVGKLKCGHRFHIHCVKQWLVRKNSCPVCKT  372



>ref|XP_008351879.1| PREDICTED: uncharacterized protein LOC103415315 [Malus domestica]
Length=304

 Score =   161 bits (407),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 136/290 (47%), Positives = 175/290 (60%), Gaps = 24/290 (8%)
 Frame = +3

Query  114  MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
            MP++ ++SS  GAEH   ++  PR+Q  +QPI+E DP   L+ S+R K TIS+LLL+ F+
Sbjct  1    MPIL-TESSTAGAEH--MKWRRPRTQ-FTQPISETDPATSLLQSTRCKPTISSLLLSSFT  56

Query  294  PASPTHDP---PITLTPKKK-NF--TTFRGLGC--TASSQVSVPAVIRSSADWDssrrvk  449
              + T +    P +LT KKK NF  +TFRGLGC  +AS QVSVP VIR+SADW   +  K
Sbjct  57   TTTTTDNNEALPSSLTMKKKTNFPSSTFRGLGCAASASQQVSVPEVIRNSADWKGKKVKK  116

Query  450  kkklrskk---kALNSVSAAGDVG--GNNVNILSNPPAASSDVWCGPGIGFATD-AASVG  611
            KK+ +S      A N  +   DVG  G    I S       DVWCGPGIG + + A SV 
Sbjct  117  KKQKKSAAAKGSASNEKNEYRDVGDGGPTFGINSATCMDFQDVWCGPGIGXSAETAGSVD  176

Query  612  CVVSRRTASRRGKVDGDTVRP---RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVL  782
            CVV+RR  S RG++  D  +    RER  C  RR V PE   FLDS+     +R   +V 
Sbjct  177  CVVARRNXSGRGRIAADNNKMSSHRER-PCLARRNVSPETLSFLDSEPDFVSSRRETEVF  235

Query  783  GSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYE  932
            GSR  R+ R+  PE LAE+++ QS LM GG    DR+RDWRLDVD MSYE
Sbjct  236  GSRCFRHVRHPSPEDLAEIMLFQSSLMMGGR--LDRFRDWRLDVDSMSYE  283



>ref|XP_003620418.1| RING finger protein [Medicago truncatula]
Length=374

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 155/270 (57%), Gaps = 47/270 (17%)
 Frame = +3

Query  351   TTFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNV  524
             +TFR LGCTA  S QVSVPAVIRSSADW   +  KKK  R+K             G ++V
Sbjct  84    STFRSLGCTAGTSQQVSVPAVIRSSADWQGKKNRKKKNRRNKTCH----------GVDDV  133

Query  525   NILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRGKVD-GDTVRPRERSAC  692
             +          DVWCGPG GF +DAA   SV CVV+R+  S RGK+D G+ +  RERS+ 
Sbjct  134   DF--------QDVWCGPGTGFLSDAAADVSVDCVVARKNVSSRGKLDNGERIPHRERSSI  185

Query  693   TLRRMVI--PEDNPFLDSDTASGMTRSRMDVLG-SRHHRYSRYGFPEGLAE---------  836
               RR V    E   FL+ ++    TR  ++  G S  +R +     +G+AE         
Sbjct  186   FGRRSVNLNQESLSFLEDNSDIFTTRPGLESFGNSGFYRNASNVSSDGIAEWQGAPSKDV  245

Query  837   ------VVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
                   +    +RLM G S   D++RDWRLDVD+MSYE+LLELG+RIG+V TGL+EDE+ 
Sbjct  246   SGEYRIMKFKGARLMGGRSR--DQFRDWRLDVDNMSYEQLLELGERIGYVKTGLKEDEMK  303

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
               +RK KL +S   S H   + ++KC++CQ
Sbjct  304   NNIRKIKLLISNDSSKH---QIDKKCTICQ  330


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+G+L C H YH  CIKQWL+ KN CP+CK
Sbjct  331   EEYESDDELGRLHCEHSYHFQCIKQWLVLKNFCPVCK  367



>emb|CDX73013.1| BnaC06g34610D [Brassica napus]
Length=355

 Score =   156 bits (395),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 145/270 (54%), Gaps = 39/270 (14%)
 Frame = +3

Query  339   KKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVG  512
             +K  ++FR LGCT  AS QVSVPAVIRSSADW            +K K+ N     G   
Sbjct  60    RKTTSSFRRLGCTSSASQQVSVPAVIRSSADW----------GATKTKSKNKNKGTGRDS  109

Query  513   GNNVNILS------NPPAASSDVWCGPGIGFATDAAS--VGCVVSRRTASRRGKVDG---  659
             G +V IL+      N   A  DVWCGPG+GF+TDA    V     RR    R K+DG   
Sbjct  110   GGSVKILTEAGDGGNACGAVPDVWCGPGVGFSTDAVVDPVEADPPRRNIPARRKIDGGDN  169

Query  660   ------DTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFP  821
                         E S+   RR    E N + DSD  S   R    +   R+HR+ R  +P
Sbjct  170   NISSTSHKSNQTEGSSVPPRRSHNQESNHYFDSDLTS---RGEQTLFSDRYHRHLRQPYP  226

Query  822   EGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
              GL+E+++LQ+ L+ GG   S D +RD RL+VD MSYE+LLELGDRIG+V+TGL E +I 
Sbjct  227   NGLSEMMLLQNGLVMGGVLSSYDHFRDLRLNVDGMSYEQLLELGDRIGYVNTGLNEKQIK  286

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
               +RK K P +           +RKCS+CQ
Sbjct  287   TCLRKVK-PFNKDTPLE-----DRKCSICQ  310


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             E+YE+ DE+GKL CGH YHI C+KQWLL KN CP+CK+
Sbjct  311   EDYEAKDEVGKLRCGHRYHISCVKQWLLRKNCCPVCKT  348



>ref|XP_009104796.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Brassica rapa]
Length=339

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 142/263 (54%), Gaps = 37/263 (14%)
 Frame = +3

Query  336   KKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KK+  ++FR LGCT  AS QVSVPAVIRSSA+WD S             +          
Sbjct  60    KKQTTSSFRSLGCTSSASQQVSVPAVIRSSANWDPSNAK----------SKKKNKGCSYS  109

Query  510   GGNNVNILSNPPAASS----DVWCGPGIGFATDAASVGCVVS---RRTASRRGKVDGDTV  668
             GG +V ILS    +      DVWCGPG+GF+TDA   G V +   RR    R K+DG   
Sbjct  110   GGGSVKILSEAERSGCGPVPDVWCGPGVGFSTDAVVSGTVEAEPPRRNIPARRKIDG---  166

Query  669   RPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRYGFPEGLAEVVM  845
                E S+   RR    E + + DSD  S     +M  L S R+HR+ R  +P GL E++M
Sbjct  167   ---EGSSVPPRRSHNQETSLYFDSDLTS--RDEQMQTLFSDRYHRHLRQPYPNGLDEMMM  221

Query  846   LQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             + +  + G   GS D +RD RL+VD MSYE+LLELGDRIG+V TGL E +I   + + K 
Sbjct  222   IHNGFVMGEMLGSHDHFRDLRLNVDGMSYEQLLELGDRIGYVDTGLNEKQIKTCLWRVK-  280

Query  1023  PLSAKLSSHFLAETE-RKCSVCQ  1088
                    SH     E RKCS+CQ
Sbjct  281   ------PSHKATPLEDRKCSICQ  297


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE  DE+GKL CGH YHIHC KQWLL KN+CP+CK+
Sbjct  298   EEYEGKDEVGKLRCGHRYHIHCAKQWLLRKNSCPVCKT  335



>ref|XP_009106036.1| PREDICTED: E3 ubiquitin-protein ligase MBR1 [Brassica rapa]
Length=357

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 147/273 (54%), Gaps = 43/273 (16%)
 Frame = +3

Query  339   KKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVG  512
             +K  ++FR LGCT  AS QVSVPAVIRSSADW            +K K+ N     G   
Sbjct  60    RKTTSSFRRLGCTSSASQQVSVPAVIRSSADW----------GATKTKSKNKNKGTGRYS  109

Query  513   GNNVNILS------NPPAASSDVWCGPGIGFATDAAS--VGCVVSRRTASRRGKVDG---  659
             G +V IL+      N   A  DVWCGPG GF+TDA    V     RR    R K+DG   
Sbjct  110   GGSVKILTEAGDGGNACGAVPDVWCGPGGGFSTDAVVDPVDADPPRRNIPARRKIDGGDK  169

Query  660   ------DTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFP  821
                         E S+   RR    E NP+ DSD  S   +++  +   R+HR+ R  +P
Sbjct  170   NISSTSHKSNQTEGSSVPPRRSHNQESNPYFDSDLTSRGEQTQT-LFSDRYHRHLRQPYP  228

Query  822   EGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
              GL+E+++L + L+ GG   S D +RD RL+VD MSYE+LLELGDRIG+V+TGL E +I 
Sbjct  229   NGLSEMMLLHNGLVMGGVLSSYDHFRDLRLNVDGMSYEQLLELGDRIGYVNTGLNEKQIK  288

Query  999   RYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
               +RK K          F  +T   +RKCS+CQ
Sbjct  289   TCLRKVK---------PFNKDTPLDDRKCSICQ  312


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             E+YE+ DE+GKL CGH YHI C+KQWLL KN CP+CK+
Sbjct  313   EDYEAKDEVGKLRCGHRYHISCVKQWLLRKNCCPVCKT  350



>emb|CDY60141.1| BnaA07g39060D [Brassica napus]
Length=357

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 147/273 (54%), Gaps = 43/273 (16%)
 Frame = +3

Query  339   KKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVG  512
             +K  ++FR LGCT  AS QVSVPAVIRSSADW            +K K+ N     G   
Sbjct  60    RKTTSSFRRLGCTSSASQQVSVPAVIRSSADW----------GATKTKSKNKNKGTGRYS  109

Query  513   GNNVNILS------NPPAASSDVWCGPGIGFATDAAS--VGCVVSRRTASRRGKVDG---  659
             G +V IL+      N   A  DVWCGPG GF+TDA    V     RR    R K+DG   
Sbjct  110   GGSVKILTEAGDGGNACGAVPDVWCGPGGGFSTDAVVDPVDADPPRRNIPARRKIDGGDK  169

Query  660   ------DTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFP  821
                         + S+   RR    E NP+ DSD  S   +++  +   R+HR+ R  +P
Sbjct  170   NISSTSHKSNQTKGSSVPPRRSHNQESNPYFDSDLTSRGEQTQT-LFSDRYHRHLRQPYP  228

Query  822   EGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
              GL+E+++L + L+ GG   S D +RD RL+VD MSYE+LLELGDRIG+V+TGL E +I 
Sbjct  229   NGLSEMMLLHNGLVMGGVLSSYDHFRDLRLNVDGMSYEQLLELGDRIGYVNTGLNEKQIK  288

Query  999   RYVRKTKLPLSAKLSSHFLAET---ERKCSVCQ  1088
               +RK K          F  +T   +RKCS+CQ
Sbjct  289   TCLRKVK---------PFNKDTPLDDRKCSICQ  312


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             E+YE+ DE+GKL CGH YHI C+KQWLL KN CP+CK+
Sbjct  313   EDYEAKDEVGKLRCGHRYHISCVKQWLLRKNCCPVCKT  350



>gb|ADK63390.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=346

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 146/262 (56%), Gaps = 28/262 (11%)
 Frame = +3

Query  336   KKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KK+  ++FR LGCT  AS QVSVPAVIRSSA+WD+S    KK     KK       +G  
Sbjct  60    KKQTTSSFRSLGCTSSASQQVSVPAVIRSSANWDASDAKSKKTKSKTKKNKGCSGYSGGG  119

Query  510   GGNNVNILSNPPAASS----DVWCGPGIGFATDAASVGCVVS---RRTASRRGKVDGDTV  668
                +V ILS    +      DVWCGPG+GF+TDA   G V +   RR    R K+DG   
Sbjct  120   ---SVKILSEAERSGCGPVPDVWCGPGVGFSTDAVVSGTVEAEPPRRNIPARRKIDG---  173

Query  669   RPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVML  848
                E S+   RR    E + + DSD  S   +++  +   R+HR+ R  +P GL E++ML
Sbjct  174   ---EGSSVPPRRSHNQETSLYFDSDLTSRDEQTQT-LFSDRYHRHLRQPYPNGLDEMMML  229

Query  849   QSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLP  1025
             Q+  + GG   S D +RD R +VD MSYE+LLELGDRIG+V TGL E +I   + + K  
Sbjct  230   QNGFVMGGMLNSHDHFRDLRFNVDGMSYEQLLELGDRIGYVDTGLNEKQIKTCLWRVK--  287

Query  1026  LSAKLSSHFLAETE-RKCSVCQ  1088
                   SH     E RKCS+CQ
Sbjct  288   -----PSHKATPLEDRKCSICQ  304


 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE  DE+GKL CGH YHI+C KQWLL KN+CP+CK+
Sbjct  305   EEYEGKDEVGKLRCGHRYHIYCAKQWLLRKNSCPVCKT  342



>ref|XP_004969621.1| PREDICTED: uncharacterized protein LOC101777321 isoform X2 [Setaria 
italica]
Length=347

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 141/276 (51%), Gaps = 44/276 (16%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCT--ASSQVSVPAV------IRSSADWDssrrvkkkklrskkkALN  485
             ++K F +   RGLGCT  A+SQ   P        +RSSADW   RR + K+ R ++    
Sbjct  48    RRKGFASAALRGLGCTSAAASQAYAPGGAAAAAAVRSSADWHGRRRRRGKERRKERGGGG  107

Query  486   SVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDT  665
                  G +    +          +DVWC PGI FA +A+SV CVV+R     RG    D 
Sbjct  108   GGGGGGGLVTGGIG---------ADVWCAPGIPFAAEASSVDCVVARHQMVGRGGRGADG  158

Query  666   VRPRERSACTLRRMVIPE---------------DNPFLDSDTASGMTRSRMDVLGSRHHR  800
              R      C  RR  + E               D PF  +D        RM     R +R
Sbjct  159   ERSHRERPCLSRRATVQEQISSSFMDSPPPPHLDAPFFGADLIPSGRLRRM-----RGYR  213

Query  801   YSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
             +S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEELL+LGD+IG+VSTGL
Sbjct  214   HSPGGLEE---EIMMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELLDLGDKIGYVSTGL  270

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             REDEI R +RK   P     S  F  E ERKCS+CQ
Sbjct  271   REDEITRSIRKVTQPSFG--SFRFATEMERKCSICQ  304


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++EMG+L CGH YH++CIK+WL  KN CP+CK+  ++ 
Sbjct  305   EEFEANEEMGRLDCGHSYHVYCIKKWLSQKNTCPVCKTAVTKT  347



>emb|CDY11092.1| BnaC06g23440D [Brassica napus]
Length=348

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 144/262 (55%), Gaps = 32/262 (12%)
 Frame = +3

Query  333   PKKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGD  506
             P  +  ++FR LGCT  AS +VSVPAVIRSSA+WD+S    KK                 
Sbjct  67    PFTQTTSSFRSLGCTSSASQRVSVPAVIRSSANWDASDAKSKKTKS---------KGCSY  117

Query  507   VGGNNVNILSNPPAASS----DVWCGPGIGFATDAASVGCVVS---RRTASRRGKVDGDT  665
              GG +V ILS    +      DVWCGPG+ F+TDA   G V S   RR    R K+DG  
Sbjct  118   SGGGSVKILSEADRSGCGPVPDVWCGPGVEFSTDAVVSGTVESEPPRRNIPARRKIDG--  175

Query  666   VRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVM  845
                 E S+   RR    E + + DSD  S   +++  +   R+HR+ R  +P GL E++M
Sbjct  176   ----EGSSVPPRRSHNHETSLYFDSDMTSRDEQTQT-LFSDRYHRHLRQPYPNGLDEMMM  230

Query  846   LQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             +++  + G    S D +RD RL+VD MSYE+LLELGDRIG+V TGL E +I     KT L
Sbjct  231   IKNGFVMGRMLNSHDHFRDLRLNVDGMSYEQLLELGDRIGYVDTGLNEKQI-----KTCL  285

Query  1023  PLSAKLSSHFLAETERKCSVCQ  1088
              L  K S    +  +RKCS+CQ
Sbjct  286   -LRVKPSHKATSREDRKCSICQ  306


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE +DE+GKL CGH YHI C +QWLL KN+CP+CK+
Sbjct  307   EEYEGEDEVGKLRCGHKYHIDCARQWLLRKNSCPVCKT  344



>ref|XP_006416651.1| hypothetical protein EUTSA_v10007935mg [Eutrema salsugineum]
 gb|ESQ35004.1| hypothetical protein EUTSA_v10007935mg [Eutrema salsugineum]
Length=365

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 165/287 (57%), Gaps = 31/287 (11%)
 Frame = +3

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNFTTFRGLGCTASS--QVSVPAVIRSSADWDssrr  443
             +  L P S    T   P+   P+K    +FRG+GCTA++  +VSVP+VIRSSADWD+  R
Sbjct  52    SFFLLPTSSNETTRKKPLGF-PQKT--ASFRGMGCTAAAAQEVSVPSVIRSSADWDARIR  108

Query  444   vkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVS  623
               KKK R+K K   S         ++++ LS    A  DVWCGPG+GF+TDA  VG  + 
Sbjct  109   KDKKKKRNKMKTKESYD------DDSISFLSEARDAIPDVWCGPGLGFSTDAV-VGRSLD  161

Query  624   ---RRTASRRGKVDGDTVR--PRERSACTLRRMVIPEDNP----FLDSDTASGMTRSRMD  776
                R   S R KVD D      RE S+   RR   P        FL+S  ++ +T SR +
Sbjct  162   APRRSLPSSRRKVDVDKSNSSQREGSSVLTRRFPFPNQESHSHGFLNSSDSTLLTSSRAE  221

Query  777   --VLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLEL  947
               ++ SR+H Y R  +P+ L E++ML++  + G  ++  D + + RLDVD MSYE+LLEL
Sbjct  222   PTLVSSRYHGYLRRPYPDDLTEMMMLRNGFVMGRITDSRDHFHNLRLDVDSMSYEQLLEL  281

Query  948   GDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             GDRIG+V+TGL+E EI R +R+    +S  L+        RKCS+CQ
Sbjct  282   GDRIGYVNTGLKESEIHRCLREINPSVSHTLAG-------RKCSICQ  321


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  322   EEYEREGQVGKLDCGHSFHVQCVKQWLSRKNACPVCKKTA  361



>dbj|BAD82497.1| RING-H2 finger protein RHG1a-like [Oryza sativa Japonica Group]
Length=351

 Score =   150 bits (380),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 143/278 (51%), Gaps = 46/278 (17%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCT--ASSQVSVPAV-------IRSSADWDssrrvkkkklrskkkAL  482
             ++K F +   RGLGCT  A+SQ   P         +RSSADW   RR + K+ R ++   
Sbjct  50    RRKGFASAALRGLGCTSAAASQAYAPGAGAAAAAAVRSSADWHGRRRRRGKEKRKERGGG  109

Query  483   NSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGD  662
                                     +DVWC PGI FA +A+SV CVV+R     RG+  GD
Sbjct  110   GGGGGG---------GHLVGGGIGADVWCAPGIPFAAEASSVDCVVARHQMVGRGR-GGD  159

Query  663   TVRPRERSACTLRRMVIPED----------------NPFLDSDTASGMTRSRMDVLGSRH  794
               RP     C  RR+ + E                  PF  +D        RM     R 
Sbjct  160   AERPHRERPCLSRRVTVQEQISSSFMDSPPPPHLDVAPFFGADLLPSGRLRRM-----RG  214

Query  795   HRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVST  974
             +R+S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+IG+V+T
Sbjct  215   YRHSPVGLEE---EIMMFQTRVLLGGMSMYDRYQDWRLDVDNMTYEELLELGDKIGYVNT  271

Query  975   GLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             GLREDEI R +RK K P +   S  +  E E+KCS+CQ
Sbjct  272   GLREDEIVRNLRKVKHP-AFDSSFRYSTEMEKKCSICQ  308


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  309   EEFEANEEMGRLDCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  350



>ref|XP_004503318.1| PREDICTED: uncharacterized protein LOC101510167 isoform X2 [Cicer 
arietinum]
Length=278

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 112/314 (36%), Positives = 158/314 (50%), Gaps = 95/314 (30%)
 Frame = +3

Query  168   RYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHDPPITLTPKKKN  347
             ++  PR   +++P++E D  P ++ S+R KSTIS+LLL+ FS  +         T KK N
Sbjct  9     KWRRPR---NNKPVSETDTRP-ILQSTRCKSTISSLLLSTFSNET---------TNKKTN  55

Query  348   FT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             F+    TFRGLGC+A  S QVSVPAVIR+SADW+                          
Sbjct  56    FSAAAATFRGLGCSAGASEQVSVPAVIRASADWEM-----------------KKKKKKTK  98

Query  510   GGNNVNILSNPPAASSDVWCGPGIGFATD-AASVGCVVSRRTASRRGKVDGDTVRPRERS  686
                      N      DVWC PGIGF+ D AASV CVVS+R  +                
Sbjct  99    KKKQKRKSKNDGVDFQDVWCAPGIGFSPDVAASVDCVVSKRNVN----------------  142

Query  687   ACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLME  866
                                  S  +R ++D+    H             ++++LQ  ++ 
Sbjct  143   --------------------VSSTSRPKIDLHKITH------------TQIMVLQGSILM  170

Query  867   GGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSS  1046
             GG    D +RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE++ Y+ KTKL +S ++  
Sbjct  171   GGRR--DLFRDWRLDVDNMSYEQLLELGERIGNVNTGLKEDEMEPYITKTKLQISDQV--  226

Query  1047  HFLAETERKCSVCQ  1088
                   ++KCS+CQ
Sbjct  227   ------DKKCSICQ  234


 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE DD++G+L C H YH  CI+QW+ HKN CP+CK
Sbjct  235   EEYEVDDKLGRLNCDHLYHFQCIQQWVAHKNFCPVCK  271



>ref|XP_008792828.1| PREDICTED: uncharacterized protein LOC103709314 [Phoenix dactylifera]
Length=334

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = +3

Query  546   AASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDN  725
             A  +DVWC PGI FA DA SV CVVS      RG+ +G+ +  RER+    R     + +
Sbjct  115   AVGADVWCAPGIPFAADA-SVDCVVSHHQMIGRGRPEGERIH-RERAFIARRGSNQEQIS  172

Query  726   PFLDSDTASGMTRSRMDVLGSRHHRYSRYGF---PEGLAEVVMLQSRLMEGGSEGSDRYR  896
              F+DS     +     ++L S H R+ R G+   P G+ E++M Q+R++ GG    DRY+
Sbjct  173   SFMDSP----VNLETPELLPSGHLRHLR-GYRRSPGGIEEIMMFQTRILLGGMNVYDRYQ  227

Query  897   DWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKC  1076
             +WRLDVD+MSYEELLELGDRIG+VSTGLREDEI R +RK K       + HF +E E KC
Sbjct  228   NWRLDVDNMSYEELLELGDRIGYVSTGLREDEIIRSLRKVKHSTFDASTIHFSSEMEWKC  287

Query  1077  SVCQ  1088
             S+CQ
Sbjct  288   SICQ  291


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEYE++DEMGKL CGH YHI CIKQWL  KNACP+CK+ 
Sbjct  292   EEYEANDEMGKLECGHSYHICCIKQWLSQKNACPLCKTA  330



>emb|CDX96741.1| BnaA08g22840D [Brassica napus]
Length=364

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 165/293 (56%), Gaps = 43/293 (15%)
 Frame = +3

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNF-----TTFRGLGCTASS---QVSVPAVIRSSAD  425
             + LL P S   P          KKK        +FRG+ CTA++   +VSVP+ IRSSAD
Sbjct  51    SFLLLPTSSNEPA---------KKKQLGFPQAASFRGMNCTAAAAAHEVSVPSAIRSSAD  101

Query  426   WDssrrvkkkklrskkk------ALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGF  587
             WD  ++ K KK + KKK      ++  +S A DV G      S    A  DVWCGPG+GF
Sbjct  102   WDKKKKKKNKKKKKKKKGSYEDGSVRFLSEARDVDG------SGGCVAVPDVWCGPGLGF  155

Query  588   ATDAASVGCVVSRRTASRRG-KVDGDTVRPRERSACTLRRMVIPEDN--PFLDSDTASGM  758
             +TDA SV        +SRR   VD ++    E S+   RR    E +   F+ SD+ + M
Sbjct  156   STDAVSVDPPRRNLPSSRRKIDVDKNSSNQTEGSSVLTRRFTNQESHSHAFMGSDS-TFM  214

Query  759   TRSRMD--VLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSY  929
             T S ++  +L SR+H + R  +P+ L E++ML++  + G +  S D +   RLDVD+MSY
Sbjct  215   TSSHVEPTLLSSRYHGHLRRPYPDDLTEMMMLRNGFVMGRTTDSLDHFHSLRLDVDNMSY  274

Query  930   EELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E+LLELGDRIG+V+TGL+E EI R +RK    +S  L+       +RKCS+CQ
Sbjct  275   EQLLELGDRIGYVNTGLKESEIRRCLRKINPSVSNTLA-------DRKCSICQ  320


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  321   DEYERECQVGKLECGHSFHVQCVKQWLSRKNACPVCKKTA  360



>ref|XP_009110372.1| PREDICTED: uncharacterized protein LOC103835929 isoform X2 [Brassica 
rapa]
Length=358

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 161/276 (58%), Gaps = 34/276 (12%)
 Frame = +3

Query  321   ITLTPKKKNF-----TTFRGLGCTASS---QVSVPAVIRSSADWDssrrvkkkklrskkk  476
             + L  KKK        +FRG+ CTA++   +VSVP+ IRSSADWD  ++ + KK + KKK
Sbjct  53    LLLPTKKKQLGFPQAASFRGMNCTAAAAAHEVSVPSAIRSSADWDKKKKKRNKKKKKKKK  112

