BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24582_g1_i1 len=1799 path=[1:0-320 @322@!:321-884 886:885-924
926:925-989 11016:990-1002 10773:1003-1065 991:1066-1181
@1221@!:1182-1568 11157:1569-1569 4240:1570-1634 1651:1635-1691
11209:1692-1703 10369:1704-1749 6209:1750-1770 7685:1771-1798]

Length=1799
                                                                      Score     E

ref|XP_009770494.1|  PREDICTED: uncharacterized protein LOC104221191    278   2e-137   
ref|XP_009629350.1|  PREDICTED: uncharacterized protein LOC104119532    275   2e-136   
ref|XP_010316031.1|  PREDICTED: uncharacterized protein LOC101266...    276   2e-135   
ref|XP_004231941.1|  PREDICTED: uncharacterized protein LOC101266...    276   3e-135   
ref|XP_006363807.1|  PREDICTED: uncharacterized protein LOC102587133    279   2e-134   
emb|CDP02625.1|  unnamed protein product                                255   2e-126   
ref|XP_011099408.1|  PREDICTED: uncharacterized protein LOC105177...    242   5e-121   
ref|XP_011099409.1|  PREDICTED: uncharacterized protein LOC105177...    243   1e-120   
ref|XP_011099405.1|  PREDICTED: uncharacterized protein LOC105177...    242   4e-120   
ref|XP_002525301.1|  amino acid binding protein, putative               226   7e-118   Ricinus communis
ref|XP_010023323.1|  PREDICTED: uncharacterized protein LOC104414031    230   2e-117   
gb|KDP32101.1|  hypothetical protein JCGZ_12562                         228   3e-117   
ref|XP_007047587.1|  ACT domain repeat 1, putative isoform 1            236   6e-117   
ref|XP_010273298.1|  PREDICTED: uncharacterized protein LOC104608...    228   4e-116   
ref|XP_010647080.1|  PREDICTED: uncharacterized protein LOC100264...    247   4e-116   
ref|XP_002265013.2|  PREDICTED: uncharacterized protein LOC100264...    246   9e-116   Vitis vinifera
ref|XP_002310330.2|  hypothetical protein POPTR_0007s14780g             225   8e-115   Populus trichocarpa [western balsam poplar]
ref|XP_010273258.1|  PREDICTED: uncharacterized protein LOC104608...    228   2e-114   
ref|XP_010273306.1|  PREDICTED: uncharacterized protein LOC104608...    228   8e-114   
ref|XP_011031317.1|  PREDICTED: uncharacterized protein LOC105130...    221   3e-113   
ref|XP_011031316.1|  PREDICTED: uncharacterized protein LOC105130...    222   7e-112   
gb|KDO78875.1|  hypothetical protein CISIN_1g014457mg                   215   7e-112   
ref|XP_006426129.1|  hypothetical protein CICLE_v10025521mg             214   6e-111   
ref|XP_011007844.1|  PREDICTED: uncharacterized protein LOC105113386    216   1e-110   
ref|XP_002320665.2|  hypothetical protein POPTR_0014s00840g             218   1e-110   Populus trichocarpa [western balsam poplar]
gb|EYU44517.1|  hypothetical protein MIMGU_mgv1a005004mg                205   3e-107   
ref|XP_010106910.1|  hypothetical protein L484_013004                   222   9e-107   
ref|XP_004288269.1|  PREDICTED: uncharacterized protein LOC101292932    209   2e-106   
ref|XP_003635457.1|  PREDICTED: uncharacterized protein LOC100854519    230   5e-105   
ref|XP_007047588.1|  ACT domain repeat 1 isoform 2                      216   5e-105   
ref|XP_010679666.1|  PREDICTED: uncharacterized protein LOC104894974    219   3e-104   
ref|XP_007205133.1|  hypothetical protein PRUPE_ppa005094mg             204   3e-103   
ref|XP_008237545.1|  PREDICTED: uncharacterized protein LOC103336...    206   1e-102   
ref|XP_008351934.1|  PREDICTED: uncharacterized protein LOC103415377    211   1e-101   
ref|XP_008237541.1|  PREDICTED: uncharacterized protein LOC103336...    206   3e-101   
ref|XP_009362597.1|  PREDICTED: uncharacterized protein LOC103952667    211   9e-101   
gb|KHF99761.1|  [Protein-PII] uridylyltransferase                       213   2e-99    
ref|XP_010936169.1|  PREDICTED: uncharacterized protein LOC105055...    190   1e-98    
ref|XP_010936168.1|  PREDICTED: uncharacterized protein LOC105055...    190   1e-98    
ref|XP_010936170.1|  PREDICTED: uncharacterized protein LOC105055...    190   2e-98    
ref|XP_008440421.1|  PREDICTED: uncharacterized protein LOC103484871    196   1e-97    
emb|CBI35746.3|  unnamed protein product                                203   4e-97    
ref|XP_004163340.1|  PREDICTED: uncharacterized protein LOC101229243    192   3e-96    
ref|XP_006573669.1|  PREDICTED: uncharacterized protein LOC100781...    201   4e-96    
gb|KHN36315.1|  [Protein-PII] uridylyltransferase                       201   4e-96    
ref|XP_004143407.1|  PREDICTED: uncharacterized protein LOC101215529    193   7e-96    
gb|KGN48629.1|  hypothetical protein Csa_6G495830                       192   1e-95    
ref|XP_003539257.1|  PREDICTED: uncharacterized protein LOC100811109    199   6e-95    
ref|XP_003611547.1|  ACT domain-containing protein                      204   7e-95    
ref|XP_004511814.1|  PREDICTED: uncharacterized protein LOC101513...    209   7e-95    
ref|XP_004511813.1|  PREDICTED: uncharacterized protein LOC101513...    208   1e-94    
ref|XP_008790256.1|  PREDICTED: uncharacterized protein LOC103707...    188   1e-92    
ref|XP_007156695.1|  hypothetical protein PHAVU_002G009500g             191   6e-92    
ref|XP_006280393.1|  hypothetical protein CARUB_v10026320mg             181   2e-87    
gb|ADE76039.1|  unknown                                                 172   1e-86    
ref|XP_010444612.1|  PREDICTED: uncharacterized protein LOC104727...    181   3e-85    
ref|XP_010444610.1|  PREDICTED: uncharacterized protein LOC104727...    180   5e-85    
ref|XP_010484442.1|  PREDICTED: uncharacterized protein LOC104762778    178   7e-85    
ref|XP_010559220.1|  PREDICTED: uncharacterized protein LOC104827695    175   2e-84    
ref|XP_002864985.1|  hypothetical protein ARALYDRAFT_919932             175   1e-83    
emb|CDY36516.1|  BnaC03g48750D                                          177   1e-83    
ref|NP_001078803.1|  ACT domain repeat 1                                176   4e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463740.1|  PREDICTED: uncharacterized protein LOC104744384    177   4e-83    
ref|NP_201390.1|  ACT domain repeat 1                                   175   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150677.1|  PREDICTED: uncharacterized protein LOC103874028    174   9e-83    
ref|XP_009412293.1|  PREDICTED: uncharacterized protein LOC103993822    171   3e-82    
gb|EPS62051.1|  hypothetical protein M569_12742                         176   9e-82    
gb|ABK22147.1|  unknown                                                 165   3e-81    Picea sitchensis
ref|XP_007155810.1|  hypothetical protein PHAVU_003G2336000g            158   1e-80    
ref|XP_006393975.1|  hypothetical protein EUTSA_v10004129mg             174   6e-79    
ref|XP_003525871.1|  PREDICTED: uncharacterized protein LOC100783...    160   4e-78    
emb|CAA16674.1|  predicted protein                                      177   6e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002990728.1|  hypothetical protein SELMODRAFT_132226             154   1e-77    
ref|XP_002986703.1|  hypothetical protein SELMODRAFT_124581             152   4e-77    
gb|ADE77534.1|  unknown                                                 154   2e-76    
ref|XP_006856315.1|  hypothetical protein AMTR_s00047p00143120          155   8e-76    
gb|AES90748.2|  four ACT domain ACT domain protein which protein        156   8e-76    
ref|XP_007222134.1|  hypothetical protein PRUPE_ppa005716mg             156   2e-75    
ref|XP_007045767.1|  ACT domain repeat 4                                152   1e-74    
ref|XP_006450386.1|  hypothetical protein CICLE_v10010775mg             152   2e-74    
ref|XP_006857102.1|  hypothetical protein AMTR_s00065p00123930          147   3e-74    
ref|XP_006844620.1|  hypothetical protein AMTR_s00016p00225040          150   4e-74    
ref|XP_004136481.1|  PREDICTED: uncharacterized protein LOC101219701    150   5e-74    
ref|XP_008466435.1|  PREDICTED: uncharacterized protein LOC103503843    150   5e-74    
ref|XP_008243801.1|  PREDICTED: uncharacterized protein LOC103342019    154   8e-74    
ref|XP_010250636.1|  PREDICTED: uncharacterized protein LOC104592829    150   1e-73    
ref|XP_002974009.1|  hypothetical protein SELMODRAFT_100599             156   2e-73    
ref|XP_011020660.1|  PREDICTED: uncharacterized protein LOC105122...    153   9e-73    
ref|XP_011020651.1|  PREDICTED: uncharacterized protein LOC105122...    153   9e-73    
ref|XP_010250220.1|  PREDICTED: uncharacterized protein LOC104592...    149   1e-72    
ref|XP_010250221.1|  PREDICTED: uncharacterized protein LOC104592...    149   1e-72    
ref|XP_010650073.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    151   2e-72    
ref|XP_002986453.1|  hypothetical protein SELMODRAFT_124305             142   2e-72    
ref|XP_010091626.1|  [Protein-PII] uridylyltransferase                  147   2e-72    
ref|XP_010241627.1|  PREDICTED: uncharacterized protein LOC104586168    149   2e-72    
ref|XP_002312346.1|  hypothetical protein POPTR_0008s10860g             153   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_010260920.1|  PREDICTED: uncharacterized protein LOC104599871    149   3e-72    
gb|KDP41357.1|  hypothetical protein JCGZ_15764                         150   4e-72    
gb|KHN29949.1|  [Protein-PII] uridylyltransferase                       150   6e-72    
ref|XP_010249096.1|  PREDICTED: uncharacterized protein LOC104591777    148   6e-72    
ref|XP_004490253.1|  PREDICTED: uncharacterized protein LOC101508...    150   6e-72    
ref|XP_004490254.1|  PREDICTED: uncharacterized protein LOC101508...    150   7e-72    
ref|XP_002978936.1|  hypothetical protein SELMODRAFT_109915             141   8e-72    
ref|XP_010270359.1|  PREDICTED: uncharacterized protein LOC104606716    156   9e-72    
gb|KHG02132.1|  [Protein-PII] uridylyltransferase                       147   9e-72    
ref|XP_004490255.1|  PREDICTED: uncharacterized protein LOC101508...    150   1e-71    
ref|XP_004490250.1|  PREDICTED: uncharacterized protein LOC101508...    150   1e-71    
ref|XP_004490251.1|  PREDICTED: uncharacterized protein LOC101508...    150   1e-71    
ref|XP_004490252.1|  PREDICTED: uncharacterized protein LOC101508...    150   1e-71    
ref|XP_008339767.1|  PREDICTED: uncharacterized protein LOC103402787    146   1e-71    
ref|XP_010066809.1|  PREDICTED: uncharacterized protein LOC104453...    144   1e-71    
ref|XP_010066810.1|  PREDICTED: uncharacterized protein LOC104453...    144   2e-71    
ref|XP_006573170.1|  PREDICTED: uncharacterized protein LOC100787...    150   2e-71    
ref|XP_003518790.2|  PREDICTED: uncharacterized protein LOC100813...    149   2e-71    
ref|XP_011039651.1|  PREDICTED: uncharacterized protein LOC105136133    149   2e-71    
ref|XP_003516462.1|  PREDICTED: uncharacterized protein LOC100787...    150   2e-71    
gb|KHN02615.1|  [Protein-PII] uridylyltransferase                       150   2e-71    
ref|XP_006847223.1|  hypothetical protein AMTR_s00017p00256400          157   2e-71    
gb|ACL53099.1|  unknown                                                 147   3e-71    Zea mays [maize]
ref|XP_008668558.1|  PREDICTED: ACR4 isoform X1                         148   3e-71    
ref|XP_002266641.1|  PREDICTED: uncharacterized protein LOC100250497    145   4e-71    Vitis vinifera
gb|ACG25547.1|  ACR4                                                    148   4e-71    Zea mays [maize]
tpg|DAA45793.1|  TPA: hypothetical protein ZEAMMB73_762765              147   4e-71    
ref|NP_001142223.1|  ACR4                                               148   4e-71    Zea mays [maize]
emb|CAN83845.1|  hypothetical protein VITISV_001862                     145   4e-71    Vitis vinifera
ref|XP_006302244.1|  hypothetical protein CARUB_v10020277mg             145   8e-71    
gb|EPS70014.1|  hypothetical protein M569_04746                         144   9e-71    
ref|XP_011086838.1|  PREDICTED: uncharacterized protein LOC105168...    147   1e-70    
ref|XP_009105454.1|  PREDICTED: uncharacterized protein LOC103831...    144   1e-70    
ref|XP_011086839.1|  PREDICTED: uncharacterized protein LOC105168...    147   1e-70    
ref|XP_004297204.1|  PREDICTED: uncharacterized protein LOC101300715    143   1e-70    
ref|XP_010099846.1|  [Protein-PII] uridylyltransferase                  141   1e-70    
ref|XP_002512031.1|  amino acid binding protein, putative               147   1e-70    Ricinus communis
ref|XP_004310107.1|  PREDICTED: uncharacterized protein LOC101292961    147   1e-70    
ref|XP_009105455.1|  PREDICTED: uncharacterized protein LOC103831...    143   1e-70    
ref|XP_006391062.1|  hypothetical protein EUTSA_v10018526mg             144   2e-70    
dbj|BAJ33767.1|  unnamed protein product                                144   2e-70    
emb|CDX95965.1|  BnaA07g27660D                                          143   2e-70    
ref|XP_002887219.1|  hypothetical protein ARALYDRAFT_476032             144   2e-70    
ref|XP_010257936.1|  PREDICTED: uncharacterized protein LOC104597...    151   3e-70    
ref|XP_008811478.1|  PREDICTED: uncharacterized protein LOC103722634    148   3e-70    
ref|XP_010257938.1|  PREDICTED: uncharacterized protein LOC104597...    150   4e-70    
ref|XP_011102236.1|  PREDICTED: uncharacterized protein LOC105180...    145   4e-70    
ref|XP_007043904.1|  ACT domain repeat 4 isoform 2                      147   4e-70    
ref|XP_011102239.1|  PREDICTED: uncharacterized protein LOC105180...    145   5e-70    
ref|NP_001145757.1|  hypothetical protein                               142   5e-70    Zea mays [maize]
ref|XP_010048170.1|  PREDICTED: uncharacterized protein LOC104437016    146   6e-70    
gb|KDP33571.1|  hypothetical protein JCGZ_07142                         150   6e-70    
ref|NP_177067.1|  ACT domain-containing protein                         141   6e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277393.1|  PREDICTED: uncharacterized protein LOC104611...    143   6e-70    
ref|NP_974107.1|  ACT domain-containing protein                         141   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411127.1|  PREDICTED: uncharacterized protein LOC103992926    147   7e-70    
dbj|BAC43240.1|  unknown protein                                        141   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936426.1|  PREDICTED: uncharacterized protein LOC105056...    152   7e-70    
ref|XP_002324307.2|  hypothetical protein POPTR_0018s01920g             142   7e-70    Populus trichocarpa [western balsam poplar]
ref|XP_010277394.1|  PREDICTED: uncharacterized protein LOC104611...    144   8e-70    
ref|XP_010936425.1|  PREDICTED: uncharacterized protein LOC105056...    152   8e-70    
gb|AAF27052.1|AC008262_1  F4N2.2                                        141   8e-70    Arabidopsis thaliana [mouse-ear cress]
gb|KDO70280.1|  hypothetical protein CISIN_1g013090mg                   152   8e-70    
ref|XP_002314917.2|  hypothetical protein POPTR_0010s14840g             145   8e-70    Populus trichocarpa [western balsam poplar]
gb|AAS07062.1|  putative ACT domain containing protein, ACR4, wit...    145   8e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27314.1|  hypothetical protein OsJ_11253                          145   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484247.1|  PREDICTED: uncharacterized protein LOC102622082    152   1e-69    
gb|KDO70279.1|  hypothetical protein CISIN_1g013090mg                   152   1e-69    
ref|XP_010537315.1|  PREDICTED: uncharacterized protein LOC104812060    144   1e-69    
ref|XP_006437860.1|  hypothetical protein CICLE_v10031536mg             152   1e-69    
ref|NP_001050359.1|  Os03g0413100                                       145   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394314.1|  PREDICTED: uncharacterized protein LOC103979823    149   1e-69    
ref|XP_008222209.1|  PREDICTED: uncharacterized protein LOC103322107    144   1e-69    
ref|XP_011009617.1|  PREDICTED: uncharacterized protein LOC105114...    145   1e-69    
gb|EAY90442.1|  hypothetical protein OsI_12028                          145   1e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_009599622.1|  PREDICTED: uncharacterized protein LOC104095244    142   1e-69    
gb|KHG23892.1|  [Protein-PII] uridylyltransferase                       148   1e-69    
gb|ABG37643.1|  unknown                                                 143   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_009127699.1|  PREDICTED: uncharacterized protein LOC103852547    141   2e-69    
ref|XP_006371753.1|  hypothetical protein POPTR_0018s01920g             143   2e-69    
emb|CDY65806.1|  BnaA02g35780D                                          141   2e-69    
gb|ACG60681.1|  unknown protein                                         141   2e-69    Brassica oleracea var. alboglabra
ref|XP_010415531.1|  PREDICTED: uncharacterized protein LOC104701533    140   2e-69    
ref|XP_007222095.1|  hypothetical protein PRUPE_ppa005632mg             144   2e-69    
ref|XP_002324305.2|  hypothetical protein POPTR_0018s01920g             142   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_010470880.1|  PREDICTED: uncharacterized protein LOC104750738    140   3e-69    
ref|XP_002281251.1|  PREDICTED: uncharacterized protein LOC100242743    140   3e-69    Vitis vinifera
ref|XP_008231090.1|  PREDICTED: uncharacterized protein LOC103330...    147   3e-69    
ref|XP_009373348.1|  PREDICTED: uncharacterized protein LOC103962372    139   3e-69    
ref|XP_010511930.1|  PREDICTED: uncharacterized protein LOC104787960    140   3e-69    
emb|CAN83103.1|  hypothetical protein VITISV_015490                     140   4e-69    Vitis vinifera
emb|CBI34815.3|  unnamed protein product                                140   4e-69    
ref|XP_010089340.1|  [Protein-PII] uridylyltransferase                  140   4e-69    
emb|CDP13377.1|  unnamed protein product                                145   4e-69    
ref|XP_009372243.1|  PREDICTED: uncharacterized protein LOC103961427    146   5e-69    
ref|XP_011036590.1|  PREDICTED: uncharacterized protein LOC105134046    140   5e-69    
ref|XP_003634395.1|  PREDICTED: uncharacterized protein LOC100250...    143   6e-69    
ref|XP_010664860.1|  PREDICTED: uncharacterized protein LOC100250...    143   6e-69    
ref|XP_010276411.1|  PREDICTED: uncharacterized protein LOC104611164    140   6e-69    
ref|XP_002268570.1|  PREDICTED: uncharacterized protein LOC100250...    143   6e-69    Vitis vinifera
ref|XP_010926807.1|  PREDICTED: uncharacterized protein LOC105048981    151   6e-69    
ref|XP_002467694.1|  hypothetical protein SORBIDRAFT_01g032575          145   7e-69    Sorghum bicolor [broomcorn]
ref|XP_010260456.1|  PREDICTED: uncharacterized protein LOC104599...    150   7e-69    
ref|XP_007153472.1|  hypothetical protein PHAVU_003G038400g             144   9e-69    
ref|XP_008231089.1|  PREDICTED: uncharacterized protein LOC103330...    148   9e-69    
ref|XP_008373875.1|  PREDICTED: uncharacterized protein LOC103437194    138   1e-68    
ref|XP_004984033.1|  PREDICTED: uncharacterized protein LOC101763...    151   1e-68    
ref|XP_009346780.1|  PREDICTED: uncharacterized protein LOC103938500    145   1e-68    
ref|XP_008389912.1|  PREDICTED: uncharacterized protein LOC103452175    141   1e-68    
ref|XP_004984034.1|  PREDICTED: uncharacterized protein LOC101763...    151   1e-68    
ref|XP_010108109.1|  [Protein-PII] uridylyltransferase                  138   2e-68    
emb|CDX81587.1|  BnaC02g18910D                                          139   2e-68    
gb|EYU32470.1|  hypothetical protein MIMGU_mgv1a006244mg                147   2e-68    
ref|XP_007208916.1|  hypothetical protein PRUPE_ppa1027134mg            137   2e-68    
ref|XP_011081540.1|  PREDICTED: uncharacterized protein LOC105164564    146   2e-68    
ref|XP_006368726.1|  ACT domain-containing family protein               137   3e-68    
ref|XP_011029105.1|  PREDICTED: uncharacterized protein LOC105128946    137   3e-68    
ref|XP_007040015.1|  ACT domain repeat 8                                143   4e-68    
ref|NP_565146.1|  ACT domain-containing protein 3                       141   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798512.1|  PREDICTED: uncharacterized protein LOC103713383    145   4e-68    
ref|XP_009343127.1|  PREDICTED: uncharacterized protein LOC103935102    141   4e-68    
ref|XP_008379088.1|  PREDICTED: uncharacterized protein LOC103442112    144   4e-68    
ref|XP_003614264.1|  ACR4                                               142   5e-68    
ref|XP_003631797.2|  PREDICTED: uncharacterized protein LOC100852...    148   5e-68    
ref|XP_007043903.1|  ACT domain repeat 4 isoform 1                      147   5e-68    
ref|XP_003622131.1|  Amino acid binding protein, putative               139   5e-68    
ref|XP_008445429.1|  PREDICTED: uncharacterized protein LOC103488452    140   6e-68    
gb|KDP26845.1|  hypothetical protein JCGZ_18003                         140   6e-68    
ref|XP_010648677.1|  PREDICTED: uncharacterized protein LOC100852...    147   6e-68    
ref|XP_008238666.1|  PREDICTED: uncharacterized protein LOC103337282    137   6e-68    
gb|KHN42726.1|  [Protein-PII] uridylyltransferase                       138   6e-68    
ref|XP_007201031.1|  hypothetical protein PRUPE_ppa005671mg             142   7e-68    
ref|XP_007215389.1|  hypothetical protein PRUPE_ppa005796mg             145   8e-68    
ref|XP_007201032.1|  hypothetical protein PRUPE_ppa005671mg             142   8e-68    
ref|XP_004514319.1|  PREDICTED: uncharacterized protein LOC101500937    141   8e-68    
ref|XP_008791268.1|  PREDICTED: uncharacterized protein LOC103708225    143   8e-68    
ref|XP_008237781.1|  PREDICTED: uncharacterized protein LOC103336...    142   9e-68    
ref|XP_006477309.1|  PREDICTED: uncharacterized protein LOC102613...    142   9e-68    
ref|XP_006477308.1|  PREDICTED: uncharacterized protein LOC102613...    142   9e-68    
gb|KDP41794.1|  hypothetical protein JCGZ_26812                         140   1e-67    
ref|XP_003517440.1|  PREDICTED: uncharacterized protein LOC100780903    138   1e-67    
ref|XP_008796580.1|  PREDICTED: uncharacterized protein LOC103711996    157   1e-67    
dbj|BAK07373.1|  predicted protein                                      138   1e-67    
gb|EYU28889.1|  hypothetical protein MIMGU_mgv1a006953mg                148   1e-67    
emb|CDP11981.1|  unnamed protein product                                146   1e-67    
ref|XP_008389382.1|  PREDICTED: uncharacterized protein LOC103451737    144   1e-67    
ref|XP_010679322.1|  PREDICTED: uncharacterized protein LOC104894719    143   1e-67    
ref|XP_009391844.1|  PREDICTED: uncharacterized protein LOC103977913    139   2e-67    
gb|KCW80355.1|  hypothetical protein EUGRSUZ_C01720                     138   2e-67    
ref|XP_011101934.1|  PREDICTED: uncharacterized protein LOC105179968    139   2e-67    
ref|XP_010940980.1|  PREDICTED: uncharacterized protein LOC105059401    137   2e-67    
ref|XP_008804075.1|  PREDICTED: uncharacterized protein LOC103717456    149   2e-67    
gb|AAM65519.1|  unknown                                                 141   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514875.1|  amino acid binding protein, putative               142   2e-67    Ricinus communis
ref|XP_004304532.1|  PREDICTED: uncharacterized protein LOC101293911    144   2e-67    
ref|XP_002520259.1|  amino acid binding protein, putative               137   2e-67    Ricinus communis
ref|XP_009356452.1|  PREDICTED: uncharacterized protein LOC103947287    145   2e-67    
ref|XP_008808484.1|  PREDICTED: uncharacterized protein LOC103720...    148   2e-67    
ref|XP_010929569.1|  PREDICTED: uncharacterized protein LOC105051...    154   2e-67    
gb|KDP43084.1|  hypothetical protein JCGZ_25270                         140   2e-67    
ref|XP_009377996.1|  PREDICTED: uncharacterized protein LOC103966550    144   2e-67    
ref|XP_010929570.1|  PREDICTED: uncharacterized protein LOC105051...    153   2e-67    
ref|XP_008808483.1|  PREDICTED: uncharacterized protein LOC103720...    147   2e-67    
ref|XP_010062190.1|  PREDICTED: uncharacterized protein LOC104449657    138   3e-67    
ref|XP_007158417.1|  hypothetical protein PHAVU_002G151300g             135   3e-67    
ref|XP_008381706.1|  PREDICTED: uncharacterized protein LOC103444...    140   3e-67    
gb|KHG17797.1|  [Protein-PII] uridylyltransferase                       148   3e-67    
ref|XP_009344226.1|  PREDICTED: uncharacterized protein LOC103936115    143   3e-67    
ref|XP_008381705.1|  PREDICTED: uncharacterized protein LOC103444...    140   3e-67    
ref|XP_006440437.1|  hypothetical protein CICLE_v10020159mg             142   3e-67    
ref|XP_008340245.1|  PREDICTED: uncharacterized protein LOC103403190    143   3e-67    
ref|XP_010090668.1|  [Protein-PII] uridylyltransferase                  140   4e-67    
gb|EPS66237.1|  hypothetical protein M569_08538                         144   5e-67    
ref|XP_006302326.1|  hypothetical protein CARUB_v10020382mg             141   5e-67    
ref|XP_009339717.1|  PREDICTED: uncharacterized protein LOC103931913    138   5e-67    
ref|XP_010679989.1|  PREDICTED: uncharacterized protein LOC104895235    141   5e-67    
gb|KHN34976.1|  [Protein-PII] uridylyltransferase                       137   5e-67    
ref|XP_003538563.1|  PREDICTED: uncharacterized protein LOC100806283    136   7e-67    
ref|XP_002302203.1|  hypothetical protein POPTR_0002s07550g             140   8e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006650194.1|  PREDICTED: uncharacterized protein LOC102721346    142   9e-67    
ref|XP_011027413.1|  PREDICTED: uncharacterized protein LOC105127...    140   9e-67    
ref|XP_010934544.1|  PREDICTED: uncharacterized protein LOC105054670    135   1e-66    
gb|KHG13930.1|  [Protein-PII] uridylyltransferase                       137   1e-66    
ref|NP_197914.1|  ACT domain-containing protein                         144   1e-66    
ref|XP_010905895.1|  PREDICTED: uncharacterized protein LOC105032...    142   1e-66    
emb|CDY33557.1|  BnaC06g29950D                                          142   1e-66    
gb|KGN47669.1|  hypothetical protein Csa_6G367150                       137   1e-66    
emb|CDP00474.1|  unnamed protein product                                142   1e-66    
gb|EYU42079.1|  hypothetical protein MIMGU_mgv1a006197mg                144   1e-66    
ref|XP_004144160.1|  PREDICTED: uncharacterized protein LOC101218703    137   1e-66    
ref|XP_010905893.1|  PREDICTED: uncharacterized protein LOC105032...    142   1e-66    
ref|XP_011027407.1|  PREDICTED: uncharacterized protein LOC105127...    140   1e-66    
ref|XP_010428767.1|  PREDICTED: uncharacterized protein LOC104713366    141   1e-66    
ref|XP_002272024.1|  PREDICTED: uncharacterized protein LOC100248040    148   1e-66    
ref|XP_010260453.1|  PREDICTED: uncharacterized protein LOC104599...    151   2e-66    
ref|XP_006437973.1|  hypothetical protein CICLE_v10031521mg             139   2e-66    
ref|XP_002304443.1|  ACT domain-containing family protein               138   2e-66    
ref|XP_010416625.1|  PREDICTED: uncharacterized protein LOC104702470    140   2e-66    
ref|XP_011033868.1|  PREDICTED: uncharacterized protein LOC105132218    137   2e-66    
ref|XP_010930652.1|  PREDICTED: uncharacterized protein LOC105051758    151   2e-66    
ref|XP_006394780.1|  hypothetical protein EUTSA_v10004050mg             145   2e-66    
ref|XP_009421053.1|  PREDICTED: uncharacterized protein LOC104000676    152   2e-66    
gb|KDO81815.1|  hypothetical protein CISIN_1g044728mg                   139   2e-66    
ref|XP_004502566.1|  PREDICTED: uncharacterized protein LOC101511775    143   2e-66    
ref|XP_008804002.1|  PREDICTED: uncharacterized protein LOC103717...    135   2e-66    
ref|XP_008804003.1|  PREDICTED: uncharacterized protein LOC103717...    135   2e-66    
ref|XP_010929566.1|  PREDICTED: uncharacterized protein LOC105051...    142   2e-66    
ref|XP_007031924.1|  ACT domain repeat 6                                145   2e-66    
ref|XP_009106363.1|  PREDICTED: uncharacterized protein LOC103832156    137   2e-66    
ref|XP_010025287.1|  PREDICTED: uncharacterized protein LOC104415658    137   3e-66    
ref|XP_002874251.1|  ACT domain-containing protein                      141   3e-66    
ref|XP_002509632.1|  amino acid binding protein, putative               140   3e-66    
ref|XP_006394781.1|  hypothetical protein EUTSA_v10004050mg             145   3e-66    
gb|KEH35390.1|  four ACT domain ACT domain protein which protein        137   3e-66    
emb|CDX80500.1|  BnaC07g29440D                                          141   3e-66    
ref|XP_010682711.1|  PREDICTED: uncharacterized protein LOC104897524    140   3e-66    
ref|XP_009368404.1|  PREDICTED: uncharacterized protein LOC103957905    137   3e-66    
ref|XP_006434331.1|  hypothetical protein CICLE_v10001100mg             136   4e-66    
ref|XP_006472891.1|  PREDICTED: uncharacterized protein LOC102609...    136   4e-66    
ref|XP_009393011.1|  PREDICTED: uncharacterized protein LOC103978802    137   4e-66    
gb|KHG00039.1|  [Protein-PII] uridylyltransferase                       143   5e-66    
ref|XP_008448923.1|  PREDICTED: uncharacterized protein LOC103490944    134   5e-66    
ref|XP_006851819.1|  hypothetical protein AMTR_s00041p00050300          138   5e-66    
ref|XP_008341281.1|  PREDICTED: uncharacterized protein LOC103404170    141   5e-66    
ref|XP_007038043.1|  ACT domain repeat 6 isoform 1                      151   5e-66    
ref|XP_009784019.1|  PREDICTED: uncharacterized protein LOC104232494    145   5e-66    
ref|XP_010554273.1|  PREDICTED: uncharacterized protein LOC104824...    140   5e-66    
gb|KCW61913.1|  hypothetical protein EUGRSUZ_H04608                     136   6e-66    
ref|XP_009360674.1|  PREDICTED: uncharacterized protein LOC103951...    140   6e-66    
ref|XP_002466847.1|  hypothetical protein SORBIDRAFT_01g015160          142   6e-66    
ref|XP_010250632.1|  PREDICTED: uncharacterized protein LOC104592825    134   7e-66    
ref|XP_009767148.1|  PREDICTED: uncharacterized protein LOC104218369    145   7e-66    
ref|XP_009360670.1|  PREDICTED: uncharacterized protein LOC103951...    140   7e-66    
emb|CDX87550.1|  BnaA07g33230D                                          135   7e-66    
ref|XP_010554272.1|  PREDICTED: uncharacterized protein LOC104824...    140   7e-66    
gb|AAM93430.1|  ACR5                                                    144   8e-66    
emb|CDX88170.1|  BnaA06g27610D                                          140   8e-66    
ref|XP_008346542.1|  PREDICTED: uncharacterized protein LOC103409499    136   8e-66    
emb|CDX79183.1|  BnaC06g21200D                                          135   8e-66    
ref|XP_009151052.1|  PREDICTED: uncharacterized protein LOC103874392    140   8e-66    
ref|XP_009611121.1|  PREDICTED: uncharacterized protein LOC104104...    145   9e-66    
ref|XP_008454022.1|  PREDICTED: uncharacterized protein LOC103494569    137   9e-66    
emb|CDX88335.1|  BnaC06g37790D                                          135   9e-66    
ref|XP_008237783.1|  PREDICTED: uncharacterized protein LOC103336...    142   9e-66    
ref|XP_002887664.1|  hypothetical protein ARALYDRAFT_476859             140   9e-66    
ref|NP_565304.1|  ACT domain-containing protein 5                       144   9e-66    
ref|XP_004152119.1|  PREDICTED: uncharacterized protein LOC101215960    138   1e-65    
ref|XP_006472895.1|  PREDICTED: uncharacterized protein LOC102609...    137   1e-65    
ref|XP_002876893.1|  hypothetical protein ARALYDRAFT_904656             144   1e-65    
ref|XP_002280377.1|  PREDICTED: uncharacterized protein LOC100256112    142   1e-65    
ref|XP_010929567.1|  PREDICTED: uncharacterized protein LOC105051...    142   1e-65    
ref|XP_008237779.1|  PREDICTED: uncharacterized protein LOC103336...    141   1e-65    
ref|XP_004140541.1|  PREDICTED: uncharacterized protein LOC101218687    137   1e-65    
ref|XP_009104635.1|  PREDICTED: uncharacterized protein LOC103830578    134   1e-65    
ref|XP_004498367.1|  PREDICTED: uncharacterized protein LOC101494...    139   1e-65    
ref|XP_004298708.1|  PREDICTED: uncharacterized protein LOC101304477    139   2e-65    
ref|XP_010543092.1|  PREDICTED: uncharacterized protein LOC104816118    136   2e-65    
ref|XP_004498366.1|  PREDICTED: uncharacterized protein LOC101494...    138   2e-65    
emb|CBI21063.3|  unnamed protein product                                139   2e-65    
ref|XP_003622132.1|  Amino acid binding protein, putative               140   2e-65    
ref|XP_009588356.1|  PREDICTED: uncharacterized protein LOC104085940    144   2e-65    
gb|KDP25581.1|  hypothetical protein JCGZ_20737                         139   2e-65    
ref|XP_009785185.1|  PREDICTED: uncharacterized protein LOC104233484    136   2e-65    
gb|KHG16540.1|  [Protein-PII] uridylyltransferase                       134   3e-65    
ref|XP_006395679.1|  hypothetical protein EUTSA_v10004191mg             143   3e-65    
ref|XP_006369838.1|  hypothetical protein POPTR_0001s33460g             144   3e-65    
gb|KHG16874.1|  hypothetical protein F383_22441                         145   3e-65    
ref|XP_007019285.1|  ACT domain repeat 3 isoform 1                      136   3e-65    
ref|XP_007019287.1|  ACT domain repeat 3 isoform 3                      136   3e-65    
ref|XP_003611221.1|  hypothetical protein MTR_5g011580                  133   3e-65    
ref|XP_003621757.1|  hypothetical protein MTR_7g022470                  137   3e-65    
ref|XP_010055557.1|  PREDICTED: uncharacterized protein LOC104443739    138   3e-65    
ref|XP_002511139.1|  amino acid binding protein, putative               137   3e-65    
emb|CDP09866.1|  unnamed protein product                                137   3e-65    
ref|XP_011070876.1|  PREDICTED: uncharacterized protein LOC105156446    141   3e-65    
ref|XP_002298641.1|  hypothetical protein POPTR_0001s33460g             143   4e-65    
ref|XP_010421384.1|  PREDICTED: uncharacterized protein LOC104706856    140   4e-65    
ref|XP_004292978.1|  PREDICTED: uncharacterized protein LOC101293754    139   4e-65    
ref|XP_002515490.1|  amino acid binding protein, putative               140   4e-65    
ref|XP_006369837.1|  hypothetical protein POPTR_0001s33460g             143   4e-65    
ref|XP_010527984.1|  PREDICTED: uncharacterized protein LOC104805208    140   4e-65    
gb|EYU37402.1|  hypothetical protein MIMGU_mgv1a005812mg                136   4e-65    
ref|XP_004156949.1|  PREDICTED: uncharacterized LOC101215960            138   4e-65    
ref|XP_003549893.2|  PREDICTED: uncharacterized protein LOC100794729    131   5e-65    
gb|KHN09770.1|  [Protein-PII] uridylyltransferase                       131   5e-65    
ref|XP_011000958.1|  PREDICTED: uncharacterized protein LOC105108...    144   5e-65    
gb|AES78350.2|  four ACT domain ACT domain protein which protein        139   5e-65    
ref|XP_009382898.1|  PREDICTED: uncharacterized protein LOC103970718    130   6e-65    
ref|XP_010454854.1|  PREDICTED: uncharacterized protein LOC104736552    139   6e-65    
emb|CAN80840.1|  hypothetical protein VITISV_043834                     140   6e-65    
ref|XP_010249097.1|  PREDICTED: uncharacterized protein LOC104591778    135   6e-65    
ref|XP_009792706.1|  PREDICTED: uncharacterized protein LOC104239695    141   6e-65    
ref|XP_008459880.1|  PREDICTED: uncharacterized protein LOC103498...    137   6e-65    
ref|XP_008459879.1|  PREDICTED: uncharacterized protein LOC103498...    137   7e-65    
ref|XP_006291103.1|  hypothetical protein CARUB_v10017215mg             144   7e-65    
ref|XP_006650292.1|  PREDICTED: uncharacterized protein LOC102702453    140   7e-65    
ref|XP_007137510.1|  hypothetical protein PHAVU_009G133100g             135   8e-65    
ref|XP_003549097.1|  PREDICTED: uncharacterized protein LOC100818...    139   8e-65    
ref|XP_011000959.1|  PREDICTED: uncharacterized protein LOC105108...    144   9e-65    
dbj|BAJ95140.1|  predicted protein                                      142   1e-64    
ref|XP_006599014.1|  PREDICTED: uncharacterized protein LOC100818...    139   1e-64    
ref|XP_009627378.1|  PREDICTED: uncharacterized protein LOC104117...    144   1e-64    
ref|XP_009793984.1|  PREDICTED: uncharacterized protein LOC104240...    144   1e-64    
ref|XP_007161677.1|  hypothetical protein PHAVU_001G089200g             138   1e-64    
ref|XP_009627377.1|  PREDICTED: uncharacterized protein LOC104117...    143   1e-64    
ref|XP_009416235.1|  PREDICTED: uncharacterized protein LOC103996875    139   1e-64    
ref|XP_009416935.1|  PREDICTED: uncharacterized protein LOC103997445    138   1e-64    
ref|XP_009793985.1|  PREDICTED: uncharacterized protein LOC104240...    143   1e-64    
ref|XP_009793986.1|  PREDICTED: uncharacterized protein LOC104240...    143   1e-64    
ref|XP_011098918.1|  PREDICTED: uncharacterized protein LOC105177449    144   1e-64    
ref|XP_008788826.1|  PREDICTED: uncharacterized protein LOC103706...    137   2e-64    
ref|XP_009627379.1|  PREDICTED: uncharacterized protein LOC104117...    143   2e-64    
ref|XP_007038044.1|  ACT domain repeat 6 isoform 2                      151   2e-64    
ref|XP_009793987.1|  PREDICTED: uncharacterized protein LOC104240...    143   2e-64    
ref|XP_007161678.1|  hypothetical protein PHAVU_001G089200g             138   2e-64    
ref|XP_006338713.1|  PREDICTED: uncharacterized protein LOC102582...    135   2e-64    
gb|KDO63881.1|  hypothetical protein CISIN_1g013535mg                   138   2e-64    
ref|XP_009613079.1|  PREDICTED: uncharacterized protein LOC104106280    140   2e-64    
ref|XP_001769906.1|  predicted protein                                  145   3e-64    
ref|XP_006390132.1|  hypothetical protein EUTSA_v10018530mg             132   3e-64    
ref|XP_008776535.1|  PREDICTED: uncharacterized protein LOC103696629    135   3e-64    
ref|XP_006348650.1|  PREDICTED: uncharacterized protein LOC102583967    140   3e-64    
ref|XP_010912996.1|  PREDICTED: uncharacterized protein LOC105038791    151   3e-64    
ref|XP_004239021.1|  PREDICTED: uncharacterized protein LOC101259744    140   3e-64    
ref|XP_006367493.1|  PREDICTED: uncharacterized protein LOC102581...    142   3e-64    
ref|XP_006447024.1|  hypothetical protein CICLE_v10015110mg             137   3e-64    
gb|KDO63882.1|  hypothetical protein CISIN_1g013535mg                   137   3e-64    
ref|XP_007161197.1|  hypothetical protein PHAVU_001G050200g             140   3e-64    
ref|XP_010502395.1|  PREDICTED: uncharacterized protein LOC104779692    144   3e-64    
ref|XP_004492064.1|  PREDICTED: uncharacterized protein LOC101498352    137   3e-64    
ref|XP_006367494.1|  PREDICTED: uncharacterized protein LOC102581...    141   4e-64    
ref|XP_007156374.1|  hypothetical protein PHAVU_003G280900g             131   4e-64    
gb|EYU40556.1|  hypothetical protein MIMGU_mgv1a006507mg                136   4e-64    
ref|XP_006447023.1|  hypothetical protein CICLE_v10015110mg             137   4e-64    
ref|XP_002304667.1|  hypothetical protein POPTR_0003s16620g             138   5e-64    
ref|XP_006447025.1|  hypothetical protein CICLE_v10015110mg             137   5e-64    
gb|EYU31837.1|  hypothetical protein MIMGU_mgv1a007510mg                142   5e-64    
emb|CDX68068.1|  BnaA07g21080D                                          132   5e-64    
emb|CDY49687.1|  BnaA02g27260D                                          142   5e-64    
ref|XP_010681133.1|  PREDICTED: uncharacterized protein LOC104896128    137   5e-64    
ref|XP_006382080.1|  hypothetical protein POPTR_0006s27260g             152   5e-64    
gb|EYU20248.1|  hypothetical protein MIMGU_mgv1a000046mg                138   5e-64    
ref|XP_006289879.1|  hypothetical protein CARUB_v10003494mg             137   6e-64    
ref|XP_003545456.1|  PREDICTED: uncharacterized protein LOC100820595    144   6e-64    
ref|XP_010053392.1|  PREDICTED: uncharacterized protein LOC104441845    138   6e-64    
ref|XP_004231764.1|  PREDICTED: uncharacterized protein LOC101263860    134   7e-64    
ref|XP_010514143.1|  PREDICTED: uncharacterized protein LOC104790131    144   7e-64    
ref|XP_004171478.1|  PREDICTED: uncharacterized LOC101205369            135   8e-64    
gb|KHN02059.1|  [Protein-PII] uridylyltransferase                       139   8e-64    
ref|XP_007155605.1|  hypothetical protein PHAVU_003G216100g             132   8e-64    
ref|XP_010999853.1|  PREDICTED: uncharacterized protein LOC105107576    143   8e-64    
ref|XP_009129076.1|  PREDICTED: uncharacterized protein LOC103853936    141   9e-64    
ref|XP_010556116.1|  PREDICTED: uncharacterized protein LOC104825486    133   9e-64    
ref|XP_007011818.1|  ACT-like superfamily protein                       135   9e-64    
ref|XP_010493784.1|  PREDICTED: uncharacterized protein LOC104771009    140   9e-64    
ref|XP_010667132.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    141   9e-64    
ref|XP_006581605.1|  PREDICTED: uncharacterized protein LOC100797...    133   1e-63    
ref|XP_010533743.1|  PREDICTED: uncharacterized protein LOC104809438    140   1e-63    
ref|XP_009613029.1|  PREDICTED: uncharacterized protein LOC104106236    134   1e-63    
ref|XP_002306671.1|  ACT domain-containing family protein               142   1e-63    
gb|KHN23444.1|  [Protein-PII] uridylyltransferase                       133   1e-63    
ref|XP_004147955.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    135   1e-63    
ref|XP_003526664.1|  PREDICTED: uncharacterized protein LOC100797...    133   1e-63    
tpg|DAA50241.1|  TPA: hypothetical protein ZEAMMB73_737306              135   1e-63    
gb|KGN55928.1|  hypothetical protein Csa_3G036540                       135   1e-63    
ref|NP_186848.1|  ACT domain-containing protein 6                       146   1e-63    
gb|AAF03449.1|AC010797_25  unknown protein                              146   1e-63    
ref|XP_009611122.1|  PREDICTED: uncharacterized protein LOC104104...    145   1e-63    
ref|XP_004290721.1|  PREDICTED: uncharacterized protein LOC101309692    137   2e-63    
ref|XP_006363718.1|  PREDICTED: uncharacterized protein LOC102603691    142   2e-63    
ref|NP_001130980.1|  uncharacterized protein LOC100192085               135   2e-63    
ref|XP_008790789.1|  PREDICTED: uncharacterized protein LOC103707875    139   2e-63    
ref|XP_004511642.1|  PREDICTED: uncharacterized protein LOC101488930    131   2e-63    
emb|CDX94123.1|  BnaC07g37570D                                          137   2e-63    
ref|XP_010928327.1|  PREDICTED: uncharacterized protein LOC105050...    139   2e-63    
ref|XP_004244583.1|  PREDICTED: uncharacterized protein LOC101243731    137   2e-63    
ref|XP_003552661.1|  PREDICTED: uncharacterized protein LOC100816426    137   2e-63    
ref|XP_010928326.1|  PREDICTED: uncharacterized protein LOC105050...    139   2e-63    
ref|XP_010541607.1|  PREDICTED: uncharacterized protein LOC104815...    132   2e-63    
ref|XP_004245697.1|  PREDICTED: uncharacterized protein LOC101260460    142   2e-63    
ref|XP_003525780.1|  PREDICTED: uncharacterized protein LOC100802262    129   2e-63    
gb|KHN13850.1|  [Protein-PII] uridylyltransferase                       137   3e-63    
ref|XP_006338714.1|  PREDICTED: uncharacterized protein LOC102582...    134   3e-63    
ref|XP_010024175.1|  PREDICTED: uncharacterized protein LOC104414711    142   3e-63    
ref|XP_009611123.1|  PREDICTED: uncharacterized protein LOC104104...    144   3e-63    
ref|XP_008378393.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   3e-63    
ref|XP_003553951.1|  PREDICTED: uncharacterized protein LOC100801859    137   4e-63    
ref|XP_010112397.1|  [Protein-PII] uridylyltransferase                  142   4e-63    
ref|XP_009383404.1|  PREDICTED: uncharacterized protein LOC103971170    144   4e-63    
gb|KFK28853.1|  hypothetical protein AALP_AA7G057000                    138   4e-63    
gb|KHN26914.1|  [Protein-PII] uridylyltransferase                       142   4e-63    
ref|XP_010540109.1|  PREDICTED: uncharacterized protein LOC104813...    132   4e-63    
ref|XP_003562315.1|  PREDICTED: uncharacterized protein LOC100840593    137   4e-63    
ref|XP_002297856.1|  hypothetical protein POPTR_0001s13490g             137   4e-63    
ref|XP_003608787.1|  hypothetical protein MTR_4g101950                  126   4e-63    
gb|EEC75693.1|  hypothetical protein OsI_12504                          135   5e-63    
ref|XP_010540117.1|  PREDICTED: uncharacterized protein LOC104813...    132   5e-63    
ref|XP_006574875.1|  PREDICTED: uncharacterized protein LOC100798999    137   5e-63    
ref|NP_001050608.1|  Os03g0598100                                       135   5e-63    
ref|XP_009405884.1|  PREDICTED: uncharacterized protein LOC103988920    137   5e-63    
ref|XP_002512902.1|  amino acid binding protein, putative               140   6e-63    
ref|XP_002466523.1|  hypothetical protein SORBIDRAFT_01g009300          132   7e-63    
ref|XP_006408561.1|  hypothetical protein EUTSA_v10020734mg             144   8e-63    
ref|XP_004138626.1|  PREDICTED: uncharacterized protein LOC101213097    142   8e-63    