Query  477   ------ALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTAS  638
                   ++  +S A DV G      S    A  DVWCGPG+GF+TDA SV        +S
Sbjct  113   GSYEDGSVRFLSEARDVDG------SGGCVAVPDVWCGPGLGFSTDAVSVDPPRRNLPSS  166

Query  639   RRG-KVDGDTVRPRERSACTLRRMVIPEDN--PFLDSDTASGMTRSRMD--VLGSRHHRY  803
             RR   VD ++    E S+   RR    E +   F+ SD+ + MT S ++  +L SR+H +
Sbjct  167   RRKIDVDKNSSNQTEGSSVLTRRFTNQESHSHAFMGSDS-TFMTSSHVEPTLLSSRYHGH  225

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
              R  +P+ L E++ML++  + G +  S D +   RLDVD+MSYE+LLELGDRIG+V+TGL
Sbjct  226   LRRPYPDDLTEMMMLRNGFVMGRTTDSLDHFHSLRLDVDNMSYEQLLELGDRIGYVNTGL  285

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +E EI R +RK    +S  L+       +RKCS+CQ
Sbjct  286   KESEIRRCLRKINPSVSNTLA-------DRKCSICQ  314


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  315   DEYERECQVGKLECGHSFHVQCVKQWLSRKNACPVCKKTA  354



>ref|XP_010476962.1| PREDICTED: uncharacterized protein LOC104756132 [Camelina sativa]
Length=346

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 147/258 (57%), Gaps = 30/258 (12%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KKK + T  FRG+GCTA+ QVSVP+VIRSSADWD+  R  KKK + K K       +  +
Sbjct  68    KKKPYQTASFRGMGCTAAQQVSVPSVIRSSADWDARVRKDKKKHKKKSKKNIYEDGSIRI  127

Query  510   GGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSA  689
                  +++     +  DVWCGPG+GF+TDA                 VD     PR R  
Sbjct  128   LSEARDVVDGGCVSVPDVWCGPGLGFSTDAV----------------VDRSVDPPRRRHL  171

Query  690   CTLRRMVIPEDNPFLDSDTASG--MTRSRMD--VLGSRHHRYSRYGFPEGLAEVVMLQSR  857
              + RR +  ++N F  +   S   +T SR +  +L SR     +  +P+ L E++MLQ+ 
Sbjct  172   PSSRRKIDVDNNFFNHTTEGSSVLLTSSRAEPTLLSSRCRSQLQRSYPDDLTEMMMLQNG  231

Query  858   LMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSA  1034
              + G  S+  D Y + RLDVD+MSYE+LLELGDRIG+V+TGL+E EI R + K K  +  
Sbjct  232   FVMGRISDLRDHYHELRLDVDNMSYEQLLELGDRIGYVNTGLKESEIHRCLGKIKPSI--  289

Query  1035  KLSSHFLAETERKCSVCQ  1088
                SH LA  +RKCS+CQ
Sbjct  290   ---SHTLA--DRKCSICQ  302


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+GKL C H +H+HC+KQWLL KNACP+CK TA
Sbjct  303   DEYEREDEVGKLNCEHNFHVHCVKQWLLRKNACPVCKKTA  342



>emb|CDX68213.1| BnaA07g22530D [Brassica napus]
Length=349

 Score =   147 bits (372),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 148/264 (56%), Gaps = 33/264 (13%)
 Frame = +3

Query  336   KKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDV  509
             KK+  ++FR LGCT  AS QVSVPAVIRSSA+WD+S    KK    KK    S  + G  
Sbjct  64    KKQTTSSFRSLGCTSSASQQVSVPAVIRSSANWDASDVKSKKTKSKKKNNGCSGYSGG--  121

Query  510   GGNNVNILSNPPAASS----DVWCGPGIGFATDAASVGCVV----SRRTASRRGKVDGDT  665
                +V ILS    +      DVWCGPG+GF+TDA   G V     SR   +RR K+DG  
Sbjct  122   --GSVKILSEAERSGCGPVPDVWCGPGVGFSTDAVVSGTVEAEPPSRNIPARR-KIDG--  176

Query  666   VRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGS-RHHRYSRYGFPEGLAEVV  842
                 E S+   RR    E + + DSD  S     +M  L S R+HR+ R  +P GL E++
Sbjct  177   ----EGSSVPPRRSHNQETSLYFDSDLTS--RDEQMQTLFSDRYHRHLRQPYPNGLDEMM  230

Query  843   MLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK  1019
             M+ +  + G   GS D +RD RL+VD MSYE+LLELGDRIG+V TGL E +I   + + K
Sbjct  231   MIHNGFVMGEMLGSHDHFRDLRLNVDGMSYEQLLELGDRIGYVDTGLNEKQIKTCLWRVK  290

Query  1020  LPLSAKLSSHFLAETE-RKCSVCQ  1088
                     SH     E RKCS+CQ
Sbjct  291   -------PSHKATPLEDRKCSICQ  307


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE  DE+GKL CGH YHIHC KQWLL KN+CP+CK+
Sbjct  308   EEYEGKDEVGKLRCGHRYHIHCAKQWLLRKNSCPVCKT  345



>ref|XP_008810050.1| PREDICTED: E3 ubiquitin-protein ligase Arkadia-like [Phoenix 
dactylifera]
Length=337

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 148/261 (57%), Gaps = 37/261 (14%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASS-----QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVS  494
             KKK F    FRGLGC ++S       +  AV+RSSADW   R  +++       A     
Sbjct  61    KKKGFAAAAFRGLGCASASSSQVLVPAAAAVVRSSADWQGKRPRRRR-------AKQKKE  113

Query  495   AAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRP  674
               G  GG              DVWC PGI FA DAA V CVVS      RG+ +G+ +  
Sbjct  114   RRGQAGGG-------------DVWCAPGIPFAADAA-VDCVVSHHQMIGRGRPNGERIH-  158

Query  675   RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGF---PEGLAEVVM  845
             RER+  + R     + + F+DS +    +    ++L S H R+ R G+   P G+ E++M
Sbjct  159   RERAFVSRRDSNQEQISSFMDSPSRFFGS----ELLPSGHLRHLR-GYHRSPGGIEEIMM  213

Query  846   LQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLP  1025
              Q+R++ GG +  D++RDWRLDVD+MSYEELLEL DRIG+VSTGLREDEI R +RK +  
Sbjct  214   FQTRVLLGGMDVYDQHRDWRLDVDNMSYEELLELSDRIGYVSTGLREDEITRSLRKVEHS  273

Query  1026  LSAKLSSHFLAETERKCSVCQ  1088
             +    + HF +E E KCS+CQ
Sbjct  274   IFDASAIHFSSEIEWKCSICQ  294


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEYE +DEMGKL CGH YHI CIKQWL  KNACP+CK+ 
Sbjct  295   EEYEENDEMGKLECGHSYHICCIKQWLSQKNACPVCKTA  333



>ref|XP_008655106.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008655107.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
Length=410

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 145/275 (53%), Gaps = 45/275 (16%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASS-------QVSVPAVIRSSADWDssrrvkkkklrskkkALNS  488
             ++K F +   RGLGCT+++         +  A +RSSADW   RR + K  R ++    +
Sbjct  114   RRKGFASAALRGLGCTSAAASKAYAPGAAAAAALRSSADWHGRRRRRGKDRRKERGGGGA  173

Query  489   VSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSR-RTASRRGKVDGDT  665
              +                    +DVWC PGI FA +A+SV CVV+R +T  R G+     
Sbjct  174   GAGG----------GLVTGGIGADVWCAPGIPFAAEASSVDCVVARHQTVGRGGRGAEGE  223

Query  666   VRPRERSACTLRRMVIPE--------------DNPFLDSDTASGMTRSRMDVLGSRHHRY  803
                RER  C  RR  + E              D PF  +D        RM     R +RY
Sbjct  224   RSHRER-PCMSRRATVQEQISSPFMDSPPPHLDAPFFGADLIPSGRLRRM-----RGYRY  277

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLR  983
             S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEEL+ELGDRIG+V+TGLR
Sbjct  278   SPGGLEE---EIMMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELVELGDRIGYVNTGLR  334

Query  984   EDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             EDEI R +RK K P    L   F AE ERKC++CQ
Sbjct  335   EDEIARSLRKAKHPSFGSL--RFAAEVERKCTICQ  367


 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE++S++EMG+LVCGH YH+ CIKQWL  KN CP+CK+  S+
Sbjct  368   EEFQSNEEMGRLVCGHSYHVLCIKQWLSQKNTCPVCKTAVSK  409



>emb|CDX83878.1| BnaC08g17670D [Brassica napus]
Length=357

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 159/291 (55%), Gaps = 46/291 (16%)
 Frame = +3

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNF-----TTFRGLGCTASS--QVSVPAVIRSSADW  428
             + LL P S   PT         KKK        +FRG+ CTA++  +VSVP+ IRSSADW
Sbjct  51    SFLLLPTSSNEPT---------KKKQLGFPQAASFRGMNCTAAAAHEVSVPSAIRSSADW  101

Query  429   Dssrrvkkkkl------rskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFA  590
             D+ ++ KKK+         +  ++  +S + DV G      S    A  DVWCGPG+GF+
Sbjct  102   DNKKKKKKKRNTKKKKGSYEDGSVRFLSESRDVDG------SGGCVAVPDVWCGPGLGFS  155

Query  591   TDAASVGCVVSRRTASRRGKVDGDTVRPR--ERSACTLRRMVI--PEDNPFLDSDTASGM  758
             TDA SV        +SRR K+D D   P   E S+   RR     P  +  + SD+    
Sbjct  156   TDAVSVNPPRKNLPSSRR-KIDVDKNSPNQTEGSSVLTRRFTNQEPHSHALMSSDSHVEP  214

Query  759   TRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEE  935
             T     +  SR+H + R  +P+ L E++ML++  + G +  S D +   RLDVD+MSYE+
Sbjct  215   T-----LFSSRYHGHLRRPYPDDLTEMMMLRNGFLMGRTTDSLDHFHSLRLDVDNMSYEQ  269

Query  936   LLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             LLELGDRIG+V+TGL+E EI R +RK    +S  L+       +RKCS+CQ
Sbjct  270   LLELGDRIGYVNTGLKESEIRRCLRKINPSVSNTLA-------DRKCSICQ  313


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  314   DEYERECQVGKLDCGHSFHVQCVKQWLSRKNACPVCKKTA  353



>ref|XP_009110371.1| PREDICTED: uncharacterized protein LOC103835929 isoform X1 [Brassica 
rapa]
Length=360

 Score =   146 bits (368),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 160/279 (57%), Gaps = 38/279 (14%)
 Frame = +3

Query  321   ITLTPKKKNF-----TTFRGLGCTASS---QVSVPAVIRSSADWDssrrvkkkklrskkk  476
             + L  KKK        +FRG+ CTA++   +VSVP+ IRSSADWD  ++ + KK + KKK
Sbjct  53    LLLPTKKKQLGFPQAASFRGMNCTAAAAAHEVSVPSAIRSSADWDKKKKKRNKKKKKKKK  112

Query  477   ------ALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTAS  638
                   ++  +S A DV G      S    A  DVWCGPG+GF+TDA SV     R   S
Sbjct  113   GSYEDGSVRFLSEARDVDG------SGGCVAVPDVWCGPGLGFSTDAVSVD-PPRRNLPS  165

Query  639   RRGKVDGDTVRPRER----SACTLRRMVIPEDN--PFLDSDTASGMTRSRMD--VLGSRH  794
              R K+D D     +     S+   RR    E +   F+ SD+ + MT S ++  +L SR+
Sbjct  166   SRRKIDVDKNSSNQTEVKGSSVLTRRFTNQESHSHAFMGSDS-TFMTSSHVEPTLLSSRY  224

Query  795   HRYSRYGFPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVS  971
             H + R  +P+ L E++ML++  + G +  S D +   RLDVD+MSYE+LLELGDRIG+V+
Sbjct  225   HGHLRRPYPDDLTEMMMLRNGFVMGRTTDSLDHFHSLRLDVDNMSYEQLLELGDRIGYVN  284

Query  972   TGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             TGL+E EI R +RK    +S  L+       +RKCS+CQ
Sbjct  285   TGLKESEIRRCLRKINPSVSNTLA-------DRKCSICQ  316


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  317   DEYERECQVGKLECGHSFHVQCVKQWLSRKNACPVCKKTA  356



>ref|NP_001148380.1| LOC100281993 [Zea mays]
 gb|ACG31220.1| protein binding protein [Zea mays]
Length=339

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 138/276 (50%), Gaps = 46/276 (17%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASS--------QVSVPAVIRSSADWDssrrvkkkklrskkkALN  485
             ++K F T   RGLGCT++S        + +  A +RSSADW   RR + +  R ++    
Sbjct  42    RRKGFATAALRGLGCTSASASQAYAPGEAAAAAAVRSSADWQGRRRRRGRDRRKERGGGG  101

Query  486   SVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDT  665
                                    ++VWC PGI FA +A+SV CVV+R     RG    + 
Sbjct  102   GGGVG-----------FVTGGIGAEVWCAPGIPFAAEASSVNCVVARHQMVGRGGRGAEG  150

Query  666   VRPRERSACTLRRMVIPE---------------DNPFLDSDTASGMTRSRMDVLGSRHHR  800
              R      C  RR+ + E               D P   +D        RM     R  R
Sbjct  151   NRSHRXRPCLSRRVTVQEQISSSFMDSPPPPHLDAPLFGADLIPSGRLRRM-----RGWR  205

Query  801   YSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGL  980
             +S  G  E   E+ M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+IG+V+TGL
Sbjct  206   HSPGGLEE---EIRMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELLELGDKIGYVNTGL  262

Query  981   REDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             R+DEI R +RK K P  + L   F  E ERKCS+CQ
Sbjct  263   RDDEITRNLRKFKHPSFSSL--RFATEMERKCSICQ  296


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  S+
Sbjct  297   EEFETNEEMGRLDCGHSYHVYCIKQWLSQKNICPVCKTAVSK  338



>ref|XP_010906978.1| PREDICTED: uncharacterized protein LOC105033766 [Elaeis guineensis]
Length=334

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 113/184 (61%), Gaps = 10/184 (5%)
 Frame = +3

Query  546   AASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDN  725
             A  +DVWC PGI FA DA SV CVVS      RG+ +G+ +  RER+    R     + +
Sbjct  115   AGGADVWCAPGIPFAADA-SVDCVVSHHQVIGRGRPEGERIH-RERAFIARRGSNQEQIS  172

Query  726   PFLDSDTASGMTRSRMDVLGSRHHRYSRYGF---PEGLAEVVMLQSRLMEGGSEGSDRYR  896
              F+DS           ++  S H R+ R G+   P G+ E++M Q+R++ GG    DRY+
Sbjct  173   SFMDSPANPETP----ELPPSGHFRHLR-GYRRSPGGIEEIMMFQTRILLGGMNVYDRYQ  227

Query  897   DWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKC  1076
             DWRLDVD+MSYEELLELGDRIG+VSTGLREDEI R +RK K       +  F +E E KC
Sbjct  228   DWRLDVDNMSYEELLELGDRIGYVSTGLREDEIIRSLRKVKRSTFDASTIQFSSEMEWKC  287

Query  1077  SVCQ  1088
             S+CQ
Sbjct  288   SICQ  291


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEY+++DEMGKL CGH YHI CIKQWL  KNACP+CK+ 
Sbjct  292   EEYDANDEMGKLECGHSYHICCIKQWLSQKNACPVCKTA  330



>ref|XP_010922495.1| PREDICTED: pre-mRNA-splicing ATP-dependent RNA helicase prp28-like 
[Elaeis guineensis]
Length=341

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 152/270 (56%), Gaps = 33/270 (12%)
 Frame = +3

Query  309   HDPPITLTPKKKNF--TTFRGLGC--TASSQ---VSVPAVIRSSADWDssrrvkkkklrs  467
               PP     KKK F    FRGLGC   ASSQ    +  AV+RSSADW   R  +++  + 
Sbjct  52    ASPPAPPGSKKKGFAAAAFRGLGCASAASSQALVPAAAAVVRSSADWQGKRPRRRRTKQK  111

Query  468   kkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRG  647
             K++        G  GG              DVWC PGI FA D ASV CVVS      RG
Sbjct  112   KER-------RGQAGGG-------------DVWCAPGIPFAAD-ASVDCVVSHHQMIGRG  150

Query  648   KVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGF---  818
             + +G+ +  RER+  + R     + + F+DS +         ++L S H R+ R G+   
Sbjct  151   RANGERIH-RERAFVSRRDNNQEQISSFMDSPSNLESRFFGSELLPSGHLRHLR-GYHRS  208

Query  819   PEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
             P G+ E++M Q+R++ GG +  D+Y+DWRLDVD+MSYEELLEL DRIG+VSTGLREDEI 
Sbjct  209   PGGIEEIMMFQTRVLLGGMDVYDQYQDWRLDVDNMSYEELLELSDRIGYVSTGLREDEIT  268

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             R +RK K  +    + H  +E E KCS+CQ
Sbjct  269   RNLRKVKHSIFDAPAIHISSEIEWKCSICQ  298


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEYE++DEMGKL CGH YHI CIKQWL  KNACP+CK+ 
Sbjct  299   EEYEANDEMGKLECGHSYHICCIKQWLSQKNACPVCKTA  337



>ref|XP_003569602.1| PREDICTED: uncharacterized protein LOC100824389 [Brachypodium 
distachyon]
Length=346

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 139/280 (50%), Gaps = 53/280 (19%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCT--ASSQVSVPAV-------IRSSADWDssrrvkkkklrskkkAL  482
             ++K F +   RGLGCT  A+SQ   P         +RSSADW                  
Sbjct  48    RRKGFASAALRGLGCTSAAASQAYAPGAGAAAAAAVRSSADWHGR-------------RR  94

Query  483   NSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGD  662
                    + GG             +DVWC PGI FA +A+SV CVV+R     R +  G+
Sbjct  95    RGKDRRKERGGGGGGAGLVGGGIGADVWCAPGIPFAAEASSVDCVVARHQMLGRAR-GGE  153

Query  663   TVRP---RERSACTLRRMVIPE---------------DNPFLDSDTASGMTRSRMDVLGS  788
               RP   RER  C  RR  + E               D PF  ++        RM     
Sbjct  154   AERPHMHRERP-CLSRRSAMQEQVSSSFMESPPPPHLDGPFFGAELLPSARLRRM-----  207

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             R +R S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELG+RIGHV
Sbjct  208   RGYRPSPGGLEE---EIMMFQTRVLLGGMSMYDRYQDWRLDVDNMTYEELLELGERIGHV  264

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TGLREDEI R +RK K P +   S  F  E E+KCS+CQ
Sbjct  265   NTGLREDEIVRNLRKVKHP-ALDSSFRFPTEVEKKCSICQ  303


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E++DEMG+L CGH YH++CIK+WL  KN CP+CK+  ++ 
Sbjct  304   EEFEANDEMGRLHCGHSYHVYCIKKWLSQKNVCPVCKTAVTKT  346



>dbj|BAJ90838.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03443.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 110/196 (56%), Gaps = 32/196 (16%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPE------  719
             DVWC PGI FA +A+SV CVV+R     RG+  GD  RP     C  RR  + E      
Sbjct  115   DVWCAPGIPFAAEASSVDCVVARHQMLGRGR-GGDPERPHRERPCLSRRTSMQEQISSSF  173

Query  720   -------------DNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRL  860
                          D PF  +D        RM     R +R S  G  E   E++M Q+R+
Sbjct  174   MESPPPPPLPQHMDGPFFGADLLPSARLRRM-----RGYRPSPGGLEE---EIMMFQTRV  225

Query  861   MEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKL  1040
             + GG    DRY+DWRLDVD+M+YEELLELG+RIGHV+TGLREDEI R +RK K P S   
Sbjct  226   LLGGMNMYDRYQDWRLDVDNMTYEELLELGERIGHVNTGLREDEITRNLRKVK-PDS---  281

Query  1041  SSHFLAETERKCSVCQ  1088
             S  F  E E+KCS+CQ
Sbjct  282   SFRFPTEVEKKCSICQ  297


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E++DEMG+L CGH YH++CIKQWL  KN CP+CK+  ++ 
Sbjct  298   EEFEANDEMGRLGCGHSYHVYCIKQWLSQKNVCPVCKTAVTKT  340



>ref|XP_010314223.1| PREDICTED: uncharacterized protein LOC101244847 isoform X1 [Solanum 
lycopersicum]
Length=306

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 8/159 (5%)
 Frame = +3

Query  615   VVSRRTASRRGKVDGDTVRPRERSACTLRRMVI-PEDNPFLDSDTASGMTRSRMDVLGSR  791
             VVSR+  S +G+VD D + P+E+S   ++RMV   ED P LD+ T      SR D  G  
Sbjct  111   VVSRKPHSSKGRVDADKITPKEQS---MQRMVTGSEDYPVLDTATLE-RPHSRADWFGFG  166

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVS  971
             HH  S + F EGL+E VMLQ+  M G ++  DRYR  RL+VD+MSYEEL+ELGDRIG+VS
Sbjct  167   HH--SHFDFSEGLSEFVMLQNSFMGGRTDCPDRYRSLRLNVDNMSYEELVELGDRIGYVS  224

Query  972   TGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             TGL+E+EI + VR+TK P+S    SH     E+ CS+CQ
Sbjct  225   TGLKENEITQCVRRTK-PVSLNNFSHLHTVVEKNCSICQ  262


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGHFYHI CIKQWL+HKN CP+CKS A
Sbjct  263   EEYEADDEMGKLGCGHFYHIDCIKQWLMHKNNCPVCKSVA  302



>ref|XP_006587489.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Glycine 
max]
Length=316

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 133/248 (54%), Gaps = 58/248 (23%)
 Frame = +3

Query  354   TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNVN  527
             TFRG GCTA  S +VSVPAVIRSSADW+  R  KK   R      NS +   D   ++V+
Sbjct  80    TFRGFGCTAGSSQKVSVPAVIRSSADWEGKRNRKKNHRRKSNSNGNSGNNTCDDDDDDVS  139

Query  528   ILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRM  707
                       DV CGPGIGF+TDAASV C V+R+  S RGK+D                 
Sbjct  140   --GGTFVDFQDVSCGPGIGFSTDAASVECAVARKNVSSRGKLD-----------------  180

Query  708   VIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGS-  884
             V+ E                         HR           E+++++ R+M GG   S 
Sbjct  181   VVEERVT----------------------HR-----------EIMIIRGRIMMGGRFNSH  207

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             D++RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE+   +RK K   S   S H L   
Sbjct  208   DQFRDWRLDVDNMSYEQLLELGERIGYVNTGLKEDEMGLNIRKVKPSSSNDTSKHQL---  264

Query  1065  ERKCSVCQ  1088
             ++KCSVCQ
Sbjct  265   DKKCSVCQ  272


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYESDDE+G+L C H YH  CIK WL HKN CP+CK 
Sbjct  273   EEYESDDELGRLKCDHSYHFQCIKHWLEHKNFCPVCKQ  310



>ref|XP_010498176.1| PREDICTED: uncharacterized protein LOC104775910 [Camelina sativa]
Length=352

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 111/285 (39%), Positives = 160/285 (56%), Gaps = 40/285 (14%)
 Frame = +3

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNFTT--FRGLGCTASSQ---VSVPAVIRSSADWDs  434
             +  L P S +S +++     T KKK + T  FRG+GCTA++    VSVP+VIRSSADWD+
Sbjct  52    SFFLLPASSSSNSNE-----TAKKKPYQTASFRGMGCTAAAAAQQVSVPSVIRSSADWDA  106

Query  435   srrvkkkklrskkkALNSVSAAGDVG--GNNVNILSNPPAASSDVWCGPGIGFATDAASV  608
               R  KKK   K K+  +    G +       ++++    +  DVWCGPG+GF+TDA   
Sbjct  107   RIRKDKKKQTKKNKSKKNSYEDGSIRILSEARDVVAGGCVSVPDVWCGPGLGFSTDAV--  164

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASG--MTRSRMD--  776
                           VD     PR R+  + RR +  ++N F  +   S   +T SR +  
Sbjct  165   --------------VDRSVDPPRRRNLPSSRRKIDVDNNIFNHNTEGSSVLLTSSRAEPT  210

Query  777   VLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGD  953
             +L SR     +  +P+ L E++MLQ+  + G  ++  D Y + RLDVD+MSYE+LLELGD
Sbjct  211   LLSSRCRSQLQRSYPDDLTEMMMLQNGFVMGKITDLRDHYHELRLDVDNMSYEQLLELGD  270

Query  954   RIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             RIG+V+TGL+E EI R + K K  +     SH LA  +RKCS+CQ
Sbjct  271   RIGYVNTGLKESEIHRCLGKIKPSI-----SHTLA--DRKCSICQ  308


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+GKL C H +H+HC+KQWL  KNACP+CK TA
Sbjct  309   DEYEREDEVGKLNCEHSFHVHCVKQWLSRKNACPVCKKTA  348



>ref|XP_008393402.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like, partial [Malus 
domestica]
Length=179

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +3

Query  690   CTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEG  869
             C  RR V PE   FLDS+     +R   +V GSR  R+ R+  PE LAE+++ QS LM G
Sbjct  5     CLARRNVSPETLSFLDSEPDFVSSRRETEVFGSRCFRHVRHPSPEDLAEIMLFQSSLMMG  64

Query  870   GSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSH  1049
             G    DR+RDWRLDVD MSYE+LLELG+RIG+VSTGL+EDEI+R +RK KLP+S+  S H
Sbjct  65    GR--LDRFRDWRLDVDSMSYEQLLELGERIGYVSTGLKEDEINRCLRKIKLPMSSDASPH  122

Query  1050  FLAETERKCSVCQ  1088
                + + KC +CQ
Sbjct  123   SSGKGDSKCIICQ  135