>ref|XP_009770494.1| PREDICTED: uncharacterized protein LOC104221191 [Nicotiana sylvestris]
Length=485

 Score =   278 bits (710),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 153/204 (75%), Gaps = 37/204 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V  EHTA+EMTG DRPGLMSEISAVLAE+GCH+SAAVAWTHN RAACIVYV
Sbjct  117   VDRNVRPRHVSMEHTAMEMTGIDRPGLMSEISAVLAELGCHVSAAVAWTHNKRAACIVYV  176

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED+ KHGPI DPYRVAQ+QAQLENVVEAHHY+GERRSVRL+ PAAS+THTERRLHQLMAA
Sbjct  177   EDELKHGPIQDPYRVAQVQAQLENVVEAHHYDGERRSVRLAAPAASQTHTERRLHQLMAA  236

Query  1208  DRDYEQCCP-------------------------------------VWSRDRPKLLFDTV  1140
             DRDYEQCC                                      V S DRPKLLFDT+
Sbjct  237   DRDYEQCCSCGYESSADDEVYRQKKGYNGTEVKVENCRQKGYSIVTVRSVDRPKLLFDTI  296

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTD+QYVVFHASISS +S +VQ
Sbjct  297   CTLTDLQYVVFHASISSFESIAVQ  320


 Score =   218 bits (555),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVRHK+G TL+ ESERRR+TQ L+AATERR SHGLRLD+ TQNR+GLLSDVTRVFRE
Sbjct  320  QEYYVRHKNGWTLDSESERRRLTQNLMAATERRVSHGLRLDVSTQNRVGLLSDVTRVFRE  379

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT--  641
            NGLSI+RAEIG QGE+A+GTFYVKD SGQ+V+PETLE+V++EIGGTV VV+KS GR T  
Sbjct  380  NGLSISRAEIGIQGEKAVGTFYVKDASGQAVNPETLETVQREIGGTVLVVNKSLGRSTSQ  439

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              +S+ + +  + RSS +  KPGFSLGSLLW+Q+E LS+NFR
Sbjct  440  PTSSNTSPSISTSRSSSKQDKPGFSLGSLLWSQVEWLSSNFR  481


 Score = 45.1 bits (105),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+IHYI++   A
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIEEAICA  105



>ref|XP_009629350.1| PREDICTED: uncharacterized protein LOC104119532 [Nicotiana tomentosiformis]
Length=486

 Score =   275 bits (704),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 152/204 (75%), Gaps = 37/204 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V  EHTA+EMTG DRPGLMSEISAVLAE+GCH+SAAVAWTHN RAACIVYV
Sbjct  117   VDRNVRPRHVSMEHTAMEMTGIDRPGLMSEISAVLAELGCHVSAAVAWTHNKRAACIVYV  176

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED+ KHGPI DPYRVAQ+Q QLENVVEAHHY+GERRSVRL+ PAAS+THTERRLHQLMAA
Sbjct  177   EDELKHGPIQDPYRVAQVQEQLENVVEAHHYDGERRSVRLAAPAASQTHTERRLHQLMAA  236

Query  1208  DRDYEQCCP-------------------------------------VWSRDRPKLLFDTV  1140
             DRDYEQCC                                      V S DRPKLLFDT+
Sbjct  237   DRDYEQCCSCGYESSADDEVYRQKKGCNGTEVKVENCRQKGYSIVTVRSVDRPKLLFDTI  296

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTD+QYVVFHASISS +S +VQ
Sbjct  297   CTLTDLQYVVFHASISSFESIAVQ  320


 Score =   216 bits (549),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVRHK+G TL+ ESERRR+TQ L+AATERR SHGLRLD+ TQNR+GLLSDVTRVFRE
Sbjct  320  QEYYVRHKNGWTLDSESERRRLTQNLMAATERRVSHGLRLDVSTQNRVGLLSDVTRVFRE  379

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGR---F  644
            +GLSI+RAEIG QGE+A+GTFYVKD SGQ+V+PETLE+VR+EIGGTV VV+KS GR    
Sbjct  380  SGLSISRAEIGIQGEKAVGTFYVKDASGQAVNPETLETVRREIGGTVLVVNKSLGRSSSQ  439

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              ++S+      +  SS +  KPGFSLGSLLW+Q+E LS+NFR
Sbjct  440  PTSSSNTTPNISTSHSSSKQDKPGFSLGSLLWSQVEWLSSNFR  482


 Score = 46.6 bits (109),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+IHYI+Q   A
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIEQAICA  105



>ref|XP_010316031.1| PREDICTED: uncharacterized protein LOC101266885 isoform X1 [Solanum 
lycopersicum]
Length=485

 Score =   276 bits (707),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 151/204 (74%), Gaps = 37/204 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR+VRPR+V  EHTA+EMT  DRPGLMSEISAVLAE+GCH+S AVAWTHN RAACIVY+
Sbjct  119   VGRNVRPRHVSMEHTAMEMTAIDRPGLMSEISAVLAELGCHVSGAVAWTHNKRAACIVYM  178

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             EDD KHGPI DPYRVAQIQAQLENVVEAHHY GERRSVRL+ PAAS+THTERRLHQLMAA
Sbjct  179   EDDLKHGPIMDPYRVAQIQAQLENVVEAHHYEGERRSVRLAAPAASQTHTERRLHQLMAA  238

Query  1208  DRDYEQCCP-------------------------------------VWSRDRPKLLFDTV  1140
             DRDYEQCC                                      V S DRPKLLFDT+
Sbjct  239   DRDYEQCCSCGYDSSGDDVAHRQKKGSNSTEVKIENCKERGYSIVTVRSMDRPKLLFDTI  298

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTD+QYVVFHASI+S +S ++Q
Sbjct  299   CTLTDLQYVVFHASINSFESIAIQ  322


 Score =   211 bits (536),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYYVRHK+G TL+ ESERR++ Q L+AATERR SH LRLD+ TQNR+GLL+DVTRVFR
Sbjct  321  IQEYYVRHKNGWTLDSESERRKMIQNLMAATERRVSHELRLDVTTQNRVGLLADVTRVFR  380

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLSI+R E+G QGE+A+GTFYVKDTSGQ V  ETLE VR+EIGGTV V +KSSGR + 
Sbjct  381  ENGLSISRTEVGVQGEQAVGTFYVKDTSGQDVTSETLEVVRREIGGTVLVANKSSGRPSS  440

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              +  ++TS S  S  +D KPGFSLGS+ W+QLE LS+NFR
Sbjct  441  QPTDLSNTSPSSSSGKQDKKPGFSLGSMFWSQLEWLSSNFR  481


 Score = 47.4 bits (111),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHVTDQLG KI DES+IHYI+QV
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIEQV  102



>ref|XP_004231941.1| PREDICTED: uncharacterized protein LOC101266885 isoform X2 [Solanum 
lycopersicum]
Length=483

 Score =   276 bits (707),  Expect(3) = 3e-135, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 151/204 (74%), Gaps = 37/204 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR+VRPR+V  EHTA+EMT  DRPGLMSEISAVLAE+GCH+S AVAWTHN RAACIVY+
Sbjct  117   VGRNVRPRHVSMEHTAMEMTAIDRPGLMSEISAVLAELGCHVSGAVAWTHNKRAACIVYM  176

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             EDD KHGPI DPYRVAQIQAQLENVVEAHHY GERRSVRL+ PAAS+THTERRLHQLMAA
Sbjct  177   EDDLKHGPIMDPYRVAQIQAQLENVVEAHHYEGERRSVRLAAPAASQTHTERRLHQLMAA  236

Query  1208  DRDYEQCCP-------------------------------------VWSRDRPKLLFDTV  1140
             DRDYEQCC                                      V S DRPKLLFDT+
Sbjct  237   DRDYEQCCSCGYDSSGDDVAHRQKKGSNSTEVKIENCKERGYSIVTVRSMDRPKLLFDTI  296

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTD+QYVVFHASI+S +S ++Q
Sbjct  297   CTLTDLQYVVFHASINSFESIAIQ  320


 Score =   211 bits (536),  Expect(3) = 3e-135, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYYVRHK+G TL+ ESERR++ Q L+AATERR SH LRLD+ TQNR+GLL+DVTRVFR
Sbjct  319  IQEYYVRHKNGWTLDSESERRKMIQNLMAATERRVSHELRLDVTTQNRVGLLADVTRVFR  378

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLSI+R E+G QGE+A+GTFYVKDTSGQ V  ETLE VR+EIGGTV V +KSSGR + 
Sbjct  379  ENGLSISRTEVGVQGEQAVGTFYVKDTSGQDVTSETLEVVRREIGGTVLVANKSSGRPSS  438

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              +  ++TS S  S  +D KPGFSLGS+ W+QLE LS+NFR
Sbjct  439  QPTDLSNTSPSSSSGKQDKKPGFSLGSMFWSQLEWLSSNFR  479


 Score = 46.6 bits (109),  Expect(3) = 3e-135, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+IHYI+Q   A
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIEQAICA  105



>ref|XP_006363807.1| PREDICTED: uncharacterized protein LOC102587133 [Solanum tuberosum]
Length=487

 Score =   279 bits (714),  Expect(3) = 2e-134, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 152/204 (75%), Gaps = 37/204 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR+VRPR+V  EHTA+EMT TDRPGLMSEISAVLAE+GCH+S AVAWTHN RAACIVY+
Sbjct  117   VGRNVRPRHVTMEHTAMEMTATDRPGLMSEISAVLAELGCHVSGAVAWTHNKRAACIVYM  176

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             EDD KHGPI DPYRVAQIQAQLENVVEAHHY GERR+VRL+ PAAS+THTERRLHQLMAA
Sbjct  177   EDDLKHGPIMDPYRVAQIQAQLENVVEAHHYEGERRTVRLAAPAASQTHTERRLHQLMAA  236

Query  1208  DRDYEQCCP-------------------------------------VWSRDRPKLLFDTV  1140
             DRDYEQCC                                      V S DRPKLLFDT+
Sbjct  237   DRDYEQCCSCGYDSSGDDVAHRQKKGSNSTEVKIENCKEKGYSIVTVRSMDRPKLLFDTI  296

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTD+QYVVFHASISS +S ++Q
Sbjct  297   CTLTDLQYVVFHASISSFESIAIQ  320


 Score =   205 bits (521),  Expect(3) = 2e-134, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 4/165 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYYVRHK+G TL+ ESERRR+ Q L+AATERR SH LRLD+ TQNR+GLL+DVTRVFR
Sbjct  319  IQEYYVRHKNGWTLDSESERRRMIQNLMAATERRVSHELRLDVTTQNRVGLLADVTRVFR  378

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGR---  647
            ENGLSI+R E+G QGE+A+GTFYVKDTSGQ+V  ETLE VR+EIGGTV V +KSS R   
Sbjct  379  ENGLSISRTEVGVQGEQAVGTFYVKDTSGQAVTSETLEIVRREIGGTVLVANKSSERPSS  438

Query  646  -FTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              T  +++  S S S  +  +D KPGFSLGS+ W+QLE LS+NFR
Sbjct  439  QPTNLSNTSPSISTSSSNGKQDNKPGFSLGSMFWSQLEWLSSNFR  483


 Score = 46.6 bits (109),  Expect(3) = 2e-134, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+IHYI+Q   A
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIEQAICA  105



>emb|CDP02625.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   255 bits (651),  Expect(3) = 2e-126, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 145/214 (68%), Gaps = 47/214 (22%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             I ++VRP Y+  EHTALEMTGTDRPGLMSE+SAVLAEMGCH+SAAVAWTHNARAACI+ V
Sbjct  116   ISKNVRPAYISAEHTALEMTGTDRPGLMSEMSAVLAEMGCHVSAAVAWTHNARAACIICV  175

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
              D+   GPITDP R+A++QAQLENVVEAHH NGE+RSVRL+ P   +THTERRLHQLMAA
Sbjct  176   ADECNGGPITDPCRLARVQAQLENVVEAHHCNGEKRSVRLACPVGGKTHTERRLHQLMAA  235

Query  1208  DRDYEQCCPV-------------------WSR----------------------------  1170
             DRDYE CC                     W R                            
Sbjct  236   DRDYEACCSCSVQDDDGKDEEMNSSGKFDWQRRKEREATTRVKIENCTEKGYSIVTVRSE  295

Query  1169  DRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             DRPKLLFDTVCALTDMQYVVFHA+ISS  S +VQ
Sbjct  296   DRPKLLFDTVCALTDMQYVVFHAAISSKGSKAVQ  329


 Score =   201 bits (512),  Expect(3) = 2e-126, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RHKDGCTL+LE ERRRVT+CLIAATERR SHG+R+D+ T+NR+GLLSDVTRVFR
Sbjct  328  VQEYYIRHKDGCTLDLEVERRRVTRCLIAATERRVSHGIRVDVTTENRIGLLSDVTRVFR  387

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEI-GGTVKVVHKSSGRFT  641
            ENGLSI RAEIGT G+RA+GTFYVKD SG ++  ETLE V++EI GGTV VV K  G   
Sbjct  388  ENGLSIARAEIGTNGDRAVGTFYVKDASGDNISRETLEMVQREIGGGTVLVVDKPLG-LR  446

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
               +S +STS    +  ED +P  SLGSL W+ LERLS+NFR
Sbjct  447  SRATSSSSTSGRNSAGTED-RPKLSLGSLFWSHLERLSSNFR  487


 Score = 47.4 bits (111),  Expect(3) = 2e-126, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG KI DES+IHYIQQ
Sbjct  76    MDVFHVTDQLGNKITDESLIHYIQQ  100



>ref|XP_011099408.1| PREDICTED: uncharacterized protein LOC105177841 isoform X2 [Sesamum 
indicum]
Length=487

 Score =   242 bits (617),  Expect(3) = 5e-121, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 145/212 (68%), Gaps = 45/212 (21%)
 Frame = -1

Query  1571  FIGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
              IGR+VRPR+V TEH ALEMTG DRPGL+SE+SAVLAE+GCH++AAVAWTH++RAACI+Y
Sbjct  115   IIGREVRPRHVSTEHMALEMTGVDRPGLLSEMSAVLAELGCHVTAAVAWTHSSRAACILY  174

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             VED +K G I DP RVAQ+QAQLENVVEAHHY  ERRSVRL+ P   +THTERRLHQL+A
Sbjct  175   VEDSAKGGLI-DPCRVAQVQAQLENVVEAHHYKDERRSVRLAAPVPGQTHTERRLHQLLA  233

Query  1211  ADRDYEQCCP--------------------------------------------VWSRDR  1164
             AD DYE CC                                             + SRDR
Sbjct  234   ADGDYELCCSCCGGIGEWDDFNVLGRCHKGRKKGCDGTHVKIENCKETGYSIVTIRSRDR  293