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +H+ CIKQWL  KN CP CK  A
Sbjct  136   EEYEADDEMGKLPCGHNFHLQCIKQWLAQKNTCPFCKVEA  175



>ref|XP_004252267.1| PREDICTED: uncharacterized protein LOC101244847 isoform X2 [Solanum 
lycopersicum]
Length=305

 Score =   141 bits (355),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 105/159 (66%), Gaps = 9/159 (6%)
 Frame = +3

Query  615   VVSRRTASRRGKVDGDTVRPRERSACTLRRMVI-PEDNPFLDSDTASGMTRSRMDVLGSR  791
             VVSR+  S +G+VD D + P+E    +++RMV   ED P LD+ T      SR D  G  
Sbjct  111   VVSRKPHSSKGRVDADKITPKE----SMQRMVTGSEDYPVLDTATLE-RPHSRADWFGFG  165

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVS  971
             HH  S + F EGL+E VMLQ+  M G ++  DRYR  RL+VD+MSYEEL+ELGDRIG+VS
Sbjct  166   HH--SHFDFSEGLSEFVMLQNSFMGGRTDCPDRYRSLRLNVDNMSYEELVELGDRIGYVS  223

Query  972   TGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             TGL+E+EI + VR+TK P+S    SH     E+ CS+CQ
Sbjct  224   TGLKENEITQCVRRTK-PVSLNNFSHLHTVVEKNCSICQ  261


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGHFYHI CIKQWL+HKN CP+CKS A
Sbjct  262   EEYEADDEMGKLGCGHFYHIDCIKQWLMHKNNCPVCKSVA  301



>ref|XP_006416652.1| hypothetical protein EUTSA_v10007935mg [Eutrema salsugineum]
 gb|ESQ35005.1| hypothetical protein EUTSA_v10007935mg [Eutrema salsugineum]
Length=379

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 162/301 (54%), Gaps = 45/301 (15%)
 Frame = +3

Query  270   ALLLAPFSPASPTHDPPITLTPKKKNFTTFRGLGCTASS--QVSVPAVIRSSADWDssrr  443
             +  L P S    T   P+   P+K    +FRG+GCTA++  +VSVP+VIRSSADWD+  R
Sbjct  52    SFFLLPTSSNETTRKKPLGF-PQKT--ASFRGMGCTAAAAQEVSVPSVIRSSADWDARIR  108

Query  444   vkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVS  623
               KKK R+K K   S         ++++ LS    A  DVWCGPG+GF+TDA  VG  + 
Sbjct  109   KDKKKKRNKMKTKESYD------DDSISFLSEARDAIPDVWCGPGLGFSTDAV-VGRSLD  161

Query  624   ---RRTASRRGKVDGDTVR--PRERSACTLRRMVIPEDNP----FLDSDTASGMTRSRMD  776
                R   S R KVD D      RE S+   RR   P        FL+S  ++ +T SR +
Sbjct  162   APRRSLPSSRRKVDVDKSNSSQREGSSVLTRRFPFPNQESHSHGFLNSSDSTLLTSSRAE  221

Query  777   --VLGSRHHRYSRYGFPEGLAE---------VVMLQSRLMEGG------SEGSDRYRDWR  905
               ++ SR+H Y R  +P+ L E            LQ  ++  G      ++  D + + R
Sbjct  222   PTLVSSRYHGYLRRPYPDDLTEPGSHVKHQKCCSLQMMMLRNGFVMGRITDSRDHFHNLR  281

Query  906   LDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVC  1085
             LDVD MSYE+LLELGDRIG+V+TGL+E EI R +R+    +S  L+        RKCS+C
Sbjct  282   LDVDSMSYEQLLELGDRIGYVNTGLKESEIHRCLREINPSVSHTLAG-------RKCSIC  334

Query  1086  Q  1088
             Q
Sbjct  335   Q  335


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE + ++GKL CGH +H+ C+KQWL  KNACP+CK TA
Sbjct  336   EEYEREGQVGKLDCGHSFHVQCVKQWLSRKNACPVCKKTA  375



>ref|XP_009396064.1| PREDICTED: uncharacterized protein LOC103981165 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=333

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 139/267 (52%), Gaps = 44/267 (16%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASSQVSVPAV----IRSSADWDssrrvkkkklrskkkALNSVSA  497
             +KK      FRGLGC +++     A     +RSSADW   R  +++  + KK+   +V  
Sbjct  52    RKKGLAAAAFRGLGCASAAASQAYAPAAAAVRSSADWQGKRPRRRRAKKKKKEGRGAVGG  111

Query  498   AGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPR  677
                                 DVWC PG+ FA + ASV CV++ +    RG+ D      R
Sbjct  112   --------------------DVWCAPGMPFAAE-ASVDCVMAHQPMVGRGRFDAAERIHR  150

Query  678   ERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDV---------LGSRHHRYSRYGFPEGL  830
             ER         IP      +  +++  + S +D          LG   H    +  P GL
Sbjct  151   ERP-------YIPRRVSHQEQISSATDSPSNLDTPFYGPGLLPLGHLRHLRGYHRTPGGL  203

Query  831   AEVVMLQSR-LMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
              E++M Q+R L+ GG E  D++RDWRLDVD+MSYEELLELGDRIGHV+ GLRE+EI R +
Sbjct  204   EEIMMFQTRVLLRGGMEVYDQFRDWRLDVDNMSYEELLELGDRIGHVNAGLREEEIARSL  263

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             RKTK  +    ++HF  E E KCS+CQ
Sbjct  264   RKTKHSVFDASANHFSPEVEWKCSICQ  290


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE +DE G+L CGH YH+HCIKQWLL KNACP+CK+
Sbjct  291   EEYEGNDETGRLQCGHSYHMHCIKQWLLLKNACPVCKT  328



>ref|XP_006305158.1| hypothetical protein CARUB_v10009526mg [Capsella rubella]
 gb|EOA38056.1| hypothetical protein CARUB_v10009526mg [Capsella rubella]
Length=363

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 152/272 (56%), Gaps = 40/272 (15%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASS---QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
             KKK + T  FRG+GCTA++   +VSVP+VIRSSADWD+  R  KKK +       S +  
Sbjct  67    KKKPYQTASFRGMGCTAAATAREVSVPSVIRSSADWDARIRNDKKKKQ----KKKSKTNK  122

Query  501   GDVGGNNVNILSNPP--------AASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRG  647
             G     ++ ILS            A  DVWCGPGIGF+TDA    SV     R   S R 
Sbjct  123   GSYEDGSIRILSETTRDVDGGGCVAIPDVWCGPGIGFSTDAVVDRSVHPPRRRTLPSSRR  182

Query  648   KVDGDTVRPR---ERSACTLRRMVIPEDNPFLDSDTAS-GMTRSRMDVLGSRHHRYSRYG  815
             K+D D        E S+   RR        FL+ ++ S   +R+   +L SR   + R  
Sbjct  183   KIDVDNNNSNHTIEGSSVLPRR--------FLNQESHSHASSRAEPTLLSSRCRSHLRQS  234

Query  816   FPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDE  992
             +P+ L E++MLQ+  + G  ++  D + + RLDVD MSYE+LLELGDRIG+V+TGL+E E
Sbjct  235   YPDDLTEMMMLQNGFVMGRITDLRDHFHELRLDVDSMSYEQLLELGDRIGYVNTGLKESE  294

Query  993   IDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             I R + K K       +SH LA  +RKCS+CQ
Sbjct  295   IHRCLGKIK-----PSTSHTLA--DRKCSICQ  319


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+GKL C H +H+HC+KQWL  KNACP+CK TA
Sbjct  320   DEYEREDEVGKLNCEHSFHVHCVKQWLARKNACPVCKKTA  359



>ref|XP_009396063.1| PREDICTED: uncharacterized protein LOC103981165 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=334

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 141/267 (53%), Gaps = 43/267 (16%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCTASSQVSVPAV----IRSSADWDssrrvkkkklrskkkALNSVSA  497
             +KK      FRGLGC +++     A     +RSSADW   R  +++  + KK+   +   
Sbjct  52    RKKGLAAAAFRGLGCASAAASQAYAPAAAAVRSSADWQGKRPRRRRAKKKKKEGRGA---  108

Query  498   AGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPR  677
                VGG              DVWC PG+ FA + ASV CV++ +    RG+ D      R
Sbjct  109   ---VGG--------------DVWCAPGMPFAAE-ASVDCVMAHQPMVGRGRFDAAERIHR  150

Query  678   ERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDV---------LGSRHHRYSRYGFPEGL  830
             E       R  IP      +  +++  + S +D          LG   H    +  P GL
Sbjct  151   E------VRPYIPRRVSHQEQISSATDSPSNLDTPFYGPGLLPLGHLRHLRGYHRTPGGL  204

Query  831   AEVVMLQSR-LMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
              E++M Q+R L+ GG E  D++RDWRLDVD+MSYEELLELGDRIGHV+ GLRE+EI R +
Sbjct  205   EEIMMFQTRVLLRGGMEVYDQFRDWRLDVDNMSYEELLELGDRIGHVNAGLREEEIARSL  264

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             RKTK  +    ++HF  E E KCS+CQ
Sbjct  265   RKTKHSVFDASANHFSPEVEWKCSICQ  291


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE +DE G+L CGH YH+HCIKQWLL KNACP+CK+
Sbjct  292   EEYEGNDETGRLQCGHSYHMHCIKQWLLLKNACPVCKT  329



>gb|KEH21403.1| C3HC4-type RING zinc finger protein [Medicago truncatula]
Length=283

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 142/280 (51%), Gaps = 33/280 (12%)
 Frame = +3

Query  126  VSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAPFSPA  299
            V+  ++   +H + R   PR+Q  N ++PI+E DPN   I      +   + + +     
Sbjct  4    VTQETKTEQQHMKWR-KPPRNQINNKNKPISETDPNTKQIQPIIQSTRSKSTISSLLLSN  62

Query  300  SPTHDPPITLTPKKKNFT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkkl  461
              T   PI    KK NF+    TFRGLGCTA  S QVSVPAVIR+SADW    +  +KK 
Sbjct  63   ETTSQQPIN---KKINFSSAAATFRGLGCTAGASQQVSVPAVIRASADWPHQGKKTRKKK  119

Query  462  rskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVGCVVSRRTAS  638
                      S  G    + V+          DVWCGPGIGF+ DAA SV CVVS++  S
Sbjct  120  HKN-------SNDGSSSSSCVDF--------QDVWCGPGIGFSADAAASVDCVVSKKNVS  164

Query  639  RRGKVDGDTVRPRERSACTLRRM-VIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYG  815
             R K+D D +  RE S+   RR  V PE   F D+D       S       RH R     
Sbjct  165  SRAKIDVDKITHREPSSSFRRRTAVYPETFSFPDTDPDIFTACSFGTATYPRHIRDLS--  222

Query  816  FPEGLAEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYE  932
              +  +E++ LQ R++ GG   S D YRDWRLDVD+MSYE
Sbjct  223  -SDDFSEIMALQGRILMGGRFNSRDLYRDWRLDVDNMSYE  261



>ref|XP_004969620.1| PREDICTED: uncharacterized protein LOC101777321 isoform X1 [Setaria 
italica]
Length=374

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 141/303 (47%), Gaps = 71/303 (23%)
 Frame = +3

Query  336   KKKNFTT--FRGLGCT--ASSQVSVPAV------IRSSADWDssrrvkkkklrskkkALN  485
             ++K F +   RGLGCT  A+SQ   P        +RSSADW   RR + K+ R ++    
Sbjct  48    RRKGFASAALRGLGCTSAAASQAYAPGGAAAAAAVRSSADWHGRRRRRGKERRKERGGGG  107

Query  486   SVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDT  665
                  G +    +          +DVWC PGI FA +A+SV CVV+R     RG    D 
Sbjct  108   GGGGGGGLVTGGIG---------ADVWCAPGIPFAAEASSVDCVVARHQMVGRGGRGADG  158

Query  666   VRPRERSACTLRRMVIPE---------------DNPFLDSDTASGMTRSRMDVLGSRHHR  800
              R      C  RR  + E               D PF  +D        RM     R +R
Sbjct  159   ERSHRERPCLSRRATVQEQISSSFMDSPPPPHLDAPFFGADLIPSGRLRRM-----RGYR  213

Query  801   YSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYE----------------  932
             +S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YE                
Sbjct  214   HSPGGLEE---EIMMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEVCIPFCCILHPAYYHC  270

Query  933   -----------ELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCS  1079
                        ELL+LGD+IG+VSTGLREDEI R +RK   P     S  F  E ERKCS
Sbjct  271   HQTVISHFALQELLDLGDKIGYVSTGLREDEITRSIRKVTQPSFG--SFRFATEMERKCS  328

Query  1080  VCQ  1088
             +CQ
Sbjct  329   ICQ  331


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIK+WL  KN CP+CK+  ++
Sbjct  332   EEFEANEEMGRLDCGHSYHVYCIKKWLSQKNTCPVCKTAVTK  373



>ref|XP_010496040.1| PREDICTED: uncharacterized protein LOC104773158 [Camelina sativa]
Length=353

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 174/340 (51%), Gaps = 54/340 (16%)
 Frame = +3

Query  135   SSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIs-----ssrskstisALLLAPFSPA  299
             SS    EH + R T  ++  H     +  P  H++      +S   S +S+  L P S +
Sbjct  2     SSTTIGEHIRLRRTRNQTIRHLDAAEDDPPLSHVVLPISQPNSFCNSAMSSFFLLPASSS  61

Query  300   SPTHDPPITLTPKKKNFTT--FRGLGCTASSQ---VSVPAVIRSSADWDssrrvkkkklr  464
             S +++     T KKK + T  FRG+GCTA++    VSVP+VIRSSADWD+  R +KKK +
Sbjct  62    SNSNE-----TAKKKPYQTASFRGMGCTAAAAAQQVSVPSVIRSSADWDARIRKEKKKHK  116

Query  465   skkkALNSVSAAGDVGGNNVNILSNP-----------PAASSDVWCGPGIGFATDAASVG  611
                   +  +  G     ++ ILS               A  DVWCGPG+GF+TDA    
Sbjct  117   ----KKSKKNNKGSYEDGSIRILSEARDVVDGGGSGGCVAVPDVWCGPGLGFSTDAV---  169

Query  612   CVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSR  791
                          VD     PR R   + RR +  +++    S      +R+   +L SR
Sbjct  170   -------------VDRSVDPPRRRHLPSSRRKIDVDNHTTEGSSVLLTSSRAEPTLLSSR  216

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
                  +  +P+ L E++MLQ+  + G  ++  D Y + RLDVD MSYE+LLELGDRIG+V
Sbjct  217   CRSQLQRSYPDDLTEMMMLQNGFVMGRITDLRDHYHELRLDVDSMSYEQLLELGDRIGYV  276

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TGL+E EI R + K +       +SH LA  +RKCS+CQ
Sbjct  277   NTGLKESEIHRCLGKIRPS-----TSHTLA--DRKCSICQ  309


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+GKL C H +H+HC+KQWL  KNACP+CK TA
Sbjct  310   DEYEREDEVGKLNCEHSFHVHCVKQWLSRKNACPVCKKTA  349



>ref|XP_011008300.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Populus 
euphratica]
Length=179

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = +3

Query  681   RSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRL  860
             R   T R  V PE   FLD+D A   +R  ++V G+R++R+ R+  P+GL  ++MLQ+  
Sbjct  2     RPCLTRRAAVNPETPSFLDTDPAFVTSRPEIEVFGTRYYRHIRHPSPDGLDRMMMLQNSF  61

Query  861   MEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKL  1040
             + GG    DR+ +WRLD+DHM+YE+LLELGDRIG+V+TGL+EDEI   V+K    +  +L
Sbjct  62    IMGGR--LDRFSNWRLDIDHMTYEQLLELGDRIGYVNTGLKEDEISSCVKKINPTIIKEL  119

Query  1041  SSHFLAETERKCSVCQ  1088
              SH     E+KCS+CQ
Sbjct  120   PSHLPMTLEKKCSICQ  135


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             +E+E  DE+GKL CGH +H+ CIK+WL  KN CP+CK+
Sbjct  136   DEFEEADELGKLDCGHGFHVQCIKKWLAQKNTCPVCKT  173



>ref|XP_009418389.1| PREDICTED: uncharacterized protein LOC103998607 [Musa acuminata 
subsp. malaccensis]
Length=340

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 108/181 (60%), Gaps = 5/181 (3%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPED-NPFL  734
             D+WC PG+ FA +A SV CV + +    RG++D  + R         RR+   E  + F+
Sbjct  118   DLWCAPGMPFAAEA-SVDCVAAHQPMVGRGRLDAASERIHRERFFIPRRVSHQEQISSFM  176

Query  735   DSDTASGMTRSRMDVLGSRH-HRYSRYG-FPEGLAEVVMLQSR-LMEGGSEGSDRYRDWR  905
              S           D+L S H HR   Y   P GL  ++M QSR L+ GG +  D++RDWR
Sbjct  177   YSPPDLSTPFFGQDLLPSGHLHRLQGYHRTPSGLEVIMMFQSRVLLGGGLDVYDQFRDWR  236

Query  906   LDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVC  1085
             LDVD+MSYEELLELG++IGHVSTGLRE+EI R +RK K  +    + H   ETE KCS+C
Sbjct  237   LDVDNMSYEELLELGEKIGHVSTGLREEEIARSLRKIKHSVFGASARHLSTETEWKCSIC  296

Query  1086  Q  1088
             Q
Sbjct  297   Q  297


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE  DE G+L CGH YH+HCIKQWLL KNACP+CKS
Sbjct  298   EEYEVSDETGRLECGHGYHMHCIKQWLLLKNACPVCKS  335



>ref|XP_009394645.1| PREDICTED: uncharacterized protein LOC103980085 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 139/262 (53%), Gaps = 34/262 (13%)
 Frame = +3

Query  336   KKKNFTT--FRGLGC-----TASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVS  494
             KKK      FRGLGC     + +   +  A +RSSADW   R  ++++ +  ++   ++ 
Sbjct  99    KKKGLAAAAFRGLGCASASASQAYAPAAAAAVRSSADWQGKRPRRRREKKKAERKNQAI-  157

Query  495   AAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRP  674
                                  DVWC PG+ FA + ASV CVV+ +    RG+ D      
Sbjct  158   --------------------GDVWCAPGMPFAAE-ASVDCVVAHQPMVSRGRPDAAERIH  196

Query  675   RERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGF---PEGLAEVVM  845
             RER     R     E + F+DS           D+  S H R+ R GF   P GL E++M
Sbjct  197   RERPYFPRRVGHREEISTFMDSPPVLDTPFFGPDLFPSGHLRHLR-GFHRAPGGLEELMM  255

Query  846   LQSR-LMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
              Q+R L+ GG +  DR+R+WRLDVD+MSYEELLELGD+IG VSTGLRE+EI R +RK K 
Sbjct  256   FQTRILLGGGLDVYDRFREWRLDVDNMSYEELLELGDKIGSVSTGLREEEIARSLRKIKH  315

Query  1023  PLSAKLSSHFLAETERKCSVCQ  1088
              +    + H   E ERKCS+CQ
Sbjct  316   SVFDASARHLATEIERKCSICQ  337


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEYE++DE G+L CGH YH++CIKQWLL KNACP+CK+
Sbjct  338   EEYEANDETGRLECGHGYHMYCIKQWLLLKNACPVCKA  375



>dbj|BAJ99022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 112/191 (59%), Gaps = 19/191 (10%)
 Frame = +3

Query  558   DVWCG--PGIGFATDAASVGCVVSRR------TASRRGKVDGDTVRPRERSACTLRRMVI  713
             DVWC   PGI FA +A+SV CVV+R          RRG+ D    R RER+A    R V 
Sbjct  112   DVWCTCTPGIPFAAEASSVDCVVARHHHYHAPAPGRRGEADR---RHRERTAEQRARRVT  168

Query  714   PEDN---PFLDSDTASGMTRSRMDVLGSRHHRY-SRYGFPEGLAE--VVMLQSRLMEGGS  875
               ++    F+DS     M     D+L S  HR+ + +G P    E  ++M ++RL+ G  
Sbjct  169   MREHISSSFMDSPPRFHMPFHDADLLHSGRHRHITGFGHPYDRTEEEIMMFRTRLLLGRM  228

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D+Y+DWRLDVD+M+YEELL L DRIG+VSTGLREDEI R +R  K    A    HF 
Sbjct  229   GMYDQYQDWRLDVDNMNYEELLALEDRIGYVSTGLREDEIVRGLRVGK--HQAFERKHFS  286

Query  1056  AETERKCSVCQ  1088
              ETER+CS+CQ
Sbjct  287   TETERRCSICQ  297


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             E++E+ +E+G+L CGH YH+HCIKQWL  KNACP+CK   S+
Sbjct  298   EDFEASEEVGRLSCGHGYHVHCIKQWLSRKNACPLCKIPVSK  339



>gb|KFK41819.1| hypothetical protein AALP_AA2G175100 [Arabis alpina]
Length=361

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 126/344 (37%), Positives = 182/344 (53%), Gaps = 44/344 (13%)
 Frame = +3

Query  114   MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFS  293
             MPV    S+ +G    Q +   PR+    +P+    P P+ I  S   S     LL    
Sbjct  1     MPVSTEPSTTIG---QQIKLQKPRNLRPDEPLI---PKPNRICKSAMSSF---FLL----  47

Query  294   PASPTHDPPITLTPKKKNFTTFRGLGCTASS--QVSVPAVIRSSADWDssrrvkkkklrs  467
             P   T   P T  P+  + ++F GL CTAS+  QVSVPAVIRSSADWD++   K KK++ 
Sbjct  48    PNETTRKKP-TGFPQTGSSSSFLGLSCTASASQQVSVPAVIRSSADWDATNFKKTKKVKK  106

Query  468   kkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCV------VSRR  629
             KKK   +  +       +V IL+           GPG+GF+TDA   G +      +SRR
Sbjct  107   KKKGSYNGGSGS----GSVKILTEVDRTGCVGC-GPGVGFSTDAVVGGSIDSVEPDLSRR  161

Query  630   TASRRGKVDG--------DTVRPRERSACTL-RRMVIPEDNPFLDSDTASGMTRSRMDVL  782
                 R K+DG             RE S+  + RR    E NP+ ++D+    +R+ +   
Sbjct  162   NIPVRRKIDGGDNNKNSSSNSNQREGSSSVIPRRSQNQESNPYFEADSTFSTSRAELTQF  221

Query  783   GSRHHRYSRYGFPEGLAEVVMLQSRLMEGG--SEGSDRYRDWRLDVDHMSYEELLELGDR  956
               R+HR+ R  + +G+ E++M+Q+  + GG  S   D +RD RL+VD+M+YE+LLELGD+
Sbjct  222   ADRYHRHLRQSYTDGITEMMMMQNGFVMGGALSAAHDHFRDLRLNVDNMTYEQLLELGDK  281

Query  957   IGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             IG+V+TGL E +I   +RK K P    L S  LA  +RKC +CQ
Sbjct  282   IGYVNTGLTEKQIKSSLRKVK-PF---LKSTPLA--DRKCCICQ  319


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             EEY   D +GKL C H +HI C+KQWL+ KN+CP+CK+
Sbjct  320   EEYSEKDNVGKLRCDHRFHIDCVKQWLMIKNSCPVCKT  357



>dbj|BAJ89596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 112/191 (59%), Gaps = 19/191 (10%)
 Frame = +3

Query  558   DVWCG--PGIGFATDAASVGCVVSRRTAS------RRGKVDGDTVRPRERSACTLRRMVI  713
             DVWC   PGI FA +A+SV CVV+R          RRG+ D    R RER+A    R V 
Sbjct  112   DVWCTCTPGIPFAAEASSVDCVVARHHHHHAPAPGRRGEADR---RHRERTAEQRARRVT  168

Query  714   PEDN---PFLDSDTASGMTRSRMDVLGSRHHRY-SRYGFPEGLAE--VVMLQSRLMEGGS  875
               ++    F+DS     M     D+L S  HR+ + +G P    E  ++M ++RL+ G  
Sbjct  169   MREHISSSFMDSPPRFHMPFHDADLLHSGRHRHITGFGHPYDRTEEEIMMFRTRLLLGRM  228

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D+Y+DWRLDVD+M+YEELL L DRIG+VSTGLREDEI R +R  K    A    HF 
Sbjct  229   GMYDQYQDWRLDVDNMNYEELLALEDRIGYVSTGLREDEIVRGLRVGK--HQAFERKHFS  286

Query  1056  AETERKCSVCQ  1088
              ETER+CS+CQ
Sbjct  287   TETERRCSICQ  297


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             E++E+ +E+G+L CGH YH+HCIKQWL  KNACP+CK   S+
Sbjct  298   EDFEASEEVGRLSCGHGYHVHCIKQWLSRKNACPLCKIPVSK  339



>ref|XP_002440194.1| hypothetical protein SORBIDRAFT_09g027550 [Sorghum bicolor]
 gb|EES18624.1| hypothetical protein SORBIDRAFT_09g027550 [Sorghum bicolor]
Length=376

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 110/192 (57%), Gaps = 29/192 (15%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVS-RRTASRRGKVDGDTVRPRERSACTLRRMVIPE-----  719
             DVWC PGI FA +A+SV CVV+  +T + R + + D  R     A   RR+ + E     
Sbjct  156   DVWCTPGIPFAAEASSVDCVVAPHQTVATRRRAEADRPRRERPGAPPARRVTMREHMSSS  215

Query  720   --------DNPFLDSDTA-SGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGG  872
                     D PF+D+D A SG  R    + G RH R           E +M ++R++ G 
Sbjct  216   PLSSPPHHDMPFVDADRAPSGRIRH---ISGRRHARAE---------EEMMFRTRILLGR  263

Query  873   SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHF  1052
                 D+Y+DWRLDVD+M+YEELL+L DRIG+VSTGLREDEI + +R  K   SA    HF
Sbjct  264   MGIYDQYQDWRLDVDNMTYEELLDLEDRIGYVSTGLREDEIIQSLRMVK--YSAFNPKHF  321

Query  1053  LAETERKCSVCQ  1088
               E +R+CS+CQ
Sbjct  322   STEMDRRCSICQ  333


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++E GKL CGH YH+HCIKQWL  KNACP+CK+T S+ 
Sbjct  334   EEFEANEETGKLSCGHTYHVHCIKQWLSRKNACPVCKTTVSKT  376



>ref|XP_003567954.1| PREDICTED: uncharacterized protein LOC100839508 [Brachypodium 
distachyon]
Length=343

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = +3

Query  558   DVWCG--PGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSA-CTLRRMVIPE--D  722
             DVWC   PGI FA +A+SV CVV+R+  +  G+      R RER+A    RR+ + E   
Sbjct  118   DVWCTCTPGIPFAAEASSVDCVVARQQTAGAGRRGEAERRHRERTADQRARRVTMREHIS  177

Query  723   NPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLA----EVVMLQSRLMEGGSEGSDR  890
             + F+DS     M     D+L S  HR+   GF         E++M ++RL+ G     D+
Sbjct  178   SSFMDSPPRFHMPFHEADLLHSGRHRHI-GGFGHSHVRTEEEIMMFRTRLLLGRMGMYDQ  236

Query  891   YRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETER  1070
             Y+DWRLDVD+M+YEELL L DRIG+VSTGLREDEI R +R  K   SA    HF  E E+
Sbjct  237   YQDWRLDVDNMNYEELLALEDRIGYVSTGLREDEIIRSLRMVK--HSAFDHKHFPTEAEK  294

Query  1071  KCSVCQ  1088
              CS+CQ
Sbjct  295   SCSICQ  300


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+ +EMG+L CGH YH+HCIKQWL  KNACP+CK   S+
Sbjct  301   EEFEASEEMGRLGCGHSYHVHCIKQWLSRKNACPVCKIAVSK  342



>ref|NP_173239.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAL16122.1|AF428290_1 At1g17970/F2H15_16 [Arabidopsis thaliana]
 gb|AAM51597.1| At1g17970/F2H15_16 [Arabidopsis thaliana]
 gb|AEE29657.1| tunicamycin Induced 1 [Arabidopsis thaliana]
Length=368

 Score =   125 bits (314),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 164/338 (49%), Gaps = 35/338 (10%)
 Frame = +3

Query  135   SSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHD  314
             SS    EH + R    ++  H     +  P  H++      +      ++ F P  PT  
Sbjct  2     SSTTIGEHIRLRRARNQTIRHLHAADDDPPLSHVVLPISQPNRFCNSAMSSFFPL-PTSS  60

Query  315   PPITLTPKKKNFTTFRGLGC-----TASSQVSVPAVIRSSADWDssrrvkkkklrskkkA  479
                +   K    ++FRG+GC      A+ +VSVP+VIR SAD D+  R  KKK + K K 
Sbjct  61    SNESTRKKPYQTSSFRGMGCYAAAAAAAQEVSVPSVIRYSADLDARIRKDKKKKKHKHKK  120

Query  480   LNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRGK  650
                    G     ++ ILS       DVWC PG+GF+TDA    SV     R   S R K
Sbjct  121   -KKKKNKGSYEDGSIRILSEEARDVIDVWCRPGLGFSTDAVIGRSVDPPRGRNIPSSRRK  179

Query  651   VDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASG---------MTRSRMD--VLGSRHH  797
             +D D          TL   V+P    FL+ +T S          +T SR +  +L SR  
Sbjct  180   IDVDNNNYNH----TLGSSVLPIR--FLNQETHSHDIFNSDSTFVTSSRAEPTMLSSRCR  233

Query  798   RYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVST  974
              +    +P+ L E+ MLQ+  + G  ++  D Y + RLDVD MSYE+LLELGDRIG+V+T
Sbjct  234   GHLPRSYPDDLTEMRMLQNGFVMGRITDSRDNYHELRLDVDSMSYEQLLELGDRIGYVNT  293

Query  975   GLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             GL+E EI R + K K  +S  L        +RKCS+CQ
Sbjct  294   GLKESEIHRCLGKIKPSVSHTL-------VDRKCSICQ  324


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+G+L CGH +H+HC+KQWL  KNACP+CK  A
Sbjct  325   DEYEREDEVGELNCGHSFHVHCVKQWLSRKNACPVCKKAA  364



>gb|EMT25614.1| E3 ubiquitin-protein ligase RLIM [Aegilops tauschii]
Length=281

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 95/177 (54%), Gaps = 56/177 (32%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLD  737
             DVWC PGI FA +A+SV CVV+R     RG+  GD+ RP                     
Sbjct  118   DVWCAPGIPFAAEASSVDCVVARHQMLGRGR-GGDSERP---------------------  155

Query  738   SDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVD  917
                                HR           E++M Q+R++ GG    DRY+DWRLDVD
Sbjct  156   -------------------HR-----------EIMMFQTRVLLGGMNMYDRYQDWRLDVD  185

Query  918   HMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +M+YEELLELG+RIGHV+TGLREDEI R +RK K P S   S  F  E E+KCS+CQ
Sbjct  186   NMTYEELLELGERIGHVNTGLREDEIIRNLRKVK-PDS---SFRFPTEVEKKCSICQ  238


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E++DEMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  239   EEFEANDEMGRLGCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  280



>gb|AAM63662.1| zinc-finger protein (C-terminal), putative [Arabidopsis thaliana]
Length=368

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 163/338 (48%), Gaps = 35/338 (10%)
 Frame = +3

Query  135   SSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHD  314
             SS    EH + R    ++  H     +  P  H++      +      +  F P  PT  
Sbjct  2     SSTTIGEHIRLRRARNQTIRHLHAADDDPPLSHVVLPISQPNRFCNSAMXSFFPL-PTSS  60

Query  315   PPITLTPKKKNFTTFRGLGC-----TASSQVSVPAVIRSSADWDssrrvkkkklrskkkA  479
                +   K    ++FRG+GC      A+ +VSVP+VIR SAD D+  R  KKK + K K 
Sbjct  61    SNESTRKKPYQTSSFRGMGCYAAAAAAAQEVSVPSVIRYSADLDARIRKDKKKKKHKHKK  120

Query  480   LNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRGK  650
                    G     ++ ILS       DVWC PG+GF+TDA    SV     R   S R K
Sbjct  121   -KKKKNKGSYEDGSIRILSEEARDVIDVWCRPGLGFSTDAVIGRSVDPPRGRNIPSSRRK  179

Query  651   VDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASG---------MTRSRMD--VLGSRHH  797
             +D D          TL   V+P    FL+ +T S          +T SR +  +L SR  
Sbjct  180   IDVDNNNYNH----TLGSSVLPIR--FLNQETHSHDIFNSDSTFVTSSRAEPTMLSSRCR  233

Query  798   RYSRYGFPEGLAEVVMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVST  974
              +    +P+ L E+ MLQ+  + G  ++  D Y + RLDVD MSYE+LLELGDRIG+V+T
Sbjct  234   GHLPRSYPDDLTEMRMLQNGFVMGRITDSRDNYHELRLDVDSMSYEQLLELGDRIGYVNT  293

Query  975   GLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             GL+E EI R + K K  +S  L        +RKCS+CQ
Sbjct  294   GLKESEIHRCLGKIKPSVSHTL-------VDRKCSICQ  324


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+G+L CGH +H+HC+KQWL  KNACP+CK  A
Sbjct  325   DEYEREDEVGELNCGHSFHVHCVKQWLSRKNACPVCKKAA  364



>ref|XP_004961323.1| PREDICTED: E3 ubiquitin-protein ligase Arkadia-like [Setaria 
italica]
Length=365

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 110/191 (58%), Gaps = 24/191 (13%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVS-RRTASRRGKVDGDTVRPRERSACTLRRMVIPEDN---  725
             DVWC PGI FA +A+SV CVV+  +TA  R + + +  R     A   RR+ + E     
Sbjct  142   DVWCTPGIPFAAEASSVNCVVAPHQTAGARRRAEAERPRRERPGAPPARRVTMREHMSSS  201

Query  726   ----------PFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS  875
                       PF+D+D A  +    M     R H ++R        E++M ++R++ G  
Sbjct  202   PMNSPPHHGMPFIDADRAPSVRNRHMS---GRRHSHARLE-----EEMMMFRTRILLGRM  253

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D+Y+DWRLDVD+M+YEELL+L D+IG+VSTGLREDEI R +R  K   SA    HF 
Sbjct  254   GMYDQYQDWRLDVDNMTYEELLDLEDQIGYVSTGLREDEITRSLRMVK--YSAFNPKHFS  311

Query  1056  AETERKCSVCQ  1088
             AE +R+CS+CQ
Sbjct  312   AEMDRRCSICQ  322


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++E GKL CGH YH+HCIKQWL  KNACP+CK+T S++
Sbjct  323   EEFEANEETGKLSCGHSYHVHCIKQWLSRKNACPVCKTTVSKI  365



>ref|NP_001152137.1| protein binding protein [Zea mays]
 gb|ACG46040.1| protein binding protein [Zea mays]
 gb|AFW83635.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=179

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = +3

Query  720   DNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRD  899
             D PF  +D        RM     R +RYS  G  E   E++M Q+R++ GG    DRY+D
Sbjct  24    DAPFFGADLIPSGRLRRM-----RGYRYSPGGLEE---EIMMFQTRVLLGGMNMYDRYQD  75

Query  900   WRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCS  1079
             WRLDVD+M+YEEL+ELGDRIG+V+TGLREDEI R +RK K P    L   F AE ERKC+
Sbjct  76    WRLDVDNMTYEELVELGDRIGYVNTGLREDEIARSLRKAKHPSFGSL--RFAAEVERKCT  133

Query  1080  VCQ  1088
             +CQ
Sbjct  134   ICQ  136


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE++S++EMG+LVCGH YH+ CIKQWL  KN CP+CK+  S+
Sbjct  137   EEFQSNEEMGRLVCGHSYHVLCIKQWLSQKNTCPVCKTAVSK  178



>gb|AFK36484.1| unknown [Lotus japonicus]
Length=164

 Score =   117 bits (294),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 16/132 (12%)
 Frame = +3

Query  705   MVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFP----EGLAEVVMLQSRLMEGG  872
             MV PE   FLD D+         DV   R  R+ R+  P    + LAE+V +Q RLM G 
Sbjct  1     MVNPESISFLDDDS---------DVFPIRPARFYRHNIPHPSADHLAEIVKIQGRLMGGR  51

Query  873   SEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHF  1052
                 D++RDWRLD+D+MSYE+LLELG++IG+V+TG++EDE++  +RK KL +S   S H 
Sbjct  52    LNSHDQFRDWRLDIDNMSYEQLLELGEKIGYVNTGVKEDEMELNIRKLKLFISNDTSKHQ  111

Query  1053  LAETERKCSVCQ  1088
             L   +RKC++CQ
Sbjct  112   L---DRKCTICQ  120


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+GKL C H +H  CIKQWL+ KN CP+CK
Sbjct  121   EEYESDDELGKLKCEHCFHFQCIKQWLVLKNFCPVCK  157



>gb|EEE64599.1| hypothetical protein OsJ_19451 [Oryza sativa Japonica Group]
Length=359

 Score =   120 bits (300),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 106/194 (55%), Gaps = 14/194 (7%)
 Frame = +3

Query  543   PAASSDVWC--GPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSAC---TLRRM  707
             PAA+ D+WC  GPGI FA +A+SV CV+      R     GD +RP           RR+
Sbjct  125   PAAAGDLWCTWGPGIPFAAEASSVECVLGGAPPPRPPHGGGDGLRPPRGGGAGPQRARRV  184

Query  708   VIPE--DNPFLDSDTASGMTRSRMDVL-----GSRHHRYSRYGFPEGLAEVVMLQSRLME  866
              + E   +  +DS     M     D+L     G   H Y          E++ML++RL+ 
Sbjct  185   TMREHISSSLMDSPPFPDMPLLNADLLPPPPSGRHRHGYRHPHVGAAEEEIMMLRTRLLW  244

Query  867   GGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSS  1046
             G     D+++DWRLDVD+M+YEELL+L DRIG+VSTGL +DEI R +R  K   SA    
Sbjct  245   GRFGMHDQHQDWRLDVDNMTYEELLDLEDRIGYVSTGLHDDEIARSLRMVK--YSAFNPK  302

Query  1047  HFLAETERKCSVCQ  1088
             HF  E ER CS+CQ
Sbjct  303   HFATEVERNCSICQ  316


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++E G+L+CGH YH+ CIKQWL  KN CP+CK+  S+
Sbjct  317   EEFEANEETGRLICGHSYHVQCIKQWLSRKNTCPVCKTVVSK  358



>ref|XP_002282898.1| PREDICTED: uncharacterized protein LOC100252628 isoform X1 [Vitis 
vinifera]
Length=351

 Score =   119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 167/337 (50%), Gaps = 47/337 (14%)
 Frame = +3

Query  123   VVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNP--HLIsssrskstisALLLAPFSP  296
             +V+++SR  ++H  +R   PR Q    P +  DP P  HLI     K +  + LL   SP
Sbjct  3     IVAETSR-SSQH--ARLRRPRKQ----PTSAPDPTPQTHLIVHPTRKKSTISGLLG--SP  53

Query  297   ASPTHDPPITLTPKKKNF------TTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkk  458
              S T+D   +L  KK N           GLGC    +   P V+ SS +W +++  KKKK
Sbjct  54    FSDTNDNAASLLSKKTNKKKTFTSVALSGLGCV---KCLSPVVVGSSGEWGANKVRKKKK  110

Query  459   lrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFA-TDAASVGCVVSRRTA  635
              + + +  N+ +    + G    +         D+ C PGIG A ++AA V  V   R+ 
Sbjct  111   KKQRMRVENATAKTTTLNGA---MSPRVVVVVPDLCCTPGIGLAASNAALVDFVEPTRSL  167

Query  636   SRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRS---RMDVLGSRHHRYS  806
             S RG+V+            T  R          D D ASG   S   R D  G       
Sbjct  168   SSRGRVNAHR---------TNNRERGRTRRRGSDHDQASGSHISNARRYDDFG-------  211

Query  807   RYGFPEGLA--EVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTG  977
              +G   GL+  E+++LQS L+ G + EGSDRY DWRLDVDHMSYEELL+LGDRIG+V TG
Sbjct  212   -HGSSGGLSRSEMMILQSSLLFGENVEGSDRYGDWRLDVDHMSYEELLDLGDRIGYVGTG  270

Query  978   LREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             LREDEI R +R  K P+   L          +CS+CQ
Sbjct  271   LREDEIFRCLRNMKHPILDSLPLLSSTGDNWRCSICQ  307


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKN  1430
             EEYE+DDE+G+L CGH YHIHCI+QWLL KN
Sbjct  308   EEYEADDEVGRLDCGHCYHIHCIRQWLLRKN  338



>ref|XP_010664821.1| PREDICTED: uncharacterized protein LOC100252628 isoform X2 [Vitis 
vinifera]
Length=350

 Score =   119 bits (298),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 167/337 (50%), Gaps = 47/337 (14%)
 Frame = +3

Query  123   VVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNP--HLIsssrskstisALLLAPFSP  296
             +V+++SR  ++H  +R   PR Q    P +  DP P  HLI     K +  + LL   SP
Sbjct  3     IVAETSR-SSQH--ARLRRPRKQ----PTSAPDPTPQTHLIVHPTRKKSTISGLLG--SP  53

Query  297   ASPTHDPPITLTPKKKNF------TTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkk  458
              S T+D   +L  KK N           GLGC    +   P V+ SS +W +++  KKKK
Sbjct  54    FSDTNDNAASLLSKKTNKKKTFTSVALSGLGCV---KCLSPVVVGSSGEWGANKVRKKKK  110

Query  459   lrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFA-TDAASVGCVVSRRTA  635
              + + +  N+ +    + G    +         D+ C PGIG A ++AA V  V   R+ 
Sbjct  111   KKQRMRVENATAKTTTLNGA---MSPRVVVVVPDLCCTPGIGLAASNAALVDFVEPTRSL  167

Query  636   SRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRS---RMDVLGSRHHRYS  806
             S RG+V+            T  R          D D ASG   S   R D  G       
Sbjct  168   SSRGRVNAHR---------TNNRERGRTRRRGSDHDQASGSHISNARRYDDFG-------  211

Query  807   RYGFPEGLA--EVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTG  977
              +G   GL+  E+++LQS L+ G + EGSDRY DWRLDVDHMSYEELL+LGDRIG+V TG
Sbjct  212   -HGSSGGLSRSEMMILQSSLLFGENVEGSDRYGDWRLDVDHMSYEELLDLGDRIGYVGTG  270

Query  978   LREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             LREDEI R +R  K P+   L          +CS+CQ
Sbjct  271   LREDEIFRCLRNMKHPILDSLPLLSSTGDNWRCSICQ  307


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKN  1430
             +EYE+DDE+G+L CGH YHIHCI+QWLL KN
Sbjct  307   QEYEADDEVGRLDCGHCYHIHCIRQWLLRKN  337



>gb|AFW79024.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=356

 Score =   119 bits (298),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 104/192 (54%), Gaps = 25/192 (13%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVS--------------RRTASRRGKVDGDTVRPRERSACT  695
             DVWC PGI FA +A+SV CVV+              R    R G      V  RE  + +
Sbjct  152   DVWCTPGIPFAAEASSVDCVVAPHHTVAARRRAEADRPRRERPGAPPARRVTMREHMSSS  211

Query  696   LRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS  875
                       PF+D D A      R+  +  R H ++R      + E +M Q+R++ G  
Sbjct  212   PLSSPPHHVMPFVDVDRAPS---GRIRHVSGRRHSHAR------VEEEMMFQTRMLLGRM  262

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D+Y+DWRLDVD+M+YEELL+L DRIG+VSTGLREDEI + +R  K   SA    HF 
Sbjct  263   GIYDQYQDWRLDVDNMTYEELLDLEDRIGYVSTGLREDEIIQSLRMVK--YSAFNPRHFS  320

Query  1056  AETERKCSVCQV  1091
              E +R+CS+CQV
Sbjct  321   TEMDRRCSICQV  332



>emb|CDM83681.1| unnamed protein product [Triticum aestivum]
Length=175

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = +3

Query  720   DNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRD  899
             D PF  +D        RM     R +R S  G  E   E++M Q+R++ GG    DRY+D
Sbjct  22    DGPFFGADLLPSARLRRM-----RGYRPSPGGLEE---EIMMFQTRVLLGGMNMYDRYQD  73

Query  900   WRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCS  1079
             WRLDVD+M+YEELLELG+RIGHV+TGLREDEI R +RK K   S +L +    E E+KCS
Sbjct  74    WRLDVDNMTYEELLELGERIGHVNTGLREDEIVRNLRKVKPDSSFRLPT----EAEKKCS  129

Query  1080  VCQ  1088
             +CQ
Sbjct  130   ICQ  132


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E++DE+G+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  133   EEFEANDELGRLGCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  174



>ref|NP_001172514.1| Os01g0692700 [Oryza sativa Japonica Group]
 gb|EEC71316.1| hypothetical protein OsI_03353 [Oryza sativa Indica Group]
 dbj|BAH91244.1| Os01g0692700 [Oryza sativa Japonica Group]
Length=201

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 89/160 (56%), Gaps = 25/160 (16%)
 Frame = +3

Query  657   GDTVRPRERSACTLRRMVIPED----------------NPFLDSDTASGMTRSRMDVLGS  788
             GD  RP     C  RR+ + E                  PF  +D        RM     
Sbjct  8     GDAERPHRERPCLSRRVTVQEQISSSFMDSPPPPHLDVAPFFGADLLPSGRLRRM-----  62

Query  789   RHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHV  968
             R +R+S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+IG+V
Sbjct  63    RGYRHSPVGLEE---EIMMFQTRVLLGGMSMYDRYQDWRLDVDNMTYEELLELGDKIGYV  119

Query  969   STGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TGLREDEI R +RK K P +   S  +  E E+KCS+CQ
Sbjct  120   NTGLREDEIVRNLRKVKHP-AFDSSFRYSTEMEKKCSICQ  158


 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  159   EEFEANEEMGRLDCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  200



>ref|XP_008649966.1| PREDICTED: E3 ubiquitin-protein ligase Arkadia-like [Zea mays]
 gb|AFW79023.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=374

 Score =   117 bits (292),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 103/191 (54%), Gaps = 25/191 (13%)
 Frame = +3

Query  558   DVWCGPGIGFATDAASVGCVVS--------------RRTASRRGKVDGDTVRPRERSACT  695
             DVWC PGI FA +A+SV CVV+              R    R G      V  RE  + +
Sbjct  152   DVWCTPGIPFAAEASSVDCVVAPHHTVAARRRAEADRPRRERPGAPPARRVTMREHMSSS  211

Query  696   LRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGS  875
                       PF+D D A      R+  +  R H ++R      + E +M Q+R++ G  
Sbjct  212   PLSSPPHHVMPFVDVDRAPS---GRIRHVSGRRHSHAR------VEEEMMFQTRMLLGRM  262

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D+Y+DWRLDVD+M+YEELL+L DRIG+VSTGLREDEI + +R  K   SA    HF 
Sbjct  263   GIYDQYQDWRLDVDNMTYEELLDLEDRIGYVSTGLREDEIIQSLRMVK--YSAFNPRHFS  320

Query  1056  AETERKCSVCQ  1088
              E +R+CS+CQ
Sbjct  321   TEMDRRCSICQ  331


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E  +E GKL CGH YH+HCIKQWL  KNACP+CK+T S+
Sbjct  332   EEFEVHEETGKLSCGHSYHVHCIKQWLSRKNACPVCKTTVSK  373



>gb|EAY98923.1| hypothetical protein OsI_20878 [Oryza sativa Indica Group]
Length=359

 Score =   116 bits (291),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 111/203 (55%), Gaps = 26/203 (13%)
 Frame = +3

Query  543   PAASSDVWC--GPGIGFATDAASVGCVVSRRT-----------ASRRGKVDGDTVRPRER  683
             PA + DVWC   PGI FA +A+SV CVV  R            + RRG+ +    R RER
Sbjct  119   PAEAGDVWCTCAPGIPFAAEASSVDCVVVARHHHAHHTAAAMGSGRRGEAE---RRHRER  175

Query  684   -SACTLRRMVIPE--DNPFLDSDTASGMTRSRMDVL-----GSRHHRYSRYGFPEGLAEV  839
              SA   RR+ + E   +  +DS     M     D+L     G   H Y          E+
Sbjct  176   PSAPRARRVTMREHISSSLMDSPPFPDMPLLNADLLPPPPSGRHRHGYRHPHVGAAEEEI  235

Query  840   VMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK  1019
             +ML++RL+ G     D+++DWRLDVD+M+YEELL+L DRIG+VSTGL +DEI R +R  K
Sbjct  236   MMLRTRLLWGRFGMHDQHQDWRLDVDNMTYEELLDLEDRIGYVSTGLHDDEIARSLRMVK  295

Query  1020  LPLSAKLSSHFLAETERKCSVCQ  1088
                SA    HF  E ER CS+CQ
Sbjct  296   --YSAFNPKHFATEVERNCSICQ  316


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++E G+L+CGH YH+ CIKQWL  KN CP+CK+  S+ 
Sbjct  317   EEFEANEETGRLICGHSYHVQCIKQWLSRKNTCPVCKTVVSKT  359



>gb|AAF97276.1|AC034106_19 Contains similarity to RING-H2 finger protein RHG1a (partial) 
from Arabidopsis thaliana gb|AF079183 and contains a Zinc finger 
(C3HC4 type) PF|00097 domain. EST gb|AV522036 comes from 
this gene [Arabidopsis thaliana]
Length=383

 Score =   117 bits (292),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 119/353 (34%), Positives = 164/353 (46%), Gaps = 50/353 (14%)
 Frame = +3

Query  135   SSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPHLIsssrskstisALLLAPFSPASPTHD  314
             SS    EH + R    ++  H     +  P  H++      +      ++ F P  PT  
Sbjct  2     SSTTIGEHIRLRRARNQTIRHLHAADDDPPLSHVVLPISQPNRFCNSAMSSFFPL-PTSS  60

Query  315   PPITLTPKKKNFTTFRGLGC-----TASSQVSVPAVIRSSADWDssrrvkkkklrskkkA  479
                +   K    ++FRG+GC      A+ +VSVP+VIR SAD D+  R  KKK + K K 
Sbjct  61    SNESTRKKPYQTSSFRGMGCYAAAAAAAQEVSVPSVIRYSADLDARIRKDKKKKKHKHKK  120

Query  480   LNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTASRRGK  650
                    G     ++ ILS       DVWC PG+GF+TDA    SV     R   S R K
Sbjct  121   -KKKKNKGSYEDGSIRILSEEARDVIDVWCRPGLGFSTDAVIGRSVDPPRGRNIPSSRRK  179

Query  651   VDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASG---------MTRSRMD--VLGSRHH  797
             +D D          TL   V+P    FL+ +T S          +T SR +  +L SR  
Sbjct  180   IDVDNNNYNH----TLGSSVLPIR--FLNQETHSHDIFNSDSTFVTSSRAEPTMLSSRCR  233

Query  798   RYSRYGFPEGLAEVV---------------MLQSRLMEGG-SEGSDRYRDWRLDVDHMSY  929
              +    +P+ L EV                MLQ+  + G  ++  D Y + RLDVD MSY
Sbjct  234   GHLPRSYPDDLTEVECSCQIVALSFLHLMRMLQNGFVMGRITDSRDNYHELRLDVDSMSY  293

Query  930   EELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             E+LLELGDRIG+V+TGL+E EI R + K K  +S  L        +RKCS+CQ
Sbjct  294   EQLLELGDRIGYVNTGLKESEIHRCLGKIKPSVSHTL-------VDRKCSICQ  339