Query  1163  PKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             PKLLFDTVC LTD+QYVV+HA+ISS  ST+ Q
Sbjct  294   PKLLFDTVCTLTDLQYVVYHAAISSRGSTAFQ  325


 Score =   202 bits (514),  Expect(3) = 5e-121, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 133/162 (82%), Gaps = 4/162 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRHK+G  L+ E E+ RVTQCLIAATERR SHGLRLDICT++R GLLSDVTRVFR
Sbjct  324  FQEYYVRHKEGGILSSEGEKHRVTQCLIAATERRVSHGLRLDICTRDRTGLLSDVTRVFR  383

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVV-HKSSGRFT  641
            E+ LSITRAEIGT+G++AIGTFYVKDTSGQ+V P+T+E +R+EIGG++ VV +KSSG   
Sbjct  384  ESSLSITRAEIGTRGKKAIGTFYVKDTSGQNVTPQTVEIIRREIGGSITVVENKSSGTSP  443

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
            + + S  STS S      + +  FSLG+LLWAQLERLS+NFR
Sbjct  444  EGSPSRTSTSSSSTV---EARSSFSLGNLLWAQLERLSSNFR  482


 Score = 41.6 bits (96),  Expect(3) = 5e-121, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQ G K+ DES+IHYIQ+ +C
Sbjct  76    MDVFHVTDQQGNKLTDESLIHYIQEGIC  103



>ref|XP_011099409.1| PREDICTED: uncharacterized protein LOC105177841 isoform X3 [Sesamum 
indicum]
Length=468

 Score =   243 bits (621),  Expect(3) = 1e-120, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 145/212 (68%), Gaps = 45/212 (21%)
 Frame = -1

Query  1571  FIGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
              IGR+VRPR+V TEH ALEMTG DRPGL+SE+SAVLAE+GCH++AAVAWTH++RAACI+Y
Sbjct  92    IIGREVRPRHVSTEHMALEMTGVDRPGLLSEMSAVLAELGCHVTAAVAWTHSSRAACILY  151

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             VED +K G I DP RVAQ+QAQLENVVEAHHY  ERRSVRL+ P   +THTERRLHQL+A
Sbjct  152   VEDSAKGGLI-DPCRVAQVQAQLENVVEAHHYKDERRSVRLAAPVPGQTHTERRLHQLLA  210

Query  1211  ADRDYEQCCP--------------------------------------------VWSRDR  1164
             AD DYE CC                                             + SRDR
Sbjct  211   ADGDYELCCSCCGGIGEWDDFNVLGRCHKGRKKGCDGTHVKIENCKETGYSIVTIRSRDR  270

Query  1163  PKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             PKLLFDTVC LTD+QYVV+HA+ISS  ST+ Q
Sbjct  271   PKLLFDTVCTLTDLQYVVYHAAISSRGSTAFQ  302


 Score =   199 bits (507),  Expect(3) = 1e-120, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVRHK+G  L+ E E+ RVTQCLIAATERR SHGLRLDICT++R GLLSDVTRVFRE
Sbjct  306  QEYYVRHKEGGILSSEGEKHRVTQCLIAATERRVSHGLRLDICTRDRTGLLSDVTRVFRE  365

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVV-HKSSGRFTK  638
            + LSITRAEIGT+G++AIGTFYVKDTSGQ+V P+T+E +R+EIGG++ VV +KSSG   +
Sbjct  366  SSLSITRAEIGTRGKKAIGTFYVKDTSGQNVTPQTVEIIRREIGGSITVVENKSSGTSPE  425

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
             + S  STS S      + +  FSLG+LLWAQLERLS+NFR
Sbjct  426  GSPSRTSTSSSSTV---EARSSFSLGNLLWAQLERLSSNFR  463


 Score = 42.0 bits (97),  Expect(3) = 1e-120, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQ G K+ DES+IHYIQ+ +C
Sbjct  53    MDVFHVTDQQGNKLTDESLIHYIQEGIC  80



>ref|XP_011099405.1| PREDICTED: uncharacterized protein LOC105177841 isoform X1 [Sesamum 
indicum]
 ref|XP_011099406.1| PREDICTED: uncharacterized protein LOC105177841 isoform X1 [Sesamum 
indicum]
 ref|XP_011099407.1| PREDICTED: uncharacterized protein LOC105177841 isoform X1 [Sesamum 
indicum]
Length=491

 Score =   242 bits (617),  Expect(3) = 4e-120, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 145/212 (68%), Gaps = 45/212 (21%)
 Frame = -1

Query  1571  FIGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
              IGR+VRPR+V TEH ALEMTG DRPGL+SE+SAVLAE+GCH++AAVAWTH++RAACI+Y
Sbjct  115   IIGREVRPRHVSTEHMALEMTGVDRPGLLSEMSAVLAELGCHVTAAVAWTHSSRAACILY  174

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             VED +K G I DP RVAQ+QAQLENVVEAHHY  ERRSVRL+ P   +THTERRLHQL+A
Sbjct  175   VEDSAKGGLI-DPCRVAQVQAQLENVVEAHHYKDERRSVRLAAPVPGQTHTERRLHQLLA  233

Query  1211  ADRDYEQCCP--------------------------------------------VWSRDR  1164
             AD DYE CC                                             + SRDR
Sbjct  234   ADGDYELCCSCCGGIGEWDDFNVLGRCHKGRKKGCDGTHVKIENCKETGYSIVTIRSRDR  293

Query  1163  PKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             PKLLFDTVC LTD+QYVV+HA+ISS  ST+ Q
Sbjct  294   PKLLFDTVCTLTDLQYVVYHAAISSRGSTAFQ  325


 Score =   199 bits (507),  Expect(3) = 4e-120, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVRHK+G  L+ E E+ RVTQCLIAATERR SHGLRLDICT++R GLLSDVTRVFRE
Sbjct  329  QEYYVRHKEGGILSSEGEKHRVTQCLIAATERRVSHGLRLDICTRDRTGLLSDVTRVFRE  388

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVV-HKSSGRFTK  638
            + LSITRAEIGT+G++AIGTFYVKDTSGQ+V P+T+E +R+EIGG++ VV +KSSG   +
Sbjct  389  SSLSITRAEIGTRGKKAIGTFYVKDTSGQNVTPQTVEIIRREIGGSITVVENKSSGTSPE  448

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
             + S  STS S      + +  FSLG+LLWAQLERLS+NFR
Sbjct  449  GSPSRTSTSSSSTV---EARSSFSLGNLLWAQLERLSSNFR  486


 Score = 41.6 bits (96),  Expect(3) = 4e-120, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQ G K+ DES+IHYIQ+ +C
Sbjct  76    MDVFHVTDQQGNKLTDESLIHYIQEGIC  103



>ref|XP_002525301.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF37129.1| amino acid binding protein, putative [Ricinus communis]
Length=477

 Score =   226 bits (576),  Expect(3) = 7e-118, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 138/198 (70%), Gaps = 31/198 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V T+HTA+EMTG DRPG++SEISAVLAE+ CH++AAVAWTHN+RAACI+Y+
Sbjct  118   LKREVRPRHVSTDHTAMEMTGIDRPGMLSEISAVLAELQCHVTAAVAWTHNSRAACIIYM  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED    GPITD  ++A ++ QL+NVVEAHH  GE RSVRL+ P   +THTERRLHQLM+A
Sbjct  178   EDGLSGGPITDSNKLAHVEEQLQNVVEAHHGIGEMRSVRLASPVTGQTHTERRLHQLMSA  237

Query  1208  DRDYEQCCP-------------------------------VWSRDRPKLLFDTVCALTDM  1122
               DYE CC                                + S DRPKLLFDT+CALTDM
Sbjct  238   TLDYEPCCGCTDGDAAHQRNCTKIHVSIESCKEKGYSVVNMRSMDRPKLLFDTLCALTDM  297

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA++SS  + + Q
Sbjct  298   QYVVFHAAVSSKGTMARQ  315


 Score =   207 bits (528),  Expect(3) = 7e-118, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHKDGCTL+ ESER ++T+CLIAATERRASHGLRLDI T NR+GLLSDVTRVFRE
Sbjct  315  QEYFIRHKDGCTLDTESERHKLTKCLIAATERRASHGLRLDISTHNRVGLLSDVTRVFRE  374

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI+RAEIG QG+RA+G+FY+ D SG   +  TLE VR+EIGG+V VV+KS G   + 
Sbjct  375  NGLSISRAEIGLQGDRAVGSFYITDASGDEANTHTLELVRKEIGGSVLVVNKSPGWTPRT  434

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             S+   +  S  S GE+ KP FSLGSLLW+QLERLS NF
Sbjct  435  PSTAGISRTSSGSVGEE-KPKFSLGSLLWSQLERLSGNF  472


 Score = 42.0 bits (97),  Expect(3) = 7e-118, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ DES+I YIQQ
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQ  100



>ref|XP_010023323.1| PREDICTED: uncharacterized protein LOC104414031 [Eucalyptus grandis]
 gb|KCW59570.1| hypothetical protein EUGRSUZ_H02320 [Eucalyptus grandis]
Length=488

 Score =   230 bits (586),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 135/201 (67%), Gaps = 40/201 (20%)
 Frame = -1

Query  1550  PRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKH  1371
             PR++ +EHT LEMTGTDRPGL+SE+SAVLAE+ CHI++AVAWTH+ RAACI YVED  + 
Sbjct  126   PRHMSSEHTVLEMTGTDRPGLLSEMSAVLAELACHIASAVAWTHHDRAACIFYVEDGVRT  185

Query  1370  GPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ  1191
             GPITDP R+AQI+ QLENVVEAHH  GERRSVRL+ P A +TH ERRLHQLM AD DYEQ
Sbjct  186   GPITDPRRLAQIEEQLENVVEAHHAKGERRSVRLTGPMAGQTHAERRLHQLMFADMDYEQ  245

Query  1190  C----------------------------------------CPVWSRDRPKLLFDTVCAL  1131
             C                                          V SRDRPKLLFDTVC L
Sbjct  246   CRCCGHSCCGDGGGRGGYEHRKGCEGAHVSIESWKDKGYSVVNVRSRDRPKLLFDTVCVL  305

Query  1130  TDMQYVVFHASISSHDSTSVQ  1068
             TDMQYVVFHAS+SS  + + Q
Sbjct  306   TDMQYVVFHASVSSEGALANQ  326


 Score =   197 bits (501),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH+DGCTL+ E+E+R++TQCL+AA ERRASHGLRL++ TQNR GLLSDVTRVFRE
Sbjct  326  QEYFIRHRDGCTLDSETEQRKLTQCLLAAVERRASHGLRLEVSTQNRPGLLSDVTRVFRE  385

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI RA++G +GERAIG+FYV + SG  V P T+E VR+EIGG+V VV+KSSG  T  
Sbjct  386  NGLSIMRADVGIRGERAIGSFYVTEASGNDVSPSTVELVRKEIGGSVLVVNKSSGASTPQ  445

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                  ++     +G D KP  SLGSL+W+QLER S+NF
Sbjct  446  GPLSALSAGLIGRNG-DEKPRLSLGSLIWSQLERFSSNF  483


 Score = 47.4 bits (111),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+VDES+IHYI+Q   A
Sbjct  77    MDVFHVTDQLGNKLVDESLIHYIEQALCA  105



>gb|KDP32101.1| hypothetical protein JCGZ_12562 [Jatropha curcas]
Length=477

 Score =   228 bits (582),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 138/198 (70%), Gaps = 31/198 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V TEHTA+EMTGTDRPGL+SEISAVLAE+ C ++AAV WTHNARAACI+Y+
Sbjct  118   LKREVRPRHVSTEHTAIEMTGTDRPGLLSEISAVLAELECQVTAAVVWTHNARAACIIYL  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED  + GPITDP R+  I+ QLENVV+AHH  GERRS+RL  P A +THTERRLHQLM +
Sbjct  178   EDRLRGGPITDPNRLGHIEEQLENVVDAHHGVGERRSLRLITPVAGQTHTERRLHQLMYS  237

Query  1208  DRDYEQCCP-------------------------------VWSRDRPKLLFDTVCALTDM  1122
             + DY  CC                                + SRDRPKLLFDT+C LTDM
Sbjct  238   NIDYAPCCSCTDTGVGHRRNCTKIHVSIESCKEKGYSVVNMRSRDRPKLLFDTLCVLTDM  297

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA++SS  + + Q
Sbjct  298   QYVVFHAAVSSMGTMADQ  315


 Score =   202 bits (514),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHKDG TL+ E ER ++TQCLIAA ERR SHGLRLD+CT NR+GLLSD+TR FRE
Sbjct  315  QEYFIRHKDGFTLDTEGERHKLTQCLIAAIERRVSHGLRLDLCTHNRIGLLSDMTRAFRE  374

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI+RAE+GTQGE A+G+FYV D SG  ++P T+E VR+EIGG+V VV+KS   +T  
Sbjct  375  NGLSISRAEMGTQGETAVGSFYVTDASGDEINPLTIEVVRKEIGGSVLVVNKSPD-WTPR  433

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + S  S SR+   S  D KP FSLGSLLW+QLERLS NF
Sbjct  434  SPSTASMSRTSSGSIGDDKPRFSLGSLLWSQLERLSGNF  472


 Score = 42.7 bits (99),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG KI DES+I YIQQ
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQ  100



>ref|XP_007047587.1| ACT domain repeat 1, putative isoform 1 [Theobroma cacao]
 gb|EOX91744.1| ACT domain repeat 1, putative isoform 1 [Theobroma cacao]
Length=474

 Score =   236 bits (602),  Expect(3) = 6e-117, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 139/197 (71%), Gaps = 30/197 (15%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R VRP +V TEHTALEMTG DRPGLMSEISA L E+GCH++A VAWTHNAR ACI++V
Sbjct  118   LKRAVRPCHVSTEHTALEMTGRDRPGLMSEISAALYELGCHVTATVAWTHNARMACIIHV  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED  K GPI  P RVA++Q +LENVVEA H +GERRSVRL+ PAA RTHTERRLHQLM A
Sbjct  178   EDGFKGGPIMAPKRVAEVQEKLENVVEAPHDSGERRSVRLTAPAAGRTHTERRLHQLMYA  237

Query  1208  DRDYEQC------CPVW------------------------SRDRPKLLFDTVCALTDMQ  1119
             DRDYEQC      C  W                        SRDR KLLFDTVCALTDMQ
Sbjct  238   DRDYEQCQGCDGSCRHWKGCTKTHVTIESCREKGYSVVHARSRDRTKLLFDTVCALTDMQ  297

Query  1118  YVVFHASISSHDSTSVQ  1068
             YVVFHA++SS  + + Q
Sbjct  298   YVVFHAAVSSKGAMADQ  314


 Score =   194 bits (494),  Expect(3) = 6e-117, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VR +DGC+L  E ER R+T+CLIAA ERR S GLRLD+CTQN+ GLLSD+TRVFRE
Sbjct  314  QEYFVRRQDGCSLVTEDERHRLTECLIAAIERRVSRGLRLDVCTQNKRGLLSDLTRVFRE  373

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAEIGT GERAIG+FYV D SG  V+P T+E VRQEIGG+  VV+KS  R ++A
Sbjct  374  NGLSITRAEIGTHGERAIGSFYVTDASGHDVNPRTVELVRQEIGGSALVVNKSPDRTSRA  433

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +SS  + S S      + +P FSLG+LLW+QLERLS NF
Sbjct  434  SSSSINRSSSSEV---EERPRFSLGNLLWSQLERLSGNF  469


 Score = 41.6 bits (96),  Expect(3) = 6e-117, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ DES+I YIQQ +C
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQAIC  103



>ref|XP_010273298.1| PREDICTED: uncharacterized protein LOC104608850 isoform X2 [Nelumbo 
nucifera]
Length=489

 Score =   228 bits (581),  Expect(4) = 4e-116, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 144/216 (67%), Gaps = 49/216 (23%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +G+ V PR+V T++TALE+TGTDRPGL+SEISAVL E+GCH+ +A AWTHN R+ACI+YV
Sbjct  120   LGKVVGPRHVSTQYTALEITGTDRPGLLSEISAVLTELGCHVVSAAAWTHNTRSACIIYV  179

Query  1388  EDDSK-HGPITDPYRVAQIQAQLENVVEAHHYN--GERRSVRLSDPAASRTHTERRLHQL  1218
             ED S+  GPITDP R+ +++ QLENVV AHH N  GER+ VRLS P+ASRTHTERRLHQL
Sbjct  180   EDASRGGGPITDPDRLTKVEEQLENVVSAHHGNGSGERKRVRLSVPSASRTHTERRLHQL  239

Query  1217  MAADRDYEQCCP----------------------------------------------VW  1176
             M ADRDYE+C                                                V 
Sbjct  240   MFADRDYEECGTGDYTTESGDGDVDRKMALELDGEGSWTGRTEVSIESCNEKGYSVVRVR  299

Query  1175  SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             SRDRPKLLFDTVC LTDMQYVVFHA++SS+ S +VQ
Sbjct  300   SRDRPKLLFDTVCTLTDMQYVVFHAAVSSNHSVAVQ  335


 Score =   193 bits (490),  Expect(4) = 4e-116, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 9/159 (6%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGCTL+ E+ER RVTQCLIAA ERR SHGLRLD+CT+NR+GLLS +TRVFRE
Sbjct  335  QEYYIRHMDGCTLDTETERCRVTQCLIAAIERRVSHGLRLDVCTRNRVGLLSHITRVFRE  394

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
             GLS++RAEIGT+GE A G+FYV D SG  VD +T+E VR+EIGGTV  V+KSSG     
Sbjct  395  YGLSVSRAEIGTRGETATGSFYVIDLSGNDVDSKTVELVRKEIGGTVLEVNKSSGWPAPT  454

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + S  S          + +  FSLGSLLWAQLERLS+NF
Sbjct  455  SCSNGSV---------EYRSRFSLGSLLWAQLERLSSNF  484


 Score = 47.4 bits (111),  Expect(4) = 4e-116, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG KI DES+IHYIQQ
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIQQ  101


 Score = 23.1 bits (48),  Expect(4) = 4e-116, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  71    SDGGWFMD  78



>ref|XP_010647080.1| PREDICTED: uncharacterized protein LOC100264704 isoform X2 [Vitis 
vinifera]
Length=417

 Score =   247 bits (631),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 142/192 (74%), Gaps = 25/192 (13%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR++ PR+V TEHTA E+TGTDRPGLMSEISAVLAE+ CH++AAVAWTHN+R ACI+ +
Sbjct  67    LGREMNPRHVSTEHTAFEITGTDRPGLMSEISAVLAELSCHVTAAVAWTHNSRVACIICL  126

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED+ K GPI DP R+A ++ QLENVVEA H +GERR VRL+ P A RTHT+RRLHQLM A
Sbjct  127   EDELKGGPIRDPERLAHVEEQLENVVEARHQSGERRKVRLTAPVAGRTHTDRRLHQLMFA  186

Query  1208  DRDYEQCCP-------------------------VWSRDRPKLLFDTVCALTDMQYVVFH  1104
             D+DYE+CC                          V SRDRPKLLFDTVC LTDMQYVVFH
Sbjct  187   DKDYERCCGGCDGSSDRIQVSIENCKEKGYSVVNVKSRDRPKLLFDTVCTLTDMQYVVFH  246

Query  1103  ASISSHDSTSVQ  1068
             A++SS  S +VQ
Sbjct  247   AAVSSKGSIAVQ  258


 Score =   179 bits (455),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL  +SER RV QCLIAA ERR +HGLRLDI  +NRLGLLSD+TRVFRE
Sbjct  258  QEYFIRQMDGCTLGTQSERNRVAQCLIAAIERRVTHGLRLDIRIKNRLGLLSDITRVFRE  317

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI  AEIG  GERA G+FYV D SG+ V P T+E +R+EIGGT+  V+KSS      
Sbjct  318  NGLSIRMAEIGIHGERASGSFYVTDVSGRDVSPNTVELIRKEIGGTIMAVNKSS---VPP  374

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +   + +     +S  + +P FSLG+ LW+Q+ER S+NF
Sbjct  375  SLPASPSRDRSTASSVENRPRFSLGT-LWSQIERFSSNF  412


 Score = 42.7 bits (99),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DES+I YIQQ   A
Sbjct  25    MDVFHVTDQLGNKLTDESLILYIQQALCA  53



>ref|XP_002265013.2| PREDICTED: uncharacterized protein LOC100264704 isoform X1 [Vitis 
vinifera]
 ref|XP_010647077.1| PREDICTED: uncharacterized protein LOC100264704 isoform X1 [Vitis 
vinifera]
 ref|XP_010647078.1| PREDICTED: uncharacterized protein LOC100264704 isoform X1 [Vitis 
vinifera]
 ref|XP_010647079.1| PREDICTED: uncharacterized protein LOC100264704 isoform X1 [Vitis 
vinifera]
 emb|CBI29515.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   246 bits (628),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 142/192 (74%), Gaps = 25/192 (13%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR++ PR+V TEHTA E+TGTDRPGLMSEISAVLAE+ CH++AAVAWTHN+R ACI+ +
Sbjct  118   LGREMNPRHVSTEHTAFEITGTDRPGLMSEISAVLAELSCHVTAAVAWTHNSRVACIICL  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED+ K GPI DP R+A ++ QLENVVEA H +GERR VRL+ P A RTHT+RRLHQLM A
Sbjct  178   EDELKGGPIRDPERLAHVEEQLENVVEARHQSGERRKVRLTAPVAGRTHTDRRLHQLMFA  237

Query  1208  DRDYEQCCP-------------------------VWSRDRPKLLFDTVCALTDMQYVVFH  1104
             D+DYE+CC                          V SRDRPKLLFDTVC LTDMQYVVFH
Sbjct  238   DKDYERCCGGCDGSSDRIQVSIENCKEKGYSVVNVKSRDRPKLLFDTVCTLTDMQYVVFH  297

Query  1103  ASISSHDSTSVQ  1068
             A++SS  S +VQ
Sbjct  298   AAVSSKGSIAVQ  309


 Score =   180 bits (456),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL  +SER RV QCLIAA ERR +HGLRLDI  +NRLGLLSD+TRVFRE
Sbjct  309  QEYFIRQMDGCTLGTQSERNRVAQCLIAAIERRVTHGLRLDIRIKNRLGLLSDITRVFRE  368

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI  AEIG  GERA G+FYV D SG+ V P T+E +R+EIGGT+  V+KSS      
Sbjct  369  NGLSIRMAEIGIHGERASGSFYVTDVSGRDVSPNTVELIRKEIGGTIMAVNKSS---VPP  425

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +   + +     +S  + +P FSLG+ LW+Q+ER S+NF
Sbjct  426  SLPASPSRDRSTASSVENRPRFSLGT-LWSQIERFSSNF  463


 Score = 42.4 bits (98),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQALCA  104



>ref|XP_002310330.2| hypothetical protein POPTR_0007s14780g [Populus trichocarpa]
 gb|EEE90780.2| hypothetical protein POPTR_0007s14780g [Populus trichocarpa]
Length=482

 Score =   225 bits (573),  Expect(3) = 8e-115, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 137/199 (69%), Gaps = 32/199 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V TEHT LEMTGTDRPGL+SEISAVL E+ CH++AA+AWTHN RAA I+Y+
Sbjct  118   LNREVRPRHVSTEHTTLEMTGTDRPGLLSEISAVLFELECHVTAALAWTHNTRAASIIYM  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA-ASRTHTERRLHQLMA  1212
             ED  + GPITDP R+A +Q QLENVVEA H  GERRSVRL+ PA   +THTERRLHQLM 
Sbjct  178   EDGFRGGPITDPKRLAHVQEQLENVVEARHGMGERRSVRLTAPAPGQQTHTERRLHQLMY  237

Query  1211  ADRDYEQC-------------------------------CPVWSRDRPKLLFDTVCALTD  1125
             A+ DYE C                                 V SRDRPKLLFDT+CALTD
Sbjct  238   ANIDYEPCQGCNGGGAAHRNNCTKTHVFIESCEEKGYSVVNVRSRDRPKLLFDTLCALTD  297

Query  1124  MQYVVFHASISSHDSTSVQ  1068
             MQYVVFHA +SS  + + Q
Sbjct  298   MQYVVFHAVVSSKGTMADQ  316


 Score =   197 bits (502),  Expect(3) = 8e-115, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R KDGCTL+ +SER ++TQCLIAA ERR SHGLRLDI T NR+GLLSD+TR FRE
Sbjct  316  QEYFIRQKDGCTLDTDSERHKLTQCLIAAIERRVSHGLRLDIRTHNRMGLLSDLTRAFRE  375

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG---RF  644
            NGLSI+ AEIGT G+RA+G+FYV D SG   +P+ +E V++EIGG++ VV+KS G   + 
Sbjct  376  NGLSISSAEIGTNGDRAVGSFYVTDASGYEANPQVIEHVKKEIGGSIVVVNKSPGWTPKT  435

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +K  S  + +  S  SS  + KP FSLGSL W+QLERLSNNF
Sbjct  436  SKTPSVASISRTSSGSSIHEDKPRFSLGSLFWSQLERLSNNF  477


 Score = 42.4 bits (98),  Expect(3) = 8e-115, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQALCA  104



>ref|XP_010273258.1| PREDICTED: uncharacterized protein LOC104608850 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273266.1| PREDICTED: uncharacterized protein LOC104608850 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273274.1| PREDICTED: uncharacterized protein LOC104608850 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273282.1| PREDICTED: uncharacterized protein LOC104608850 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273291.1| PREDICTED: uncharacterized protein LOC104608850 isoform X1 [Nelumbo 
nucifera]
Length=492

 Score =   228 bits (580),  Expect(4) = 2e-114, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 144/216 (67%), Gaps = 49/216 (23%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +G+ V PR+V T++TALE+TGTDRPGL+SEISAVL E+GCH+ +A AWTHN R+ACI+YV
Sbjct  120   LGKVVGPRHVSTQYTALEITGTDRPGLLSEISAVLTELGCHVVSAAAWTHNTRSACIIYV  179

Query  1388  EDDSK-HGPITDPYRVAQIQAQLENVVEAHHYN--GERRSVRLSDPAASRTHTERRLHQL  1218
             ED S+  GPITDP R+ +++ QLENVV AHH N  GER+ VRLS P+ASRTHTERRLHQL
Sbjct  180   EDASRGGGPITDPDRLTKVEEQLENVVSAHHGNGSGERKRVRLSVPSASRTHTERRLHQL  239

Query  1217  MAADRDYEQCCP----------------------------------------------VW  1176
             M ADRDYE+C                                                V 
Sbjct  240   MFADRDYEECGTGDYTTESGDGDVDRKMALELDGEGSWTGRTEVSIESCNEKGYSVVRVR  299

Query  1175  SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             SRDRPKLLFDTVC LTDMQYVVFHA++SS+ S +VQ
Sbjct  300   SRDRPKLLFDTVCTLTDMQYVVFHAAVSSNHSVAVQ  335


 Score =   187 bits (476),  Expect(4) = 2e-114, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 121/162 (75%), Gaps = 12/162 (7%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASH---GLRLDICTQNRLGLLSDVTRV  824
            QEYY+RH DGCTL+ E+ER RVTQCLIAA ERR SH   GLRLD+CT+NR+GLLS +TRV
Sbjct  335  QEYYIRHMDGCTLDTETERCRVTQCLIAAIERRVSHVCPGLRLDVCTRNRVGLLSHITRV  394

Query  823  FRENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRF  644
            FRE GLS++RAEIGT+GE A G+FYV D SG  VD +T+E VR+EIGGTV  V+KSSG  
Sbjct  395  FREYGLSVSRAEIGTRGETATGSFYVIDLSGNDVDSKTVELVRKEIGGTVLEVNKSSGWP  454

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               + S  S          + +  FSLGSLLWAQLERLS+NF
Sbjct  455  APTSCSNGSV---------EYRSRFSLGSLLWAQLERLSSNF  487


 Score = 47.4 bits (111),  Expect(4) = 2e-114, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG KI DES+IHYIQQ
Sbjct  77    MDVFHVTDQLGNKITDESLIHYIQQ  101


 Score = 23.1 bits (48),  Expect(4) = 2e-114, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  71    SDGGWFMD  78



>ref|XP_010273306.1| PREDICTED: uncharacterized protein LOC104608850 isoform X3 [Nelumbo 
nucifera]
Length=422

 Score =   228 bits (580),  Expect(3) = 8e-114, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 144/216 (67%), Gaps = 49/216 (23%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +G+ V PR+V T++TALE+TGTDRPGL+SEISAVL E+GCH+ +A AWTHN R+ACI+YV
Sbjct  50    LGKVVGPRHVSTQYTALEITGTDRPGLLSEISAVLTELGCHVVSAAAWTHNTRSACIIYV  109

Query  1388  EDDSK-HGPITDPYRVAQIQAQLENVVEAHHYN--GERRSVRLSDPAASRTHTERRLHQL  1218
             ED S+  GPITDP R+ +++ QLENVV AHH N  GER+ VRLS P+ASRTHTERRLHQL
Sbjct  110   EDASRGGGPITDPDRLTKVEEQLENVVSAHHGNGSGERKRVRLSVPSASRTHTERRLHQL  169

Query  1217  MAADRDYEQCCP----------------------------------------------VW  1176
             M ADRDYE+C                                                V 
Sbjct  170   MFADRDYEECGTGDYTTESGDGDVDRKMALELDGEGSWTGRTEVSIESCNEKGYSVVRVR  229

Query  1175  SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             SRDRPKLLFDTVC LTDMQYVVFHA++SS+ S +VQ
Sbjct  230   SRDRPKLLFDTVCTLTDMQYVVFHAAVSSNHSVAVQ  265


 Score =   187 bits (475),  Expect(3) = 8e-114, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 121/163 (74%), Gaps = 12/163 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASH---GLRLDICTQNRLGLLSDVTR  827
             QEYY+RH DGCTL+ E+ER RVTQCLIAA ERR SH   GLRLD+CT+NR+GLLS +TR
Sbjct  264  VQEYYIRHMDGCTLDTETERCRVTQCLIAAIERRVSHVCPGLRLDVCTRNRVGLLSHITR  323

Query  826  VFRENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGR  647
            VFRE GLS++RAEIGT+GE A G+FYV D SG  VD +T+E VR+EIGGTV  V+KSSG 
Sbjct  324  VFREYGLSVSRAEIGTRGETATGSFYVIDLSGNDVDSKTVELVRKEIGGTVLEVNKSSGW  383

Query  646  FTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                + S  S          + +  FSLGSLLWAQLERLS+NF
Sbjct  384  PAPTSCSNGSV---------EYRSRFSLGSLLWAQLERLSSNF  417


 Score = 47.0 bits (110),  Expect(3) = 8e-114, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  1705  VFHVTDQLGYKIVDESIIHYIQQ  1637
             VFHVTDQLG KI DES+IHYIQQ
Sbjct  9     VFHVTDQLGNKITDESLIHYIQQ  31



>ref|XP_011031317.1| PREDICTED: uncharacterized protein LOC105130476 isoform X2 [Populus 
euphratica]
Length=482

 Score =   221 bits (564),  Expect(3) = 3e-113, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (69%), Gaps = 32/199 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V TEHT LEM GTDRPGL+SEISAVL ++ CH++AA+AWTHN RAA I+Y+
Sbjct  118   LNREVRPRHVSTEHTTLEMAGTDRPGLLSEISAVLYDLECHVTAALAWTHNTRAASIIYM  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA-ASRTHTERRLHQLMA  1212
             ED  + GPITDP R+A +Q QLENVVEA H  GERR+VRL+ PA   +THTERRLHQLM 
Sbjct  178   EDGFRGGPITDPKRLAHVQEQLENVVEARHGMGERRNVRLTAPAPGQQTHTERRLHQLMY  237