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYE +DE+G+L CGH +H+HC+KQWL  KNACP+CK  A
Sbjct  340   DEYEREDEVGELNCGHSFHVHCVKQWLSRKNACPVCKKAA  379



>ref|XP_002890255.1| hypothetical protein ARALYDRAFT_312759 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66514.1| hypothetical protein ARALYDRAFT_312759 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   116 bits (291),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 142/292 (49%), Gaps = 67/292 (23%)
 Frame = +3

Query  330   TPKKKNFTT--FRGLGCTAS----SQVSVPAVIRSSADWDssrrvkkkklrskkkALNS-  488
             T +KK + T  FRG+GCTA+     +VSVP+VIRSSADWD+  R  KKK   KKK   S 
Sbjct  54    TTRKKPYQTSSFRGMGCTAAAAAAQEVSVPSVIRSSADWDARIRKDKKKKHKKKKNKGSY  113

Query  489   -------VSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA---SVGCVVSRRTAS  638
                    ++ A DV G           A  DVWCGPG+GF+TDA    SV  +  +   S
Sbjct  114   EDGSIRILNEARDVDGGGC-------VAIPDVWCGPGLGFSTDAVVDRSVDPLRRKNIPS  166

Query  639   RRGKVD------GDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHR  800
              R  +D      G +V     S           D+ F+ S  A   +R R  +       
Sbjct  167   SRRNIDVDNNTQGSSVDQESHS-----HAFFNSDSTFVTSSRAEPTSRCRGHL-------  214

Query  801   YSRYGFPEGLAEV---------------VMLQSRLMEGG-SEGSDRYRDWRLDVDHMSYE  932
               R  + + L +V               +MLQ+  + G  ++  D Y + RLDVD MSYE
Sbjct  215   --RRSYRDDLTQVECSCQIVALSFLYLMMMLQNGFVMGRITDSRDHYHELRLDVDSMSYE  272

Query  933   ELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +LLELGDRIG+V TGL+E EI R + K    +S  L        +RKCS+CQ
Sbjct  273   QLLELGDRIGYVKTGLKESEIHRCLGKITPSISHTLG-------DRKCSICQ  317


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             +EYES+DE+GKL CGH +H+HC+KQWL  KNACP+CK TA
Sbjct  318   DEYESEDEVGKLNCGHSFHVHCVKQWLSRKNACPVCKKTA  357



>gb|EEE55221.1| hypothetical protein OsJ_03093 [Oryza sativa Japonica Group]
Length=167

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 9/121 (7%)
 Frame = +3

Query  726   PFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWR  905
             PF  +D        RM     R +R+S  G  E   E++M Q+R++ GG    DRY+DWR
Sbjct  13    PFFGADLLPSGRLRRM-----RGYRHSPVGLEE---EIMMFQTRVLLGGMSMYDRYQDWR  64

Query  906   LDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVC  1085
             LDVD+M+YEELLELGD+IG+V+TGLREDEI R +RK K P +   S  +  E E+KCS+C
Sbjct  65    LDVDNMTYEELLELGDKIGYVNTGLREDEIVRNLRKVKHP-AFDSSFRYSTEMEKKCSIC  123

Query  1086  Q  1088
             Q
Sbjct  124   Q  124


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  125   EEFEANEEMGRLDCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  166



>ref|XP_002458351.1| hypothetical protein SORBIDRAFT_03g031830 [Sorghum bicolor]
 gb|EES03471.1| hypothetical protein SORBIDRAFT_03g031830 [Sorghum bicolor]
Length=201

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = +3

Query  720   DNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRD  899
             D PF  +D        RM     R +R+S  G  E   E++M Q+R++ GG    DRY+D
Sbjct  46    DAPFFGADLIPSGRLRRM-----RGYRHSPGGLEE---EIMMFQTRVLLGGMNMYDRYQD  97

Query  900   WRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCS  1079
             WRLDVD+M+YEELLEL D+IG+V+TGLREDEI R ++K K P  +  S  F  E ERKCS
Sbjct  98    WRLDVDNMTYEELLELEDKIGYVNTGLREDEITRNLKKVKHPSFS--SFRFATEMERKCS  155

Query  1080  VCQ  1088
             +CQ
Sbjct  156   ICQ  158


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  S+
Sbjct  159   EEFEANEEMGRLDCGHSYHVYCIKQWLSQKNTCPVCKTAVSK  200



>gb|EMS63205.1| E3 ubiquitin ligase BIG BROTHER [Triticum urartu]
Length=179

 Score =   109 bits (272),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +3

Query  804   SRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLR  983
             S +G    L +++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELG+RIGHV+TGLR
Sbjct  46    SGWGNLTCLGQIMMFQTRVLLGGMNVYDRYQDWRLDVDNMTYEELLELGERIGHVNTGLR  105

Query  984   EDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             EDEI R +RK K P S   S  F  E E+KCS+CQ
Sbjct  106   EDEIVRNLRKVK-PDS---SFQFPTEVEKKCSICQ  136


 Score = 72.0 bits (175),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E++DEMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  137   EEFEANDEMGRLGCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  178



>dbj|BAG89594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=153

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+IG+V+TGLREDEI R +RK
Sbjct  27    QIMMFQTRVLLGGMSMYDRYQDWRLDVDNMTYEELLELGDKIGYVNTGLREDEIVRNLRK  86

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K P +   S  +  E E+KCS+CQ
Sbjct  87    VKHP-AFDSSFRYSTEMEKKCSICQ  110


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  111   EEFEANEEMGRLDCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  152



>ref|XP_008655108.1| PREDICTED: protein binding protein isoform X2 [Zea mays]
Length=353

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             E++M Q+R++ GG    DRY+DWRLDVD+M+YEEL+ELGDRIG+V+TGLREDEI R +RK
Sbjct  228   EIMMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELVELGDRIGYVNTGLREDEIARSLRK  287

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K P    L   F AE ERKC++CQ
Sbjct  288   AKHPSFGSL--RFAAEVERKCTICQ  310


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE++S++EMG+LVCGH YH+ CIKQWL  KN CP+CK+  S+
Sbjct  311   EEFQSNEEMGRLVCGHSYHVLCIKQWLSQKNTCPVCKTAVSK  352



>gb|AAT39263.1| unknown protein [Oryza sativa Japonica Group]
Length=364

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 107/198 (54%), Gaps = 26/198 (13%)
 Frame = +3

Query  558   DVWC--GPGIGFATDAASVGCVVSRRT-----------ASRRGKVDGDTVRPRERSAC-T  695
             DVWC   PGI FA +A+SV CVV  R            + RRG+ +    R RER A   
Sbjct  129   DVWCTCAPGIPFAAEASSVDCVVVARHHHAHHTAAAMGSGRRGEAE---RRHRERPAAPR  185

Query  696   LRRMVIPE--DNPFLDSDTASGMTRSRMDVL-----GSRHHRYSRYGFPEGLAEVVMLQS  854
              RR+ + E   +  +DS     M     D+L     G   H Y          E++ML++
Sbjct  186   ARRVTMREHISSSLMDSPPFPDMPLLNADLLPPPPSGRHRHGYRHPHVGAAEEEIMMLRT  245

Query  855   RLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSA  1034
             RL+ G     D+++DWRLDVD+M+YEELL+L DRIG+VSTGL +DEI R +R  K   SA
Sbjct  246   RLLWGRFGMHDQHQDWRLDVDNMTYEELLDLEDRIGYVSTGLHDDEIARSLRMVK--YSA  303

Query  1035  KLSSHFLAETERKCSVCQ  1088
                 HF  E ER CS+CQ
Sbjct  304   FNPKHFATEVERNCSICQ  321


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++E G+L+CGH YH+ CIKQWL  KN CP+CK+  S+ 
Sbjct  322   EEFEANEETGRLICGHSYHVQCIKQWLSRKNTCPVCKTVVSKT  364



>gb|ACN31440.1| unknown [Zea mays]
 tpg|DAA58013.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=191

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +3

Query  819   PEGLAEVV-MLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             P GL E + M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+IG+V+TGLR+DEI
Sbjct  60    PGGLEEEIRMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELLELGDKIGYVNTGLRDDEI  119

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
              R +RK K P  + L   F  E ERKCS+CQ
Sbjct  120   TRNLRKVKHPSFSSL--RFATEMERKCSICQ  148


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMG+L CGH YH++CIKQWL  KN CP+CK+  S+
Sbjct  149   EEFETNEEMGRLDCGHSYHVYCIKQWLSQKNICPVCKTAVSK  190



>ref|XP_006644545.1| PREDICTED: uncharacterized protein LOC102715154 [Oryza brachyantha]
Length=203

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 87/163 (53%), Gaps = 29/163 (18%)
 Frame = +3

Query  657   GDTVRPRERSACTLRRMVIPED-------------------NPFLDSDTASGMTRSRMDV  779
             GD  RP     C  RR+ + E                     PF  +D        RM  
Sbjct  8     GDAERPHRERPCLSRRVTVQEQISSSFMDSPPPPPHHHLDAAPFFGADLLPSGRLRRM--  65

Query  780   LGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRI  959
                R +R+S  G  E   E++M Q+R++ GG    DRY+DWRLDVD+M+YEELLELGD+I
Sbjct  66    ---RGYRHSPGGLEE---EIMMFQTRVLLGGMSLYDRYQDWRLDVDNMTYEELLELGDKI  119

Query  960   GHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             G+V+TGLREDEI R +RK K P        +  E E+KCS+CQ
Sbjct  120   GYVNTGLREDEIVRNLRKVKHPSFDPF--RYPTEMEKKCSICQ  160


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++EMGKL CGH YH++CIKQWL  KN CP+CK+  ++
Sbjct  161   EEFEANEEMGKLDCGHSYHVYCIKQWLSQKNVCPVCKTAVTK  202



>emb|CBI26972.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 100/184 (54%), Gaps = 24/184 (13%)
 Frame = +3

Query  558   DVWCGPGIGFA-TDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFL  734
             D+ C PGIG A ++AA V  V   R+ S RG+V+            T  R          
Sbjct  11    DLCCTPGIGLAASNAALVDFVEPTRSLSSRGRVNAHR---------TNNRERGRTRRRGS  61

Query  735   DSDTASGMTRS---RMDVLGSRHHRYSRYGFPEGLA--EVVMLQSRLMEGGS-EGSDRYR  896
             D D ASG   S   R D  G        +G   GL+  E+++LQS L+ G + EGSDRY 
Sbjct  62    DHDQASGSHISNARRYDDFG--------HGSSGGLSRSEMMILQSSLLFGENVEGSDRYG  113

Query  897   DWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKC  1076
             DWRLDVDHMSYEELL+LGDRIG+V TGLREDEI R +R  K P+   L          +C
Sbjct  114   DWRLDVDHMSYEELLDLGDRIGYVGTGLREDEIFRCLRNMKHPILDSLPLLSSTGDNWRC  173

Query  1077  SVCQ  1088
             S+CQ
Sbjct  174   SICQ  177


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKN  1430
             EEYE+DDE+G+L CGH YHIHCI+QWLL KN
Sbjct  178   EEYEADDEVGRLDCGHCYHIHCIRQWLLRKN  208



>ref|XP_003631025.1| RING finger protein [Medicago truncatula]
Length=125

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +3

Query  846   LQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             LQ R++ GG   S D YRDWRLDVD+MSYE+LLEL +RIG+V+TGL+EDEI+ Y+RKTKL
Sbjct  3     LQGRILMGGRFNSRDLYRDWRLDVDNMSYEQLLELSERIGYVNTGLKEDEIEPYIRKTKL  62

Query  1023  PLSAKLSSHFLAETERKCSVCQ  1088
               S   S H   + ++KCS+CQ
Sbjct  63    QFSDDASKH---QVDKKCSICQ  81


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EE+E+DDE+G+L C H YH  CI+QW+ HKN CP+CK   +
Sbjct  82    EEFEADDELGRLNCDHLYHFQCIQQWVAHKNFCPVCKQQVA  122



>ref|XP_011070758.1| PREDICTED: uncharacterized protein LOC105156351 [Sesamum indicum]
Length=300

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 127/252 (50%), Gaps = 51/252 (20%)
 Frame = +3

Query  348   FTTFRGLGCTASSQ-VSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNV  524
             F  FRGLGC  SS   S PA+IRS+ADW+S +  K++  R K++  N  +  G+V  +  
Sbjct  57    FVKFRGLGCKGSSLPASTPAIIRSAADWESKQTGKERNRRRKREQENRRNP-GNVVVDVP  115

Query  525   NILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRR  704
             ++   PP          G+G A+D A        RT S   ++D     PRE       R
Sbjct  116   DVCCTPP----------GVGIASDFAP-------RTRSNAPRID-HRKHPREA------R  151

Query  705   MVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGS  884
                    P   +  +SG         GSR    S +G    + E +M Q R++ G     
Sbjct  152   RNEDTSGPNFPAILSSG--------FGSR----SNHGSAGQIIETLMSQQRILHG----Q  195

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             DRY+DWRL+VD MSYEELL+L ++IG+V +GLRE+EI R +R+ K         HF  E 
Sbjct  196   DRYQDWRLNVDDMSYEELLDLSEKIGYVGSGLREEEISRCLRRFK---------HFNPER  246

Query  1065  ERKCSVCQVGSR  1100
             + KCS+CQ   R
Sbjct  247   DWKCSICQEKYR  258


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+Y  D ++  L CGH +H+ CIKQWLL KN CP+CKS A
Sbjct  255   EKYRRDGDVVTLDCGHHHHVRCIKQWLLQKNECPVCKSPA  294



>ref|XP_009407296.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=231

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +3

Query  729   FLDSDTASGMTRSRMDVLGSRH-HRYSRY-GFPEGLAEVVMLQSRLMEGGSEGSDRYRDW  902
             F+DS           D+L S H H    Y   P  L E++M Q R++ G  +  D+YRDW
Sbjct  67    FMDSSLELDAPLFGHDLLSSGHLHNLPMYRQTPSRLEEILMFQRRILLGRMDLYDQYRDW  126

Query  903   RLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSV  1082
             +L+VD+MSYEELLELGDRIGHVSTGL+E+EI   +RK K      L   F  E + KCS+
Sbjct  127   QLNVDNMSYEELLELGDRIGHVSTGLKEEEIIGSLRKVKHSFFYALKRFFSTEIDGKCSI  186

Query  1083  CQ  1088
             CQ
Sbjct  187   CQ  188


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EEYE++DE+G+L CGH YH+ CIKQWLL  N CP+ K++  R
Sbjct  189   EEYEANDEIGELDCGHSYHVFCIKQWLLQNNVCPVSKTSVPR  230



>ref|XP_010271053.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Nelumbo nucifera]
Length=180

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  840   VMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK  1019
             +M QS L+ G SE  D+YRDWRLDVD+M+YEELLELG +IG+V+T LREDEI   +RK K
Sbjct  1     MMFQSLLLCGRSEVYDQYRDWRLDVDNMTYEELLELGGKIGYVNTSLREDEIFHCLRKIK  60

Query  1020  LPLSAKLSSHFLAETERKCSVCQ  1088
                   L SH   ET+ KCS+CQ
Sbjct  61    HSFMEDLQSHIPTETDWKCSICQ  83


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EEY  DDE+GKL CGH YH+ CIKQWLL KNACP+CK+ A+ +
Sbjct  84    EEYVVDDEVGKLDCGHSYHLFCIKQWLLQKNACPVCKAAAAAI  126



>ref|XP_009407279.1| PREDICTED: uncharacterized protein LOC103990002 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=324

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +3

Query  729   FLDSDTASGMTRSRMDVLGSRH-HRYSRY-GFPEGLAEVVMLQSRLMEGGSEGSDRYRDW  902
             F+DS           D+L S H H    Y   P  L E++M Q R++ G  +  D+YRDW
Sbjct  160   FMDSSLELDAPLFGHDLLSSGHLHNLPMYRQTPSRLEEILMFQRRILLGRMDLYDQYRDW  219

Query  903   RLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSV  1082
             +L+VD+MSYEELLELGDRIGHVSTGL+E+EI   +RK K      L   F  E + KCS+
Sbjct  220   QLNVDNMSYEELLELGDRIGHVSTGLKEEEIIGSLRKVKHSFFYALKRFFSTEIDGKCSI  279

Query  1083  CQ  1088
             CQ
Sbjct  280   CQ  281


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EEYE++DE+G+L CGH YH+ CIKQWLL  N CP+ K++  R
Sbjct  282   EEYEANDEIGELDCGHSYHVFCIKQWLLQNNVCPVSKTSVPR  323



>gb|KEH21404.1| C3HC4-type RING zinc finger protein [Medicago truncatula]
Length=230

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 110/216 (51%), Gaps = 29/216 (13%)
 Frame = +3

Query  126  VSDSSRVGAEHNQSRYTTPRSQ--NHSQPIAEADPNPHLIsssrskstisALLLAPFSPA  299
            V+  ++   +H + R   PR+Q  N ++PI+E DPN   I      +   + + +     
Sbjct  4    VTQETKTEQQHMKWR-KPPRNQINNKNKPISETDPNTKQIQPIIQSTRSKSTISSLLLSN  62

Query  300  SPTHDPPITLTPKKKNFT----TFRGLGCTA--SSQVSVPAVIRSSADWDssrrvkkkkl  461
              T   PI    KK NF+    TFRGLGCTA  S QVSVPAVIR+SADW    +  +KK 
Sbjct  63   ETTSQQPIN---KKINFSSAAATFRGLGCTAGASQQVSVPAVIRASADWPHQGKKTRKKK  119

Query  462  rskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAA-SVGCVVSRRTAS  638
                      S  G    + V+          DVWCGPGIGF+ DAA SV CVVS++  S
Sbjct  120  HKN-------SNDGSSSSSCVDF--------QDVWCGPGIGFSADAAASVDCVVSKKNVS  164

Query  639  RRGKVDGDTVRPRERSACTLRRM-VIPEDNPFLDSD  743
             R K+D D +  RE S+   RR  V PE   F D+D
Sbjct  165  SRAKIDVDKITHREPSSSFRRRTAVYPETFSFPDTD  200



>gb|ACU20643.1| unknown [Glycine max]
Length=125

 Score =   100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = +3

Query  840   VMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKT  1016
             +MLQ  L+ GG   S D ++DWRLDVD+MSYE+LLELG+RIGHV+TGL+EDE+ R +RKT
Sbjct  1     MMLQGSLLMGGQLNSHDHFKDWRLDVDNMSYEQLLELGERIGHVNTGLKEDEMGRNIRKT  60

Query  1017  KLPLSAKLSSHFLAETERKCSVCQ  1088
             +L      S H   + +++CS+CQ
Sbjct  61    RLQFWDDTSKH---QVDKECSICQ  81


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE+ +E+G+L C H YH  CIKQW   KN CP+CK   +
Sbjct  82    EEYEAGNELGRLNCEHIYHFQCIKQWAAQKNFCPVCKQQVA  122



>ref|XP_009630445.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Nicotiana tomentosiformis]
Length=294

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 131/262 (50%), Gaps = 50/262 (19%)
 Frame = +3

Query  339   KKNF--TTFRGLGCTA---SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAG  503
             KK F   +F GLGC     S  VS PAVIRS+A W+S+ +++KK  R  K  L+S S   
Sbjct  38    KKKFMSVSFGGLGCKGKLNSPPVSAPAVIRSAAQWESTNQMRKKNTRRNKTTLSSKSTR-  96

Query  504   DVGGNNVNILSNPPAASSDVWCGP-GIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRE  680
                 N  N++ + P    DV C P GIG A+D A        RT S+R          RE
Sbjct  97    ----NLANVVVDIP----DVCCAPPGIGSASDVAP-----RPRTTSQRSN-------NRE  136

Query  681   RSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRL  860
              S    R              TA+G   SR+     RH     +  P  L + +     L
Sbjct  137   HSRVARR--------------TANGEEISRLHASNIRHQCPRSHCRPPILRQNLHFARDL  182

Query  861   MEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKL  1040
                  +G D++  WRLDVD MSYE+L+EL DRIG+V TGL E++I +Y+RK K  LS   
Sbjct  183   -----DGDDQHGSWRLDVDDMSYEQLVELSDRIGYVGTGLAEEKIVQYIRKFK--LSTID  235

Query  1041  SSHFLAETER--KCSVCQVGSR  1100
             SS  L  T++  KC++CQ G +
Sbjct  236   SSPLLTSTDKAWKCTICQEGYK  257


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y+ DDE+G+L CGH++HI CIK+WL  KN CP+CKS A
Sbjct  254   EGYKVDDEIGRLECGHYHHIECIKKWLKQKNTCPVCKSAA  293



>gb|EYU30013.1| hypothetical protein MIMGU_mgv1a010691mg [Erythranthe guttata]
Length=305

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 122/253 (48%), Gaps = 45/253 (18%)
 Frame = +3

Query  348   FTTFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNVN  527
             F  F+GLGC  +S  S PA+IRS+A+W++ R            A N          N  N
Sbjct  54    FVKFKGLGCKGTS--STPAIIRSAAEWETKR------------AKNQNQTTKKPSKNRRN  99

Query  528   ILSNPPAASSDVWCGP-GIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRR  704
               +       DV C P GIG ++D A +    + +   R+         PRE        
Sbjct  100   PANIVVDFVPDVCCAPPGIGLSSDFAPLNKNPASKLDHRK--------HPRE--------  143

Query  705   MVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGG-SEG  881
                P  N    S     ++R    V+ SR + +   G    + E++M Q  L+ G   +G
Sbjct  144   ---PRRNGDDSSLEFPAISRR---VISSRTNNHRSAG---EIIEMMMSQQTLLPGRIVQG  194

Query  882   SDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAE  1061
             +DRY  WR ++D MSYEELL+LGD+IG+V TGL+E+E+ R +RK K+     ++SH    
Sbjct  195   NDRYWAWRRNIDDMSYEELLDLGDKIGYVGTGLQEEELSRCIRKFKMCNQKLITSH----  250

Query  1062  TERKCSVCQVGSR  1100
              + KCS+CQ   R
Sbjct  251   KDWKCSICQEKGR  263


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKS  1451
             E+   +D++G L CGH +H+ CIK+WL HKN CP+CKS
Sbjct  260   EKGRRNDDIGTLDCGHHHHLQCIKKWLTHKNECPVCKS  297



>ref|XP_004507240.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cicer arietinum]
Length=171

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 84/131 (64%), Gaps = 15/131 (11%)
 Frame = +3

Query  699   RRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHH-RYSRYGFPEGLAEVVMLQSRLMEGGS  875
             RR V PE   F D+D       S    LG+  H R+ R    +  +E+++LQ  ++ GG 
Sbjct  11    RRTVYPETFSFPDTDPDIFTACS----LGTAAHPRHIRDPSSDDFSEIMVLQGSILMGGR  66

Query  876   EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFL  1055
                D +RDWRLDVD+MSYE+LLELG+RIG+V+TGL+EDE++ Y+ KTKL +S ++     
Sbjct  67    R--DLFRDWRLDVDNMSYEQLLELGERIGNVNTGLKEDEMEPYITKTKLQISDQV-----  119

Query  1056  AETERKCSVCQ  1088
                ++KCS+CQ
Sbjct  120   ---DKKCSICQ  127


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTAS  1460
             EEYE DD++G+L C H YH  CI+QW+ HKN CP+CK   +
Sbjct  128   EEYEEDDKLGRLNCDHLYHFQCIQQWVAHKNCCPVCKHQVA  168



>gb|EMS63498.1| E3 ubiquitin ligase BIG BROTHER-related protein [Triticum urartu]
Length=168

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = +3

Query  729   FLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRL  908
             F+DS     M     D+L S  HR++ + +     E++M ++RL+ G     D+Y+DWRL
Sbjct  9     FMDSPPRFHMPFHDADLLHSGRHRHA-HPYDRTDQEIMMFRTRLLLGRMGMYDQYQDWRL  67

Query  909   DVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK-LPLSAKLSSHFLAETERKCSVC  1085
             DVD+M+YEELL L DRIG+VSTGLREDEI R +R  K L    K   HF  ETER CS+C
Sbjct  68    DVDNMNYEELLALEDRIGYVSTGLREDEIVRGLRVGKHLAFDRK---HFSTETERSCSIC  124

Query  1086  Q  1088
             Q
Sbjct  125   Q  125


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+ +E+G+L CGH YH+HCIKQWL  KNACP+CK+  S+
Sbjct  126   EEFEASEEIGRLSCGHGYHVHCIKQWLSRKNACPLCKTAVSK  167



>ref|XP_010314224.1| PREDICTED: E3 ubiquitin-protein ligase MBR1 isoform X3 [Solanum 
lycopersicum]
Length=259

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             E VMLQ+  M G ++  DRYR  RL+VD+MSYEEL+ELGDRIG+VSTGL+E+EI + VR+
Sbjct  132   EFVMLQNSFMGGRTDCPDRYRSLRLNVDNMSYEELVELGDRIGYVSTGLKENEITQCVRR  191

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
             TK P+S    SH     E+ CS+CQ
Sbjct  192   TK-PVSLNNFSHLHTVVEKNCSICQ  215


 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGHFYHI CIKQWL+HKN CP+CKS A
Sbjct  216   EEYEADDEMGKLGCGHFYHIDCIKQWLMHKNNCPVCKSVA  255



>gb|AGT16136.1| hypothetical protein SHCRBa_127_N06_R_350 [Saccharum hybrid cultivar 
R570]
Length=154

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 13/122 (11%)
 Frame = +3

Query  726   PFLDSDTA-SGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDW  902
             PF+D+D A SG  R     +  R H ++R    EG    +M ++R++ G     D+Y+DW
Sbjct  2     PFVDADRAPSGRIRH----ISGRRHSHAR---VEG---EMMFRTRILLGRMGIYDQYQDW  51

Query  903   RLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSV  1082
             RLDVD+M+YEELL+L DRIG+VSTGLREDEI + +R  K   SA    HF  E +R+CS+
Sbjct  52    RLDVDNMTYEELLDLEDRIGYVSTGLREDEIIQSLRMVK--YSAFNPKHFSTEMDRRCSI  109

Query  1083  CQ  1088
             CQ
Sbjct  110   CQ  111


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E+++E GKL CGH YH+HCIKQWL  KNACP+CK+T S+
Sbjct  112   EEFEANEETGKLSCGHSYHVHCIKQWLSRKNACPVCKTTVSK  153



>gb|AFK43700.1| unknown [Medicago truncatula]
Length=123

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 5/79 (6%)
 Frame = +3

Query  852   SRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLS  1031
             +RLM G S   D++RDWRLDVD+MSYE+LLELG+RIG+V TGL+EDE+   +RK KL +S
Sbjct  6     ARLMGGRSR--DQFRDWRLDVDNMSYEQLLELGERIGYVKTGLKEDEMKNNIRKIKLLIS  63

Query  1032  AKLSSHFLAETERKCSVCQ  1088
                S H   + ++KC++CQ
Sbjct  64    NDSSKH---QIDKKCTICQ  79


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYESDDE+G+L C H YH  CIKQWL+ KN CP+CK
Sbjct  80    EEYESDDELGRLHCEHSYHFQCIKQWLVLKNFCPVCK  116



>ref|XP_006344318.1| PREDICTED: uncharacterized protein LOC102583267 [Solanum tuberosum]
Length=292

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 122/277 (44%), Gaps = 51/277 (18%)
 Frame = +3

Query  282   APFSPASPTHDPPITLTPKKKNFTTFRGLGCTA---SSQVSVPAVIRSSADWDssrrvkk  452
              P    S T+D  ++   KK    +F GLGC     S   S P VIRS+A W+SS +  +
Sbjct  23    TPNHQFSNTNDSNVSKNKKKFMSMSFGGLGCKGKLNSLVASAPEVIRSAAQWESSSKQMR  82

Query  453   kklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRT  632
             K  R K   L + +       N+ N++   P         PGIG A D A          
Sbjct  83    KNRRKKMTTLTTNTR------NSTNVVCCAP---------PGIGSAFDVAP---------  118

Query  633   ASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRY  812
                         RP+ RS          E +      + +G   SR     +RHH    +
Sbjct  119   ------------RPKTRSN-------NKEHSRIARRTSTNGEAISRSHTSNTRHHCPRSH  159

Query  813   GFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLRED  989
               P     +++L+  L      EG D+Y  WRLDVD MSYE+L+EL D+IG+V TGL E+
Sbjct  160   HRPH----IMILRHNLQYARDIEGDDQYGSWRLDVDDMSYEQLVELSDKIGYVGTGLEEE  215

Query  990   EIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQVGSR  1100
             +I  Y+RK KL      S     +   +C++CQ G +
Sbjct  216   KIVEYIRKFKLSTIDSYSMLISTDKSWRCTICQEGYK  252


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y+ DDE+GKL CGH++HI CIK+WL+HKNACPICK  A
Sbjct  249   EGYKVDDEIGKLECGHYHHIECIKKWLMHKNACPICKIAA  288



>ref|XP_010456473.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
[Camelina sativa]
Length=629

 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 93/195 (48%), Gaps = 45/195 (23%)
 Frame = +3

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSS-HFLAE  1061
             D++RD RLD+D+MSYEELL LGD++G VST L E+ + R ++++    + +  +   + +
Sbjct  470   DQHRDMRLDIDNMSYEELLALGDKMGTVSTALSEEALSRSLKQSIYQGTDETGAISLVKD  529

Query  1062  TERKCSVCQVGSRFPNSAWISLF---*LYHSPCWAEASKGQV*HLVTGGLLDGGW*RAKS  1232
              + KCS+CQ    + +   +       +YH  C  +                  W     
Sbjct  530   DDIKCSICQ--EEYVDGDEVGTMPCQHMYHVSCVQQ------------------W-----  564

Query  1233  STQCLKDVMTVYKEIKLRLYKW*TLDPNTSRL*V*EEYESDDEMGKLVCGHFYHIHCIKQ  1412
                             LR+  W  +   ++     EEY   DE+G + C H YH+ C++Q
Sbjct  565   ----------------LRMKNWCPICKTSAEEEKSEEYVDGDEVGTMPCQHMYHVSCVQQ  608

Query  1413  WLLHKNACPICKSTA  1457
             WL  KN CPICK++A
Sbjct  609   WLRMKNWCPICKTSA  623



>ref|XP_009796804.1| PREDICTED: uncharacterized protein LOC104243322 [Nicotiana sylvestris]
Length=295

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 89/263 (34%), Positives = 129/263 (49%), Gaps = 51/263 (19%)
 Frame = +3

Query  339   KKNF--TTFRGLGCTA---SSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAG  503
             KK F   +F GLGC     S  VS PA IRS+A W+S+ +++K   R      N  + + 
Sbjct  38    KKKFMSVSFGGLGCKGKLNSPPVSAPAAIRSAAQWESTNQMRKNIRR------NKTTLSS  91

Query  504   DVGGNNVNILSNPPAASSDVWCGP-GIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRE  680
                 N  N++ + P    DV C P GIG A+D A    + ++R+ +R            E
Sbjct  92    TSTRNLANVVVDIP----DVCCAPPGIGSASDVAPRPRITTQRSNNR------------E  135

Query  681   RSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRL  860
              S    R              TA+G   SR      RH     +  P     +++L+  L
Sbjct  136   HSRVARR--------------TANGEEISRFRASNIRHQCPRSHHRPP----IMILRHNL  177

Query  861   MEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAK  1037
                   +G D++  WRLDVD MSYE+L+EL DRIG+V TGL E++I +Y+RK K  LS  
Sbjct  178   QFARDLDGDDQHGSWRLDVDDMSYEQLVELSDRIGYVGTGLAEEKIVQYIRKFK--LSTI  235

Query  1038  LSSHFLAETER--KCSVCQVGSR  1100
              SS  L  T++  +C++CQ G +
Sbjct  236   DSSPLLISTDKAWRCTICQEGYK  258


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y+ DDE+G+L CGH++HI CIK+WL+ KN CP+CKS A
Sbjct  255   EGYKVDDEIGRLECGHYHHIECIKKWLMQKNTCPVCKSAA  294



>ref|XP_007152718.1| hypothetical protein PHAVU_004G153500g [Phaseolus vulgaris]
 gb|ESW24712.1| hypothetical protein PHAVU_004G153500g [Phaseolus vulgaris]
Length=126

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = +3

Query  855   RLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLS  1031
             R++ GG   S D++RDWRLD+D MSYEELLELG+RIGHVSTGL+EDE+   +RK KL  S
Sbjct  7     RIIMGGRLNSHDQFRDWRLDIDDMSYEELLELGERIGHVSTGLKEDEMGHNIRKVKLSSS  66

Query  1032  AKLSSHFLAETERKCSVCQ  1088
                S     +  + CSVCQ
Sbjct  67    NDASKD---QEGKNCSVCQ  82


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EEYE  DE+GKL C H YH  CIKQWL+HKN CP+CK
Sbjct  83    EEYEPHDELGKLKCDHSYHFQCIKQWLVHKNFCPVCK  119



>gb|KFK40799.1| hypothetical protein AALP_AA2G042800, partial [Arabis alpina]
Length=145

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 82/145 (57%), Gaps = 17/145 (12%)
 Frame = +3

Query  579  IGFATDAASVGCV------VSRRTASRRGKVDG--------DTVRPRERSACTL-RRMVI  713
            +GF+TDA   G +      +SRR    R K+DG             RE S+  + RR   
Sbjct  1    VGFSTDAVVGGSIDSVEPDLSRRNIPVRRKIDGGDNNKNSSSNSNQREGSSSVIPRRSQN  60

Query  714  PEDNPFLDSDTASGMTRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGG--SEGSD  887
             E NP+ ++D+    +R+ +     R+HR+ R  + +G+ E++M+Q+  + GG  S   D
Sbjct  61   QESNPYFEADSTFSTSRAELTQFADRYHRHLRQSYTDGITEMMMMQNGFVMGGALSAAHD  120

Query  888  RYRDWRLDVDHMSYEELLELGDRIG  962
             +RD RL+VD+M+YE+LLELGD+IG
Sbjct  121  HFRDLRLNVDNMTYEQLLELGDKIG  145



>ref|XP_004238892.1| PREDICTED: uncharacterized protein LOC101243888 [Solanum lycopersicum]
Length=220

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 115/253 (45%), Gaps = 60/253 (24%)
 Frame = +3

Query  291   SPASPTHDPP------ITLTPKKKNFTT--FRGLGCTA---SSQVSVPAVIRSSADWDss  437
             +P + TH  P        ++  KK F +  FRGLGC     S   S P VIRS+A W+SS
Sbjct  15    NPKNNTHSTPNHQFSNTNVSKNKKKFMSMSFRGLGCKGKLNSPDASTPEVIRSAAQWESS  74

Query  438   rrvkkkklrskkkALNSVSAAGDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCV  617
              +  +K  R K   L++ +       N+ N++   P         PGIG A D A     
Sbjct  75    SKQMRKNRRKKMTTLSTSTR------NSTNVVCCAP---------PGIGSAYDVAP----  115

Query  618   VSRRTASRRGKVDGDTVRPRERSACTLRRMVIPEDNPFLDSDTASGMTRSRMDVLGSRHH  797
                              RP+ RS           ++P +     +G   SR     +RHH
Sbjct  116   -----------------RPKTRSN--------NREHPRIARRATNGEAISRSHTSNTRHH  150

Query  798   RYSRYGFPEGLAEVVMLQSRLMEGGS-EGSDRYRDWRLDVDHMSYEELLELGDRIGHVST  974
                 +  P     +++L+  L      EG D+Y  WRLDVD MSYE+L+EL D+IG+V T
Sbjct  151   CPRSHHRPH----IMILRHNLQYARDVEGDDQYGSWRLDVDDMSYEQLVELSDKIGYVGT  206

Query  975   GLREDEIDRYVRK  1013
             GL E++I  Y+RK
Sbjct  207   GLEEEKIVEYIRK  219



>gb|AFW79025.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=316

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  840   VMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK  1019
             +M Q+R++ G     D+Y+DWRLDVD+M+YEELL+L DRIG+VSTGLREDEI + +R  K
Sbjct  193   MMFQTRMLLGRMGIYDQYQDWRLDVDNMTYEELLDLEDRIGYVSTGLREDEIIQSLRMVK  252

Query  1020  LPLSAKLSSHFLAETERKCSVCQ  1088
                SA    HF  E +R+CS+CQ
Sbjct  253   --YSAFNPRHFSTEMDRRCSICQ  273


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EE+E  +E GKL CGH YH+HCIKQWL  KNACP+CK+T S+
Sbjct  274   EEFEVHEETGKLSCGHSYHVHCIKQWLSRKNACPVCKTTVSK  315



>ref|XP_006655556.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Oryza 
brachyantha]
Length=193

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 90/159 (57%), Gaps = 18/159 (11%)
 Frame = +3

Query  633   ASRRGKVDGDTVRPRERSACTLRRMVIPEDN---PFLDSDTASGMTRSRMDVL----GSR  791
             + RRG+ +    R RER A    R V   ++     +DS     M     D+L    G  
Sbjct  3     SGRRGEAER---RHRERPAAPRPRRVTMREHISSSLMDSPPLPDMPLLNADLLPPPPGRH  59

Query  792   HHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVS  971
              HR++  G  E   E++M ++RL+ G     D+++DWRLDVD+M+YEELL+L DRIG+VS
Sbjct  60    RHRHTHVGAEE---EIMMFRTRLLWGRMGMHDQHQDWRLDVDNMTYEELLDLEDRIGYVS  116

Query  972   TGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             TGL +DEI R +R  K   SA    +F+   ER CS+CQ
Sbjct  117   TGLHDDEITRSLRMVK--YSAFNPKNFV---ERNCSICQ  150


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASRV  1466
             EE+E+++E G+L+CGH YH+ CIKQWL  KN CP+CK+  S+ 
Sbjct  151   EEFEANEEAGRLICGHSYHVQCIKQWLSRKNTCPVCKTAVSKT  193



>ref|XP_010246194.1| PREDICTED: uncharacterized protein LOC104589544 isoform X2 [Nelumbo 
nucifera]
Length=119

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = +3

Query  327  LTPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
            L  KKK+FT  T+RGLGCT+SSQ+S P  IRSSADW   +  KKK+  +++K  + V+  
Sbjct  5    LKDKKKSFTSATWRGLGCTSSSQISAPEAIRSSADWQEKKVRKKKQRSTQRKKSHHVTEM  64

Query  501  GDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRE  680
              +G         P     DVWC  GIGFA +AA + CVVSRR  + RG++D + +  RE
Sbjct  65   TSMGN------PTPVVVVPDVWCSLGIGFAANAAPIDCVVSRRPVAGRGRIDSERINQRE  118

Query  681  R  683
            R
Sbjct  119  R  119



>emb|CDO98403.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 77/112 (69%), Gaps = 16/112 (14%)
 Frame = +3

Query  114  MPVVVSDSSRVGAEHNQSRYTTPR----SQNHSQPIAEADPNPHLIsssrskstisALLL  281
            MP+V+ +SS +G   +  RY   R    SQN  QPI+E DP P L+ S+RSKSTIS+LL 
Sbjct  1    MPMVIPESSAIG---DTGRYRRSRNLNFSQNQHQPISETDPIPSLVDSNRSKSTISSLLF  57

Query  282  APFSPASPTHDPPITLTPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWD  431
                   PT+D   + + KKKNF+  TFRGLGCTASSQVSVPAVIR+SADWD
Sbjct  58   -------PTNDHHTSASHKKKNFSSATFRGLGCTASSQVSVPAVIRTSADWD  102


 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++DDEMGKL CGH +HI CIK+WL  KNACPICK+ A
Sbjct  356   EEYDADDEMGKLNCGHQFHIQCIKKWLSQKNACPICKTEA  395



>ref|XP_010246193.1| PREDICTED: uncharacterized protein LOC104589544 isoform X1 [Nelumbo 
nucifera]
Length=140

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 8/120 (7%)
 Frame = +3

Query  327  LTPKKKNFT--TFRGLGCTASSQVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAA  500
            L  KKK+FT  T+RGLGCT+SSQ+S P  IRSSADW   +  KKK+  +++K  + V+  
Sbjct  5    LKDKKKSFTSATWRGLGCTSSSQISAPEAIRSSADWQEKKVRKKKQRSTQRKKSHHVTEM  64

Query  501  GDVGGNNVNILSNPPAASSDVWCGPGIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRE  680
              +G               DVWC  GIGFA +AA + CVVSRR  + RG++D + +  RE
Sbjct  65   TSMGNPTPV------VVVPDVWCSLGIGFAANAAPIDCVVSRRPVAGRGRIDSERINQRE  118



>gb|EPS72630.1| hypothetical protein M569_02127, partial [Genlisea aurea]
Length=116

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +3

Query  879   GSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTK-LPLSAKLSSHFL  1055
             G D Y D RLDVD MSYEELL+LGDRIG+V TGL+EDEI + +R  K    S + ++   
Sbjct  1     GQDPYHDLRLDVDEMSYEELLDLGDRIGYVGTGLQEDEIPKCLRIIKQYSASTQFNNAAA  60

Query  1056  AETERKCSVCQ  1088
             A+ + KCS+CQ
Sbjct  61    AQRDWKCSICQ  71


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  1353  DDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             D+E+  L C H +H+ CIKQWL+ KN+CPICKS A
Sbjct  77    DNEICVLECEHPHHVECIKQWLMKKNSCPICKSVA  111



>ref|XP_001779244.1| predicted protein [Physcomitrella patens]
 gb|EDQ55932.1| predicted protein [Physcomitrella patens]
Length=134

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + +++ML++ L+ GG    D++ D RLDVD+MSYEELL L +RIG+VSTG+  + + + +
Sbjct  6     IQQLLMLEATLLFGGMGLHDQHSDLRLDVDNMSYEELLALEERIGNVSTGVSSEAMAQKL  65

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +KT+      + + +  E++ KCS+CQ
Sbjct  66    KKTRYSSLDAVVARYSQESDIKCSICQ  92


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE  DE+GK+ CGH YH  CI+QWL+ KN CPICK+TA
Sbjct  93    EEYEEGDELGKIECGHGYHSQCIQQWLVQKNQCPICKATA  132



>ref|XP_001773380.1| predicted protein [Physcomitrella patens]
 gb|EDQ61753.1| predicted protein [Physcomitrella patens]
Length=129

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++ML++ L+ GG    D++ D RLDVD+MSYEELL L +RIG+VSTG+  D + + ++K
Sbjct  3     QLLMLEATLLFGGMGLHDQHSDLRLDVDNMSYEELLALEERIGNVSTGVSPDVLAQKLKK  62

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
             T+      + + +  E + KCS+CQ
Sbjct  63    TRYSSLDAVVARYSQECDIKCSICQ  87


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE  DE+GK+ CGH YH  CI+QWL+ KN CPICK+ A
Sbjct  88    EEYEEGDELGKIECGHGYHAQCIQQWLVQKNQCPICKAAA  127



>ref|XP_007163853.1| hypothetical protein PHAVU_L011000g, partial [Phaseolus vulgaris]
 gb|ESW35847.1| hypothetical protein PHAVU_L011000g, partial [Phaseolus vulgaris]
Length=153

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 91/172 (53%), Gaps = 27/172 (16%)
 Frame = +3

Query  114  MPVVVSDSSRVGAEHNQSRYTTPRSQNHSQPIAEADPNPH---LIsssrskstisALLLA  284
            MPVV         EH + R   PR+Q    PI++ D NP     I SS +KSTIS+LL +
Sbjct  1    MPVVT--------EHMKWRR--PRNQFRC-PISDNDQNPQNPSTIQSSHTKSTISSLLSS  49

Query  285  PFSPASPTH--DPPITLTPKKKNFTTFRGLGCT--ASSQVSVPAVIRSSADWDssrrvkk  452
              +P   TH  D       +K +  TFRGLGCT  AS +VSVP VIRSSADW+  R  KK
Sbjct  50   FSTPNETTHVRDQNSNKNSRKFSTATFRGLGCTVRASQKVSVPTVIRSSADWEGKRNRKK  109

Query  453  kklrskkkALNSVSAAGDV-GGNNVNILSNPPAASSDVWCGPGIGFATDAAS  605
            K  R+            DV GG  V+          DVWCGPGIGF+TD A+
Sbjct  110  KHRRNSNSNKTCDGVVHDVSGGTCVDF--------QDVWCGPGIGFSTDTAA  153



>ref|XP_002988343.1| hypothetical protein SELMODRAFT_447294 [Selaginella moellendorffii]
 gb|EFJ10762.1| hypothetical protein SELMODRAFT_447294 [Selaginella moellendorffii]
Length=703

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +3

Query  834   EVVMLQ-SRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
             +++ML+ +  + GG    D + DWRLD+D+MSYEELL LGDRIG VSTGL ED I + ++
Sbjct  564   QLIMLEATTFLFGGIGLHDDHSDWRLDIDNMSYEELLALGDRIGTVSTGLSEDTIVQQLK  623

Query  1011  KTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TK   +   SS    +++ KC VCQ
Sbjct  624   RTKYAAALARSSE---DSDVKCCVCQ  646


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EE+E   E+G + CGH YH+ CI+QWL+ KN+CPICK+TA
Sbjct  647   EEFEEGVELGTINCGHNYHMDCIRQWLVRKNSCPICKATA  686



>ref|XP_002991447.1| hypothetical protein SELMODRAFT_448412 [Selaginella moellendorffii]
 gb|EFJ07559.1| hypothetical protein SELMODRAFT_448412 [Selaginella moellendorffii]
Length=510

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +3

Query  834   EVVMLQ-SRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
             +++ML+ +  + GG    D + DWRLD+D+MSYEELL LGDRIG VSTGL ED I + ++
Sbjct  371   QLIMLEATTFLFGGIGLHDDHSDWRLDIDNMSYEELLALGDRIGTVSTGLSEDTIVQQLK  430

Query  1011  KTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +TK   +   SS    +++ KC VCQ
Sbjct  431   RTKYAAALARSSE---DSDVKCCVCQ  453


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EE+E   E+G + CGH YH+ CI+QWL+ KN+CPICK+TA
Sbjct  454   EEFEEGVELGTINCGHNYHMDCIRQWLVRKNSCPICKATA  493



>ref|XP_008646556.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Zea mays]
Length=129

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 7/93 (8%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++ML++ L+ G     DR+RD R+D+D MSYEELL L +RIG VST L E++  + +++
Sbjct  40    QLLMLEANLVFGAFASYDRHRDMRMDIDDMSYEELLALEERIGSVSTALSEEQFTKCLKR  99

Query  1014  ---TKLPLSAKLSSHFLAETERKCSVCQVGSRF  1103
                T++ L    S+      + KCS+CQV   F
Sbjct  100   SIYTQVALEVNKST----VDDMKCSICQVSGNF  128



>ref|XP_002976040.1| hypothetical protein SELMODRAFT_104716, partial [Selaginella 
moellendorffii]
 gb|EFJ22945.1| hypothetical protein SELMODRAFT_104716, partial [Selaginella 
moellendorffii]
Length=126

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +++ML++ ++ GG    DR+ DWR+DVD+M+YEELL L +++G+VS G+ E+ I   +
Sbjct  1     LQQLLMLEATVLFGGMAVHDRHSDWRMDVDNMTYEELLALEEKMGNVSIGVSEERIAHGL  60

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +K +    + L +    + E KCS+CQ
Sbjct  61    QKCRF---STLFAGCGQDGELKCSICQ  84


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY + +++G++ CGH +HI CIKQWL HKN CPICK+TA
Sbjct  85    EEYRNGEQLGRIECGHKFHIGCIKQWLGHKNLCPICKATA  124



>ref|XP_002968333.1| hypothetical protein SELMODRAFT_89607, partial [Selaginella moellendorffii]
 gb|EFJ30587.1| hypothetical protein SELMODRAFT_89607, partial [Selaginella moellendorffii]
Length=125

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +++ML++ ++ GG    DR+ DWR+DVD+M+YEELL L +++G VS G+ E+ I   +
Sbjct  1     LQQLLMLEATVLFGGMAVHDRHSDWRMDVDNMTYEELLALEEKMGSVSIGVSEERIAHGL  60

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +K +    + L +    + E KCS+CQ
Sbjct  61    QKCRF---STLFAGCGQDGELKCSICQ  84


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EE+ + +++G++ CGH +H++CIKQWL  KN CPICK TA
Sbjct  85    EEFRNGEDLGEIDCGHKFHVNCIKQWLGRKNLCPICKVTA  124



>gb|AEX12881.1| hypothetical protein CL1032Contig1_02 [Pinus taeda]
Length=104

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  897   DWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKC  1076
             D RLDVD MSYE+LLELGDRIG+V+TGL ED I + ++K K  +  +  S  L E ERKC
Sbjct  1     DLRLDVDSMSYEDLLELGDRIGYVNTGLSEDAIFQCLQKIKHCI-MEARSTCLTENERKC  59

Query  1077  SVCQ  1088
             S+CQ
Sbjct  60    SICQ  63


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE++DE+GKL CGH YH+ CIKQWLL KNACP+CK++ 
Sbjct  64    EEYEANDELGKLQCGHSYHVCCIKQWLLQKNACPVCKASV  103



>ref|XP_006477772.1| PREDICTED: serine/threonine-protein kinase prpf4B-like [Citrus 
sinensis]
Length=381

 Score = 74.3 bits (181),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +HI CIKQWL  KNACP+CK+  
Sbjct  338   EEYEADDEMGKLDCGHSFHIQCIKQWLSQKNACPVCKAAV  377


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  327  LTPKKKNFTTFRGLGCTA--SSQVSVPAVIRSSADWD  431
            LTPKKK   TFRG GCTA  S QVS+PAVIRSSADWD
Sbjct  40   LTPKKKLNNTFRGFGCTAAASQQVSLPAVIRSSADWD  76



>ref|XP_009417181.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009417182.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=730

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 71/121 (59%), Gaps = 8/121 (7%)
 Frame = +3

Query  732   LDSDTASGMTRSRMDVLGSRHHRYS-RYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRL  908
             + S TA+G  RSRM +   RH   S R+G      +V +L   L+  GS+  DR+RD RL
Sbjct  573   MRSLTAAGEERSRM-LSEIRHALESLRHGDGLRFEDVFILDQTLILAGSDLHDRHRDMRL  631

Query  909   DVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERK-CSVC  1085
             DVD+MSYEELL L +RIG+V TGL E+ I + +++ K       S+   A  E K C +C
Sbjct  632   DVDNMSYEELLALEERIGNVCTGLSEETILKSLKQQK-----HSSAAIRASMEHKPCCIC  686

Query  1086  Q  1088
             Q
Sbjct  687   Q  687


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  688   EEYVEGDDLGTLDCGHDFHSVCIKQWLMHKNLCPICKNTA  727



>emb|CDP00670.1| unnamed protein product [Coffea canephora]
Length=262

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 112/247 (45%), Gaps = 42/247 (17%)
 Frame = +3

Query  363   GLGCTASS-QVSVPAVIRSSADWDssrrvkkkklrskkkALNSVSAAGDVGGNNVNILSN  539
             GLGC  +S +VS   +IRS+ADW++ RR +K                G+   +   I  N
Sbjct  9     GLGCKGTSTRVSESTIIRSAADWETERRRRKN--------------LGNRPPSKARIPDN  54

Query  540   PPAASSDVWCGP-GIGFATDAASVGCVVSRRTASRRGKVDGDTVRPRERSACTLRRMVIP  716
                   D+ C P GI FA+D      + ++RT      V    V  R R   T++ +   
Sbjct  55    VAVDVPDICCAPPGISFASDVVPRPSMTTQRTT----HVQHSRVARRTR---TIQHISAS  107