Query  1211  ADRDYEQC-------------------------------CPVWSRDRPKLLFDTVCALTD  1125
             A+ DYE C                                 V SRDRPKLLFDT+CALTD
Sbjct  238   ANIDYEPCQGCNGGGAAHRNNCTKTHVFIESCEEKGYSVVNVRSRDRPKLLFDTLCALTD  297

Query  1124  MQYVVFHASISSHDSTSVQ  1068
             MQYVVFHA++SS  + + Q
Sbjct  298   MQYVVFHAAVSSKGTMADQ  316


 Score =   196 bits (497),  Expect(3) = 3e-113, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R KDGCTL+ +SER ++TQCLIAA ERR SHGLRLDI T NR+GLLSD+TR FRE
Sbjct  316  QEYFIRQKDGCTLDTDSERHKLTQCLIAAIERRVSHGLRLDIRTHNRMGLLSDLTRAFRE  375

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG---RF  644
            NGLSI+ AEIGT G+RA+G FYV D SG   +P+ +E V++EIGG++ +V+KS G   + 
Sbjct  376  NGLSISSAEIGTDGDRAVGFFYVTDASGYEANPQVIEQVKKEIGGSIVIVNKSPGWTPKT  435

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +K  S  + +  S  +S  + KP FSLGSL W+QLE+LSNNF
Sbjct  436  SKTPSVASISRTSSGNSIHEDKPRFSLGSLFWSQLEKLSNNF  477


 Score = 42.7 bits (99),  Expect(3) = 3e-113, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQALCA  104



>ref|XP_011031316.1| PREDICTED: uncharacterized protein LOC105130476 isoform X1 [Populus 
euphratica]
Length=483

 Score =   222 bits (565),  Expect(3) = 7e-112, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (69%), Gaps = 32/199 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+VRPR+V TEHT LEM GTDRPGL+SEISAVL ++ CH++AA+AWTHN RAA I+Y+
Sbjct  118   LNREVRPRHVSTEHTTLEMAGTDRPGLLSEISAVLYDLECHVTAALAWTHNTRAASIIYM  177

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA-ASRTHTERRLHQLMA  1212
             ED  + GPITDP R+A +Q QLENVVEA H  GERR+VRL+ PA   +THTERRLHQLM 
Sbjct  178   EDGFRGGPITDPKRLAHVQEQLENVVEARHGMGERRNVRLTAPAPGQQTHTERRLHQLMY  237

Query  1211  ADRDYEQC-------------------------------CPVWSRDRPKLLFDTVCALTD  1125
             A+ DYE C                                 V SRDRPKLLFDT+CALTD
Sbjct  238   ANIDYEPCQGCNGGGAAHRNNCTKTHVFIESCEEKGYSVVNVRSRDRPKLLFDTLCALTD  297

Query  1124  MQYVVFHASISSHDSTSVQ  1068
             MQYVVFHA++SS  + + Q
Sbjct  298   MQYVVFHAAVSSKGTMADQ  316


 Score =   191 bits (485),  Expect(3) = 7e-112, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASH-GLRLDICTQNRLGLLSDVTRVFR  818
            QEY++R KDGCTL+ +SER ++TQCLIAA ERR SH GLRLDI T NR+GLLSD+TR FR
Sbjct  316  QEYFIRQKDGCTLDTDSERHKLTQCLIAAIERRVSHQGLRLDIRTHNRMGLLSDLTRAFR  375

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG---R  647
            ENGLSI+ AEIGT G+RA+G FYV D SG   +P+ +E V++EIGG++ +V+KS G   +
Sbjct  376  ENGLSISSAEIGTDGDRAVGFFYVTDASGYEANPQVIEQVKKEIGGSIVIVNKSPGWTPK  435

Query  646  FTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             +K  S  + +  S  +S  + KP FSLGSL W+QLE+LSNNF
Sbjct  436  TSKTPSVASISRTSSGNSIHEDKPRFSLGSLFWSQLEKLSNNF  478


 Score = 42.7 bits (99),  Expect(3) = 7e-112, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKLTDESLILYIQQALCA  104



>gb|KDO78875.1| hypothetical protein CISIN_1g014457mg [Citrus sinensis]
Length=424

 Score =   215 bits (548),  Expect(4) = 7e-112, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 128/188 (68%), Gaps = 30/188 (16%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             RDVRPR+V TE+TALE+TG DRPGLMSEISAVL E+GCH+ AAVAWTH  RAACI Y+ED
Sbjct  70    RDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYIED  129

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR  1203
               +  PIT P  +A ++ QLE VV AHH  GE RSVRL+ P   RTHTERRLHQLM ADR
Sbjct  130   GLEGRPITAPEMLAHVEEQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYADR  189

Query  1202  DYEQC--CPV----WSR------------------------DRPKLLFDTVCALTDMQYV  1113
             DYE C  C      W+                         DRPKLLFDT+CALTD+QYV
Sbjct  190   DYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCIDRPKLLFDTLCALTDLQYV  249

Query  1112  VFHASISS  1089
             VFHA+ISS
Sbjct  250   VFHAAISS  257


 Score =   197 bits (500),  Expect(4) = 7e-112, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL+ ES+R+++TQCLIAA ERR SHGLRL+ICTQNR+GLLSDVTR FRE
Sbjct  264  QEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRE  323

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++ AEIGT GE+A G+FYV D SG  V+  T+E ++QEIGG+V VV+KSS R ++A
Sbjct  324  NGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKSSNRTSQA  383

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +S   S S S   S +D +P FSLG+LLW++LERLS NF
Sbjct  384  SSVSLSRSSSGGGSLDD-RPKFSLGNLLWSRLERLSGNF  421


 Score = 41.6 bits (96),  Expect(4) = 7e-112, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DE++I YIQQ   A
Sbjct  25    MDVFHVTDQLGNKLTDETLILYIQQALCA  53


 Score = 23.1 bits (48),  Expect(4) = 7e-112, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  19    SDGGWFMD  26



>ref|XP_006426129.1| hypothetical protein CICLE_v10025521mg [Citrus clementina]
 gb|ESR39369.1| hypothetical protein CICLE_v10025521mg [Citrus clementina]
Length=476

 Score =   214 bits (545),  Expect(4) = 6e-111, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 129/190 (68%), Gaps = 30/190 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + RDVRPR+V TE+TALE+TG DRPGLMSEISAVL E+GCH+ AAVAWTH  RAACI Y+
Sbjct  120   LKRDVRPRHVSTENTALEVTGVDRPGLMSEISAVLYELGCHVPAAVAWTHKTRAACIFYI  179

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED  +  PIT P  +A ++ QLE VV AHH  GE RSVRL+ P   RTHTERRLHQLM A
Sbjct  180   EDGLEGRPITAPEMLAHVEDQLEIVVGAHHGEGETRSVRLTTPMPGRTHTERRLHQLMYA  239

Query  1208  DRDYEQC--CPV----WSR------------------------DRPKLLFDTVCALTDMQ  1119
             DRDYE C  C      W+                         DRPKLLFDT+CALTD+Q
Sbjct  240   DRDYELCRGCDGGAGHWNGCTRTHVLIDSCKEKGYSVVNIKCVDRPKLLFDTLCALTDLQ  299

Query  1118  YVVFHASISS  1089
             YVVFHA+ISS
Sbjct  300   YVVFHAAISS  309


 Score =   195 bits (496),  Expect(4) = 6e-111, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL+ ES+R+++TQCLIAA ERR SHGLRL+ICTQNR+GLLSDVTR FRE
Sbjct  316  QEYFIRQTDGCTLDTESQRQKLTQCLIAAIERRVSHGLRLEICTQNRMGLLSDVTRAFRE  375

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++ AEIGT GE+A G+FYV D SG  V+  T+E ++QEIGG+V VV+KSS R ++ 
Sbjct  376  NGLSVSMAEIGTNGEKATGSFYVMDASGHDVNQRTVELLKQEIGGSVLVVNKSSNRTSQT  435

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +S   S S S   S +D +P FSLG+LLW++LERLS NF
Sbjct  436  SSVSLSRSSSGGGSLDD-RPKFSLGNLLWSRLERLSGNF  473


 Score = 41.2 bits (95),  Expect(4) = 6e-111, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DE++I YIQQ   A
Sbjct  77    MDVFHVTDQLGNKLTDETLILYIQQALCA  105


 Score = 23.1 bits (48),  Expect(4) = 6e-111, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  71    SDGGWFMD  78



>ref|XP_011007844.1| PREDICTED: uncharacterized protein LOC105113386 [Populus euphratica]
 ref|XP_011007845.1| PREDICTED: uncharacterized protein LOC105113386 [Populus euphratica]
 ref|XP_011007846.1| PREDICTED: uncharacterized protein LOC105113386 [Populus euphratica]
Length=482

 Score =   216 bits (551),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 135/197 (69%), Gaps = 32/197 (16%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+VRP Y  T+HTA+E+ GTDRPGL+SEISAVL+++ CH++A+  WTHN RAA I+Y+ED
Sbjct  121   REVRPPYASTDHTAMEIIGTDRPGLLSEISAVLSKLECHVTASAVWTHNKRAASIIYMED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA-ASRTHTERRLHQLMAAD  1206
               + GPITDP R+A +Q QLENVVEAHH  GERRSVRL+ PA   +THT RRLHQLM A+
Sbjct  181   GFQGGPITDPKRLAHVQEQLENVVEAHHGVGERRSVRLTAPAPGKKTHTGRRLHQLMYAN  240

Query  1205  RDYEQC-----------------------CP--------VWSRDRPKLLFDTVCALTDMQ  1119
              DYE C                       C         V SRDRPKLLFDT+CALTDMQ
Sbjct  241   MDYEPCQGCNGGGLAHRNNCTKIHVSIDSCKEKGYSVVNVRSRDRPKLLFDTLCALTDMQ  300

Query  1118  YVVFHASISSHDSTSVQ  1068
             YVVFHA+IS+  + + Q
Sbjct  301   YVVFHAAISAKGTMADQ  317


 Score =   193 bits (491),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R +DGCTL+ ESER ++TQCLIAA ERR SHG+RLDICT NR+GLLS+VTR FRE
Sbjct  317  QEYFIRQQDGCTLDTESERHKLTQCLIAAIERRVSHGVRLDICTHNRMGLLSNVTRAFRE  376

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI+RAEIGT G+RA+G+FYV D SG   DP+ ++ V++E+GG+V VV+KS G   K 
Sbjct  377  NGLSISRAEIGTNGDRAVGSFYVTDASGCEADPQAIDEVKKEMGGSVVVVNKSPGWTPKT  436

Query  634  tssgnstsrs--rrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + +  + S S     S ++ KP  S GSL W+QL+RLS+NF
Sbjct  437  SKTPLAGSISRYSSGSIDEEKPRLSPGSLFWSQLKRLSSNF  477


 Score = 41.6 bits (96),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VCV  1628
             + VFHVTDQLG K+ D+S+I YIQQ +CV
Sbjct  77    MEVFHVTDQLGSKLTDDSLILYIQQALCV  105



>ref|XP_002320665.2| hypothetical protein POPTR_0014s00840g [Populus trichocarpa]
 gb|EEE98980.2| hypothetical protein POPTR_0014s00840g [Populus trichocarpa]
Length=482

 Score =   218 bits (554),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 136/197 (69%), Gaps = 32/197 (16%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+VRP Y  T+HTA+E+TGTDRPGL+SEISAVL+++ CH++A+  WTHN RAA I+Y+ED
Sbjct  121   REVRPPYASTDHTAMEITGTDRPGLLSEISAVLSKLECHVTASAVWTHNNRAASIIYMED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA-ASRTHTERRLHQLMAAD  1206
               + GPITDP R+A +Q QLENVVEAHH  GERRSVRL+ PA   +THT RRLHQLM A+
Sbjct  181   GFQGGPITDPKRLAHVQEQLENVVEAHHGVGERRSVRLTAPAPGQKTHTGRRLHQLMYAN  240

Query  1205  RDYEQC-----------------------CP--------VWSRDRPKLLFDTVCALTDMQ  1119
              DYE C                       C         V SRDRPKLLFDT+CALTDMQ
Sbjct  241   MDYEPCQGCNGGGLAHRNNCTKIHVSIDSCKEKGYSVVNVRSRDRPKLLFDTLCALTDMQ  300

Query  1118  YVVFHASISSHDSTSVQ  1068
             YVVFHA++S+  + + Q
Sbjct  301   YVVFHAAVSAKGTMADQ  317


 Score =   192 bits (487),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R +DGCTL+ ESER ++TQCLIAA ERR SHG RLDICT NR+GLLS+VTR FRE
Sbjct  317  QEYFIRQQDGCTLDTESERHKLTQCLIAAIERRVSHGARLDICTHNRMGLLSNVTRAFRE  376

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI+RAEIGT G+RA+G+FYV D SG   +P+ ++ V++E+GG+V VV+KS G   K 
Sbjct  377  NGLSISRAEIGTNGDRAVGSFYVTDASGYEANPQAIDEVKKEMGGSVVVVNKSPGWTPKT  436

Query  634  tssgn--stsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + + +  S SR+   S ++ KP  S GSL W+QL+RLS+NF
Sbjct  437  SKTPSVGSVSRNSSGSIDEEKPRLSPGSLFWSQLKRLSSNF  477


 Score = 41.6 bits (96),  Expect(3) = 1e-110, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VCV  1628
             + VFHVTDQLG K+ D+S+I YIQQ +CV
Sbjct  77    MEVFHVTDQLGSKLTDDSLILYIQQALCV  105



>gb|EYU44517.1| hypothetical protein MIMGU_mgv1a005004mg [Erythranthe guttata]
Length=501

 Score =   205 bits (521),  Expect(3) = 3e-107, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 130/205 (63%), Gaps = 49/205 (24%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDD---SKHG-  1368
             T+H ALEMTGTDRPGLMSE+SAVLAE+GCH+++AVAWTHN RAA I+YVED    SK G 
Sbjct  129   TQHVALEMTGTDRPGLMSEMSAVLAELGCHVTSAVAWTHNGRAASIIYVEDTAAASKSGG  188

Query  1367  -PITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-  1194
                 DP RVAQ+QAQLENVVEAHH+  ERRSVR++ P   RTHTERRLHQLMAAD DYE 
Sbjct  189   SAAMDPCRVAQVQAQLENVVEAHHHKDERRSVRMAAPTPGRTHTERRLHQLMAADGDYEG  248

Query  1193  -------------------------QCC------------------PVWSRDRPKLLFDT  1143
                                      + C                   V SRDR KLLFDT
Sbjct  249   CCSCSGGSSELDDFYVHGGCHKGQKKGCDGTHVKIENCKETGYSVITVRSRDRLKLLFDT  308

Query  1142  VCALTDMQYVVFHASISSHDSTSVQ  1068
             VC LTD+QYVV HA+ISS  S + Q
Sbjct  309   VCTLTDLQYVVHHAAISSQGSNAFQ  333


 Score =   195 bits (495),  Expect(3) = 3e-107, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 128/166 (77%), Gaps = 5/166 (3%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYV+HKDG T++ E+E+ RVT+CLIAA ERR SHGLRLDICT+NR GLLSDVTRVFR
Sbjct  332  FQEYYVKHKDGYTIDSENEKCRVTKCLIAAAERRVSHGLRLDICTRNRTGLLSDVTRVFR  391

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLSI RAEIG +GE+A GTFY+KDT+G++V PET++ +R EIGG++ V +KSSG   +
Sbjct  392  ENGLSINRAEIGIRGEKATGTFYLKDTTGKNVGPETVDIIRHEIGGSIFVHNKSSGVSPE  451

Query  637  Atssg-----nstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
            AT S        +  S    G + +  FS G+LLWA LERLS+NF+
Sbjct  452  ATPSTRSRSGGGSGGSNNGGGAEERSRFSFGNLLWAHLERLSSNFK  497


 Score = 40.4 bits (93),  Expect(3) = 3e-107, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQ G K+ DE++IHYIQ+ +C
Sbjct  76    MDVFHVTDQQGDKLTDETLIHYIQECIC  103



>ref|XP_010106910.1| hypothetical protein L484_013004 [Morus notabilis]
 gb|EXC12626.1| hypothetical protein L484_013004 [Morus notabilis]
Length=480

 Score =   222 bits (566),  Expect(4) = 9e-107, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 135/199 (68%), Gaps = 34/199 (17%)
 Frame = -1

Query  1571  FIGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             F+GRDV P     + TALEMTGTDRPGLMSEISAVL E+GC+++A +AWTHN+RAACIVY
Sbjct  124   FLGRDVMPG---QKDTALEMTGTDRPGLMSEISAVLVELGCNVTATMAWTHNSRAACIVY  180

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             VE+    GPITDP R+AQ+Q QL+NVVEAHH  GE+RSVRL+ PA  RTHTERRLHQLM 
Sbjct  181   VENGPGGGPITDPIRLAQVQEQLQNVVEAHHGKGEKRSVRLTTPAPGRTHTERRLHQLMY  240

Query  1211  ADRDYEQC-------------------------------CPVWSRDRPKLLFDTVCALTD  1125
              D DYE+C                                 V SRDRPKLLFDTVCAL D
Sbjct  241   EDGDYERCRGCDGGGTTHKQGCDRTHVTIERCEEKGYWIVNVRSRDRPKLLFDTVCALAD  300

Query  1124  MQYVVFHASISSHDSTSVQ  1068
             ++YVV HA ++S  + + Q
Sbjct  301   LEYVVSHAVVASKGTIADQ  319


 Score =   177 bits (448),  Expect(4) = 9e-107, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHK GC L+ ESERR++  CLIAA ERR SHGLRLD+C+ N++GL SD+TRVFRE
Sbjct  319  QEYFIRHKYGCPLDTESERRKLILCLIAAIERRISHGLRLDLCSPNQMGLFSDITRVFRE  378

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++R EI T+ ++A G+ YV D SG  VDPET+E    EIGG++  VH+S   +   
Sbjct  379  NGLSMSRIEITTRDDKAFGSIYVTDASGNDVDPETVELAITEIGGSIIAVHRSPD-WVPR  437

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
             SS +++    +   ED +P FS GSL W+QLERLS++FR
Sbjct  438  RSSPSTSPEIAKREVED-RPRFSFGSLFWSQLERLSSSFR  476


 Score = 37.7 bits (86),  Expect(4) = 9e-107, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ DE +I YI+Q
Sbjct  81    MDVFHVTDQLGNKLTDERLILYIKQ  105


 Score = 22.7 bits (47),  Expect(4) = 9e-107, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  75    SDGGWFMD  82



>ref|XP_004288269.1| PREDICTED: uncharacterized protein LOC101292932 [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   209 bits (531),  Expect(3) = 2e-106, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 129/198 (65%), Gaps = 34/198 (17%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +G++V P     +  ALEMT  DRPGLMSEISAVL E+GC+I+AAV WTH++R A I YV
Sbjct  117   LGKEVAPG---VKDLALEMTTKDRPGLMSEISAVLVELGCNITAAVTWTHSSRTASIFYV  173

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
             ED  K GPI DP R++ +Q QLENV+EAHH  GE+RSVRL+ PAA RTHTERRLHQLM  
Sbjct  174   EDGLKGGPIMDPIRLSNVQEQLENVIEAHHEKGEKRSVRLTTPAAGRTHTERRLHQLMYG  233

Query  1208  DRDYEQC-----------------------CP--------VWSRDRPKLLFDTVCALTDM  1122
             D DYE C                       C         V  RDRPKLLFDTVCALTD+
Sbjct  234   DDDYEMCRGCDGGDKGHKKGCDRTHVSIESCKEKGYWIVNVRCRDRPKLLFDTVCALTDL  293

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA +SS  + + Q
Sbjct  294   QYVVFHALVSSRGTMADQ  311


 Score =   184 bits (468),  Expect(3) = 2e-106, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VRHKDG TLN ESER ++T CL+AA ERR S GLRLDIC +NR+GLLSD+TRVFRE
Sbjct  311  QEYFVRHKDGYTLNAESERHKLTLCLVAAIERRISQGLRLDICAKNRMGLLSDITRVFRE  370

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK-  638
            +GLSITRAEIGT GERA+G+ YV DTSG  V+   +ESVR+E+GG+V  VHK        
Sbjct  371  SGLSITRAEIGTYGERAVGSIYVTDTSGHDVNLNLVESVRKEVGGSVIAVHKPQTWAAHG  430

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             +S  +    + R   E+ +P  S GSL+W+QLERLS++F
Sbjct  431  GSSRTSRRVPNTRVEDEEDRPRLSFGSLVWSQLERLSSSF  470


 Score = 43.9 bits (102),  Expect(3) = 2e-106, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ DESII YIQQ   A
Sbjct  76    MDVFHVTDQLGNKVTDESIILYIQQALCA  104



>ref|XP_003635457.1| PREDICTED: uncharacterized protein LOC100854519, partial [Vitis 
vinifera]
Length=338

 Score =   230 bits (586),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 130/179 (73%), Gaps = 25/179 (14%)
 Frame = -1

Query  1529  HTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPY  1350
             HTA E+TGTDRPGLMSEISAVLAE+ CH++AAVAWTHN+R ACI+ +ED+ K GPI DP 
Sbjct  1     HTAFEITGTDRPGLMSEISAVLAELSCHVTAAVAWTHNSRVACIICLEDELKGGPIRDPE  60

Query  1349  RVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCP----  1182
             R+  ++ QLENVVEA H +GERR VRL+ P A RTHT+RRLHQLM AD+DYE+CC     
Sbjct  61    RLVHVEEQLENVVEARHQSGERRKVRLTAPVAGRTHTDRRLHQLMFADKDYERCCGGCDG  120

Query  1181  ---------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                  V SRDRPKLLFDTVC LTDMQYVVFHA++SS  S +VQ
Sbjct  121   SSDRIQVSIENCKEKGYSVVNVKSRDRPKLLFDTVCTLTDMQYVVFHAAVSSKGSIAVQ  179


 Score =   181 bits (459),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL  ESER RV QCLIAA ERR +HGLRLDI  +NRLGLLSD+TRVFRE
Sbjct  179  QEYFIRQMDGCTLGTESERNRVAQCLIAAIERRVTHGLRLDIRIKNRLGLLSDITRVFRE  238

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI  AEIG  GERA G+FYV D SG+ V P T+E +R+EIGGT+  V+KSS      
Sbjct  239  NGLSIRMAEIGIHGERASGSFYVTDVSGRDVSPNTVELIRKEIGGTIMAVNKSS---VPP  295

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +   + +     +S  + +P FSLG+ LW+Q+ER S+NF
Sbjct  296  SLPASPSRDRSTASSVENRPRFSLGT-LWSQIERFSSNF  333



>ref|XP_007047588.1| ACT domain repeat 1 isoform 2 [Theobroma cacao]
 gb|EOX91745.1| ACT domain repeat 1 isoform 2 [Theobroma cacao]
Length=339

 Score =   216 bits (551),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 125/179 (70%), Gaps = 30/179 (17%)
 Frame = -1

Query  1514  MTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRVAQI  1335
             MTG DRPGLMSEISA L E+GCH++A VAWTHNAR ACI++VED  K GPI  P RVA++
Sbjct  1     MTGRDRPGLMSEISAALYELGCHVTATVAWTHNARMACIIHVEDGFKGGPIMAPKRVAEV  60

Query  1334  QAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC------CPVW-  1176
             Q +LENVVEA H +GERRSVRL+ PAA RTHTERRLHQLM ADRDYEQC      C  W 
Sbjct  61    QEKLENVVEAPHDSGERRSVRLTAPAAGRTHTERRLHQLMYADRDYEQCQGCDGSCRHWK  120

Query  1175  -----------------------SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                    SRDR KLLFDTVCALTDMQYVVFHA++SS  + + Q
Sbjct  121   GCTKTHVTIESCREKGYSVVHARSRDRTKLLFDTVCALTDMQYVVFHAAVSSKGAMADQ  179


 Score =   194 bits (493),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VR +DGC+L  E ER R+T+CLIAA ERR S GLRLD+CTQN+ GLLSD+TRVFRE
Sbjct  179  QEYFVRRQDGCSLVTEDERHRLTECLIAAIERRVSRGLRLDVCTQNKRGLLSDLTRVFRE  238

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAEIGT GERAIG+FYV D SG  V+P T+E VRQEIGG+  VV+KS  R ++A
Sbjct  239  NGLSITRAEIGTHGERAIGSFYVTDASGHDVNPRTVELVRQEIGGSALVVNKSPDRTSRA  298

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +SS  + S S      + +P FSLG+LLW+QLERLS NF
Sbjct  299  SSSSINRSSSSEV---EERPRFSLGNLLWSQLERLSGNF  334



>ref|XP_010679666.1| PREDICTED: uncharacterized protein LOC104894974 [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   219 bits (557),  Expect(3) = 3e-104, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 137/206 (67%), Gaps = 40/206 (19%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR+VRPR+V  E TALEMT TD+PGL+SE+SAVL E+GC++SAAVAWTHN R ACI+YV+
Sbjct  118   GREVRPRHVAMECTALEMTVTDQPGLLSEVSAVLTELGCNVSAAVAWTHNHRGACIIYVD  177

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D     PITD  R++ IQ QL+ VVEAHH NGE+++VRL+ P+ S+THTERRLHQLM AD
Sbjct  178   DQEMGKPITDQKRLSYIQEQLQTVVEAHHKNGEKQTVRLTTPSTSQTHTERRLHQLMVAD  237

Query  1205  RDYEQC--------------------------------CP--------VWSRDRPKLLFD  1146
              DY  C                                C         +  +DRPKLLFD
Sbjct  238   EDYATCSDCGGSVGGGEGTKYARIHGMSCGCTHVSIDTCKERGYSVVNIRCKDRPKLLFD  297

Query  1145  TVCALTDMQYVVFHASISSHDSTSVQ  1068
             TVCALTDMQY+VFHA+ISS+ S +VQ
Sbjct  298   TVCALTDMQYMVFHAAISSNSSIAVQ  323


 Score =   170 bits (431),  Expect(3) = 3e-104, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 10/159 (6%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVR KDGCTL+ E+ERRRV QCLIAA ERR + GLR++I  ++R+GLLSDVTRVFRE
Sbjct  323  QEYYVRRKDGCTLDTENERRRVRQCLIAAVERRGTQGLRVEITAKDRIGLLSDVTRVFRE  382

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
             GLS+TRAEIGT GE+A GTFYV D SG+ +  E +E++ Q+I G+V V  K+  +    
Sbjct  383  YGLSVTRAEIGTSGEKATGTFYVTDISGRKISKEMVEAIEQKIDGSVVVHDKTPNK----  438

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                     S  S  ED     SLGS LW++LER+S NF
Sbjct  439  ------KYNSNTSEMEDRPSLLSLGSFLWSRLERISGNF  471


 Score = 40.4 bits (93),  Expect(3) = 3e-104, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQ G KI DE++I YIQ+   A
Sbjct  78    MDVFHVTDQFGKKITDEALIEYIQKAICA  106



>ref|XP_007205133.1| hypothetical protein PRUPE_ppa005094mg [Prunus persica]
 gb|EMJ06332.1| hypothetical protein PRUPE_ppa005094mg [Prunus persica]
Length=477

 Score =   204 bits (520),  Expect(4) = 3e-103, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 127/198 (64%), Gaps = 35/198 (18%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR+V P     +  A+EMT  DRPGL+SEISAVL E+GC+I+ AVAWTH  RAA I YVE
Sbjct  117   GRNVTPGL---KDLAVEMTSKDRPGLVSEISAVLVELGCNITTAVAWTHGTRAASIFYVE  173

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D  + GPITDP R+A +Q QLENVV+AHH  GE+RSVRL+ PA   TH ERRLHQLM AD
Sbjct  174   DGLEGGPITDPIRLAHVQEQLENVVKAHHEEGEKRSVRLTTPAGGHTHKERRLHQLMYAD  233

Query  1205  RDYEQC------------------------CP--------VWSRDRPKLLFDTVCALTDM  1122
              DYE C                        C         V SRDRPKLLFDTVCALTD+
Sbjct  234   EDYESCRGCDGSGSSAHKKGCDRTHVNIESCKEKGYWIVNVRSRDRPKLLFDTVCALTDL  293

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA ++S  + + Q
Sbjct  294   QYVVFHAVVASRGTLADQ  311


 Score =   177 bits (448),  Expect(4) = 3e-103, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 3/162 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VRHKDG T N ESER ++T CL+AA ERR S GLRLD+C +NR+GLLSD+TRVFRE
Sbjct  311  QEYFVRHKDGYTSNTESERHKLTLCLVAAIERRISQGLRLDLCAKNRMGLLSDITRVFRE  370

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++R EIGT+GERA+G+ YV D SG  V+P  +E V +EIG ++  VHKS     +A
Sbjct  371  NGLSMSRIEIGTRGERAVGSIYVTDASGDEVNPNAVELVTKEIGESIIAVHKSHKWAPQA  430

Query  634  tssgnstsrsrr---ssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +SS  ++ +         E+ +P FSLGSL+W+ LERLS+ F
Sbjct  431  SSSSRTSHKIHNRRIEEEEEDRPRFSLGSLVWSHLERLSSTF  472


 Score = 43.5 bits (101),  Expect(4) = 3e-103, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQALCA  104


 Score = 23.1 bits (48),  Expect(4) = 3e-103, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWFMD  77



>ref|XP_008237545.1| PREDICTED: uncharacterized protein LOC103336270 isoform X2 [Prunus 
mume]
Length=476

 Score =   206 bits (525),  Expect(4) = 1e-102, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 127/198 (64%), Gaps = 35/198 (18%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR+V P     +  ALEMT  DRPGL+SEISAVL E+GC+I+ AVAWTH  RAA I YVE
Sbjct  117   GRNVTPGL---KDLALEMTSKDRPGLVSEISAVLVELGCNITTAVAWTHGTRAASIFYVE  173

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D  + GPITDP R+A +Q QLENVV+AHH  GE+RSVRL+ PA   TH ERRLHQLM AD
Sbjct  174   DGLEGGPITDPIRLAHVQEQLENVVKAHHEEGEKRSVRLTTPAGGHTHKERRLHQLMYAD  233

Query  1205  RDYEQC------------------------CP--------VWSRDRPKLLFDTVCALTDM  1122
              DYE C                        C         V SRDRPKLLFDTVCALTD+
Sbjct  234   EDYESCRGCDGSGSSAHKKGCDRTHVNIESCKEKGYWIVNVRSRDRPKLLFDTVCALTDL  293

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA ++S  + + Q
Sbjct  294   QYVVFHAVVASRGTLADQ  311


 Score =   173 bits (438),  Expect(4) = 1e-102, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VRH+DG T N ES+R ++T CL+AA ERR S GLRLD+C +NR+GLLSD+TRVFRE
Sbjct  311  QEYFVRHQDGYTSNTESQRHKLTLCLVAAIERRISQGLRLDLCAKNRMGLLSDITRVFRE  370

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++R EIGT+GERA+G+ YV D SG  V+P  +E V +EIG ++  VHKS     + 
Sbjct  371  NGLSMSRIEIGTRGERAVGSIYVTDASGDEVNPNAVELVTKEIGESIIAVHKSHKWAPQP  430

Query  634  tssgnstsrsr--rssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +SS  S           E+ +P FSLGSL+W+ LERLS++F
Sbjct  431  SSSRASNKIHNRRIEEEEEDRPRFSLGSLVWSHLERLSSSF  471


 Score = 43.5 bits (101),  Expect(4) = 1e-102, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQALCA  104


 Score = 23.1 bits (48),  Expect(4) = 1e-102, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWFMD  77



>ref|XP_008351934.1| PREDICTED: uncharacterized protein LOC103415377 [Malus domestica]
Length=476

 Score =   211 bits (536),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 129/197 (65%), Gaps = 35/197 (18%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V P     +  ALEMT  DRPGLMSEISAVL E+GCHI+AA+AWTH+ARAA I Y+ED
Sbjct  119   REVTPEL---KDLALEMTSKDRPGLMSEISAVLVELGCHITAAMAWTHSARAAGIFYIED  175