Query  717   EDNPFLDSDTASGMTRSRMDVLGSR-HHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRY  893
                    S   S    SR     +R +H+  +Y    G  EV  L  R +       D+Y
Sbjct  108   ------SSQGPSNYIFSRDHSFNARQYHQLGQYS-QRGFREVFALFERSL-------DQY  153

Query  894   RDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETER-  1070
              DWRL++D MSYEELLEL D IG+V  GL E++I  +   T L  S   S+  L   +  
Sbjct  154   MDWRLNLDRMSYEELLELSDEIGYVGRGLSEEDI--FSCLTILEPSDFESAPLLMSLDEG  211

Query  1071  -KCSVCQ  1088
              +C++CQ
Sbjct  212   WRCTICQ  218


 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICK  1448
             EE ++ DE+G+L CGH +HI CIKQWL  KN CP+CK
Sbjct  219   EECKAKDEVGRLGCGHCHHIDCIKQWLKQKNQCPVCK  255



>ref|XP_009395494.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Musa acuminata 
subsp. malaccensis]
Length=688

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +V++ +  +  GG+   DR+RD RLDVD+MSYEELL LG+RIG+V+TGL E++I   +
Sbjct  563   LEDVLLFEQSVFAGGANFHDRFRDMRLDVDNMSYEELLALGERIGNVNTGLSEEKILNCL  622

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             R+ K    A   S    E    C +C+
Sbjct  623   RQRKYVSIASEPS----EEAEPCCICR  645


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G+L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  646   EEYIEGEELGRLDCGHDFHTACIKQWLVIKNLCPICKTTA  685



>ref|XP_006393660.1| hypothetical protein EUTSA_v10011314mg [Eutrema salsugineum]
 ref|XP_006393661.1| hypothetical protein EUTSA_v10011314mg [Eutrema salsugineum]
 gb|ESQ30946.1| hypothetical protein EUTSA_v10011314mg [Eutrema salsugineum]
 gb|ESQ30947.1| hypothetical protein EUTSA_v10011314mg [Eutrema salsugineum]
Length=634

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             E VML ++ M GG++  DRYRD RLDVD+M+YEELL L +RIG V TGL E+ I   +++
Sbjct  506   EEVMLLNQSMAGGADNHDRYRDMRLDVDNMTYEELLSLEERIGDVCTGLNEETISNRLKQ  565

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K   ++  SS    E    C +CQ
Sbjct  566   HK--YNSSTSSQQEVE---PCCICQ  585


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             EEY+  +EMG L CGH +H  CIK+WL+ KN CPICK+T
Sbjct  586   EEYKEGEEMGMLECGHDFHSQCIKEWLMRKNLCPICKTT  624



>ref|XP_008666895.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Zea mays]
Length=109

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++ML++ L+ G     DR+RD R+D+D MSYEELL L +RIG VST L E++  + +++
Sbjct  20    QLLMLEANLVFGAFTSYDRHRDMRMDIDDMSYEELLALEERIGSVSTALSEEQFTKCLKR  79

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQV  1091
             +     A L  +     + KCS+CQV
Sbjct  80    SIYSQVA-LEVNKSTVDDMKCSICQV  104



>ref|NP_175132.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAF69164.1|AC007915_16 F27F5.26 [Arabidopsis thaliana]
 gb|AEE32091.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=645

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +V++L   +M G ++  DRYRD RLDVD+M+YEELL L +RIG V TGL E+ I   +
Sbjct  515   LEDVMLLNQSIMLGAADIHDRYRDMRLDVDNMTYEELLSLEERIGDVCTGLNEETISNRL  574

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   S + S     E E  C VCQ
Sbjct  575   KQQKYKSSTRSSQ----EVE-PCCVCQ  596


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  1362  MGKLVCGHFYHIHCIKQWLLHKNACPICKST  1454
             +G+L CGH +H  CIK+WL  KN CPICK+T
Sbjct  605   IGRLECGHDFHSQCIKEWLKQKNLCPICKTT  635



>ref|XP_008645308.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Zea mays]
Length=129

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++ML++ L  G     DR+RD R+D+D MSYEELL L +RIG VST L E++  + +++
Sbjct  40    QLLMLEANLFFGAFASYDRHRDMRMDIDDMSYEELLALEERIGSVSTALSEEQFTKCLKR  99

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQV  1091
             +     A L  +     + KCS+CQV
Sbjct  100   SIYSQVA-LEVNKSTVDDMKCSICQV  124



>ref|NP_001053779.1| Os04g0603200 [Oryza sativa Japonica Group]
 dbj|BAF15693.1| Os04g0603200 [Oryza sativa Japonica Group]
Length=329

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 9/83 (11%)
 Frame = +3

Query  861   MEGGSE------GSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             MEG  E       +DRYR  R+D+D MSYEELL LGDRIG VSTGL ED + + + ++ +
Sbjct  245   MEGSEELENYFIFNDRYRGMRMDIDGMSYEELLALGDRIGTVSTGLSEDALSKCLDRS-M  303

Query  1023  PLSAKLSSHFLAETERKCSVCQV  1091
              ++    +H   + ERKCS+CQ 
Sbjct  304   YMATTSGTH--EDCERKCSICQA  324



>ref|XP_003589164.1| Zinc finger protein [Medicago truncatula]
 gb|AES59415.1| zinc finger (C3HC4-type RING finger) family protein [Medicago 
truncatula]
Length=708

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               +V++L   +  G ++  DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I +++
Sbjct  583   FEDVMILDHSMFAGIADMHDRHRDMRLDVDNMSYEELLALEERIGNVSTGLNEETIMKHL  642

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K  +    S    +ETE  C VCQ
Sbjct  643   KQKKYSVDGLGSQ---SETE-PCCVCQ  665


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EE++++D++G L CGH YHI CIKQWL HKN CPICK+T 
Sbjct  666   EEFKNEDDIGSLDCGHDYHIDCIKQWLTHKNICPICKTTG  705



>ref|XP_010929288.1| PREDICTED: uncharacterized protein LOC105050815 isoform X2 [Elaeis 
guineensis]
Length=546

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +3

Query  819   PEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEID  998
             PE L+   +L++ L   G   SDR+RD R+D+D+MSYEELL L +++G V+TGL +D++ 
Sbjct  440   PEQLS---VLETTLFSAGVSFSDRHRDMRMDIDNMSYEELLALEEKMGTVNTGLSKDQLS  496

Query  999   RYVRKTKLPLSAKLSSHFLAETERKCSVCQVG  1094
               ++++    ++++S    +  + KCS+CQ+G
Sbjct  497   ECLKRSLYTPASEVSGITGSGDDTKCSICQIG  528



>gb|KDO84119.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
Length=672

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  569   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  628

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQV  1091
                +++ K  +S  L S    + +  C +CQV
Sbjct  629   KNRLKQQKYSIS--LGSQ---QEQEPCCICQV  655



>emb|CAA85320.1| C-terminal zinc-finger [Glycine max]
Length=388

 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 6/67 (9%)
 Frame = +3

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             DR+RD R+D+D+MSYEELL LG+RIGHVSTGL ED I +Y+ +T    S +      ++ 
Sbjct  278   DRHRDMRMDIDNMSYEELLALGERIGHVSTGLSEDLISKYLTETIYCSSEQ------SQE  331

Query  1065  ERKCSVC  1085
             E  C++C
Sbjct  332   EEACAIC  338


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKL-VCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++ D +G L  CGH YH+ CI++WL  K  CPICK++A
Sbjct  340   EEYKNMDYVGTLKACGHDYHVGCIRKWLSMKKVCPICKASA  380



>ref|XP_003537281.2| PREDICTED: uncharacterized protein LOC547939 isoform X1 [Glycine 
max]
 ref|XP_006588773.1| PREDICTED: uncharacterized protein LOC547939 isoform X2 [Glycine 
max]
 ref|XP_006588774.1| PREDICTED: uncharacterized protein LOC547939 isoform X3 [Glycine 
max]
 ref|XP_006588775.1| PREDICTED: uncharacterized protein LOC547939 isoform X4 [Glycine 
max]
 gb|KHN39093.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=539

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 6/67 (9%)
 Frame = +3

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             DR+RD R+D+D+MSYEELL LG+RIGHVSTGL ED I +Y+ +T    S +      ++ 
Sbjct  429   DRHRDMRMDIDNMSYEELLALGERIGHVSTGLSEDLISKYLTETIYCSSEQ------SQE  482

Query  1065  ERKCSVC  1085
             E  C++C
Sbjct  483   EEACAIC  489


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKL-VCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++ D++G L  CGH YH+ CI++WL  K  CPICK++A
Sbjct  491   EEYKNMDDVGTLKACGHDYHVGCIRKWLSMKKVCPICKASA  531



>emb|CAE01827.2| OSJNBa0041A02.20 [Oryza sativa Japonica Group]
 emb|CAH66712.1| OSIGBa0118P15.2 [Oryza sativa Indica Group]
 dbj|BAG94541.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77936.1| hypothetical protein OsI_17277 [Oryza sativa Indica Group]
 gb|EEE61625.1| hypothetical protein OsJ_16053 [Oryza sativa Japonica Group]
Length=367

 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +3

Query  861   MEGGSE------GSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKL  1022
             MEG  E       +DRYR  R+D+D MSYEELL LGDRIG VSTGL ED + + + ++ +
Sbjct  245   MEGSEELENYFIFNDRYRGMRMDIDGMSYEELLALGDRIGTVSTGLSEDALSKCLDRS-M  303

Query  1023  PLSAKLSSHFLAETERKCSVCQ  1088
              ++    +H   + ERKCS+CQ
Sbjct  304   YMATTSGTH--EDCERKCSICQ  323


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+GK+VC H+YH  CIK WL  KN CPICKS A
Sbjct  324   EEYSDGEEVGKMVCKHYYHFSCIKNWLRQKNWCPICKSVA  363



>ref|XP_011038595.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Populus euphratica]
Length=133

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +V++L   ++ G ++  DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I   +++
Sbjct  11    DVMILDQSVLLGAADMYDRHRDMRLDVDNMSYEELLALEERIGNVSTGLSEETIVNNLKQ  70

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K   S  + +   AE    C +CQ
Sbjct  71    QK--YSVAVGAKVEAE---PCCICQ  90


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +++G L CGH +H+ C+KQWL+HKN CPICK+T 
Sbjct  91    EEYNDGEDLGTLDCGHDFHVECVKQWLMHKNWCPICKTTG  130



>ref|XP_003542508.1| PREDICTED: uncharacterized protein LOC100786013 isoform X1 [Glycine 
max]
 ref|XP_006594133.1| PREDICTED: uncharacterized protein LOC100786013 isoform X2 [Glycine 
max]
 ref|XP_006594134.1| PREDICTED: uncharacterized protein LOC100786013 isoform X3 [Glycine 
max]
 ref|XP_006594135.1| PREDICTED: uncharacterized protein LOC100786013 isoform X4 [Glycine 
max]
 ref|XP_006594136.1| PREDICTED: uncharacterized protein LOC100786013 isoform X5 [Glycine 
max]
 ref|XP_006594137.1| PREDICTED: uncharacterized protein LOC100786013 isoform X6 [Glycine 
max]
 ref|XP_006594138.1| PREDICTED: uncharacterized protein LOC100786013 isoform X7 [Glycine 
max]
 ref|XP_006594139.1| PREDICTED: uncharacterized protein LOC100786013 isoform X8 [Glycine 
max]
 gb|KHN48308.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=550

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 7/86 (8%)
 Frame = +3

Query  831   AEVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             +E  M+  R    GS    D++RD R+D+D+MSYEELL LG+RIGHVSTGL ED I +Y+
Sbjct  421   SEGFMIVDRTSLNGSRNMLDQHRDMRMDIDNMSYEELLALGERIGHVSTGLSEDLISKYL  480

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVC  1085
              +T    S +      ++ E  C++C
Sbjct  481   TETIYCSSEQ------SQEEETCAIC  500


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKL-VCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++ D++G L  CGH YH+ CI++WL  K  CPICK +A
Sbjct  502   EEYKNMDDVGTLKACGHDYHVGCIRKWLSMKKVCPICKVSA  542



>ref|XP_006594140.1| PREDICTED: uncharacterized protein LOC100786013 isoform X9 [Glycine 
max]
Length=540

 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGS-DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
             E  M+  R    GS    D++RD R+D+D+MSYEELL LG+RIGHVSTGL ED I +Y+ 
Sbjct  412   EGFMIVDRTSLNGSRNMLDQHRDMRMDIDNMSYEELLALGERIGHVSTGLSEDLISKYLT  471

Query  1011  KTKLPLSAKLSSHFLAETERKCSVC  1085
             +T    S +      ++ E  C++C
Sbjct  472   ETIYCSSEQ------SQEEETCAIC  490


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKL-VCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++ D++G L  CGH YH+ CI++WL  K  CPICK +A
Sbjct  492   EEYKNMDDVGTLKACGHDYHVGCIRKWLSMKKVCPICKVSA  532



>ref|XP_010240527.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X1 [Brachypodium distachyon]
Length=661

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  831   AEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
              E V  +  +  GG E  DR+RD RLD+D+MSYEELL L +RIG+VSTGL E+++   ++
Sbjct  538   GENVRFEQSIFYGGVEIHDRHRDMRLDIDNMSYEELLALEERIGNVSTGLSEEDVMNLLK  597

Query  1011  KTKLPLSAKLSSHFLAETERKCSVCQ  1088
             + K   S +LSS    E E  CS+CQ
Sbjct  598   QRKFS-SWRLSS---VEHE-PCSICQ  618


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  1248  KDVMTVYKEIKLRLYKW*TLDPNTSRL*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHK  1427
             +DVM + K+ K   ++  +++     +   EEY   D++G L CGH +H  CI+QWL+ K
Sbjct  590   EDVMNLLKQRKFSSWRLSSVEHEPCSI-CQEEYIDGDDLGTLHCGHDFHAGCIRQWLVVK  648

Query  1428  NACPICKSTA  1457
             N CPICK+TA
Sbjct  649   NLCPICKNTA  658



>emb|CDY17114.1| BnaC06g00470D [Brassica napus]
Length=531

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             E VML ++ M G +   DRYRD RLDVD+MSYEELL LG+RIG V TGL E+ I   +++
Sbjct  403   EDVMLLNQSMLGAAGIHDRYRDMRLDVDNMSYEELLSLGERIGDVCTGLNEETISNRLKQ  462

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K     +            C +CQ
Sbjct  463   RKYSSDTRCPQEI-----EPCCICQ  482


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G L CGH +H  CIK+WL  KN CPICK+T 
Sbjct  483   EEYNEGEELGMLECGHGFHSQCIKEWLKQKNLCPICKTTG  522



>ref|XP_009119409.1| PREDICTED: E3 ubiquitin-protein ligase MBR1 [Brassica rapa]
Length=597

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++L   + +G +E  DR+R+ RLDVD+MSYEELL LG+RIG VSTGL ED I + +
Sbjct  472   IEDYMVLDPLIFQGMTEMHDRHREMRLDVDNMSYEELLALGERIGDVSTGLSEDVILKTM  531

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K       SS  L +    C +CQ
Sbjct  532   KQHK----CTSSSPELHQYMEPCCICQ  554


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  555   EEYAEGDDLGTLECGHEFHKDCIKQWVMLKNLCPICKTVA  594



>ref|XP_010110816.1| E3 ubiquitin ligase BIG BROTHER [Morus notabilis]
 gb|EXC28188.1| E3 ubiquitin ligase BIG BROTHER [Morus notabilis]
Length=698

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               +V++L   +  G ++  DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I + +
Sbjct  574   FEDVMILDPSVFVGVADIHDRHRDMRLDVDNMSYEELLALEERIGNVSTGLSEEMILKCL  633

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   + K    F +E E  CS+CQ
Sbjct  634   KQKKYTAAGK----FQSENE-PCSICQ  655


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   + +G+L CGH +H  CIKQWL  KN CPICK+TA
Sbjct  656   EEYNEGENVGRLDCGHDFHRDCIKQWLTQKNLCPICKTTA  695



>ref|XP_010922541.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Elaeis 
guineensis]
 ref|XP_010922542.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Elaeis 
guineensis]
 ref|XP_010922543.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Elaeis 
guineensis]
 ref|XP_010922544.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Elaeis 
guineensis]
Length=531

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +3

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             D++RD RLD+D+MSYEELL LG+RIG+VSTGL ED I RY+ +T    S +       E 
Sbjct  419   DQHRDLRLDIDNMSYEELLALGERIGNVSTGLSEDAISRYLMETIYCSSEQNQD---DEE  475

Query  1065  ERKCSVC  1085
             E KC++C
Sbjct  476   ELKCAIC  482


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   + +G+L CGH +H  CIK+WLL KN CPICK++A
Sbjct  484   EEYRDRESIGRLTCGHDFHASCIKRWLLIKNVCPICKASA  523



>gb|AAC69857.1| RING-H2 finger protein RHG1a, partial [Arabidopsis thaliana]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +V++L   ++  G+ G DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   +
Sbjct  59    LEDVMLLNHSVLFDGATGHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNRL  118

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   + K       +    C VCQ
Sbjct  119   KQRKYKSNTK-----SPQDAEPCCVCQ  140


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R YK  T  P  +       EEY   ++MG L CGH +H  CI++WL  KN 
Sbjct  113   TISNRLKQRKYKSNTKSPQDAEPCCVCQEEYTEGEDMGTLECGHEFHSQCIEEWLKQKNL  172

Query  1434  CPICKST  1454
             CPICK+T
Sbjct  173   CPICKTT  179



>ref|XP_008351924.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like, partial [Malus 
domestica]
Length=97

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEYE+DDEMGKL CGH +H+ CIKQWL  KN CP CK  A
Sbjct  54    EEYEADDEMGKLPCGHNFHLQCIKQWLAQKNTCPFCKVEA  93


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  930   EELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++LLELG+RIG+VSTGL+EDEI+R +RK KLP+S+  S H   + + KC +CQ
Sbjct  1     QQLLELGERIGYVSTGLKEDEINRCLRKIKLPMSSDASPHSSGKGDSKCIICQ  53



>ref|NP_001045903.1| Os02g0150700 [Oryza sativa Japonica Group]
 dbj|BAD38048.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAF07817.1| Os02g0150700 [Oryza sativa Japonica Group]
 dbj|BAG99863.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             ++++L++ ++ G     D++ D R+D+D+MSYEELL LGDRIG VST L E++  + +R+
Sbjct  451   QLMVLETNILLGAFTSHDQHSDMRMDIDNMSYEELLALGDRIGSVSTALSEEQFVKCLRR  510

Query  1014  T-KLPLSAKLSSHFLAETERKCSVCQ  1088
             +  +P++ K ++  + +   KCS+CQ
Sbjct  511   SIYIPVATKANAQVVDDI--KCSICQ  534


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G+L C H YH+ CI QWL  KN CPICK++A
Sbjct  535   EEYIEGEEVGRLGCEHQYHVCCIHQWLRQKNWCPICKASA  574



>ref|NP_199108.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAL58938.1|AF462851_1 AT5g42940/MBD2_14 [Arabidopsis thaliana]
 dbj|BAB09196.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42794.1| At5g42940/MBD2_14 [Arabidopsis thaliana]
 dbj|BAH57192.1| AT5G42940 [Arabidopsis thaliana]
 gb|AED94890.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=691

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +V++L   ++  G+ G DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   +
Sbjct  560   LEDVMLLNHSVLFDGATGHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNRL  619

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   + K       +    C VCQ
Sbjct  620   KQRKYKSNTK-----SPQDAEPCCVCQ  641


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R YK  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  614   TISNRLKQRKYKSNTKSPQDAEPCCVCQEEYTEGEDMGTLECGHEFHSQCIKEWLKQKNL  673

Query  1434  CPICKSTA  1457
             CPICK+T 
Sbjct  674   CPICKTTG  681



>ref|XP_010432474.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Camelina sativa]
 ref|XP_010432475.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Camelina sativa]
 ref|XP_010432476.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Camelina sativa]
Length=671

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  546   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAI  605

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   S+ + SH   +    C VCQ
Sbjct  606   KQRKY-TSSAVESH---QDMEPCCVCQ  628


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  629   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  668



>ref|XP_002883900.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60159.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=701

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    + +G ++ +DR+R+ RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  572   VEDYMVFDPLIYQGMTDMNDRHREMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAL  631

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K  +S+  SS  L +    C +CQ
Sbjct  632   KQHKHTISSA-SSAELHQNIEPCCICQ  657


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D +G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  658   EEYVEGDNLGTLKCGHEFHKDCIKQWVMIKNLCPICKTEA  697



>ref|XP_010484880.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like, partial [Camelina 
sativa]
Length=133

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 7/85 (8%)
 Frame = +3

Query  840   VML--QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             VML  QS L +G +   DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   +++
Sbjct  4     VMLLNQSVLFDGAAGIHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNRLKQ  63

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K   + K       +    C +CQ
Sbjct  64    RKYKSNTK-----SPQDAEPCCICQ  83


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R YK  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  56    TISNRLKQRKYKSNTKSPQDAEPCCICQEEYTEGEDMGTLECGHEFHSQCIKEWLKQKNL  115

Query  1434  CPICKSTA  1457
             CPICK+T 
Sbjct  116   CPICKTTG  123



>emb|CDY22376.1| BnaA06g36980D [Brassica napus]
Length=615

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V++L QS + +G +   DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  483   LEDVMLLNQSGIFDGAAGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  542

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++++K   S K       E    C +CQ
Sbjct  543   LKQSKYKSSTK-----SPEDAEPCCICQ  565


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D+MG L CGH +H  CIK+WL  KN CPICK+T 
Sbjct  566   EEYTEGDDMGTLECGHEFHSQCIKEWLKQKNLCPICKTTG  605



>gb|KDO84114.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
 gb|KDO84115.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
 gb|KDO84116.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
 gb|KDO84117.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
Length=699

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  569   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  628

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  629   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  654


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  655   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  694



>gb|KDO59741.1| hypothetical protein CISIN_1g004784mg [Citrus sinensis]
Length=695

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  822   EGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDR  1001
             E L + ++ +  +  G +E  DR+RD RLDVD+MSYEELL L +RIG VSTGL E+ I +
Sbjct  568   ENLRDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMK  627

Query  1002  YVRKTKLP-LSAKLSSHFLAETERKCSVCQ  1088
              +++ + P L  ++ S      E  C +CQ
Sbjct  628   IMKQKRYPSLEIEIPS-----DEEPCCICQ  652


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D +G L CGH +H +CIKQWL+ KN CPICK+T 
Sbjct  653   EEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTG  692



>ref|XP_009101822.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Brassica rapa]
Length=615

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V++L QS + +G +   DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  483   LEDVMLLNQSGIFDGAAGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  542

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++++K   S K       E    C +CQ
Sbjct  543   LKQSKYKSSTK-----SPEDAEPCCICQ  565


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D+MG L CGH +H  CIK+WL  KN CPICK+T 
Sbjct  566   EEYTEGDDMGTLECGHEFHSQCIKEWLKQKNLCPICKTTG  605



>gb|KDO84118.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
Length=657

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  527   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  586

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  587   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  612


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  613   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  652



>gb|KDO84113.1| hypothetical protein CISIN_1g005363mg [Citrus sinensis]
Length=700

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  570   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  629

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  630   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  655


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  656   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  695



>gb|KDO59743.1| hypothetical protein CISIN_1g004784mg [Citrus sinensis]
Length=728

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  822   EGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDR  1001
             E L + ++ +  +  G +E  DR+RD RLDVD+MSYEELL L +RIG VSTGL E+ I +
Sbjct  601   ENLRDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMK  660

Query  1002  YVRKTKLP-LSAKLSSHFLAETERKCSVCQ  1088
              +++ + P L  ++ S      E  C +CQ
Sbjct  661   IMKQKRYPSLEIEIPS-----DEEPCCICQ  685


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D +G L CGH +H +CIKQWL+ KN CPICK+T 
Sbjct  686   EEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTG  725



>ref|XP_006434732.1| hypothetical protein CICLE_v10000459mg [Citrus clementina]
 gb|ESR47972.1| hypothetical protein CICLE_v10000459mg [Citrus clementina]
Length=699

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  569   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  628

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  629   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  654


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  655   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  694



>ref|XP_004290596.1| PREDICTED: uncharacterized protein LOC101296252 [Fragaria vesca 
subsp. vesca]
Length=660

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    +  G +E  DR+RD RLDVD+M+YEELL LG+RIG VSTGL E+ I + +
Sbjct  535   VEDYMLFDPYIYHGMAEMHDRHRDMRLDVDNMTYEELLALGERIGDVSTGLSEETILKLM  594

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K      + + F A+ E  C +CQ
Sbjct  595   KQRKC---VSVMTEFPADME-PCCICQ  617


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E+Y   D++G+L CGH +H +CIKQWL+ KN CPICK+ A
Sbjct  618   EQYADGDDIGRLDCGHDFHTNCIKQWLMQKNLCPICKTPA  657



>ref|XP_006434731.1| hypothetical protein CICLE_v10000459mg [Citrus clementina]
 gb|ESR47971.1| hypothetical protein CICLE_v10000459mg [Citrus clementina]
Length=657

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  527   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  586

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  587   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  612


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  613   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  652



>ref|XP_006473300.1| PREDICTED: uncharacterized protein LOC102629270 isoform X3 [Citrus 
sinensis]
Length=699

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  569   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  628

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  629   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  654


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  655   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  694



>ref|XP_006473298.1| PREDICTED: uncharacterized protein LOC102629270 isoform X1 [Citrus 
sinensis]
 ref|XP_006473299.1| PREDICTED: uncharacterized protein LOC102629270 isoform X2 [Citrus 
sinensis]
Length=700

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  822   EGLA--EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEI  995
             EGL   +V++L   +  G ++ +DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I
Sbjct  570   EGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETI  629

Query  996   DRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
                +++ K  +S  L S    + +  C +CQ
Sbjct  630   KNRLKQQKYSIS--LGSQ---QEQEPCCICQ  655


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   ++ G L CGH +H  CIKQWL+HKN CPICK+TA
Sbjct  656   EEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTA  695



>ref|XP_010437680.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X2 [Camelina 
sativa]
Length=676

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  551   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  610

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  611   KQHKYTSSAAESHQDM----EPCCVCQ  633


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  634   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  673



>ref|XP_010437676.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Camelina 
sativa]
 ref|XP_010437679.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Camelina 
sativa]
Length=671

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  546   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  605

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  606   KQHKYTSSAAESHQDM----EPCCVCQ  628


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  629   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  668



>tpg|DAA35698.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=136

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  831   AEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
              E V L+S +  GG +  DR+RD RLD+D+MSYEELL L +RIG+VSTGL E+ + + ++
Sbjct  13    GENVRLES-IFYGGLDIHDRHRDMRLDIDNMSYEELLALEERIGNVSTGLSEEAVIKLLK  71

Query  1011  KTKLPLSAKLSSHFLAETERKCSVCQ  1088
             + K   S +L +    E    C +CQ
Sbjct  72    QRKFS-SWRLKASLDPE---PCCICQ  93


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G+L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  94    EEYVDGDDLGRLDCGHDFHAGCIKQWLVVKNVCPICKNTA  133



>emb|CDY62314.1| BnaCnng39930D [Brassica napus]
Length=592

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    + +  +E  DR+R+ RLDVD+MSYEELL LG+RIG VSTGLRED I + +
Sbjct  467   MEDYMVFDPLIFQSMTEMHDRHREMRLDVDNMSYEELLALGERIGDVSTGLREDVILKTM  526

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K       SS  L +    C +CQ
Sbjct  527   KQHK----CTSSSAELHQDIEPCCICQ  549


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  550   EEYAEGDDLGTLECGHEFHKDCIKQWVMLKNLCPICKTVA  589



>ref|XP_010488964.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Camelina sativa]
Length=136

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             + ++L   + +G ++  DR+R+ RLDVD+MSYEELL LG+RIG VSTGL E+ I + +++
Sbjct  11    DYMVLDPLIYQGMTDLHDRHREMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAMKQ  70

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K   S   S+    +    C +CQ
Sbjct  71    HKHTSS---SAELHQDIIEPCCICQ  92


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D +G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  93    EEYVEGDNLGTLKCGHEFHKDCIKQWVMIKNLCPICKTEA  132



>ref|NP_001174121.1| Os04g0648800 [Oryza sativa Japonica Group]
 dbj|BAH92849.1| Os04g0648800 [Oryza sativa Japonica Group]
Length=418

 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +3

Query  858   LMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAK  1037
             +  GG +  DR+RD RLD+D+MSYEELL L +RIG+VSTGL E+E+ + +++ K   S +
Sbjct  303   IFYGGVDIHDRHRDMRLDIDNMSYEELLALEERIGNVSTGLSEEEVTKLLKQRKFS-SWR  361

Query  1038  LSSHFLAETERKCSVCQ  1088
             L +   +  E  C +CQ
Sbjct  362   LEA---SVEEEPCCICQ  375


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTASR  1463
             EEY   D++G L CGH +H+ C++QWL+ KN CPICK+TA +
Sbjct  376   EEYVDGDDLGTLDCGHDFHVGCVRQWLVVKNTCPICKNTALK  417



>ref|XP_009123238.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Brassica rapa]
 ref|XP_009123239.1| PREDICTED: E3 ubiquitin-protein ligase MBR1-like [Brassica rapa]
Length=597

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    + +  +E  DR+R+ RLDVD+MSYEELL LG+RIG VSTGLRED I + +
Sbjct  472   IEDYMVFDPLIFQSMTEMHDRHREMRLDVDNMSYEELLALGERIGDVSTGLREDVILKTM  531

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K       SS  L +    C +CQ
Sbjct  532   KQHK----CTSSSAELHQDIEPCCICQ  554


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  555   EEYAEGDDLGTLECGHEFHKDCIKQWVMLKNLCPICKTVA  594



>ref|XP_003581618.1| PREDICTED: uncharacterized RING finger protein C4G3.12c-like 
[Brachypodium distachyon]
Length=387

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  882   SDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAE  1061
             SDR+R  R+D+D MSYEELL LGDRIG V+TGL ED + + + ++    +A   +H   +
Sbjct  277   SDRHRGMRMDIDGMSYEELLALGDRIGTVNTGLSEDALSKCLARSMYAPTAPPETH--QD  334

Query  1062  TERKCSVCQ  1088
              +RKCSVCQ
Sbjct  335   CDRKCSVCQ  343


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G++ C H+YHI CI+ WL  KN CPICKS A
Sbjct  344   EEYTGGEEVGEMACRHYYHIACIQHWLRQKNWCPICKSVA  383



>ref|NP_195130.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 sp|O49500.1|MBR2_ARATH RecName: Full=E3 ubiquitin-protein ligase MBR2; AltName: Full=HAL3-interacting 
protein 1 homolog; Short=AtHIP1; AltName: 
Full=MED25-binding RING-H2 protein 2; AltName: Full=RING-H2 
finger MBR2 [Arabidopsis thaliana]
 emb|CAA17568.1| putative protein [Arabidopsis thaliana]
 emb|CAB80121.1| putative protein [Arabidopsis thaliana]
 gb|AAU05489.1| At4g34040 [Arabidopsis thaliana]
 gb|AAV85696.1| At4g34040 [Arabidopsis thaliana]
 dbj|BAF01129.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86313.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=666

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    + +G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  541   FEDYMVFDPLIYQGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKVM  600

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  601   KQHKHTSSAAGSHQDM----EPCCVCQ  623


 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  624   EEYAEGDDLGTLGCGHEFHTACVKQWLMLKNLCPICKTVA  663



>gb|EEE56307.1| hypothetical protein OsJ_05392 [Oryza sativa Japonica Group]
Length=1881

 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             ++++L++ ++ G     D++ D R+D+D+MSYEELL LGDRIG VST L E++  + +R+
Sbjct  1752  QLMVLETNILLGAFTSHDQHSDMRMDIDNMSYEELLALGDRIGSVSTALSEEQFVKCLRR  1811

Query  1014  T-KLPLSAKLSSHFLAETERKCSVCQ  1088
             +  +P++ K ++  + +   KCS+CQ
Sbjct  1812  SIYIPVATKANAQVVDDI--KCSICQ  1835


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G+L C H YH+ CI QWL  KN CPICK++A
Sbjct  1836  EEYIEGEEVGRLGCEHQYHVCCIHQWLRQKNWCPICKASA  1875



>ref|XP_006283256.1| hypothetical protein CARUB_v10004296mg [Capsella rubella]
 gb|EOA16154.1| hypothetical protein CARUB_v10004296mg [Capsella rubella]
Length=672

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  547   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  606

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA   SH   +    C VCQ
Sbjct  607   KQHKH-TSAAAESH---QDMEPCCVCQ  629


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  630   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  669



>gb|KHN12795.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=699

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY+  D++G L CGH YH  CIKQWL+HKN CPICK+T 
Sbjct  657   EEYKDGDDLGSLDCGHDYHRDCIKQWLMHKNLCPICKTTG  696


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               +V++L   +  G ++  DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ + + +
Sbjct  575   FEDVMILDPSVFSGIADIHDRHRDMRLDVDNMSYEELLALEERIGNVSTGLSEEIVSKLL  634

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +K K   SA+  S   AE    C VCQ
Sbjct  635   KKKK--YSAEPDSQHEAE---PCCVCQ  656



>ref|XP_004291092.1| PREDICTED: uncharacterized protein LOC101300206 [Fragaria vesca 
subsp. vesca]
Length=714

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               +V++L   ++ G ++  DR+RD RLDVD+MSYEELL L +RIG+V+TGL E+ I   +
Sbjct  589   FEDVMILDQSMLFGVADIHDRHRDMRLDVDNMSYEELLALEERIGNVNTGLSEEIISNRL  648

Query  1008  RKTKLPLSAKLSSHFLAETERK-CSVCQ  1088
             +  K      ++  + AETE + C VCQ
Sbjct  649   KHKKY-----IAMAYEAETETEPCCVCQ  671


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQWL HKN CPICK+TA
Sbjct  672   EEYNEADDLGMLECGHDFHSDCIKQWLTHKNLCPICKTTA  711



>ref|XP_002867137.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43396.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=667

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    + +G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  542   FEDYMVFDPLIYQGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  601

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  602   KQHKHTSSAAGSHQDM----EPCCVCQ  624


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  625   EEYAEGDDLGTLGCGHEFHTACVKQWLMLKNLCPICKTVA  664



>ref|XP_006283257.1| hypothetical protein CARUB_v10004296mg [Capsella rubella]
 gb|EOA16155.1| hypothetical protein CARUB_v10004296mg [Capsella rubella]
Length=673

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  548   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  607

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA   SH   +    C VCQ
Sbjct  608   KQHKH-TSAAAESH---QDMEPCCVCQ  630


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  631   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  670



>ref|XP_011040965.1| PREDICTED: uncharacterized RING finger protein C4G3.12c [Populus 
euphratica]
 ref|XP_011040966.1| PREDICTED: uncharacterized RING finger protein C4G3.12c [Populus 
euphratica]
 ref|XP_011040967.1| PREDICTED: uncharacterized RING finger protein C4G3.12c [Populus 
euphratica]
 ref|XP_011040968.1| PREDICTED: uncharacterized RING finger protein C4G3.12c [Populus 
euphratica]
Length=545

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = +3

Query  825   GLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             G   ++ML    + G     D+YRD RLDVD MSYEELL LG+RIG+V+TGL ED   + 
Sbjct  415   GSEALMMLDHSYLYGSRNFFDQYRDMRLDVDSMSYEELLALGERIGNVNTGLPEDVFSKC  474

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVC  1085
             + +T+   S K      A+ E  C++C
Sbjct  475   LVETRCHSSDK------AQEETSCAIC  495


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKLV-CGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY+S D++G +  CGH YH+ CIK+WL  KN CPICK+ A
Sbjct  497   EEYKSMDKVGMIKNCGHVYHVDCIKKWLSMKNMCPICKAPA  537



>tpg|DAA60535.1| TPA: putative clathrin heavy chain family protein [Zea mays]
Length=330

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             +++ML++ L  G     DR+RD R+D+D MSYE+LL L +RIG VST L E++  + +++
Sbjct  40    QLLMLEANLFFGAFASYDRHRDMRMDIDDMSYEKLLALEERIGSVSTALSEEQFTKCLKR  99

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQVGSRFPN  1109
             +     A L  +     + KCS+CQ  S  P+
Sbjct  100   SIYSQVA-LEVNKSTVDDMKCSICQHYSELPD  130



>emb|CDY37230.1| BnaA09g08510D [Brassica napus]
Length=589

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    + +  +E  DR+R+ RLDVD+MSYEELL LG+RIG VSTGLRED I + +
Sbjct  464   IEDYMVFDPLIFQSMTEMHDRHREMRLDVDNMSYEELLALGERIGDVSTGLREDVILKTM  523

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K       SS  L +    C +CQ
Sbjct  524   KQHK----CTSSSAELHQDIEPCCICQ  546


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  547   EEYAEGDDLGTLECGHEFHKDCIKQWVMLKNLCPICKTVA  586



>ref|XP_010538110.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Tarenaya hassleriana]
 ref|XP_010538111.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Tarenaya hassleriana]
 ref|XP_010538112.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Tarenaya hassleriana]
Length=689

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             L +V+ L   ++ G ++  DRYR+ RLDVD+MSYEELL L +RIG V TGL E+ I  ++
Sbjct  559   LEDVMFLDQSVLLGVADIHDRYREMRLDVDNMSYEELLALEERIGDVCTGLTEEIISNHL  618

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   + K S     ETE  C +CQ
Sbjct  619   KQRKYKSTNKSSQ----ETE-PCCICQ  640


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D+MG L CGH +H  C+K+WL  KN CPICK+T 
Sbjct  641   EEYNEGDDMGTLECGHDFHSQCVKEWLKRKNLCPICKTTG  680



>emb|CDY32973.1| BnaA09g16200D [Brassica napus]
Length=410

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V++L QS L +G     DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  278   LEDVMLLNQSLLFDGAGGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  337

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +++ K   S K       +    C +CQ
Sbjct  338   LKQRKFKSSTK-----SPQDAEPCCICQ  360


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R +K  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  333   TISNRLKQRKFKSSTKSPQDAEPCCICQEEYIEGEDMGALECGHDFHSQCIKEWLKQKNI  392

Query  1434  CPICKST  1454
             CPICK+T
Sbjct  393   CPICKTT  399



>ref|XP_006412283.1| hypothetical protein EUTSA_v10024583mg [Eutrema salsugineum]
 gb|ESQ53736.1| hypothetical protein EUTSA_v10024583mg [Eutrema salsugineum]
Length=683

 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  558   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  617

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  618   KQHKHTSSAAESHQDM----EPCCVCQ  640


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  641   EEYAEGDDLGTLGCGHEFHTACVKQWLMLKNLCPICKTVA  680



>emb|CDY43590.1| BnaC09g17290D [Brassica napus]
Length=421

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V+ L QS L +G +   DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  289   LEDVMFLNQSLLFDGAAGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  348

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +++ K   S K       +    C +CQ
Sbjct  349   LKQRKFKSSTK-----SPQDAEPCCICQ  371


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R +K  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  344   TISNRLKQRKFKSSTKSPQDAEPCCICQEEYSEGEDMGTLECGHDFHSQCIKEWLKQKNL  403

Query  1434  CPICKST  1454
             CPICK+T
Sbjct  404   CPICKTT  410



>ref|XP_009114020.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X1 [Brassica 
rapa]
 ref|XP_009114021.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X1 [Brassica 
rapa]
Length=410

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V++L QS L +G     DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  278   LEDVMLLNQSLLFDGAGGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  337

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +++ K   S K       +    C +CQ
Sbjct  338   LKQRKFKSSTK-----SPQDAEPCCICQ  360


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R +K  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  333   TISNRLKQRKFKSSTKSPQDAEPCCICQEEYSEGEDMGALECGHDFHSQCIKEWLKQKNL  392

Query  1434  CPICKST  1454
             CPICK+T
Sbjct  393   CPICKTT  399



>ref|XP_010906570.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X1 [Elaeis guineensis]
Length=738

 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               ++ +L      GG +  DR+RD RLDVD+MSYEELL L +RIG+VSTGL E+ I + +
Sbjct  613   FEDIFILDQSAFFGGGDLHDRHRDMRLDVDNMSYEELLALEERIGNVSTGLSEEMILKCL  672

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   +A  SS    E E  C +CQ
Sbjct  673   KQRKYTFTALDSS---VEVE-PCCICQ  695


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +E+G L C H +H  CIK+WL+ KN CPICK+TA
Sbjct  696   EEYREGEELGTLDCRHDFHTACIKRWLMIKNLCPICKTTA  735



>ref|XP_008364450.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=692

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  567   VEDYMLFDPFIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEETIMKCM  626

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K    ++ SS   A+ E  C VCQ
Sbjct  627   KQRKFLAISEESS---ADME-PCCVCQ  649


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y  +D++G L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  650   EVYADEDDIGTLDCGHDFHTSCIKQWLMQKNLCPICKTTA  689



>ref|XP_010028452.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X3 [Eucalyptus 
grandis]
 gb|KCW55187.1| hypothetical protein EUGRSUZ_I01135 [Eucalyptus grandis]
Length=655

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             + V+ Q  L  G  E  DR+RD RLDVD+MSYEELL L +RIG VSTGL E+ I + +++
Sbjct  531   DYVIFQPFLNNGFGEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLSEETILKALKR  590

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K  +S       L +    C +CQ
Sbjct  591   QKKNVSVAGE---LPQDVEPCCICQ  612


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQWL+ KN CPICK+T 
Sbjct  613   EEYADGDDLGVLGCGHEFHADCIKQWLMRKNLCPICKTTG  652



>ref|XP_009114022.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like isoform X2 [Brassica 
rapa]
Length=408

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = +3

Query  828   LAEVVML-QSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRY  1004
             L +V++L QS L +G     DRYRD RLDVD+MSYEELL L +RIG V TG+ E+ I   
Sbjct  276   LEDVMLLNQSLLFDGAGGMHDRYRDMRLDVDNMSYEELLALEERIGDVCTGVNEETISNR  335

Query  1005  VRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             +++ K   S K       +    C +CQ
Sbjct  336   LKQRKFKSSTK-----SPQDAEPCCICQ  358


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +3

Query  1260  TVYKEIKLRLYKW*TLDPNTSR--L*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNA  1433
             T+   +K R +K  T  P  +       EEY   ++MG L CGH +H  CIK+WL  KN 
Sbjct  331   TISNRLKQRKFKSSTKSPQDAEPCCICQEEYSEGEDMGALECGHDFHSQCIKEWLKQKNL  390

Query  1434  CPICKST  1454
             CPICK+T
Sbjct  391   CPICKTT  397



>ref|XP_008373127.1| PREDICTED: uncharacterized protein DDB_G0271670 [Malus domestica]
Length=692

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  567   VEDYMLFDPFIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEETIMKCM  626

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K      +S    A+ E  C VCQ
Sbjct  627   KQRKF---LAISEESSADME-PCCVCQ  649


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y  +D++G L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  650   EVYADEDDIGTLDCGHDFHTSCIKQWLMQKNLCPICKTTA  689



>ref|XP_010028444.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028445.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028446.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028447.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028448.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028449.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55185.1| hypothetical protein EUGRSUZ_I01135 [Eucalyptus grandis]
 gb|KCW55186.1| hypothetical protein EUGRSUZ_I01135 [Eucalyptus grandis]
Length=702

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             + V+ Q  L  G  E  DR+RD RLDVD+MSYEELL L +RIG VSTGL E+ I + +++
Sbjct  578   DYVIFQPFLNNGFGEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLSEETILKALKR  637

Query  1014  TKLPLSAKLSSHFLAETERKCSVCQ  1088
              K  +S       L +    C +CQ
Sbjct  638   QKKNVSVAGE---LPQDVEPCCICQ  659


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQWL+ KN CPICK+T 
Sbjct  660   EEYADGDDLGVLGCGHEFHADCIKQWLMRKNLCPICKTTG  699



>ref|XP_002451554.1| hypothetical protein SORBIDRAFT_04g003650 [Sorghum bicolor]
 gb|EES04530.1| hypothetical protein SORBIDRAFT_04g003650 [Sorghum bicolor]
Length=518

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 20/119 (17%)
 Frame = +3

Query  834   EVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRK  1013
             ++++L++ L  G     DR+RD R+D+D+MSYEELL L +RIG VST L E++  + +R+
Sbjct  390   QLLVLETNLFFGAFASYDRHRDMRMDIDNMSYEELLALEERIGSVSTALSEEQFTKCLRR  449

Query  1014  TKLPLSAKLSSHFLAET--ERKCSVCQ--------VGSRFPNSAWISLF*LYHSPCWAE  1160
             +   + ++++S     T  + KCS+CQ        VG R P   W      YH  C  +
Sbjct  450   S---IYSQVASEVSKSTVDDMKCSICQEEYMEGEEVG-RLPCEHW------YHVCCIGQ  498


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +3

Query  1236  TQCLKDVMTVYKEIKLRLYKW*TLDPNTSRL*V*EEYESDDEMGKLVCGHFYHIHCIKQW  1415
             T+CL+   ++Y ++   + K  T+D     +   EEY   +E+G+L C H+YH+ CI QW
Sbjct  444   TKCLR--RSIYSQVASEVSKS-TVDDMKCSI-CQEEYMEGEEVGRLPCEHWYHVCCIGQW  499

Query  1416  LLHKNACPICKSTA  1457
             L  KN CP+CK++A
Sbjct  500   LRQKNWCPVCKASA  513



>ref|XP_009341337.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Pyrus x bretschneideri]
Length=692

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  567   VEDYMLFDPFIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEETIMKCM  626

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K      +S    A+ E  C VCQ
Sbjct  627   KQRKF---LAISEESPADME-PCCVCQ  649


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             E Y  +D +G L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  650   EVYADEDAVGTLDCGHDFHTSCIKQWLMQKNLCPICKTTA  689



>ref|XP_006386504.1| hypothetical protein POPTR_0002s12590g [Populus trichocarpa]
 gb|ERP64301.1| hypothetical protein POPTR_0002s12590g [Populus trichocarpa]
Length=709

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 82/170 (48%), Gaps = 23/170 (14%)
 Frame = +3

Query  609   GCVVSRRTASRRGKVDGDTVRPRERSACTLRR-----MVIPEDNPFLDSD-----TASGM  758
             G   S  T    G  +    RP  RSA  L R     + IP     L S+       S  
Sbjct  510   GASSSEDTVPSSGAGNQGLHRPHPRSASWLERQGDGVLGIPYPLRALSSEGRSRLVVSEQ  569

Query  759   TRSRMDVLGSRHHRYSRYGFPEGLAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEEL  938
              R+ +D++        R G      +V++L   ++ G ++  DR+RD RLDVD+MSYEEL
Sbjct  570   IRNVLDLM--------RRGESLRFEDVMILDQSVLFGAADMYDRHRDMRLDVDNMSYEEL  621

Query  939   LELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             L L +RIG+VSTGL E+ I   +++ K   S  + +   AE    C +CQ
Sbjct  622   LALEERIGNVSTGLSEETIVNNLKQQK--YSVAVGAKVEAE---PCCICQ  666


 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   +++G L CGH +H  C+KQWL+HKN CPICK+T 
Sbjct  667   EEYNDGEDLGTLDCGHDFHAGCVKQWLMHKNWCPICKTTG  706



>gb|AES60749.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=700

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 7/67 (10%)
 Frame = +3

Query  885   DRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSSHFLAET  1064
             D++RD R+D+  MSYEELL LG+RIG+V+TGL E  I +Y+ KT L  SA+ S       
Sbjct  595   DQHRDMRMDISGMSYEELLALGERIGYVNTGLSESLISKYLTKT-LYCSAEQSQ------  647

Query  1065  ERKCSVC  1085
             E  C++C
Sbjct  648   EGTCAIC  654


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  1338  EEYESDDEMGKL-VCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY++ D +G L  CGH YH+ CI++WL  KN CPICK +A
Sbjct  656   EEYKNMDSIGTLETCGHDYHVSCIRKWLSMKNLCPICKVSA  696



>ref|XP_003580695.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X2 [Brachypodium distachyon]
Length=660

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 6/86 (7%)
 Frame = +3

Query  831   AEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVR  1010
              E V  +S +  GG E  DR+RD RLD+D+MSYEELL L +RIG+VSTGL E+++   ++
Sbjct  538   GENVRFES-IFYGGVEIHDRHRDMRLDIDNMSYEELLALEERIGNVSTGLSEEDVMNLLK  596

Query  1011  KTKLPLSAKLSSHFLAETERKCSVCQ  1088
             + K   S +LSS    E E  CS+CQ
Sbjct  597   QRKFS-SWRLSS---VEHE-PCSICQ  617


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  1248  KDVMTVYKEIKLRLYKW*TLDPNTSRL*V*EEYESDDEMGKLVCGHFYHIHCIKQWLLHK  1427
             +DVM + K+ K   ++  +++     +   EEY   D++G L CGH +H  CI+QWL+ K
Sbjct  589   EDVMNLLKQRKFSSWRLSSVEHEPCSI-CQEEYIDGDDLGTLHCGHDFHAGCIRQWLVVK  647

Query  1428  NACPICKSTA  1457
             N CPICK+TA
Sbjct  648   NLCPICKNTA  657



>ref|XP_006409547.1| hypothetical protein EUTSA_v10022580mg [Eutrema salsugineum]
 gb|ESQ51000.1| hypothetical protein EUTSA_v10022580mg [Eutrema salsugineum]
Length=698

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
             + + ++    + +  +E  DR+R+ RLDVD+MSYEELL LG+RIG VSTGLRED I + +
Sbjct  573   IEDYMVFDPLIYQSMTEMHDRHREMRLDVDNMSYEELLALGERIGDVSTGLREDVILKTM  632

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K       SS  L +    C +CQ
Sbjct  633   KQHK----HTSSSAELHQDIEPCCICQ  655


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  CIKQW++ KN CPICK+ A
Sbjct  656   EEYVEGDDLGTLECGHEFHKDCIKQWVMLKNLCPICKTVA  695



>ref|XP_010447158.1| PREDICTED: E3 ubiquitin-protein ligase MBR2-like [Camelina sativa]
Length=665

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +3

Query  828   LAEVVMLQSRLMEGGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYV  1007
               + ++    +  G +E  DR+RD RLDVD+MSYEELL LG+RIG VSTGL E+ I + +
Sbjct  540   FEDYMVFDPLIYHGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKAM  599

Query  1008  RKTKLPLSAKLSSHFLAETERKCSVCQ  1088
             ++ K   SA  S   +      C VCQ
Sbjct  600   KQHKHTSSAAESHQDM----EPCCVCQ  622


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY   D++G L CGH +H  C+KQWL+ KN CPICK+ A
Sbjct  623   EEYAEGDDLGTLACGHEFHTACVKQWLMLKNLCPICKTVA  662



>ref|XP_009418514.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=697

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +3

Query  867   GGSEGSDRYRDWRLDVDHMSYEELLELGDRIGHVSTGLREDEIDRYVRKTKLPLSAKLSS  1046
             GG+   DRYRD RLDVD+MSYEELL LG+RIG+V+TGL E++I   +R+ K      ++S
Sbjct  585   GGTNFHDRYRDMRLDVDNMSYEELLVLGERIGYVNTGLSEEKILNCLRQRKY---VSIAS  641

Query  1047  HFLAETERKCSVC  1085
                 E E  C +C
Sbjct  642   EPSGEVE-PCCIC  653


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  1338  EEYESDDEMGKLVCGHFYHIHCIKQWLLHKNACPICKSTA  1457
             EEY    E+G+L CGH +H  CIKQWL+ KN CPICK+TA
Sbjct  655   EEYMEGAELGRLDCGHDFHTACIKQWLMIKNLCPICKTTA  694



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5670177943056