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR  1203
               K GPITDP R+A ++ QLENV+EAHH  GE+RSV+L+ PA   THTERRLHQLM AD 
Sbjct  176   GLKGGPITDPVRLAHVEEQLENVIEAHHEEGEKRSVKLTTPAGGHTHTERRLHQLMYADD  235

Query  1202  DYEQC------------------------CP--------VWSRDRPKLLFDTVCALTDMQ  1119
             DYE C                        C         V  RDRPKLLFDTVCALTD+Q
Sbjct  236   DYESCRGCDGGGSSAHKRGCDRTHVNIESCKEKGYWVVNVSCRDRPKLLFDTVCALTDLQ  295

Query  1118  YVVFHASISSHDSTSVQ  1068
             YVVFHA +SS  + + Q
Sbjct  296   YVVFHAVVSSRGTMADQ  312


 Score =   167 bits (423),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VRHKDG TLN ESER ++T CLIAA ERR S GLRLD+C +NR+GL SD+TRV RE
Sbjct  312  QEYFVRHKDGYTLNTESERHKLTLCLIAAIERRISQGLRLDLCAKNRMGLFSDITRVLRE  371

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS-SGRFTK  638
             GLSI+R  +G  GE+A+G+ YV D SG  + P T+E V +EIG +V  VHKS       
Sbjct  372  YGLSISRFSLGIHGEKAVGSIYVTDASGHDISPSTVEMVTKEIGESVIAVHKSQKWALQG  431

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            ++S  +  +  RR   E+ +P FSLG L+W+ LERLS++F
Sbjct  432  SSSRTSQKAAKRREEEEEERPRFSLGGLVWSHLERLSSSF  471


 Score = 43.1 bits (100),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQALCA  104



>ref|XP_008237541.1| PREDICTED: uncharacterized protein LOC103336270 isoform X1 [Prunus 
mume]
Length=477

 Score =   206 bits (525),  Expect(4) = 3e-101, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 127/198 (64%), Gaps = 35/198 (18%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR+V P     +  ALEMT  DRPGL+SEISAVL E+GC+I+ AVAWTH  RAA I YVE
Sbjct  117   GRNVTPGL---KDLALEMTSKDRPGLVSEISAVLVELGCNITTAVAWTHGTRAASIFYVE  173

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D  + GPITDP R+A +Q QLENVV+AHH  GE+RSVRL+ PA   TH ERRLHQLM AD
Sbjct  174   DGLEGGPITDPIRLAHVQEQLENVVKAHHEEGEKRSVRLTTPAGGHTHKERRLHQLMYAD  233

Query  1205  RDYEQC------------------------CP--------VWSRDRPKLLFDTVCALTDM  1122
              DYE C                        C         V SRDRPKLLFDTVCALTD+
Sbjct  234   EDYESCRGCDGSGSSAHKKGCDRTHVNIESCKEKGYWIVNVRSRDRPKLLFDTVCALTDL  293

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA ++S  + + Q
Sbjct  294   QYVVFHAVVASRGTLADQ  311


 Score =   168 bits (426),  Expect(4) = 3e-101, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASH-GLRLDICTQNRLGLLSDVTRVFR  818
            QEY+VRH+DG T N ES+R ++T CL+AA ERR S  GLRLD+C +NR+GLLSD+TRVFR
Sbjct  311  QEYFVRHQDGYTSNTESQRHKLTLCLVAAIERRISQQGLRLDLCAKNRMGLLSDITRVFR  370

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS++R EIGT+GERA+G+ YV D SG  V+P  +E V +EIG ++  VHKS     +
Sbjct  371  ENGLSMSRIEIGTRGERAVGSIYVTDASGDEVNPNAVELVTKEIGESIIAVHKSHKWAPQ  430

Query  637  Atssgnstsrsr--rssGEDGKPGFSLGSLLWAQLERLSNNF  518
             +SS  S           E+ +P FSLGSL+W+ LERLS++F
Sbjct  431  PSSSRASNKIHNRRIEEEEEDRPRFSLGSLVWSHLERLSSSF  472


 Score = 43.5 bits (101),  Expect(4) = 3e-101, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQALCA  104


 Score = 23.1 bits (48),  Expect(4) = 3e-101, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWFMD  77



>ref|XP_009362597.1| PREDICTED: uncharacterized protein LOC103952667 [Pyrus x bretschneideri]
 ref|XP_009362598.1| PREDICTED: uncharacterized protein LOC103952667 [Pyrus x bretschneideri]
Length=476

 Score =   211 bits (536),  Expect(3) = 9e-101, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 129/197 (65%), Gaps = 35/197 (18%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V P     +  A+EMT  DRPGLMSEISAVL E+GCHI+AA+AWTH+ARAA I Y+ED
Sbjct  119   REVTPEL---KDLAIEMTSKDRPGLMSEISAVLVELGCHITAAMAWTHSARAAVIFYIED  175

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR  1203
               K GPITDP R+A ++ QLENV+EAHH  GE+RSV+L+ PA   THTERRLHQLM AD 
Sbjct  176   GLKGGPITDPVRLAHVEEQLENVIEAHHEEGEKRSVKLTTPAGGHTHTERRLHQLMYADD  235

Query  1202  DYEQC------------------------CP--------VWSRDRPKLLFDTVCALTDMQ  1119
             DYE C                        C         V SRDRPKLLFDTVCALTD+Q
Sbjct  236   DYESCRGCDGGGSSVHKRGCDRTHVNIESCKEKGYWVVNVRSRDRPKLLFDTVCALTDLQ  295

Query  1118  YVVFHASISSHDSTSVQ  1068
             Y VFHA +SS  + + Q
Sbjct  296   YAVFHAVVSSRGTMADQ  312


 Score =   164 bits (416),  Expect(3) = 9e-101, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VRHKDG TLN ESER ++  CLIAA ERR S GLRLD+C +NR+GLLSD+TRV RE
Sbjct  312  QEYFVRHKDGYTLNTESERHKLALCLIAAIERRISQGLRLDLCAKNRMGLLSDITRVLRE  371

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS-SGRFTK  638
             GLSI+R  +G  GE+A+G+ YV D SG  +   T+E V +EIG +V  VHKS       
Sbjct  372  YGLSISRISLGIHGEKAVGSIYVTDASGHDISQSTVEIVTKEIGESVIAVHKSQKWALQG  431

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            ++S  +  +  RR   E+ +P FSLGSL+W+ LERLS++F
Sbjct  432  SSSRTSQKAAERREEEEEERPRFSLGSLVWSHLERLSSSF  471


 Score = 43.1 bits (100),  Expect(3) = 9e-101, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DES+I YIQQ   A
Sbjct  76    MDVFHVTDQLGNKITDESLILYIQQALCA  104



>gb|KHF99761.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=466

 Score =   213 bits (542),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 124/284 (44%), Positives = 154/284 (54%), Gaps = 77/284 (27%)
 Frame = -1

Query  1799  CSDGGWLMD--------G*SPLSIFVSLFMWD--CSNCMFASIPRDRPTGIQNCR*KHHP  1650
             CSDGGWLMD        G       ++L++    C   M   +P++    +Q C+     
Sbjct  69    CSDGGWLMDVFHVRDQLGKKITDETLNLYIQQELCDTKMRGGVPKE----LQTCQ-----  119

Query  1649  LHPAGLCSHF*LPPAQLSSVDLTTIIFIGRDVRPRYVLTEHTALEMTGTDRPGLMSEISA  1470
                                          R +RP ++ TEHTALE+TG DRPGLMS+ISA
Sbjct  120   ----------------------------KRKLRPCHISTEHTALEITGRDRPGLMSDISA  151

Query  1469  VLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNG  1290
              L E+GCHI  AVAWTHN R ACI+ VED  K GPI    R+A +Q +LE+VVE HH N 
Sbjct  152   ALYELGCHIMTAVAWTHNGRMACIIQVEDGLKGGPIMVQKRLALVQEKLESVVEGHHENR  211

Query  1289  ERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC------CPVW----------------  1176
             +++SV L+ PAA RTHTERRLHQ+M A++DYE C      C  W                
Sbjct  212   DKKSVLLTAPAADRTHTERRLHQMMYAEKDYEPCQGCDGSCRCWNGCKKTHVTVETCKEK  271

Query  1175  --------SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                     SRDR KLLFDTVCALTDMQYVVFHA++S   S + Q
Sbjct  272   GYSVVNVRSRDRNKLLFDTVCALTDMQYVVFHAAVSLKGSMANQ  315


 Score =   179 bits (454),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R +DGC+L  E+E R++ QCL+AA ERR SHGLRLDICT+N++GLL  +TRVFRE
Sbjct  315  QEYFIRRQDGCSLASETESRKLAQCLVAAIERRVSHGLRLDICTENKMGLLWYLTRVFRE  374

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITR EIGT GERA G FYV D SG   +P T+E VRQ+IGG+V VV+KS     + 
Sbjct  375  NGLSITRTEIGTHGERASGCFYVTDASGNDANPRTVELVRQQIGGSVFVVNKSPNSSLRI  434

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + S             + +P FSLG+LLW+QLERL+ +F
Sbjct  435  SRSNGEM---------EDRPRFSLGNLLWSQLERLTFSF  464



>ref|XP_010936169.1| PREDICTED: uncharacterized protein LOC105055860 isoform X2 [Elaeis 
guineensis]
Length=569

 Score =   190 bits (483),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCT-LNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
             QEYY+RH DGCT L+ ESER+RVT+CL+AA ERR SHGLRLD+CT+NR GLLSDVTR F
Sbjct  404  IQEYYIRHMDGCTILDTESERQRVTRCLVAAVERRVSHGLRLDLCTRNRQGLLSDVTRAF  463

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLS+TRAE  T+GE A+GTFYV D  G  VDPE +E+VR+E+GG+  +  K +  + 
Sbjct  464  RENGLSLTRAECTTRGETAVGTFYVTDAHGGEVDPERMEAVRREVGGSFNLEIKENPGWP  523

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +S + +   R ++ E+ +P FSLGSLLW+++ER S+NF
Sbjct  524  PVKTSKDPSPSRRNNNPEEDRPKFSLGSLLWSRIERFSSNF  564


 Score =   181 bits (460),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 122/215 (57%), Gaps = 48/215 (22%)
 Frame = -1

Query  1568  IGRDVRPRYVL-TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             +G+ V P + L +EHTALE+T TDRPGL+SEISAVL E+ CH+    AWTHN RAACI Y
Sbjct  191   LGKLVGPGHQLASEHTALELTATDRPGLLSEISAVLTELACHVVGVHAWTHNERAACIAY  250

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             V D +    ITD  R+A IQ Q+++VV AH   GERR VR+  P   R HTERRLHQLM 
Sbjct  251   VADRATGRAITDTARLAHIQDQVDSVVGAHQGPGERRWVRMFGPFPGRVHTERRLHQLMR  310

Query  1211  ADRDYE-----------------------------------------------QCCPVWS  1173
              DRDYE                                                   + S
Sbjct  311   EDRDYEAGPPPPPADADQFAAANIEVRRNGWPSSSSMGMETRASIDSWMERGYSVVNIRS  370

Query  1172  RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             RDRP+LLFDTVC LTDMQY+VFHA++SSH   ++Q
Sbjct  371   RDRPRLLFDTVCTLTDMQYLVFHAAVSSHGPLAIQ  405


 Score = 39.7 bits (91),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTD LG K+ D +++ YIQQ  VA
Sbjct  149   MDVFHVTDHLGSKLTDPTLVRYIQQSLVA  177



>ref|XP_010936168.1| PREDICTED: uncharacterized protein LOC105055860 isoform X1 [Elaeis 
guineensis]
Length=588

 Score =   190 bits (482),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCT-LNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
             QEYY+RH DGCT L+ ESER+RVT+CL+AA ERR SHGLRLD+CT+NR GLLSDVTR F
Sbjct  423  IQEYYIRHMDGCTILDTESERQRVTRCLVAAVERRVSHGLRLDLCTRNRQGLLSDVTRAF  482

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLS+TRAE  T+GE A+GTFYV D  G  VDPE +E+VR+E+GG+  +  K +  + 
Sbjct  483  RENGLSLTRAECTTRGETAVGTFYVTDAHGGEVDPERMEAVRREVGGSFNLEIKENPGWP  542

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +S + +   R ++ E+ +P FSLGSLLW+++ER S+NF
Sbjct  543  PVKTSKDPSPSRRNNNPEEDRPKFSLGSLLWSRIERFSSNF  583


 Score =   181 bits (460),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 122/215 (57%), Gaps = 48/215 (22%)
 Frame = -1

Query  1568  IGRDVRPRYVL-TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             +G+ V P + L +EHTALE+T TDRPGL+SEISAVL E+ CH+    AWTHN RAACI Y
Sbjct  210   LGKLVGPGHQLASEHTALELTATDRPGLLSEISAVLTELACHVVGVHAWTHNERAACIAY  269

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             V D +    ITD  R+A IQ Q+++VV AH   GERR VR+  P   R HTERRLHQLM 
Sbjct  270   VADRATGRAITDTARLAHIQDQVDSVVGAHQGPGERRWVRMFGPFPGRVHTERRLHQLMR  329

Query  1211  ADRDYE-----------------------------------------------QCCPVWS  1173
              DRDYE                                                   + S
Sbjct  330   EDRDYEAGPPPPPADADQFAAANIEVRRNGWPSSSSMGMETRASIDSWMERGYSVVNIRS  389

Query  1172  RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             RDRP+LLFDTVC LTDMQY+VFHA++SSH   ++Q
Sbjct  390   RDRPRLLFDTVCTLTDMQYLVFHAAVSSHGPLAIQ  424


 Score = 39.7 bits (91),  Expect(3) = 1e-98, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTD LG K+ D +++ YIQQ  VA
Sbjct  168   MDVFHVTDHLGSKLTDPTLVRYIQQSLVA  196



>ref|XP_010936170.1| PREDICTED: uncharacterized protein LOC105055860 isoform X3 [Elaeis 
guineensis]
Length=501

 Score =   190 bits (483),  Expect(3) = 2e-98, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCT-LNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
             QEYY+RH DGCT L+ ESER+RVT+CL+AA ERR SHGLRLD+CT+NR GLLSDVTR F
Sbjct  336  IQEYYIRHMDGCTILDTESERQRVTRCLVAAVERRVSHGLRLDLCTRNRQGLLSDVTRAF  395

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLS+TRAE  T+GE A+GTFYV D  G  VDPE +E+VR+E+GG+  +  K +  + 
Sbjct  396  RENGLSLTRAECTTRGETAVGTFYVTDAHGGEVDPERMEAVRREVGGSFNLEIKENPGWP  455

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +S + +   R ++ E+ +P FSLGSLLW+++ER S+NF
Sbjct  456  PVKTSKDPSPSRRNNNPEEDRPKFSLGSLLWSRIERFSSNF  496


 Score =   181 bits (459),  Expect(3) = 2e-98, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 122/215 (57%), Gaps = 48/215 (22%)
 Frame = -1

Query  1568  IGRDVRPRYVL-TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             +G+ V P + L +EHTALE+T TDRPGL+SEISAVL E+ CH+    AWTHN RAACI Y
Sbjct  123   LGKLVGPGHQLASEHTALELTATDRPGLLSEISAVLTELACHVVGVHAWTHNERAACIAY  182

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             V D +    ITD  R+A IQ Q+++VV AH   GERR VR+  P   R HTERRLHQLM 
Sbjct  183   VADRATGRAITDTARLAHIQDQVDSVVGAHQGPGERRWVRMFGPFPGRVHTERRLHQLMR  242

Query  1211  ADRDYE-----------------------------------------------QCCPVWS  1173
              DRDYE                                                   + S
Sbjct  243   EDRDYEAGPPPPPADADQFAAANIEVRRNGWPSSSSMGMETRASIDSWMERGYSVVNIRS  302

Query  1172  RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             RDRP+LLFDTVC LTDMQY+VFHA++SSH   ++Q
Sbjct  303   RDRPRLLFDTVCTLTDMQYLVFHAAVSSHGPLAIQ  337


 Score = 39.3 bits (90),  Expect(3) = 2e-98, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTD LG K+ D +++ YIQQ  VA
Sbjct  81    MDVFHVTDHLGSKLTDPTLVRYIQQSLVA  109



>ref|XP_008440421.1| PREDICTED: uncharacterized protein LOC103484871 [Cucumis melo]
Length=476

 Score =   196 bits (498),  Expect(4) = 1e-97, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 127/186 (68%), Gaps = 30/186 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA E+TG DRPGL+SEI AVL E+GC+++AAVAWTH+ +AA I+Y+E+    G I D
Sbjct  128   SEHTAAEITGIDRPGLLSEIFAVLVELGCNVTAAVAWTHHKKAASIIYMEEGWNGGMIKD  187

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R+A +Q QLENVV+AH+  GE  SV+L+ P+A +TH ERRLHQLM A+ DYEQC    
Sbjct  188   PKRLAHVQEQLENVVDAHNGQGETSSVKLTAPSAGQTHPERRLHQLMYANGDYEQCRCHE  247

Query  1187  ----CP----------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                 C                       + SRDRPKLLFDT+CALTD+QYVVFHA++SS+
Sbjct  248   GSKPCKMSCTHTHVRIESCKEKGYSIINIKSRDRPKLLFDTICALTDLQYVVFHAAVSSN  307

Query  1085  DSTSVQ  1068
              + + Q
Sbjct  308   GTVADQ  313


 Score =   165 bits (417),  Expect(4) = 1e-97, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 113/161 (70%), Gaps = 4/161 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHK GC L+ E+ER+R+ Q L+AA ERR SHGLRL++C  +R+GLLSD+TRVFRE
Sbjct  313  QEYFIRHKGGCILDSENERKRLLQALVAAIERRVSHGLRLELCALDRVGLLSDITRVFRE  372

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSG--QSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            NG SI+  ++GT G+ AIG+ ++ D SG  + VDP  L+ V +EIGG++ VV        
Sbjct  373  NGFSISTIDVGTNGKTAIGSIFITDASGHDKDVDPHILDLVLKEIGGSIAVVQGPPNWDD  432

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +A+SS  +         +  KP FSLG+LLW+QLERLS NF
Sbjct  433  RASSSRANHGTKVTEVED--KPRFSLGNLLWSQLERLSTNF  471


 Score = 43.5 bits (101),  Expect(4) = 1e-97, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQ G K+ DES+IHYI+Q   A
Sbjct  78    MDVFHVTDQFGNKLTDESLIHYIKQALCA  106


 Score = 24.3 bits (51),  Expect(4) = 1e-97, Method: Compositional matrix adjust.
 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGWLMD
Sbjct  72    SDGGWLMD  79



>emb|CBI35746.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   203 bits (516),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 117/165 (71%), Gaps = 25/165 (15%)
 Frame = -1

Query  1487  MSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRVAQIQAQLENVVE  1308
             MSEISAVLAE+ CH++AAVAWTHN+R ACI+ +ED+ K GPI DP R+  ++ QLENVVE
Sbjct  1     MSEISAVLAELSCHVTAAVAWTHNSRVACIICLEDELKGGPIRDPERLVHVEEQLENVVE  60

Query  1307  AHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCP------------------  1182
             A H +GERR VRL+ P A RTHT+RRLHQLM AD+DYE+CC                   
Sbjct  61    ARHQSGERRKVRLTAPVAGRTHTDRRLHQLMFADKDYERCCGGCDGSSDRIQVSIENCKE  120

Query  1181  -------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                    V SRDRPKLLFDTVC LTDMQYVVFHA++SS  S +VQ
Sbjct  121   KGYSVVNVKSRDRPKLLFDTVCTLTDMQYVVFHAAVSSKGSIAVQ  165


 Score =   181 bits (460),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R  DGCTL  ESER RV QCLIAA ERR +HGLRLDI  +NRLGLLSD+TRVFRE
Sbjct  165  QEYFIRQMDGCTLGTESERNRVAQCLIAAIERRVTHGLRLDIRIKNRLGLLSDITRVFRE  224

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSI  AEIG  GERA G+FYV D SG+ V P T+E +R+EIGGT+  V+KSS      
Sbjct  225  NGLSIRMAEIGIHGERASGSFYVTDVSGRDVSPNTVELIRKEIGGTIMAVNKSS---VPP  281

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +   + +     +S  + +P FSLG+ LW+Q+ER S+NF
Sbjct  282  SLPASPSRDRSTASSVENRPRFSLGT-LWSQIERFSSNF  319



>ref|XP_004163340.1| PREDICTED: uncharacterized protein LOC101229243 [Cucumis sativus]
Length=476

 Score =   192 bits (489),  Expect(3) = 3e-96, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 124/185 (67%), Gaps = 30/185 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA E+TG DRPGL+SEI AVL E+GC+++AAVAWTH+ +AA I+Y+E+    G I D 
Sbjct  129   EHTAAEITGIDRPGLLSEIFAVLVELGCNVTAAVAWTHHKKAASIIYIEEGWNGGMIKDS  188

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A +Q QLENVV+AH+  GE  SV+L+ P+A  TH ERRLHQLM A+ DYEQC     
Sbjct  189   KRLAHVQEQLENVVDAHNGQGETSSVKLTAPSAGWTHPERRLHQLMYANGDYEQCRCHDD  248

Query  1187  ---CP----------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                C                       + SRDRPKLLFDTVCALTD+QYVVFHA++SS+ 
Sbjct  249   SKSCKMSCTRTHVKIESCKEKGYSIINIRSRDRPKLLFDTVCALTDLQYVVFHAAVSSNG  308

Query  1082  STSVQ  1068
             + + Q
Sbjct  309   TVAYQ  313


 Score =   167 bits (422),  Expect(3) = 3e-96, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 4/162 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++R K GC L+ ESER+R+ Q L+AA ERR SHGLRL++C  NR+GLLSD+TRVFR
Sbjct  312  YQEYFIRQKGGCILDSESERKRLLQALVAAIERRVSHGLRLELCALNRVGLLSDITRVFR  371

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQ--SVDPETLESVRQEIGGTVKVVHKSSGRF  644
            ENG SI+  ++ T G+RAIG+ ++ D SG    VDP  L+ V +EIGG++ VV   S ++
Sbjct  372  ENGFSISTMDVKTNGKRAIGSIFITDASGHDVDVDPHILDLVLKEIGGSIAVVQGPS-KW  430

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               TSS  +   ++ +  ED KP FSLG+LLW+QLERLS NF
Sbjct  431  DDRTSSSRANHGTKVARVED-KPRFSLGNLLWSQLERLSTNF  471


 Score = 43.5 bits (101),  Expect(3) = 3e-96, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQ G K+ DES+IHYI+Q   A
Sbjct  78    MDVFHVTDQFGNKLTDESLIHYIKQALCA  106



>ref|XP_006573669.1| PREDICTED: uncharacterized protein LOC100781435 isoform X1 [Glycine 
max]
 ref|XP_006573670.1| PREDICTED: uncharacterized protein LOC100781435 isoform X2 [Glycine 
max]
Length=480

 Score =   201 bits (510),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 126/190 (66%), Gaps = 32/190 (17%)
 Frame = -1

Query  1541  VLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI  1362
             V  E+TALEM+ TDRPGL+SE+SAVL E+GC +++A+AWTHN R ACI+++ED S  GPI
Sbjct  130   VPKENTALEMSVTDRPGLLSELSAVLVELGCSVTSAMAWTHNDRVACIIFLEDASSPGPI  189

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--  1188
             +DP R+  ++ QLENVV AH   G+++SVR++     RTHTERRLHQLM ADRDYE C  
Sbjct  190   SDPERLGLVEEQLENVVAAHGETGQKKSVRVTTLGTGRTHTERRLHQLMYADRDYESCRA  249

Query  1187  ----------------------CP--------VWSRDRPKLLFDTVCALTDMQYVVFHAS  1098
                                   C         V SRDRPKLLFDTVC LTDMQYVVFHA+
Sbjct  250   CDGDSSGEHKKGCDGTHVSVGRCEDKGYLVVNVRSRDRPKLLFDTVCVLTDMQYVVFHAA  309

Query  1097  ISSHDSTSVQ  1068
             ISS  S + Q
Sbjct  310   ISSKRSMAHQ  319


 Score =   163 bits (412),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 6/161 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRR--VTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
            QEY++R+  G +L L SER +  +T CLIAA ERR SHGL +DI T NR+GLLS+VTRVF
Sbjct  319  QEYFIRNCKG-SLALPSEREKEELTLCLIAAIERRVSHGLMVDIRTDNRMGLLSNVTRVF  377

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLSI+R EIGT+GE+A+G+F+V D+SG+ V+P+ +E VRQ  GG+V   HKS  R  
Sbjct  378  RENGLSISRFEIGTEGEKAVGSFFVTDSSGEEVNPDIVELVRQASGGSVVTDHKSPHRVH  437

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +++SS +           + KP FSLGSLLW++LERLS  F
Sbjct  438  QSSSSSDINETMGSM---EPKPKFSLGSLLWSRLERLSGGF  475


 Score = 37.7 bits (86),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1714  CLPVFHVTDQLGYKIVDESIIHYIQQ  1637
             C+ VFHVTD+ G K+ DE+++ +IQQ
Sbjct  75    CMDVFHVTDEAGKKLTDETLMLHIQQ  100


 Score = 22.3 bits (46),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWCMD  77



>gb|KHN36315.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=480

 Score =   201 bits (510),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 126/190 (66%), Gaps = 32/190 (17%)
 Frame = -1

Query  1541  VLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI  1362
             V  E+TALEM+ TDRPGL+SE+SAVL E+GC +++A+AWTHN R ACI+++ED S  GPI
Sbjct  130   VPKENTALEMSVTDRPGLLSELSAVLVELGCSVTSAMAWTHNDRVACIIFLEDASSPGPI  189

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--  1188
             +DP R+  ++ QLENVV AH   G+++SVR++     RTHTERRLHQLM ADRDYE C  
Sbjct  190   SDPERLGLVEEQLENVVAAHGETGQKKSVRVTTLGTGRTHTERRLHQLMYADRDYESCRA  249

Query  1187  ----------------------CP--------VWSRDRPKLLFDTVCALTDMQYVVFHAS  1098
                                   C         V SRDRPKLLFDTVC LTDMQYVVFHA+
Sbjct  250   CDGDSSGEHKKGCDGTHVSVGRCEDKGYLVVNVRSRDRPKLLFDTVCVLTDMQYVVFHAA  309

Query  1097  ISSHDSTSVQ  1068
             ISS  S + Q
Sbjct  310   ISSKRSMAHQ  319


 Score =   163 bits (412),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 6/161 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRR--VTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
            QEY++R+  G +L L SER +  +T CLIAA ERR SHGL +DI T NR+GLLS+VTRVF
Sbjct  319  QEYFIRNCKG-SLALPSEREKEELTLCLIAAIERRVSHGLMVDIRTDNRMGLLSNVTRVF  377

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLSI+R EIGT+GE+A+G+F+V D+SG+ V+P+ +E VRQ  GG+V   HKS  R  
Sbjct  378  RENGLSISRFEIGTEGEKAVGSFFVTDSSGEEVNPDIVELVRQASGGSVVTDHKSPHRVH  437

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +++SS +           + KP FSLGSLLW++LERLS  F
Sbjct  438  QSSSSSDINETMGSM---EPKPKFSLGSLLWSRLERLSGGF  475


 Score = 37.7 bits (86),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1714  CLPVFHVTDQLGYKIVDESIIHYIQQ  1637
             C+ VFHVTD+ G K+ DE+++ +IQQ
Sbjct  75    CMDVFHVTDEAGKKLTDETLMLHIQQ  100


 Score = 22.3 bits (46),  Expect(4) = 4e-96, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWCMD  77



>ref|XP_004143407.1| PREDICTED: uncharacterized protein LOC101215529 [Cucumis sativus]
Length=476

 Score =   193 bits (490),  Expect(3) = 7e-96, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 124/185 (67%), Gaps = 30/185 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA E+TG DRPGL+SEI AVL E+GC+I+AAVAWTH+ +AA I+Y+E+    G I D 
Sbjct  129   EHTAAEITGIDRPGLLSEIFAVLVELGCNITAAVAWTHHKKAASIIYIEEGWNGGMIKDS  188

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A +Q QLENVV+AH+  GE  SV+L+ P+A  TH ERRLHQLM A+ DYEQC     
Sbjct  189   KRLAHVQEQLENVVDAHNGQGETSSVKLTAPSAGWTHPERRLHQLMYANGDYEQCRCHDD  248

Query  1187  ---CP----------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                C                       + SRDRPKLLFDTVCALTD+QYVVFHA++SS+ 
Sbjct  249   SKSCKMSCTRTHVKIESCKEKGYSIINIRSRDRPKLLFDTVCALTDLQYVVFHAAVSSNG  308

Query  1082  STSVQ  1068
             + + Q
Sbjct  309   TVAYQ  313


 Score =   165 bits (418),  Expect(3) = 7e-96, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 4/162 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++R K GC L+ E ER+R+ Q L+AA ERR SHGLRL++C  NR+GLLSD+TRVFR
Sbjct  312  YQEYFIRQKGGCILDSECERKRLLQALVAAIERRVSHGLRLELCALNRVGLLSDITRVFR  371

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQ--SVDPETLESVRQEIGGTVKVVHKSSGRF  644
            ENG SI+  ++ T G+RAIG+ ++ D SG    VDP  L+ V +EIGG++ VV   S ++
Sbjct  372  ENGFSISTMDVKTNGKRAIGSIFITDASGHDVDVDPHILDLVLKEIGGSIAVVQGPS-KW  430

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               TSS  +   ++ +  ED KP FSLG+LLW+QLERLS NF
Sbjct  431  DDRTSSSRANHGTKVARVED-KPRFSLGNLLWSQLERLSTNF  471


 Score = 43.5 bits (101),  Expect(3) = 7e-96, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQ G K+ DES+IHYI+Q   A
Sbjct  78    MDVFHVTDQFGNKLTDESLIHYIKQALCA  106



>gb|KGN48629.1| hypothetical protein Csa_6G495830 [Cucumis sativus]
Length=600

 Score =   192 bits (489),  Expect(3) = 1e-95, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 124/185 (67%), Gaps = 30/185 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA E+TG DRPGL+SEI AVL E+GC+I+AAVAWTH+ +AA I+Y+E+    G I D 
Sbjct  253   EHTAAEITGIDRPGLLSEIFAVLVELGCNITAAVAWTHHKKAASIIYIEEGWNGGMIKDS  312

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A +Q QLENVV+AH+  GE  SV+L+ P+A  TH ERRLHQLM A+ DYEQC     
Sbjct  313   KRLAHVQEQLENVVDAHNGQGETSSVKLTAPSAGWTHPERRLHQLMYANGDYEQCRCHDD  372

Query  1187  ---CP----------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                C                       + SRDRPKLLFDTVCALTD+QYVVFHA++SS+ 
Sbjct  373   SKSCKMSCTRTHVKIESCKEKGYSIINIRSRDRPKLLFDTVCALTDLQYVVFHAAVSSNG  432

Query  1082  STSVQ  1068
             + + Q
Sbjct  433   TVAYQ  437


 Score =   165 bits (418),  Expect(3) = 1e-95, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 4/162 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++R K GC L+ E ER+R+ Q L+AA ERR SHGLRL++C  NR+GLLSD+TRVFR
Sbjct  436  YQEYFIRQKGGCILDSECERKRLLQALVAAIERRVSHGLRLELCALNRVGLLSDITRVFR  495

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQ--SVDPETLESVRQEIGGTVKVVHKSSGRF  644
            ENG SI+  ++ T G+RAIG+ ++ D SG    VDP  L+ V +EIGG++ VV   S ++
Sbjct  496  ENGFSISTMDVKTNGKRAIGSIFITDASGHDVDVDPHILDLVLKEIGGSIAVVQGPS-KW  554

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               TSS  +   ++ +  ED KP FSLG+LLW+QLERLS NF
Sbjct  555  DDRTSSSRANHGTKVARVED-KPRFSLGNLLWSQLERLSTNF  595


 Score = 43.5 bits (101),  Expect(3) = 1e-95, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQ G K+ DES+IHYI+Q   A
Sbjct  202   MDVFHVTDQFGNKLTDESLIHYIKQALCA  230



>ref|XP_003539257.1| PREDICTED: uncharacterized protein LOC100811109 [Glycine max]
Length=459

 Score =   199 bits (505),  Expect(3) = 6e-95, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 20/186 (11%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             G   + + V  E+TALEM+ TDR GL+SE+SAVL E+G  +++A AWTHN R ACI+++E
Sbjct  122   GAQAQQQNVAMENTALEMSVTDRAGLLSELSAVLVELGYSVTSATAWTHNDRVACIIFLE  181

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D S  GPI+DP R+  ++ QLENVV AH   G++ SVR++     RTHTERRLHQLM AD
Sbjct  182   DASSPGPISDPKRLGLVEEQLENVVAAHGETGQKNSVRVTTLGTGRTHTERRLHQLMYAD  241

Query  1205  RDYEQC--------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
             RDYE C                      V SRDRPKLLFDTVC LTDMQYVVFHA+ISS 
Sbjct  242   RDYESCRACDRTHVSVGRCEDKGYLVVNVRSRDRPKLLFDTVCVLTDMQYVVFHAAISSK  301

Query  1085  DSTSVQ  1068
              S + Q
Sbjct  302   RSMADQ  307


 Score =   162 bits (410),  Expect(3) = 6e-95, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 110/160 (69%), Gaps = 13/160 (8%)
 Frame = -2

Query  994  QEYYVRH-KDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            QEY++RH K    L  ESE   +T CLIAA ERR S GL +DI T+NR+GLLS+VTRVFR
Sbjct  307  QEYFIRHCKGSLALPSESETEELTLCLIAAIERRVSRGLMVDIRTENRMGLLSNVTRVFR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLSI+R EIGT+GE+A+G+F+V D+SG+ V+P  +E VRQ  GG+V   HKS  R  +
Sbjct  367  ENGLSISRFEIGTEGEKAVGSFFVTDSSGEQVNPNIVELVRQASGGSVVTDHKSPHRVRQ  426

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            + S              + KP FSLGSLLW++LERLS  F
Sbjct  427  SQSDI------------EAKPKFSLGSLLWSRLERLSGGF  454


 Score = 38.1 bits (87),  Expect(3) = 6e-95, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1714  CLPVFHVTDQLGYKIVDESIIHYIQQ  1637
             C+ VFHVTD+ G K+ DE+++ +IQQ
Sbjct  75    CMDVFHVTDEAGKKLTDETLMLHIQQ  100



>ref|XP_003611547.1| ACT domain-containing protein [Medicago truncatula]
 gb|AES94505.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=486

 Score =   204 bits (520),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 125/190 (66%), Gaps = 32/190 (17%)
 Frame = -1

Query  1541  VLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI  1362
             V TE+TALEM+G DRPGL+SEISAVL  M C++++A AWTHN R ACI+YVE+ SK GPI
Sbjct  132   VSTENTALEMSGMDRPGLLSEISAVLVNMSCNVTSATAWTHNGRVACILYVEEASKPGPI  191

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--  1188
              DP R+AQ++ QLE+VV AH   GER +VRL + AA RTHTERRLHQLM ADRDYE C  
Sbjct  192   RDPRRLAQVKEQLESVVVAHCEKGERNNVRLRNFAAGRTHTERRLHQLMYADRDYEGCRA  251

Query  1187  ----------------------CP---VW-----SRDRPKLLFDTVCALTDMQYVVFHAS  1098
                                   C     W      RDRPKL FDTVC L DMQYVVFHA+
Sbjct  252   CHGDSSGDHKKGCDGTHVSISRCKDRGYWVVNLVCRDRPKLFFDTVCVLRDMQYVVFHAA  311

Query  1097  ISSHDSTSVQ  1068
             ISS  S + Q
Sbjct  312   ISSKKSIADQ  321


 Score =   159 bits (403),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 118/162 (73%), Gaps = 4/162 (2%)
 Frame = -2

Query  994  QEYYVRHK-DGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            QEYY+RHK +G  L  +SER ++  C+IAA ERR SHGLR+DICT+N+ GLLS VTRV R
Sbjct  321  QEYYIRHKWNGLALRTQSEREKLILCIIAAIERRVSHGLRVDICTENKTGLLSKVTRVIR  380

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVV--HKSSGRF  644
            ENGLSI R EIG +G+  +GTFYV+D SGQ V P  +E +RQE GG+V VV  HK+  + 
Sbjct  381  ENGLSIPRVEIGMRGDDVVGTFYVRDPSGQEVKPNIVELLRQECGGSVDVVTDHKAPRKL  440

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            ++ +SS +S++ S  SS ED  P  S+GS LW+Q+ ++S+N 
Sbjct  441  SRTSSSSSSSTNSENSSIED-TPRLSIGSKLWSQIGKISSNL  481


 Score = 32.7 bits (73),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D +++H I++
Sbjct  76    MDVFHVTDQAGKKLTDRNLMHQIEK  100


 Score = 23.1 bits (48),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWFMD  77



>ref|XP_004511814.1| PREDICTED: uncharacterized protein LOC101513334 isoform X2 [Cicer 
arietinum]
Length=436

 Score =   209 bits (532),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 126/190 (66%), Gaps = 32/190 (17%)
 Frame = -1

Query  1541  VLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI  1362
             V TE TALEM+  DRPGL+SEISAVL E+GC+I +A AWTHN RAACI+YVE+ SK GPI
Sbjct  83    VSTEDTALEMSVMDRPGLLSEISAVLLELGCNIISATAWTHNKRAACILYVEEASKPGPI  142

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--  1188
              DP R+AQ++ QLE+VVEA    GER+SVRL + A  RTHTERRLHQLM ADRDYE C  
Sbjct  143   KDPKRLAQVKEQLESVVEARGDKGERKSVRLRNFADGRTHTERRLHQLMYADRDYEGCHA  202

Query  1187  ------------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHAS  1098
                                             V SRDRPKLLFDTVC L DMQYVVFHA+
Sbjct  203   CHGDSSGEHRNGCDGTHVTISRCEDRGYWVVNVTSRDRPKLLFDTVCVLRDMQYVVFHAA  262

Query  1097  ISSHDSTSVQ  1068
             ISS  S + Q
Sbjct  263   ISSKKSIANQ  272


 Score =   159 bits (401),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -2

Query  994  QEYYVRHK-DGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            QEYY+RHK D   L  ESER+++  C+IAA  RR SHGLR+DICT+N++GLLS VTRV R
Sbjct  272  QEYYIRHKVDSSALRTESERKKLILCIIAAIARRVSHGLRVDICTENKMGLLSKVTRVIR  331

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV--VHKSSGRF  644
            ENGLSI R EIGT+GE  +GTF+V D+SGQ V+P   E +RQE GG+V V   HK S   
Sbjct  332  ENGLSIPRVEIGTRGENVVGTFFVTDSSGQEVNPNIAELLRQECGGSVDVDIDHKMSPHI  391

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +SS  S S +     +  +P  S+G++LW+ + R+S+NF
Sbjct  392  LSRSSSSLSISENSNIVED--RPRLSIGNMLWSHIGRISSNF  431


 Score = 28.5 bits (62),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D +++  I++
Sbjct  25    MDVFHVTDQAGKKLTDNNLMLQIEK  49


 Score = 23.1 bits (48),  Expect(4) = 7e-95, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  19    SDGGWFMD  26



>ref|XP_004511813.1| PREDICTED: uncharacterized protein LOC101513334 isoform X1 [Cicer 
arietinum]
Length=489

 Score =   208 bits (530),  Expect(4) = 1e-94, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 126/190 (66%), Gaps = 32/190 (17%)
 Frame = -1

Query  1541  VLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI  1362
             V TE TALEM+  DRPGL+SEISAVL E+GC+I +A AWTHN RAACI+YVE+ SK GPI
Sbjct  136   VSTEDTALEMSVMDRPGLLSEISAVLLELGCNIISATAWTHNKRAACILYVEEASKPGPI  195

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--  1188
              DP R+AQ++ QLE+VVEA    GER+SVRL + A  RTHTERRLHQLM ADRDYE C  
Sbjct  196   KDPKRLAQVKEQLESVVEARGDKGERKSVRLRNFADGRTHTERRLHQLMYADRDYEGCHA  255

Query  1187  ------------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHAS  1098
                                             V SRDRPKLLFDTVC L DMQYVVFHA+
Sbjct  256   CHGDSSGEHRNGCDGTHVTISRCEDRGYWVVNVTSRDRPKLLFDTVCVLRDMQYVVFHAA  315

Query  1097  ISSHDSTSVQ  1068
             ISS  S + Q
Sbjct  316   ISSKKSIANQ  325


 Score =   159 bits (402),  Expect(4) = 1e-94, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -2

Query  994  QEYYVRHK-DGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            QEYY+RHK D   L  ESER+++  C+IAA  RR SHGLR+DICT+N++GLLS VTRV R
Sbjct  325  QEYYIRHKVDSSALRTESERKKLILCIIAAIARRVSHGLRVDICTENKMGLLSKVTRVIR  384

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV--VHKSSGRF  644
            ENGLSI R EIGT+GE  +GTF+V D+SGQ V+P   E +RQE GG+V V   HK S   
Sbjct  385  ENGLSIPRVEIGTRGENVVGTFFVTDSSGQEVNPNIAELLRQECGGSVDVDIDHKMSPHI  444

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +SS  S S +     +  +P  S+G++LW+ + R+S+NF
Sbjct  445  LSRSSSSLSISENSNIVED--RPRLSIGNMLWSHIGRISSNF  484


 Score = 28.5 bits (62),  Expect(4) = 1e-94, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D +++  I++
Sbjct  78    MDVFHVTDQAGKKLTDNNLMLQIEK  102


 Score = 23.1 bits (48),  Expect(4) = 1e-94, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  72    SDGGWFMD  79



>ref|XP_008790256.1| PREDICTED: uncharacterized protein LOC103707514 isoform X1 [Phoenix 
dactylifera]
Length=509

 Score =   188 bits (478),  Expect(3) = 1e-92, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCT-LNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVF  821
             QEYY+RH DGCT L+ ESER+RVT+CL+AA ERR SHGLRLD+CT+NR GLLSDVTRV 
Sbjct  344  LQEYYIRHMDGCTILDTESERQRVTRCLVAAVERRVSHGLRLDLCTRNRPGLLSDVTRVL  403

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLS+TRAE  T+GE A+GTFYV D  G  VDPE + +VR+EIGG+V +  K +  + 
Sbjct  404  RENGLSLTRAECATRGETAVGTFYVTDAYGGGVDPERMVAVRREIGGSVSLEIKENPGWP  463

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                S + + + R  S E+ +P  SLGSLLW+++ERLS+NF
Sbjct  464  PIKKSKDPSPKRRNRSLEEDRPKVSLGSLLWSRIERLSSNF  504


 Score =   168 bits (425),  Expect(3) = 1e-92, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 118/215 (55%), Gaps = 48/215 (22%)
 Frame = -1

Query  1568  IGRDVRPRYVL-TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             +G+ V P + L +EHTALE+T  DRPGL+SEISAV+  + C++ A   WTH  RAACI Y
Sbjct  131   LGKLVGPGHRLASEHTALELTAADRPGLLSEISAVVTALACYVVAVHVWTHKQRAACIAY  190

Query  1391  VEDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMA  1212
             V D S    ITD  R+A IQ Q+++VV AH    ERR VR+  P   R HTERRLHQLM 
Sbjct  191   VADRSTGRAITDAARLAHIQDQVDSVVWAHQGPCERRWVRVFGPFPGRVHTERRLHQLMR  250

Query  1211  ADRDYE-----------------------------------------------QCCPVWS  1173
              DRDYE                                                   V S
Sbjct  251   EDRDYEAGPPPPPAEADQFAAANIEVRRNGWLPSSSMGMETRVSIDSWMERGYSVVNVRS  310

Query  1172  RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             RDRPKLLFDTVC LTDMQY+VFHA++SSH   ++Q
Sbjct  311   RDRPKLLFDTVCTLTDMQYLVFHAAVSSHGPLALQ  345


 Score = 34.7 bits (78),  Expect(3) = 1e-92, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCV  1628
             + VFHVTD LG K+ + ++I YIQ+  V
Sbjct  89    MDVFHVTDHLGRKLAEPTLIRYIQKSLV  116



>ref|XP_007156695.1| hypothetical protein PHAVU_002G009500g [Phaseolus vulgaris]
 gb|ESW28689.1| hypothetical protein PHAVU_002G009500g [Phaseolus vulgaris]
Length=479

 Score =   191 bits (486),  Expect(3) = 6e-92, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 118/185 (64%), Gaps = 34/185 (18%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TA+EM+G DR GL+SE+S +L E+GC ++AA AWTHN R ACI+ VED+SK GPI+DP R
Sbjct  133   TAMEMSGMDRTGLLSELSGMLVELGCIVTAATAWTHNDRVACIILVEDESKGGPISDPKR  192

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             +  ++ QLENVV AH   GER+ VR++   A  TH ERRLHQLM ADRDYE C       
Sbjct  193   LGLVEEQLENVVAAHR--GERKRVRVTRLGAGHTHRERRLHQLMYADRDYESCRACDGDS  250

Query  1187  -------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                                        V SRDRPKLLFDTVC LTDMQYVVFHA+ISS  
Sbjct  251   SGEHKKECDGTHVSVGRCEDKGYLMVNVRSRDRPKLLFDTVCVLTDMQYVVFHAAISSKR  310

Query  1082  STSVQ  1068
             S + Q
Sbjct  311   SMANQ  315


 Score =   163 bits (412),  Expect(3) = 6e-92, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCT-LNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            QEYY+RH  G      ESE++++T CLIAA ERR SHGLR+DI T+NR GLLS+VTRV R
Sbjct  315  QEYYIRHSMGSAGFPSESEKQKLTLCLIAAVERRVSHGLRVDILTENRKGLLSNVTRVLR  374

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLSI+R EI T+G +A G+F+V+D SG+ V+P  +E V+QE GG+V + HKS  R  +
Sbjct  375  ENGLSISRVEIETEGGKAEGSFFVRDCSGEEVNPNIVELVKQETGGSVVIDHKSPHRLHQ  434

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            ++SS +S+  ++     + K  FSLGSLLW++LERLS+ F
Sbjct  435  SSSSSSSSVINQSKDTVEAKQKFSLGSLLWSRLERLSSGF  474


 Score = 34.3 bits (77),  Expect(3) = 6e-92, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+ G K+ DE+++ +IQQ
Sbjct  76    MDVFHVTDEAGKKLTDETLMLHIQQ  100



>ref|XP_006280393.1| hypothetical protein CARUB_v10026320mg [Capsella rubella]
 gb|EOA13291.1| hypothetical protein CARUB_v10026320mg [Capsella rubella]
Length=480

 Score =   181 bits (460),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 124/204 (61%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TGT+RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAFEITGTNRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGER-----RSVRLSDPAASRTHTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+      R V          HTERRLH+L
Sbjct  181   GFNGGPIIDPMRKAQVKDHLDTVMEAHHRVGDESRVVVRIVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC--CPVWS--------------------------------RDRPKLLFDTV  1140
             M A+ DYE C  C  +S                                RDRPKLLFDTV
Sbjct  241   MYAEGDYESCFDCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVNVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGAKGSTAEQ  324


 Score =   152 bits (384),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS GL+L+I TQN++GLLSDVTRV RE
Sbjct  324  QEYFIRKKNGCTLETEVQRERLRHCLVAAISRRASRGLKLEIRTQNKMGLLSDVTRVVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   DP  +E+V +E+GG V    K+ G  +  
Sbjct  384  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETDPNAVEAVVRELGGAVVSAVKAVGMMS--  441

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                     +  S  +  K   S+G + W++LERLS + R
Sbjct  442  ---MRMGGSTSASVEQQDKAKSSIGRMFWSKLERLSTSIR  478


 Score = 40.0 bits (92),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>gb|ADE76039.1| unknown [Picea sitchensis]
Length=454

 Score =   172 bits (435),  Expect(3) = 1e-86, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 123/192 (64%), Gaps = 30/192 (16%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR V  + +  EHTA+E+TGTDRPGL+SEISAVL  + C++ AA  WTHN R AC+VYV
Sbjct  117   LGRTVGVQSI-GEHTAIELTGTDRPGLLSEISAVLTNLKCNVVAAEVWTHNMRVACVVYV  175

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
              D+S   PI +P ++A I+ QL NV++    N +RR V+ +D +   THTERRLHQ+M A
Sbjct  176   TDESTSRPIEEPEQLAAIKEQLSNVLKG---NDDRRGVK-TDFSMGLTHTERRLHQMMFA  231

Query  1208  DRDYE-----------------QCC--------PVWSRDRPKLLFDTVCALTDMQYVVFH  1104
             DRDYE                 + C         V  +DRPKLLFDTVC LTDMQYVV H
Sbjct  232   DRDYEGPDTRSLGENGRPIIKIENCNEKGYSVVTVHCKDRPKLLFDTVCTLTDMQYVVLH  291

Query  1103  ASISSHDSTSVQ  1068
             A+I+S  + ++Q
Sbjct  292   ATITSSGTYALQ  303


 Score =   159 bits (402),  Expect(3) = 1e-86, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 109/162 (67%), Gaps = 16/162 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RH DGCTL+ E E++RV +CL AA ERR S G+RL++CT +R+GLLSD+TR+FR
Sbjct  302  LQEYYIRHMDGCTLDTEGEKQRVIKCLEAAIERRVSEGVRLELCTSDRVGLLSDITRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVH--KSSGRF  644
            ENGLS+TRA++ T+ ++A+  FYV DTSG  VD + +E++R+EIG T+  V    SS R 
Sbjct  362  ENGLSVTRADVTTRADKAVNVFYVTDTSGNPVDMKIVEAMRREIGHTILQVKSIPSSPRP  421

Query  643  TKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                +                K  FS GSLL +QLERLS NF
Sbjct  422  CPTDTG--------------DKAKFSFGSLLKSQLERLSYNF  449


 Score = 40.0 bits (92),  Expect(3) = 1e-86, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ D+ II YIQQ
Sbjct  76    MDVFHVTDQLGNKLTDQRIIDYIQQ  100



>ref|XP_010444612.1| PREDICTED: uncharacterized protein LOC104727252 isoform X2 [Camelina 
sativa]
Length=427

 Score =   181 bits (458),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 123/204 (60%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  69    REVQQRHVCTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  128

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGER-----RSVRLSDPAASRTHTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+      R V          HTERRLH+L
Sbjct  129   GFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDESRVVVRIVEAKGAPVGWAHTERRLHEL  188

Query  1217  MAADRDYEQC--CPVWS--------------------------------RDRPKLLFDTV  1140
             M A+ DYE C  C  +S                                RDRPKLLFDTV
Sbjct  189   MYAEGDYESCSDCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVNVKCRDRPKLLFDTV  248

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  249   CALKELQFVVFHAVAGAKGSTAEQ  272


 Score =   145 bits (367),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLS+VTRV RE
Sbjct  272  QEYFIRKKNGCTLETEVQRERLRHCLVAAISRRASRGLKLEIRTENKMGLLSEVTRVVRE  331

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   DP  +E+V +E+GG V    K+ G     
Sbjct  332  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETDPNAVEAVVRELGGAVVSAVKAVGMMPMR  391

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              S + +   R       K   S+G ++W++LERLS++ +
Sbjct  392  MGSTSDSVELR------DKTKSSIGRMIWSKLERLSSSIK  425


 Score = 40.0 bits (92),  Expect(3) = 3e-85, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  25    MDVFHVTDQLGNKLTDRSLILYIQQAIC  52



>ref|XP_010444610.1| PREDICTED: uncharacterized protein LOC104727252 isoform X1 [Camelina 
sativa]
 ref|XP_010444611.1| PREDICTED: uncharacterized protein LOC104727252 isoform X1 [Camelina 
sativa]
Length=479

 Score =   180 bits (456),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 123/204 (60%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVCTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGER-----RSVRLSDPAASRTHTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+      R V          HTERRLH+L
Sbjct  181   GFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDESRVVVRIVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC--CPVWS--------------------------------RDRPKLLFDTV  1140
             M A+ DYE C  C  +S                                RDRPKLLFDTV
Sbjct  241   MYAEGDYESCSDCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVNVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGAKGSTAEQ  324


 Score =   146 bits (368),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLS+VTRV RE
Sbjct  324  QEYFIRKKNGCTLETEVQRERLRHCLVAAISRRASRGLKLEIRTENKMGLLSEVTRVVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   DP  +E+V +E+GG V    K+ G     
Sbjct  384  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETDPNAVEAVVRELGGAVVSAVKAVGMMPMR  443

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              S + +   R       K   S+G ++W++LERLS++ +
Sbjct  444  MGSTSDSVELR------DKTKSSIGRMIWSKLERLSSSIK  477


 Score = 39.7 bits (91),  Expect(3) = 5e-85, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|XP_010484442.1| PREDICTED: uncharacterized protein LOC104762778 [Camelina sativa]
 ref|XP_010484443.1| PREDICTED: uncharacterized protein LOC104762778 [Camelina sativa]
Length=480

 Score =   178 bits (451),  Expect(3) = 7e-85, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 128/206 (62%), Gaps = 39/206 (19%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+
Sbjct  119   LKREVQQRHVCTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYL  178

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGE--RRSVRLSDPAASRT---HTERRLH  1224
             +D    GPI DP R AQ++  L+ V+EAHH  G+  R  VR+ +   +     HTERRLH
Sbjct  179   DDGFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDESRVVVRIVEAKGAPVEWDHTERRLH  238

Query  1223  QLMAADRDYEQC--CPVWS--------------------------------RDRPKLLFD  1146
             +LM A+ DYE C  C  +S                                RDRPKLLFD
Sbjct  239   ELMYAEGDYENCSDCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVNVKCRDRPKLLFD  298

Query  1145  TVCALTDMQYVVFHASISSHDSTSVQ  1068
             TVCAL ++Q+VVFHA   +  ST+ Q
Sbjct  299   TVCALKELQFVVFHAVAGAKGSTAEQ  324


 Score =   147 bits (371),  Expect(3) = 7e-85, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  324  QEYFIRKKNGCTLETEVQRERLRHCLVAAISRRASRGLKLEIRTENKMGLLSDVTRVVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   DP  +E+V +E+GG V    K+ G     
Sbjct  384  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETDPNAVEAVVRELGGAVVSAVKAVGMMPMR  443

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              S +  S   R      K   S+G + W++LERLS++ +
Sbjct  444  MGSTSDNSVELR-----DKTKSSIGRMFWSKLERLSSSIK  478


 Score = 39.7 bits (91),  Expect(3) = 7e-85, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|XP_010559220.1| PREDICTED: uncharacterized protein LOC104827695 [Tarenaya hassleriana]
 ref|XP_010559226.1| PREDICTED: uncharacterized protein LOC104827695 [Tarenaya hassleriana]
Length=475

 Score =   175 bits (443),  Expect(4) = 2e-84, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 125/191 (65%), Gaps = 33/191 (17%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             + R+ + R+V T+HTA E+TGTDRPGL+SEISA L+++GCH++AA+AWTH+ RAA ++YV
Sbjct  120   LNREAQQRHVSTQHTAFEITGTDRPGLLSEISAALSDLGCHVTAAMAWTHHDRAAMVIYV  179

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPA---ASRTHTERRLHQL  1218
             E+    G I    ++  ++ QLENVVEAHH  GE R+V++  P    A  THTERRLHQ+
Sbjct  180   EEGIGGGGIN---QLGLVKEQLENVVEAHHAEGETRTVKVVAPPGALAGWTHTERRLHQI  236

Query  1217  MAADRDYEQC-------------------CP--------VWSRDRPKLLFDTVCALTDMQ  1119
             M  DRDYE+C                   C         V  RDRPKLLFDTVCA T++ 
Sbjct  237   MHGDRDYEKCRGCDRRGCGCGKVHVAGEACKEKGYSMVNVRCRDRPKLLFDTVCAFTELN  296

Query  1118  YVVFHASISSH  1086
             YVVFHA++ S+
Sbjct  297   YVVFHAAVGSN  307


 Score =   146 bits (368),  Expect(4) = 2e-84, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+G TL+ ESER+R+ QCLIAA ERR S G+ L + T++R+G++SD+TR  RE
Sbjct  313  QEYFIRQKNGSTLDTESERQRLMQCLIAAIERRTSRGVELKVRTKDRMGVISDITRAVRE  372

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHKSSGRFTK  638
            NGLSITRAE  T GE  +G+  V D +GQ  D + ++S+ Q++GG+V     KS   +T 
Sbjct  373  NGLSITRAEFNTGGETTVGSIQVVDMTGQDADSKAVKSLIQQLGGSVMPAATKSLAGWTM  432

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
              +S +    S  +  E  K  FS+GSLLW+QLERLS NF
Sbjct  433  KMASSSGVGNSEVNRQEKAK--FSIGSLLWSQLERLSGNF  470


 Score = 40.8 bits (94),  Expect(4) = 2e-84, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG K+ D S+I YIQQ   A
Sbjct  78    MDVFHVTDQLGNKLTDRSLILYIQQAICA  106


 Score = 23.1 bits (48),  Expect(4) = 2e-84, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  72    SDGGWFMD  79



>ref|XP_002864985.1| hypothetical protein ARALYDRAFT_919932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41244.1| hypothetical protein ARALYDRAFT_919932 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   175 bits (443),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 123/203 (61%), Gaps = 38/203 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRT-----HTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+   V +    A        HTERRLH+L
Sbjct  181   GFNGGPIIDPIRKAQVKDHLDTVMEAHHRVGDVSHVVVRVVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC---------------------------CPVWS------RDRPKLLFDTVC  1137
             M  + DYE C                           C  +S      RDRPKLLFDTVC
Sbjct  241   MYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACNGYSMVNVKCRDRPKLLFDTVC  300

Query  1136  ALTDMQYVVFHASISSHDSTSVQ  1068
             AL ++Q+VVFHA   +  ST+ Q
Sbjct  301   ALKELQFVVFHAVAGAKGSTAEQ  323


 Score =   146 bits (368),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  323  QEYFIRKKNGCTLETEVQRERLRHCLVAAISRRASRGLKLEIRTENKMGLLSDVTRVVRE  382

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV D +G   +   +E+V +E+GG V    K+ G     
Sbjct  383  NGLSITRAEMCTQGEIAVGSFYVTDVNGGETNANAVEAVVRELGGAVVSAVKAVGMVP--  440

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                 +   S   S E  K   S+G L W++LERLS + R
Sbjct  441  -----TRMGSTSDSVEQDKAKSSIGRLFWSKLERLSTSIR  475


 Score = 39.7 bits (91),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ D S+I YIQQ
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQ  101



>emb|CDY36516.1| BnaC03g48750D [Brassica napus]
Length=477

 Score =   177 bits (448),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 124/204 (61%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG DRPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAFEITGIDRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNG-ERRSVRLSDPAASR----THTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAH   G E R V     A        HTERRLH+L
Sbjct  181   GFNGGPIIDPIRKAQVKDHLDIVMEAHQRVGDESRVVVSVVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC----------------------------CPVWS------RDRPKLLFDTV  1140
             M A+RDYE C                            C  +S      RDRPKLLFDTV
Sbjct  241   MYAERDYENCFGCDCCSGDRCDALWRGRCERIHVAIEACNGYSMVSVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGARGSTAEQ  324


 Score =   144 bits (362),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS G +LD+ T+N++GLLSDVTR  RE
Sbjct  324  QEYFIRKKNGCTLETEGQRERLRHCLVAAISRRASRGFKLDVRTKNKMGLLSDVTRTVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV   SG   D   +E+V +E+ G V    K+ G  +  
Sbjct  384  NGLSITRAEMSTQGENAVGSFYVAGVSGGEKDANAVEAVVRELHGVVVSAVKTVGMVS--  441

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                 +   S     E+ +   S+G LLW++LERLS + R
Sbjct  442  -----TRLGSSSDVEEENRAKSSIGRLLWSKLERLSTSIR  476


 Score = 40.0 bits (92),  Expect(3) = 1e-83, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|NP_001078803.1| ACT domain repeat 1 [Arabidopsis thaliana]
 gb|AED98120.1| ACT domain repeat 1 [Arabidopsis thaliana]
Length=425

 Score =   176 bits (446),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 123/203 (61%), Gaps = 38/203 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  69    REVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  128

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRT-----HTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+   V +    A        HTERRLH+L
Sbjct  129   GFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDVSHVVVRVVEAKGVPVGWAHTERRLHEL  188

Query  1217  MAADRDYEQC---------------------------CPVWS------RDRPKLLFDTVC  1137
             M  + DYE C                           C  +S      RDRPKLLFDTVC
Sbjct  189   MYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACNGYSMVNVKCRDRPKLLFDTVC  248

Query  1136  ALTDMQYVVFHASISSHDSTSVQ  1068
             AL ++Q+VVFHA   +  ST+ Q
Sbjct  249   ALKELQFVVFHAVAGAKGSTAEQ  271


 Score =   143 bits (361),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+G TL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  271  QEYFIRKKNGGTLETEGQRERLRHCLVAAISRRASQGLKLEIRTENKMGLLSDVTRVVRE  330

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV D +G    P  +E+V +E+GG V    K  G   + 
Sbjct  331  NGLSITRAEMCTQGEIAVGSFYVTDVNGGETGPSEVEAVVRELGGAVVSAVKGVGMMPR-  389

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                     S   S E  K   S+G + W++LERLS + R
Sbjct  390  ------RIGSTSDSVEQDKAKSSIGRMFWSKLERLSTSIR  423


 Score = 39.7 bits (91),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  25    MDVFHVTDQLGNKLTDRSLILYIQQAIC  52



>ref|XP_010463740.1| PREDICTED: uncharacterized protein LOC104744384 [Camelina sativa]
 ref|XP_010463748.1| PREDICTED: uncharacterized protein LOC104744384 [Camelina sativa]
Length=480

 Score =   177 bits (448),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 122/204 (60%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVCTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGER-----RSVRLSDPAASRTHTERRLHQL  1218
                 GPI D  R AQ++  L+ V+EAHH  G+      R V          HTERRLH+L
Sbjct  181   GFNGGPIIDSIRKAQVKDHLDTVMEAHHIVGDESRVVVRIVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC--CPVWS--------------------------------RDRPKLLFDTV  1140
             M A+ DYE C  C  +S                                RDRPKLLFDTV
Sbjct  241   MYAEGDYESCSDCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVNVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGAKGSTAEQ  324


 Score =   142 bits (358),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R ++  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  324  QEYFIRKKNGCTLETEVQREKLRHCLVAAISRRASRGLKLEIRTENKMGLLSDVTRVVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   D   +E+V +E+GG V    K+ G     
Sbjct  384  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETDQNAVEAVVRELGGAVVSAVKAVGMMPMR  443

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
              S +  S   R      K   S+G + W++LERLS++ +
Sbjct  444  MGSTSDNSVELR-----DKTKSSIGRMFWSKLERLSSSIK  478


 Score = 40.0 bits (92),  Expect(3) = 4e-83, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|NP_201390.1| ACT domain repeat 1 [Arabidopsis thaliana]
 sp|Q9FHP1.1|ACR1_ARATH RecName: Full=ACT domain-containing protein ACR1; AltName: Full=Protein 
ACT DOMAIN REPEATS 1 [Arabidopsis thaliana]
 gb|AAK25966.1|AF360256_1 putative uridylyl transferases [Arabidopsis thaliana]
 dbj|BAB11136.1| uridylyl transferases-like [Arabidopsis thaliana]
 gb|AAK64128.1| putative uridylyl transferases [Arabidopsis thaliana]
 gb|AAM93427.1| ACR1 [Arabidopsis thaliana]
 gb|AED98119.1| ACT domain repeat 1 [Arabidopsis thaliana]
Length=477

 Score =   175 bits (444),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 123/203 (61%), Gaps = 38/203 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRT-----HTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+   V +    A        HTERRLH+L
Sbjct  181   GFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDVSHVVVRVVEAKGVPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC---------------------------CPVWS------RDRPKLLFDTVC  1137
             M  + DYE C                           C  +S      RDRPKLLFDTVC
Sbjct  241   MYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACNGYSMVNVKCRDRPKLLFDTVC  300

Query  1136  ALTDMQYVVFHASISSHDSTSVQ  1068
             AL ++Q+VVFHA   +  ST+ Q
Sbjct  301   ALKELQFVVFHAVAGAKGSTAEQ  323


 Score =   143 bits (361),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+G TL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  323  QEYFIRKKNGGTLETEGQRERLRHCLVAAISRRASQGLKLEIRTENKMGLLSDVTRVVRE  382

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV D +G    P  +E+V +E+GG V    K  G   + 
Sbjct  383  NGLSITRAEMCTQGEIAVGSFYVTDVNGGETGPSEVEAVVRELGGAVVSAVKGVGMMPR-  441

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                     S   S E  K   S+G + W++LERLS + R
Sbjct  442  ------RIGSTSDSVEQDKAKSSIGRMFWSKLERLSTSIR  475


 Score = 39.7 bits (91),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|XP_009150677.1| PREDICTED: uncharacterized protein LOC103874028 [Brassica rapa]
 emb|CDY08741.1| BnaA06g24830D [Brassica napus]
Length=477

 Score =   174 bits (441),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 123/204 (60%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG DRPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAFEITGIDRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNG-ERRSVRLSDPAASR----THTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAH   G E R V     A        HTERRLH+L
Sbjct  181   GFNGGPIIDPIRKAQVKDHLDIVMEAHQRVGDESRVVVSVVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC----------------------------CPVWS------RDRPKLLFDTV  1140
             M A+ DYE C                            C  +S      RDRPKLLFDTV
Sbjct  241   MYAEGDYENCFGCDCCSGDRCDALSRGRCERIHVAIEACNGYSMVSVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGARGSTAEQ  324


 Score =   144 bits (362),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RRAS G +LD+ T+N++GLLSDVTR  RE
Sbjct  324  QEYFIRKKNGCTLETEGQRERLRHCLVAAISRRASRGFKLDVRTKNKMGLLSDVTRTVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV   SG   D   +E+V +E+ G V    K+ G  +  
Sbjct  384  NGLSITRAEMSTQGENAVGSFYVAGVSGGEKDANAVEAVVRELRGVVVSAVKTVGMVS--  441

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                 +   S     E+ +   S+G LLW++LERLS + R
Sbjct  442  -----TRLGSSSDVEEENRAKSSIGRLLWSKLERLSTSIR  476


 Score = 40.0 bits (92),  Expect(3) = 9e-83, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|XP_009412293.1| PREDICTED: uncharacterized protein LOC103993822 [Musa acuminata 
subsp. malaccensis]
Length=513

 Score =   171 bits (432),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 123/220 (56%), Gaps = 53/220 (24%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +G+ V P  + +EH A+E+T TDRPGL+SEI+AVLAE+ CH++ A AWTHN+ AA I+YV
Sbjct  119   LGKLVGPGQLASEHAAVEITATDRPGLLSEIAAVLAELHCHVACAQAWTHNSCAAVILYV  178

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
              D+    PI D  R+A ++ Q+++VV AHH  GERR V++S P   R H ERRLHQLM  
Sbjct  179   IDEPTRRPIADADRLAHVEQQVDSVVGAHHEPGERRRVKVSGPMPGRVHMERRLHQLMYE  238

Query  1208  DRDYEQCCP-----------------------VW--------------------------  1176
             + DYE   P                       +W                          
Sbjct  239   EGDYETGPPPPPANGDQFADANLEARRDNVLFLWSPSSSSSTVLRTRASIDSWKERGYTV  298

Query  1175  ----SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                 SRDRPKLLFDTVC LTDM+YVV+HA++ S    +VQ
Sbjct  299   VNIQSRDRPKLLFDTVCTLTDMKYVVYHAAVGSRGPLAVQ  338


 Score =   151 bits (381),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYYVR  DGCTL+ ESER++V++CL+AA ERRA HGLRLDI T++R GLLSD+TRV R
Sbjct  337  VQEYYVRRMDGCTLDTESERQKVSRCLVAAVERRACHGLRLDISTRDRRGLLSDITRVLR  396

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTS-GQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGLS+T AE  T+ ERA+GTFYV D S G +VDP+++E+VR+E+G +V +V ++ G
Sbjct  397  ENGLSLTMAECATREERAVGTFYVTDASGGGNVDPKSMEAVREELGESVTLVVRAGG  453


 Score = 35.0 bits (79),  Expect(3) = 3e-82, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFH+ D+LG K+ D  +I YIQQ  V+
Sbjct  76    MDVFHIGDRLGNKLTDPDLIRYIQQSLVS  104



>gb|EPS62051.1| hypothetical protein M569_12742, partial [Genlisea aurea]
Length=330

 Score =   176 bits (446),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 118/189 (62%), Gaps = 46/189 (24%)
 Frame = -1

Query  1523  ALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRV  1344
             ALEMTG DRPGL+SEISA LA + C I++AVAWTH  +AAC++ +E         D    
Sbjct  7     ALEMTGVDRPGLLSEISAALAHLECRITSAVAWTHRGQAACMINIE---------DVLEA  57

Query  1343  AQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR--DYEQCC-----  1185
             +Q+QAQLENV+EAHH + E RSV+L+ P+A +T +ERRLHQLMAA+R  DY QCC     
Sbjct  58    SQVQAQLENVLEAHHNDDEARSVKLASPSAGQTDSERRLHQLMAAERGDDYGQCCSCGSE  117

Query  1184  ------------------------------PVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                                            V SRDRPKLLFDTVCALTD+ YVV HA++
Sbjct  118   EFDGLYVQKERCDGTHVRIESCRESGYLMIAVRSRDRPKLLFDTVCALTDLAYVVHHAAV  177

Query  1094  SSHDSTSVQ  1068
              S+DST+ Q
Sbjct  178   GSNDSTAFQ  186


 Score =   157 bits (397),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 17/162 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYV+ +DGC+   E+E++R+ QCL AATERR S G+RL+I   +RLGLLSD+TRVFR
Sbjct  185  FQEYYVKREDGCSWYSEAEKQRIVQCLSAATERRCSQGVRLEIHANDRLGLLSDITRVFR  244

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSG-QSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            ENGLSITRAE+  +GE A G FYVK+TSG +SVD  T+E V +E+G T  V+  +     
Sbjct  245  ENGLSITRAEMAVRGENATGAFYVKETSGDESVDQRTIERVVREMGSTDIVLDNTLSGSR  304

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
            ++  S                  FSLGS++WAQLERLS NFR
Sbjct  305  RSCVSTK----------------FSLGSVIWAQLERLSWNFR  330



>gb|ABK22147.1| unknown [Picea sitchensis]
Length=466

 Score =   165 bits (418),  Expect(4) = 3e-81, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 110/178 (62%), Gaps = 32/178 (18%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + E+TA+E+TGTDRPGL+SEISAVL    C++ AA +WTHN R AC+VYV D+S + PI 
Sbjct  126   IGEYTAIELTGTDRPGLLSEISAVLTSFSCNVVAAESWTHNMRVACVVYVTDESSNRPIE  185

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             D  R++ I+ QL NV++ +  +   + V+ +D +   TH ERRLHQLM ADRDYE     
Sbjct  186   DEVRLSTIKGQLSNVLKGN--DDSTKGVK-TDFSMGLTHRERRLHQLMFADRDYECSSDS  242

Query  1193  ------------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASIS  1092
                                         +  RDRPKLLFDTVC LTDMQYVVFHASI+
Sbjct  243   SNPSLLDENMKPVITVENCNEKGYSVVNIQCRDRPKLLFDTVCTLTDMQYVVFHASIT  300


 Score =   142 bits (357),  Expect(4) = 3e-81, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 106/166 (64%), Gaps = 13/166 (8%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RH DGCTL+ E E+ RV +CL AA  RRAS GL L++   +R+GLLSDVTR+FR
Sbjct  307  LQEYYIRHMDGCTLDTEGEKHRVIKCLEAAIGRRASEGLSLELSASDRIGLLSDVTRMFR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTS----GQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGLS+TRA++ T+G++AI  FYV+D S      ++D + +E++R+EIG T+        
Sbjct  367  ENGLSVTRADVTTRGDKAINVFYVRDASSGNLAINIDMKVVEAMRREIGHTM--------  418

Query  649  RFTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFRV  512
             F +  +     + +        K  FS  SL  AQL+R+S NFR+
Sbjct  419  -FLQVKNMPGDIAYNSLPIDSRSKFRFSFASLFKAQLDRISYNFRM  463


 Score = 43.5 bits (101),  Expect(4) = 3e-81, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ DESII YIQQ
Sbjct  76    MDVFHVTDQLGDKLTDESIIEYIQQ  100


 Score = 23.5 bits (49),  Expect(4) = 3e-81, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  70    SDGGWFMD  77



>ref|XP_007155810.1| hypothetical protein PHAVU_003G2336000g, partial [Phaseolus vulgaris]
 gb|ESW27804.1| hypothetical protein PHAVU_003G2336000g, partial [Phaseolus vulgaris]
Length=402

 Score =   158 bits (400),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 111/183 (61%), Gaps = 31/183 (17%)
 Frame = -1

Query  1523  ALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRV  1344
             ALE+T  D+PGL S+ISA L  +G ++S+A AWTHN R ACI+++ED ++ GPI D   +
Sbjct  58    ALELTMRDQPGLFSDISATLLGLGFNVSSATAWTHNERVACIIHLEDANELGPIHDAESL  117

Query  1343  AQIQAQLENVVEAHHYNGERRSV--RLSDPAASRTHTERRLHQLMAADRDYEQCCP----  1182
             A +Q +L+  ++A     ER+ V  RL   AA R HTERRLHQ+M AD DYE+C      
Sbjct  118   AHVQDELQKAIKARDGEEERKRVRLRLRSFAAGRNHTERRLHQMMYADGDYERCGAWQDE  177

Query  1181  -------------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDST  1077
                                      V SRDRPKLLFDTVC LTDMQY VFHA+I+S+ S 
Sbjct  178   KEKNGCEGIEVSVGRYAEKGYWVVNVRSRDRPKLLFDTVCVLTDMQYEVFHAAITSNTSM  237

Query  1076  SVQ  1068
             + Q
Sbjct  238   ADQ  240


 Score =   154 bits (388),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASH--GLRLDICTQNRLGLLSDVTRVF  821
            QEY+VR K    LN ESER+++T CLIAA ERR SH  GL++DI  +NR GLLS VTRV 
Sbjct  240  QEYFVRPKGSLNLNNESERQKLTLCLIAAIERRVSHPKGLKVDIRAENRSGLLSKVTRVI  299

Query  820  RENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFT  641
            RENGLSIT+ +IG +GE AIG+FY+K+ SG+ V+P   E VR E GG+V   + S     
Sbjct  300  RENGLSITKVDIGVEGETAIGSFYLKNCSGEDVNPNIAELVRGETGGSVIANYISPHSLP  359

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
            K  SS   +   + +S +   P  SLG++LW+QLE LSNNFR
Sbjct  360  KPVSSSGRSCMHKTNSSQ-ATPKLSLGTMLWSQLECLSNNFR  400


 Score = 38.9 bits (89),  Expect(3) = 1e-80, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 23/27 (85%), Gaps = 1/27 (4%)
 Frame = -2

Query  1702  FHVTDQLGYKIVDESIIHYIQQ-VCVA  1625
             FHVTDQ+G+K+ D+ ++H+IQQ +C A
Sbjct  1     FHVTDQVGHKLTDKGLVHHIQQALCEA  27



>ref|XP_006393975.1| hypothetical protein EUTSA_v10004129mg [Eutrema salsugineum]
 gb|ESQ31261.1| hypothetical protein EUTSA_v10004129mg [Eutrema salsugineum]
Length=475

 Score =   174 bits (441),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 122/204 (60%), Gaps = 39/204 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG DRPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  121   REVQQRHVSTEHTAYEITGIDRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  180

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNG-ERRSVRLSDPAASR----THTERRLHQL  1218
                 GPI  P R AQ++  L  VVEAHH  G E R V     A        HTERRLH+L
Sbjct  181   GFNGGPIIGPVRKAQVKDHLLTVVEAHHRVGDESRVVVSVVEAKGAPVGWAHTERRLHEL  240

Query  1217  MAADRDYEQC--CPVWS--------------------------------RDRPKLLFDTV  1140
             M A+ DYE C  C  +S                                RDRPKLLFDTV
Sbjct  241   MYAEGDYENCFGCDCFSGDRCDALWRGRCERIHVAIEACNGYSMVTVKCRDRPKLLFDTV  300

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             CAL ++Q+VVFHA   +  ST+ Q
Sbjct  301   CALKELQFVVFHAVAGARGSTAEQ  324


 Score =   131 bits (330),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+GCTL  E +R R+  CL+AA  RR S G + ++ T N++GLLSDVTRV RE
Sbjct  324  QEYFIRKKNGCTLETEGQRERLRHCLVAAISRRTSRGSKFEVRTNNKMGLLSDVTRVVRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQG+ A+G+FYV D +G   + + +E+V +++  +            KA
Sbjct  384  NGLSITRAEMSTQGDIAVGSFYVTDVNGGETESKAVEAVVRDLDVSA----------VKA  433

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                +S   S   + E  K   S+G L W++LERLS + R
Sbjct  434  VGMVSSRLSSSSDTVEQDKAKLSIGRLFWSKLERLSTSIR  473


 Score = 39.7 bits (91),  Expect(3) = 6e-79, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ-VC  1631
             + VFHVTDQLG K+ D S+I YIQQ +C
Sbjct  77    MDVFHVTDQLGNKLTDRSLILYIQQAIC  104



>ref|XP_003525871.1| PREDICTED: uncharacterized protein LOC100783892 isoform X1 [Glycine 
max]
 ref|XP_006579951.1| PREDICTED: uncharacterized protein LOC100783892 isoform X2 [Glycine 
max]
 ref|XP_006579952.1| PREDICTED: uncharacterized protein LOC100783892 isoform X3 [Glycine 
max]
 ref|XP_006579953.1| PREDICTED: uncharacterized protein LOC100783892 isoform X4 [Glycine 
max]
Length=481

 Score =   160 bits (405),  Expect(3) = 4e-78, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 118/196 (60%), Gaps = 39/196 (20%)
 Frame = -1

Query  1550  PRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKH  1371
             PR V   + A+E+T  ++ GL SE+SAVL  +G ++++A AWTHN R ACI+++ED  K 
Sbjct  125   PRLV---NLAIELTTANQHGLFSEMSAVLLGLGFNVTSATAWTHNDRVACIIHLEDAKKL  181

Query  1370  GPITDPYRVAQIQAQLENVVEAHHYNGERRSV--RLSDPAASRTHTERRLHQLMAADRDY  1197
             GPI +  R+AQ+Q +L NVV+A   NGE   V  RL    A R HTERRLHQ+M AD DY
Sbjct  182   GPI-NAERLAQVQPELRNVVKARDRNGEEERVRLRLRSFGAGRNHTERRLHQMMYADGDY  240

Query  1196  EQC--CPV--------------------------W-----SRDRPKLLFDTVCALTDMQY  1116
             E+C  C V                          W     SRDRPKLLFDTVC LTDMQY
Sbjct  241   ERCRACHVGDRNGEKKKGCEETQVTVGRYEEKGYWVVNVRSRDRPKLLFDTVCVLTDMQY  300

Query  1115  VVFHASISSHDSTSVQ  1068
              VFHA++SS+ S + Q
Sbjct  301   EVFHAAVSSNGSMADQ  316


 Score =   145 bits (367),  Expect(3) = 4e-78, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY+VR K    L+ ESE+++++ CLIAA ERR SHGL++DI  +N  GLLS VTRV RE
Sbjct  316  QEYFVRPKGSSNLDNESEKQKLSLCLIAAIERRVSHGLKVDIRAENTTGLLSKVTRVIRE  375

Query  814  NGLSITRAEIGTQG-ERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            NGLSIT+ +IG +  E A+G+F V ++SGQ V+P   E VR+E GG+V   + S  R  K
Sbjct  376  NGLSITKVQIGVESDEMAVGSFCVANSSGQEVNPNIAELVRRETGGSVVANYNSPYRVPK  435

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR-VPTHKI  497
            +  S + T    +SS E G+  FS+GS+LW+QLE LSNNFR + +HK+
Sbjct  436  S-LSSSKTMHETKSSTEVGQ-RFSIGSMLWSQLECLSNNFRPIRSHKL  481


 Score = 37.0 bits (84),  Expect(3) = 4e-78, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (58%), Gaps = 3/45 (7%)
 Frame = -2

Query  1771  VSPLSPSLFLYSCGTVLIACLPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + P+    ++ S G  L   + VFHVTD  G K+ D  ++HYIQQ
Sbjct  59    LDPVISKSYISSDGGWL---MDVFHVTDHDGNKLTDRGLVHYIQQ  100



>emb|CAA16674.1| predicted protein [Arabidopsis thaliana]
Length=446

 Score =   177 bits (448),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 123/203 (61%), Gaps = 38/203 (19%)
 Frame = -1

Query  1562  RDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVED  1383
             R+V+ R+V TEHTA E+TG +RPGL+SEISAVL+++GCH++AAVAWTH+ RAA ++Y+ED
Sbjct  90    REVQQRHVSTEHTAFEITGINRPGLLSEISAVLSDIGCHVTAAVAWTHHERAAMVIYLED  149

Query  1382  DSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRT-----HTERRLHQL  1218
                 GPI DP R AQ++  L+ V+EAHH  G+   V +    A        HTERRLH+L
Sbjct  150   GFNGGPIIDPIRKAQVKDHLDTVMEAHHIVGDVSHVVVRVVEAKGVPVGWAHTERRLHEL  209

Query  1217  MAADRDYEQC---------------------------CPVWS------RDRPKLLFDTVC  1137
             M  + DYE C                           C  +S      RDRPKLLFDTVC
Sbjct  210   MYGEGDYENCFDCDCFGDRCDALWRGRCERIHVTIEACNGYSMVNVKCRDRPKLLFDTVC  269

Query  1136  ALTDMQYVVFHASISSHDSTSVQ  1068
             AL ++Q+VVFHA   +  ST+ Q
Sbjct  270   ALKELQFVVFHAVAGAKGSTAEQ  292


 Score =   144 bits (362),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 7/160 (4%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R K+G TL  E +R R+  CL+AA  RRAS GL+L+I T+N++GLLSDVTRV RE
Sbjct  292  QEYFIRKKNGGTLETEGQRERLRHCLVAAISRRASQGLKLEIRTENKMGLLSDVTRVVRE  351

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITRAE+ TQGE A+G+FYV D +G    P  +E+V +E+GG V    K  G   + 
Sbjct  352  NGLSITRAEMCTQGEIAVGSFYVTDVNGGETGPSEVEAVVRELGGAVVSAVKGVGMMPR-  410

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                     S   S E  K   S+G + W++LERLS + R
Sbjct  411  ------RIGSTSDSVEQDKAKSSIGRMFWSKLERLSTSIR  444



>ref|XP_002990728.1| hypothetical protein SELMODRAFT_132226 [Selaginella moellendorffii]
 gb|EFJ08177.1| hypothetical protein SELMODRAFT_132226 [Selaginella moellendorffii]
Length=466

 Score =   154 bits (389),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 105/174 (60%), Gaps = 34/174 (20%)
 Frame = -1

Query  1529  HTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPY  1350
             HTA+E++G DRPGL+SEIS VL  M C++ AA  WTHN R AC+VYV D++   PI DP 
Sbjct  128   HTAIELSGRDRPGLLSEISGVLTGMTCNVVAAEVWTHNKRVACVVYVTDEATGCPIKDPE  187

Query  1349  RVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE--------  1194
             ++A+++ QL  V+     N     +  +D ++  THTERRLHQ+M ADRDY+        
Sbjct  188   KLARMKEQLSQVLRGDDEN----RLATTDFSSGLTHTERRLHQMMLADRDYDVPSSTSSI  243

Query  1193  ------QCCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHAS  1098
                   +  PV S                +DRPKLLFDTVC LTDM+YVVFHAS
Sbjct  244   NAVLDARIRPVISLRNCLEKGYSVVSVQCKDRPKLLFDTVCTLTDMEYVVFHAS  297


 Score =   147 bits (371),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGCTL+L++E+ RV +CL AA ERR S GLRL++CT++R+GLLSDVTRVFR
Sbjct  306  YQEYYIRHMDGCTLDLDAEQERVVKCLEAAIERRVSEGLRLELCTRDRVGLLSDVTRVFR  365

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            E GLS+TRA++ T+G+RA+  FYV DTSG++V  + +E++R EIG  +
Sbjct  366  EKGLSVTRADVSTRGDRAVNVFYVTDTSGKAVSMKVVEALRLEIGQAI  413


 Score = 39.7 bits (91),  Expect(3) = 1e-77, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+LG+K+ D+ II YIQQ
Sbjct  76    MDVFHVTDKLGHKLRDQGIIDYIQQ  100



>ref|XP_002986703.1| hypothetical protein SELMODRAFT_124581 [Selaginella moellendorffii]
 gb|EFJ12266.1| hypothetical protein SELMODRAFT_124581 [Selaginella moellendorffii]
Length=466

 Score =   152 bits (384),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 105/174 (60%), Gaps = 34/174 (20%)
 Frame = -1

Query  1529  HTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPY  1350
             HTA+E++G DRPGL+SEIS VL  M C++ AA  WTHN R AC+VYV D++   PI DP 
Sbjct  128   HTAIELSGRDRPGLLSEISGVLTGMTCNVVAAEVWTHNKRVACVVYVTDEATGCPIKDPE  187

Query  1349  RVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE--------  1194
             ++A+++ +L  V+     N     +  +D ++  THTERRLHQ+M ADRDY+        
Sbjct  188   KLARMKERLSQVLRGDDEN----RLATTDFSSGLTHTERRLHQMMLADRDYDVPSSTSSI  243

Query  1193  ------QCCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHAS  1098
                   +  PV S                +DRPKLLFDTVC LTDM+YVVFHAS
Sbjct  244   NAVLDARIRPVISLRNCLEKGYSVVSVQCKDRPKLLFDTVCTLTDMEYVVFHAS  297


 Score =   147 bits (371),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGCTL+L++E+ RV +CL AA ERR S GLRL++CT++R+GLLSDVTRVFR
Sbjct  306  YQEYYIRHMDGCTLDLDAEQERVVKCLEAAIERRVSEGLRLELCTRDRVGLLSDVTRVFR  365

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            E GLS+TRA++ T+G+RA+  FYV DTSG++V  + +E++R EIG  +
Sbjct  366  EKGLSVTRADVSTRGDRAVNVFYVTDTSGKAVSMKVVEALRLEIGQAI  413


 Score = 39.7 bits (91),  Expect(3) = 4e-77, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+LG+K+ D+ II YIQQ
Sbjct  76    MDVFHVTDKLGHKLRDQGIIDYIQQ  100



>gb|ADE77534.1| unknown [Picea sitchensis]
Length=439

 Score =   154 bits (390),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 107/155 (69%), Gaps = 14/155 (9%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGC +N E+ER+RV QCL AA  RRAS G+RL++CT +R+GLLSDVTR+FRE
Sbjct  288  QEYYIRHTDGCPVNSEAERQRVIQCLEAAIRRRASEGVRLELCTNDRVGLLSDVTRIFRE  347

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NG+S+TRAE+ T+G++A+  FYV D +G  VDP+T+E+VR+EIG T+  V K +   TK+
Sbjct  348  NGMSVTRAEVSTRGDKAVNVFYVTDAAGNPVDPKTVEAVRREIGLTILQV-KDNCMDTKS  406

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERL  530
                           E   P FS G+L  ++ ER 
Sbjct  407  ------------PRREPAIP-FSFGNLFKSKSERF  428


 Score =   152 bits (383),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 108/196 (55%), Gaps = 41/196 (21%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
              G+ V       +HTA+E+TGTDRPGL+SEI AVL+++ C++  A  WTHN R AC+VYV
Sbjct  93    FGKSVGVEVAADQHTAIELTGTDRPGLLSEIFAVLSDLKCNVVEAEVWTHNRRVACLVYV  152

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASR--THTERRLHQLM  1215
              D+    PI D  ++ +I+  L NV+  +       ++R +   AS   THTERRLHQLM
Sbjct  153   TDEETGAPIDDGQKICKIEELLRNVMRGNS------NIRGAKTVASMGLTHTERRLHQLM  206

Query  1214  AADRDYEQ---------------------------------CCPVWSRDRPKLLFDTVCA  1134
              ADRDYE+                                    V  +DRPKLLFD VC 
Sbjct  207   FADRDYEKLDGTVGRAPPPLNDNDNAKPHVTVENCLERGYSVVNVQCKDRPKLLFDVVCT  266

Query  1133  LTDMQYVVFHASISSH  1086
             LTDM+YVVFHA+I S 
Sbjct  267   LTDMEYVVFHATIDSQ  282


 Score = 30.8 bits (68),  Expect(3) = 2e-76, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ DE +I YI++
Sbjct  57    MDVFYVTDENGKKLTDEGVIGYIEK  81



>ref|XP_006856315.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
 gb|ERN17782.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
Length=438

 Score =   155 bits (392),  Expect(3) = 8e-76, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 111/182 (61%), Gaps = 31/182 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T +T++E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA +++V DD    PI+D
Sbjct  114   TNYTSIELTGTDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDDPTSAPISD  173

Query  1355  PYRVAQIQAQLENVVEAHHYN-GERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----  1191
             P R+A+I+  L NV++ ++   G +  V L       THTERRLHQ+M ADRDYE+    
Sbjct  174   PQRLAKIKELLCNVLKGNNKTRGAKTVVSLGG-----THTERRLHQMMFADRDYERDGQD  228

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     +  +DRPKLLFDTVC LTDMQYVVFHA++ +    +
Sbjct  229   SVDEGLRPQVTVIDCFQKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHATVDAERPEA  288

Query  1073  VQ  1068
              Q
Sbjct  289   YQ  290


 Score =   153 bits (387),  Expect(3) = 8e-76, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  289  YQEYYIRHIDGCPVNSEAERQRVVQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  348

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+ RAE+ T+  +A+ TFYV+D +G  VDP+T+ESVR+EIG TV
Sbjct  349  ENSLSVIRAEVSTRNGKAVNTFYVRDATGNPVDPKTVESVRREIGQTV  396


 Score = 25.8 bits (55),  Expect(3) = 8e-76, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ DE  + YI++
Sbjct  68    MDVFNVTDRDGKKLRDEETMDYIRK  92



>gb|AES90748.2| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=490

 Score =   156 bits (394),  Expect(4) = 8e-76, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 109/188 (58%), Gaps = 34/188 (18%)
 Frame = -1

Query  1529  HTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPY  1350
             + A+E+ GTDRPGL SEIS VL ++G +I +A AWTHN +  CI+Y ED S+ GPI +  
Sbjct  148   NVAIEVIGTDRPGLFSEISVVLMDLGFNIISAKAWTHNDKVVCIIYPEDASRPGPINERE  207

Query  1349  RVAQIQAQLENVVEAHHYNGER--RSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             R+AQ+  Q+ NV+EA+   G++  RSV L       +HTERRLHQ+M A  DYE C    
Sbjct  208   RLAQVVDQIRNVIEANEGKGDKDMRSVVLKSSTTGHSHTERRLHQMMYAASDYESCHACH  267

Query  1187  ----------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASIS  1092
                                           V SRDRPKLLFD VC LTDMQY VFHA+++
Sbjct  268   GDNDSEHKRQYDGTHVSVDRYQGRDYWVVNVRSRDRPKLLFDIVCMLTDMQYEVFHAAVT  327

Query  1091  SHDSTSVQ  1068
             S+   + Q
Sbjct  328   SNSPMAEQ  335


 Score =   140 bits (352),  Expect(4) = 8e-76, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++R++    L+ E+E++R+T CLIAA E RASHGL++DI TQN++GLLS VT+V  E
Sbjct  335  QEYFIRNQGSSNLDNETEKQRLTLCLIAAIECRASHGLKVDIRTQNKMGLLSKVTQVIHE  394

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLSITR E G +GE AIG+ YV   SGQ V+   +E +++EIGG++ +   S  R    
Sbjct  395  NGLSITRIEFGVEGEAAIGSLYVTGCSGQDVNENIVELIKREIGGSIVLAQSSPYR----  450

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFR  515
                +S S S  ++  D  P FS G ++ + LERL NNFR
Sbjct  451  ----DSQSSSSSNNSRDVIPTFSFGGMIRSHLERLINNFR  486


 Score = 35.0 bits (79),  Expect(4) = 8e-76, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHV DQ+G K+ D+S++++I+Q+
Sbjct  95    MDVFHVKDQIGNKLTDKSLVNHIEQI  120


 Score = 24.6 bits (52),  Expect(4) = 8e-76, Method: Compositional matrix adjust.
 Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGWLMD
Sbjct  89    SDGGWLMD  96



>ref|XP_007222134.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
 gb|EMJ23333.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
Length=447

 Score =   156 bits (394),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 112/181 (62%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA +++V D+     +TD
Sbjct  123   TDHTAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLAVTD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R+A+I+  L NV++  +     R+V     + + THTERRLHQ+M ADRDYE+     
Sbjct  183   PQRLARIKELLCNVLKGSNKTRGARTV----VSHAVTHTERRLHQMMFADRDYERVDDGL  238

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDMQYVVFHASI +    + 
Sbjct  239   LDDNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAY  298

Query  1070  Q  1068
             Q
Sbjct  299   Q  299


 Score =   144 bits (363),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+DTSG  VD +T+E++RQ IG T+
Sbjct  358  ENSLTVTRAEVATKAGKAVNTFYVRDTSGYPVDSKTIEAIRQVIGQTI  405


 Score = 33.1 bits (74),  Expect(3) = 2e-75, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEGVLEYIQK  102



>ref|XP_007045767.1| ACT domain repeat 4 [Theobroma cacao]
 gb|EOY01599.1| ACT domain repeat 4 [Theobroma cacao]
Length=485

 Score =   152 bits (384),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 110/180 (61%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+ K   ITDP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEEKGTAITDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+++I+A L NV++  + +   ++V     + S THTERRLHQ+M ADRDYE+      
Sbjct  184   ERLSRIKALLCNVLKGSNKSSLAKTV----VSHSVTHTERRLHQMMFADRDYERTGDDVL  239

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFDTVC LTDM YVVFHA+I +    S Q
Sbjct  240   DDKQRPNVDVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMDYVVFHANIDTEGPESYQ  299


 Score =   145 bits (365),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RVTQCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHIDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+DTSG  VD +T++S+RQ IG T+
Sbjct  358  ENSLTVTRAEVTTKAGKAVNTFYVRDTSGYPVDAKTIDSIRQVIGQTI  405


 Score = 33.9 bits (76),  Expect(3) = 1e-74, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G KIVDE I+ YI +
Sbjct  78    MDVFNVTDQDGNKIVDEGILDYIMK  102



>ref|XP_006450386.1| hypothetical protein CICLE_v10010775mg [Citrus clementina]
 ref|XP_006483395.1| PREDICTED: uncharacterized protein LOC102630166 [Citrus sinensis]
 gb|ESR63626.1| hypothetical protein CICLE_v10010775mg [Citrus clementina]
 gb|KDO61789.1| hypothetical protein CISIN_1g048063mg [Citrus sinensis]
Length=484

 Score =   152 bits (383),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 15/164 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH DG  LN E E+ RV +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  333  FQEYFIRHIDGYALNTEGEKERVIKCLEAAIERRVCEGVRLELCAANRVGLLSDITRVLR  392

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA + T+GE+++  FY++D SG  VD + +ES+++EI G + +  K+  R T 
Sbjct  393  ENGLAVVRAHVATKGEKSVNAFYLRDISGNEVDMDFVESMKKEILGPIDLAVKNDSRSTS  452

Query  637  AtssgnstsrsrrssGEDGKPG-FSLGSLLWAQLERLSNNFRVP  509
                          S  D  P  FSLG LL +QLERLS+NF VP
Sbjct  453  P-------------SPPDRSPTRFSLGDLLRSQLERLSHNF-VP  482


 Score =   144 bits (363),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 107/204 (52%), Gaps = 48/204 (24%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EMTGTDRPGL SEISA LA++ C+I  A AW+HN R AC+ YV D S   PI D
Sbjct  131   SEHTAIEMTGTDRPGLFSEISAALADLHCNIVEAHAWSHNDRLACVAYVSDQSTDTPIDD  190

Query  1355  PYRVAQIQAQLENVV---------EAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR  1203
             P R+A I+  +  V+         E H    + ++         +T+ ERRLHQLM + R
Sbjct  191   PGRLATIEEYITTVLRATAERSPSETHINPLQVKANGFPCGDCIKTNVERRLHQLMLSVR  250

Query  1202  DYE-QCCPVWSR--------------------------------------DRPKLLFDTV  1140
             D++ QC P  SR                                      DRP+L+FDTV
Sbjct  251   DFDGQCGPNMSRSTPSSAVGFGDEEGMRRTAVYIESCEEKGYSIVSVDCKDRPRLMFDTV  310

Query  1139  CALTDMQYVVFHASISSHDSTSVQ  1068
             C LTDMQYVVFHASI  H   + Q
Sbjct  311   CTLTDMQYVVFHASIGCHGDYAFQ  334


 Score = 34.3 bits (77),  Expect(3) = 2e-74, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+ +I+YIQQ
Sbjct  78    MDVFHVKDEHGNKLTDQKVINYIQQ  102



>ref|XP_006857102.1| hypothetical protein AMTR_s00065p00123930 [Amborella trichopoda]
 gb|ERN18569.1| hypothetical protein AMTR_s00065p00123930 [Amborella trichopoda]
Length=580

 Score =   147 bits (370),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 113/193 (59%), Gaps = 34/193 (18%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEH-TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVY  1392
             +GR V      T+H TALE+TG  R GL+SEISAVLA++ C++S+   WTHN R ACIV+
Sbjct  117   LGRIVSAESAPTDHGTALELTGPGRLGLLSEISAVLADLSCNVSSMQFWTHNGRMACIVH  176

Query  1391  VEDDSKHGPIT-DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLM  1215
             V D     PI  DP R+A ++ QL +V+      G+R+           +  ERRLHQ+M
Sbjct  177   VADGDTGAPIEDDPERLACVREQLASVLGGTCTCGDRQ--------GGLSRVERRLHQMM  228

Query  1214  AADRDY-----------------EQC-------CPVWSRDRPKLLFDTVCALTDMQYVVF  1107
              A+RD+                 E+C         V SRDRPKLL DTVCALTDMQYVVF
Sbjct  229   VAERDFEGGGEREVGRNRASVSVERCGEKGYSVVSVQSRDRPKLLLDTVCALTDMQYVVF  288

Query  1106  HASISSHDSTSVQ  1068
             HA+ISS  S +VQ
Sbjct  289   HAAISSSGSQAVQ  301


 Score =   136 bits (343),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 101/160 (63%), Gaps = 13/160 (8%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+R  DGC L+ E+E++ V +C+ AA ERR SHGLRLDI T NR GLLS +TRV RE
Sbjct  301  QEYYIRRTDGCPLDSEAEKQGVMKCIEAAIERRVSHGLRLDIRTVNRPGLLSAITRVLRE  360

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGT----VKVVHKSSGR  647
            NGLS+ RA++ T+G RA+ +FYV      ++D +TL+++RQEIG      V+ V  S+  
Sbjct  361  NGLSVVRADVATRGGRALNSFYVCRADEAAIDAKTLDAIRQEIGPQAVLEVRRVPDSARP  420

Query  646  FTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLS  527
             T           ++    E     FSLGSL W+ +ERLS
Sbjct  421  ATAT---------AKAPPEEKHAAKFSLGSLFWSHIERLS  451


 Score = 46.6 bits (109),  Expect(3) = 3e-74, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVA  1625
             + VFHVTDQLG KI DE +IHYI+QV  A
Sbjct  75    MDVFHVTDQLGNKITDERLIHYIEQVLCA  103



>ref|XP_006844620.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
 gb|ERN06295.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
Length=452

 Score =   150 bits (378),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 105/177 (59%), Gaps = 33/177 (19%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT++E+TG DRPGL+SEI AVLA++ C++ AA  WTHN+R A +VY+ D+    PI DP
Sbjct  124   EHTSIELTGRDRPGLLSEIFAVLADLKCNVVAAEVWTHNSRMASVVYITDECSGSPIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+++I+  L N++         ++V     +   THTERRLHQ+M ADRDYE+      
Sbjct  184   QRLSRIKELLSNILRGDRDKRGAKTV----VSMGLTHTERRLHQMMFADRDYERVERDGL  239

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                       + S+DRPKLLFDTVC LTDMQYVV+H ++ +
Sbjct  240   EREEDKSLRPDVTLLDCFERDYSVVTMRSKDRPKLLFDTVCTLTDMQYVVYHGTVQT  296


 Score =   145 bits (366),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  ++ E+E++RV QCL AA ERRAS GL L++CT++R+GLLSDVTR+FR
Sbjct  302  YQEYYIRHVDGLPVSSEAEKQRVIQCLEAAIERRASEGLELELCTEDRVGLLSDVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            EN L+ITRAEI T+  +AI TFY+ D SG  VDP+T++++RQEIG
Sbjct  362  ENSLTITRAEITTKSGKAIDTFYLTDVSGNPVDPKTIDAIRQEIG  406


 Score = 34.3 bits (77),  Expect(3) = 4e-74, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+ G K+ DE +I+ IQQ
Sbjct  77    MDVFHVTDRYGNKLCDEEVINKIQQ  101



>ref|XP_004136481.1| PREDICTED: uncharacterized protein LOC101219701 [Cucumis sativus]
 ref|XP_004169538.1| PREDICTED: uncharacterized LOC101219701 [Cucumis sativus]
 gb|KGN60082.1| hypothetical protein Csa_3G876050 [Cucumis sativus]
Length=469

 Score =   150 bits (378),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH +G  LN + ++ RV +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  320  FQEYFIRHVNGYALNSDYDKHRVVKCLEAAIERRVCEGVRLELCANNRVGLLSDITRVLR  379

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHKSSGRFT  641
            ENGL++ RA+I TQGE+AI  FYVKD SG+ VD E +ESV++EIG  V +V +++S   T
Sbjct  380  ENGLNVVRADIATQGEKAINAFYVKDISGKEVDMEMVESVKKEIGPVVLRVKNETSPPST  439

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +                +  FS   +L +QLERLS+NF
Sbjct  440  PQIT----------------RSRFSFSDMLKSQLERLSHNF  464


 Score =   149 bits (376),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 110/193 (57%), Gaps = 40/193 (21%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA+EMTGTDRPGL SEISA LA++ C++  A AW+HNAR ACI Y+ D S   PI DP
Sbjct  131   EHTAIEMTGTDRPGLFSEISAALADLHCNVVEAHAWSHNARLACIAYISDQSTDSPIEDP  190

Query  1352  YRVAQIQAQLENVVE-------AHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-  1197
             +R+A I+  L  V+        A   +  ++ V++S  A   T+ ERRLHQL+ + +DY 
Sbjct  191   HRLANIEEHLSTVLRAATAPPIASWTHTLQQEVKIS--ATITTNVERRLHQLLVSVKDYD  248

Query  1196  -----------------------EQC-------CPVWSRDRPKLLFDTVCALTDMQYVVF  1107
                                    E C         +  +DRP+L+FDTVC LTDMQYV+F
Sbjct  249   WTSESISRRPKRKEEWRKTTVSIESCDQKGYSIVSIECKDRPRLMFDTVCTLTDMQYVIF  308

Query  1106  HASISSHDSTSVQ  1068
             HASISS    + Q
Sbjct  309   HASISSKKDNAFQ  321


 Score = 29.6 bits (65),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+  +K+ D+ +I+ IQQ
Sbjct  78    MDVFHVKDENSHKLTDQKVINSIQQ  102



>ref|XP_008466435.1| PREDICTED: uncharacterized protein LOC103503843 [Cucumis melo]
Length=469

 Score =   150 bits (378),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH +G  LN + ++ RV +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  320  FQEYFIRHVNGYALNSDYDKHRVVKCLEAAIERRVCEGVRLELCANNRVGLLSDITRVLR  379

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHKSSGRFT  641
            ENGL++ RA+I TQGE+AI  FYVKD SG+ VD E +ESV++EIG  V +V +++S   T
Sbjct  380  ENGLNVVRADIATQGEKAINAFYVKDISGKEVDMEMVESVKKEIGPVVLRVKNETSPPST  439

Query  640  KAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               +                +  FS   +L +QLERLS+NF
Sbjct  440  PQIT----------------RSRFSFSDMLKSQLERLSHNF  464


 Score =   149 bits (376),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 110/193 (57%), Gaps = 40/193 (21%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA+EMTGTDRPGL SEISA LA++ C++  A AW+HNAR ACI Y+ D S   PI DP
Sbjct  131   EHTAIEMTGTDRPGLFSEISAALADLHCNVVEAHAWSHNARLACIAYISDQSTDSPIEDP  190

Query  1352  YRVAQIQAQLENVVE-------AHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-  1197
             +R+A I+  L  V+        A   +  ++ V++S  A   T+ ERRLHQL+ + +DY 
Sbjct  191   HRLANIEEHLSTVLRAATAPPIASWTHTLQQEVKIS--ATITTNVERRLHQLLVSVKDYD  248

Query  1196  -----------------------EQC-------CPVWSRDRPKLLFDTVCALTDMQYVVF  1107
                                    E C         +  +DRP+L+FDTVC LTDMQYV+F
Sbjct  249   WTSESISKRPKRNEDWRKTMVSIESCDQKGYSIVSIECKDRPRLMFDTVCTLTDMQYVIF  308

Query  1106  HASISSHDSTSVQ  1068
             HASISS    + Q
Sbjct  309   HASISSKKDNAFQ  321


 Score = 29.6 bits (65),  Expect(3) = 5e-74, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+  +K+ D+ +I+ IQQ
Sbjct  78    MDVFHVKDENSHKLTDQKVINSIQQ  102



>ref|XP_008243801.1| PREDICTED: uncharacterized protein LOC103342019 [Prunus mume]
Length=447

 Score =   154 bits (390),  Expect(3) = 8e-74, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA +++V D+     +TDP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLAVTDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A+I+  L NV++  +     R+V     + + THTERRLHQ+M ADRDYE+      
Sbjct  184   QRLARIKELLCNVLKGSNKTRGARTV----VSHAVTHTERRLHQMMFADRDYERVDDGLL  239

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDMQYVVFHASI +    + Q
Sbjct  240   DDNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299


 Score =   140 bits (353),  Expect(3) = 8e-74, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VD +T+E++R+ IG T+
Sbjct  358  ENSLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIEAIREVIGQTI  405


 Score = 33.1 bits (74),  Expect(3) = 8e-74, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEGVLEYIQK  102



>ref|XP_010250636.1| PREDICTED: uncharacterized protein LOC104592829 [Nelumbo nucifera]
Length=450

 Score =   150 bits (378),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 107/178 (60%), Gaps = 35/178 (20%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SEI AVL ++ C++ AA  WTHN+R A +VY+ D++   PI DP
Sbjct  124   EHTTIELTGRDRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSPIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAAS--RTHTERRLHQLMAADRDYEQ----  1191
              R+A+I+  L  V++        R +R ++ A S   THTERRLHQ+M ADRDY++    
Sbjct  184   DRLARIKQLLLYVLKGD------RDMRTANTAVSVGTTHTERRLHQMMYADRDYDREDMG  237

Query  1190  ----------CCPVWS-------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                       C  V +             RDRPKLLFD VC LTDMQYVVFH ++ + 
Sbjct  238   NSPAIDRSKPCVTVENCADKGYTVVNLRCRDRPKLLFDIVCTLTDMQYVVFHGTVGTE  295


 Score =   144 bits (364),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RHKDG  +  E+ER+R+  CL AA +RR++ G+RL++C ++R+GLLSDVTR+FR
Sbjct  300  YQEYYIRHKDGYPIRSEAERQRLVHCLEAAVQRRSTEGIRLELCIEDRIGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVH--------  662
            ENGLS+TRAE+ T+G +A+ +FYV D+SG  V  ET+ESVR EIG TV  V         
Sbjct  360  ENGLSVTRAEVTTRGSQAVNSFYVTDSSGNPVKSETIESVRSEIGQTVLRVKDNIYTNSP  419

Query  661  -KSSGRFT  641
             + SGRF+
Sbjct  420  PQESGRFS  427


 Score = 32.7 bits (73),  Expect(3) = 1e-73, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV DQ G K+ DE +I  IQQ
Sbjct  77    MDVFHVVDQDGNKLFDEKVIDRIQQ  101



>ref|XP_002974009.1| hypothetical protein SELMODRAFT_100599 [Selaginella moellendorffii]
 ref|XP_002983482.1| hypothetical protein SELMODRAFT_180275 [Selaginella moellendorffii]
 gb|EFJ15383.1| hypothetical protein SELMODRAFT_180275 [Selaginella moellendorffii]
 gb|EFJ24964.1| hypothetical protein SELMODRAFT_100599 [Selaginella moellendorffii]
Length=477

 Score =   156 bits (394),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 111/197 (56%), Gaps = 43/197 (22%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKH-GPI  1362
             L EHTA+E+TG DRPGL+SEISAVLA +GC++ AA  WTHN R AC+VYV D   H GP+
Sbjct  126   LAEHTAIELTGNDRPGLLSEISAVLASLGCNVVAAEVWTHNTRVACMVYVTDHEGHGGPV  185

Query  1361  TDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR-------  1203
              DP ++  I+  L  V++    +G  ++ R +D A   THTERRLHQ+M+AD+       
Sbjct  186   KDPTKLCHIKQMLGQVMKGDSLDG--KTAR-TDFAMGLTHTERRLHQMMSADKEEEMEVA  242

Query  1202  -----------------DYE---------------QCCPVWSRDRPKLLFDTVCALTDMQ  1119
                              DY+                   V   DRPKLLFDTVC LTDM+
Sbjct  243   EEEAALSPAPTSISDSVDYKGRPTVTVKNCVEKGYSVVTVQCADRPKLLFDTVCTLTDME  302

Query  1118  YVVFHASISSHDSTSVQ  1068
             YVVFHA+I S    + Q
Sbjct  303   YVVFHATIDSEGPNAFQ  319


 Score =   140 bits (353),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYY+RH DG TLN E+ER+RV +CL AA  RRAS G+RL++ TQ+R+GLLSDVTR+FR
Sbjct  318  FQEYYIRHLDGYTLNTETERQRVVRCLEAAILRRASQGVRLELSTQDRIGLLSDVTRIFR  377

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS+ RAE+ T+ + A+  FYV D +G SVD   +E++R+E+G  + ++  +  RF  
Sbjct  378  ENGLSVARAEVTTRDDMAVNVFYVTDANGGSVDMRVVEAIREEVG--LAILKVTQERFPP  435

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERL  530
                      S   S +     FSLGS   +  ERL
Sbjct  436  -----KMLHSSPTESADKSAARFSLGSFFRSHSERL  466


 Score = 30.8 bits (68),  Expect(3) = 2e-73, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ--VCVA  1625
             + VFHVTD+ G K+ DE +I +I+   VC A
Sbjct  81    MDVFHVTDRDGNKLSDEKVIAHIEHKGVCQA  111



>ref|XP_011020660.1| PREDICTED: uncharacterized protein LOC105122947 isoform X2 [Populus 
euphratica]
Length=443

 Score =   153 bits (387),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 108/175 (62%), Gaps = 31/175 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVLA + C++  A  WTHN RAA ++ V DD     ITDP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDP  179

Query  1352  YRVAQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
              ++++I+  L N+++  + Y G R  V     +   THTERRLHQ+M ADRDYE+     
Sbjct  180   EKLSKIKELLCNLLKGSNKYRGARTVV-----SHGVTHTERRLHQMMFADRDYERANNDV  234

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                    + S+DRPKLLFDTVC LTDM+YVVFHA+I + 
Sbjct  235   LDEKQRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAE  289


 Score =   139 bits (350),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY++H DG  +  E+ER+R+ QCL AA ERR S GL+L++CT +R+GLLSDVTR+FRE
Sbjct  295  QEYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRE  354

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            N L++TRAE+ T+  +A+ TFYV D SG  VD +T++S+RQ IG T+
Sbjct  355  NSLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTI  401


 Score = 32.3 bits (72),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI +
Sbjct  74    MDVFNVTDQDGNKVTDEAILDYITK  98



>ref|XP_011020651.1| PREDICTED: uncharacterized protein LOC105122947 isoform X1 [Populus 
euphratica]
Length=447

 Score =   153 bits (386),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 108/175 (62%), Gaps = 31/175 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVLA + C++  A  WTHN RAA ++ V DD     ITDP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDP  183

Query  1352  YRVAQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
              ++++I+  L N+++  + Y G R  V     +   THTERRLHQ+M ADRDYE+     
Sbjct  184   EKLSKIKELLCNLLKGSNKYRGARTVV-----SHGVTHTERRLHQMMFADRDYERANNDV  238

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                    + S+DRPKLLFDTVC LTDM+YVVFHA+I + 
Sbjct  239   LDEKQRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAE  293


 Score =   139 bits (350),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY++H DG  +  E+ER+R+ QCL AA ERR S GL+L++CT +R+GLLSDVTR+FRE
Sbjct  299  QEYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRE  358

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            N L++TRAE+ T+  +A+ TFYV D SG  VD +T++S+RQ IG T+
Sbjct  359  NSLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTI  405


 Score = 32.3 bits (72),  Expect(3) = 9e-73, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI +
Sbjct  78    MDVFNVTDQDGNKVTDEAILDYITK  102



>ref|XP_010250220.1| PREDICTED: uncharacterized protein LOC104592510 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score =   149 bits (377),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 112/202 (55%), Gaps = 46/202 (23%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             TEHTA+E+TGTDRPGL SEISA L ++GC++  A AW+HN R AC+  + D+S    I D
Sbjct  152   TEHTAIELTGTDRPGLFSEISAALTDLGCNVVEAHAWSHNERLACVALISDESTDSRIDD  211

Query  1355  PYRVAQIQAQLENVVEAHHYN---GERRSVRLSD-PAA------SRTHTERRLHQLMAAD  1206
             P R+A I+  L  V+ A   +    E + V+ +  P        + T+ ERRLHQLM A 
Sbjct  212   PGRLATIEDHLSTVLAATTNSSGANEEQGVKTAGLPGGGDGATPTTTNVERRLHQLMLAG  271

Query  1205  RDY-----------------------------EQC-------CPVWSRDRPKLLFDTVCA  1134
             RD+                             E+C         V +RDRPKL+FDTVC 
Sbjct  272   RDFDGPPGNSSLSSSPYSTEGEEEGKKTVVTIERCDEKGYSVVTVETRDRPKLMFDTVCT  331

Query  1133  LTDMQYVVFHASISSHDSTSVQ  1068
             LTDMQYV+FHASISSH  ++ Q
Sbjct  332   LTDMQYVIFHASISSHGDSAFQ  353


 Score =   140 bits (352),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 15/160 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYY+RH DG  LN ESE++RV +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  352  FQEYYIRHVDGYALNTESEKKRVIKCLEAAIERRVCEGVRLELCANNRVGLLSDITRVLR  411

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            E GL++ RA++ TQGE+A+  FYV+D  G  VD E +ES+++E+      V   + R   
Sbjct  412  EYGLAVVRADVETQGEKAVNAFYVRDIYGNEVDMELVESLKREMESLALEVKNETHR---  468

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                          S E  +   S G +L +QLER S NF
Sbjct  469  ------------PGSPERPQNRLSFGDMLKSQLERFSQNF  496


 Score = 34.7 bits (78),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+ G K+ D+++I +IQQ
Sbjct  94    MDVFHVTDEHGSKLTDQNVIDHIQQ  118



>ref|XP_010250221.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010250223.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   149 bits (377),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 112/202 (55%), Gaps = 46/202 (23%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             TEHTA+E+TGTDRPGL SEISA L ++GC++  A AW+HN R AC+  + D+S    I D
Sbjct  136   TEHTAIELTGTDRPGLFSEISAALTDLGCNVVEAHAWSHNERLACVALISDESTDSRIDD  195

Query  1355  PYRVAQIQAQLENVVEAHHYN---GERRSVRLSD-PAA------SRTHTERRLHQLMAAD  1206
             P R+A I+  L  V+ A   +    E + V+ +  P        + T+ ERRLHQLM A 
Sbjct  196   PGRLATIEDHLSTVLAATTNSSGANEEQGVKTAGLPGGGDGATPTTTNVERRLHQLMLAG  255

Query  1205  RDY-----------------------------EQC-------CPVWSRDRPKLLFDTVCA  1134
             RD+                             E+C         V +RDRPKL+FDTVC 
Sbjct  256   RDFDGPPGNSSLSSSPYSTEGEEEGKKTVVTIERCDEKGYSVVTVETRDRPKLMFDTVCT  315

Query  1133  LTDMQYVVFHASISSHDSTSVQ  1068
             LTDMQYV+FHASISSH  ++ Q
Sbjct  316   LTDMQYVIFHASISSHGDSAFQ  337


 Score =   139 bits (351),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 15/160 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYY+RH DG  LN ESE++RV +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  336  FQEYYIRHVDGYALNTESEKKRVIKCLEAAIERRVCEGVRLELCANNRVGLLSDITRVLR  395

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            E GL++ RA++ TQGE+A+  FYV+D  G  VD E +ES+++E+      V   + R   
Sbjct  396  EYGLAVVRADVETQGEKAVNAFYVRDIYGNEVDMELVESLKREMESLALEVKNETHR---  452

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                          S E  +   S G +L +QLER S NF
Sbjct  453  ------------PGSPERPQNRLSFGDMLKSQLERFSQNF  480


 Score = 34.7 bits (78),  Expect(3) = 1e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD+ G K+ D+++I +IQQ
Sbjct  78    MDVFHVTDEHGSKLTDQNVIDHIQQ  102



>ref|XP_010650073.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100259472 
[Vitis vinifera]
Length=442

 Score =   151 bits (381),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+HT++E+TG+DRPGL+SE+SAVL  + C +  A  WTHN RAA +++V D+     ITD
Sbjct  120   TDHTSIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMHVTDEETGCAITD  179

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++++  L NV++  + + E ++V     +   THTERRLHQ+M ADRDYE+     
Sbjct  180   PERLSKVKQLLCNVLKGSNKSREAKTV----VSHGVTHTERRLHQMMFADRDYERIYNDG  235

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDMQYVVFHA++ +    + 
Sbjct  236   SDEAQRPNVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVDAEGPEAY  295

Query  1070  Q  1068
             Q
Sbjct  296   Q  296


 Score =   138 bits (348),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  295  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  354

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+TRAE+ T+  +A+ TF+V+D SG  VD +T++S+R+ IG T+
Sbjct  355  ENSLSVTRAEVTTRAGKAVNTFHVRDASGYPVDAKTIDSIREAIGQTI  402


 Score = 34.3 bits (77),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G KI DE I+ YIQ+
Sbjct  74    MDVFNVTDQDGNKITDEEILDYIQK  98



>ref|XP_002986453.1| hypothetical protein SELMODRAFT_124305, partial [Selaginella 
moellendorffii]
 gb|EFJ12310.1| hypothetical protein SELMODRAFT_124305, partial [Selaginella 
moellendorffii]
Length=452

 Score =   142 bits (359),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             TE TA+E+ G DRPGL+S+IS VL +M C++ AA  WTHN R AC+VYV D+   GPI D
Sbjct  126   TEQTAIELCGRDRPGLLSDISGVLKDMMCNVVAAEVWTHNLRVACVVYVTDEVTGGPIED  185

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADR---------  1203
               ++A I+A+L   ++        ++    D   +  HTERRLHQ+M+AD          
Sbjct  186   EKKLAVIKARLSQALQGDESGKGSKT----DIPMAVLHTERRLHQIMSADFAAIQPESTN  241

Query  1202  -------------DYEQCCP-------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                            + C         V  +DRPKLLFDTVC LTDM+YVVFHA+I S  
Sbjct  242   TFVAAADKTRPAISVQNCAEKGYSVVNVRCKDRPKLLFDTVCTLTDMKYVVFHAAIRSEG  301

Query  1082  STSVQ  1068
             S + Q
Sbjct  302   SFAYQ  306


 Score =   138 bits (347),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+R  DGCTL  E+E+  V +CL AA ERR   G+RL++CT++R+GLLSDVTR+FR
Sbjct  305  YQEYYIRLMDGCTLKSEAEQEYVVKCLEAAIERRTGGGIRLELCTKDRVGLLSDVTRIFR  364

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRA++ TQG++A+  FYV D SG  VD   +E+ R+EIG ++
Sbjct  365  ENGLSVTRADVSTQGDKAVNVFYVTDASGNPVDRRIVEATRKEIGQSI  412


 Score = 43.1 bits (100),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K++DE II YIQQ
Sbjct  75    MDVFHVTDQLGNKLIDEGIIDYIQQ  99



>ref|XP_010091626.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB44892.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=443

 Score =   147 bits (371),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+ AVL  + C++ +A  WTHN RAA I++V D+     I+DP
Sbjct  120   DHTAIELTGSDRPGLLSEVCAVLTHLKCNVVSAEVWTHNTRAASIMHVTDEETGSAISDP  179

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+++I+  L NV++  + +   ++V     +   THTERRLHQ+M ADRDYE+      
Sbjct  180   ERLSRIKELLCNVLKGSNKSRGAKTV----VSHEVTHTERRLHQMMFADRDYERLDDDAL  235

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDM+YVVFHA+I +    + Q
Sbjct  236   DERQRPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMKYVVFHANIDAEGPEAYQ  295


 Score =   143 bits (360),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  294  YQEYYIRHVDGSPVKSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG  VD +T++S+RQ IG T+
Sbjct  354  ENSLTVTRAEVTTKGGKAMNTFYVSDASGYPVDSKTIDSIRQAIGQTI  401


 Score = 33.1 bits (74),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEGVLDYIQK  98



>ref|XP_010241627.1| PREDICTED: uncharacterized protein LOC104586168 [Nelumbo nucifera]
Length=496

 Score =   149 bits (376),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 107/203 (53%), Gaps = 48/203 (24%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHTA+E+TGTDRPGL SEISAVL ++ C++  A AW+HN R AC+ Y+ D S   PI DP
Sbjct  129   EHTAIELTGTDRPGLFSEISAVLKDLKCNVVEAHAWSHNERLACVAYISDQSTDSPIDDP  188

Query  1352  YRVAQIQAQLENVVEA------HHYNGERRSVRLSDPAAS-----RTHTERRLHQLMAAD  1206
              R+A I+  L  V+ A       H     ++  L  P  S      T+ ERRLHQLM A 
Sbjct  189   RRLATIEEHLATVLGATINGSGTHDEQGVKTAGLPPPGGSINGITTTNVERRLHQLMFAG  248

Query  1205  RDY------------------------------EQC-------CPVWSRDRPKLLFDTVC  1137
             RD+                              E C         V  +DRPKL+FDTVC
Sbjct  249   RDFDGPPANASLSALPSPAEGEEERNKKIIVTIESCNEKRYSVVTVECKDRPKLMFDTVC  308

Query  1136  ALTDMQYVVFHASISSHDSTSVQ  1068
              LTDMQYV+FHASIS H  ++ Q
Sbjct  309   TLTDMQYVIFHASISPHGDSAFQ  331


 Score =   140 bits (352),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 100/160 (63%), Gaps = 13/160 (8%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYY+RH +GC LN ESE++RV +CL AA ERR   G+RL +C  NR+GLLSD+TR+ R
Sbjct  330  FQEYYIRHINGCPLNTESEKQRVIKCLEAALERRVCEGVRLKLCANNRIGLLSDITRLLR  389

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            E GL++ RA++ TQGE+A+  FYV+D SG  VD + +ES+++E+      V        +
Sbjct  390  EYGLAVVRADVETQGEKAVDAFYVRDISGNEVDMKIVESMKREMEALALEVKNEPSSHRR  449

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +             S E     FS G +L +Q+ER S++F
Sbjct  450  S-------------SPERPPFCFSFGDILKSQIERFSHHF  476


 Score = 34.7 bits (78),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHVTD+ G K+ D+++I+ IQQV
Sbjct  78    MDVFHVTDEHGNKLTDQNVINRIQQV  103



>ref|XP_002312346.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
 gb|EEE89713.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
Length=443

 Score =   153 bits (387),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 108/175 (62%), Gaps = 31/175 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVLA + C++  A  WTHN RAA ++ V DD     ITDP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDP  179

Query  1352  YRVAQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
              ++++++  L NV++  + Y G R  V     +   THTERRLHQ+M ADRDYE+     
Sbjct  180   EKLSRVKELLCNVLKGSNKYRGARTVV-----SHGVTHTERRLHQMMFADRDYERANNDV  234

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                    + S+DRPKLLFDTVC LTDM+YVVFHA+I + 
Sbjct  235   LDEKQRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAE  289


 Score =   137 bits (346),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY++H DG  +  E+ER+R+ QCL AA ERR S GL+L++CT++R+GLLSDVTR+FRE
Sbjct  295  QEYYIKHVDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTKDRIGLLSDVTRIFRE  354

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            N L++TRAE+ T+  +A+ TFYV D SG  VD +T++S+RQ  G T+
Sbjct  355  NSLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQATGQTI  401


 Score = 32.3 bits (72),  Expect(3) = 2e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI +
Sbjct  74    MDVFNVTDQDGNKVTDEAILDYITK  98



>ref|XP_010260920.1| PREDICTED: uncharacterized protein LOC104599871 [Nelumbo nucifera]
Length=448

 Score =   149 bits (377),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 109/182 (60%), Gaps = 31/182 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T HT++E+TGTDRPGL+SE+ AVL  + C++  A  WTHN RAA +++V D+     ITD
Sbjct  124   TNHTSIELTGTDRPGLLSEVCAVLTGLKCNVVNAEVWTHNTRAAAVMHVTDEETGSAITD  183

Query  1355  PYRVAQIQAQLENVVEAHHYN-GERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----  1191
             P  +++I+A L NV++ ++   G + +V L       THTERRLHQ+M ADRDYE+    
Sbjct  184   PESLSKIKALLCNVLKGNNKTRGAKTAVSLG-----VTHTERRLHQMMFADRDYERLDDH  238

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     +  +DRPKLLFDTVC LTDMQYVVFHA++ +    +
Sbjct  239   AFDEKQRPNVTVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEQPEA  298

Query  1073  VQ  1068
              Q
Sbjct  299   YQ  300


 Score =   144 bits (364),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  299  YQEFYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+  +AI TFYV+D +G  VD +T++S+RQ IG T+
Sbjct  359  ENGLAVTRAEVTTRAGKAINTFYVRDAAGNPVDAKTIDSIRQVIGQTI  406


 Score = 29.3 bits (64),  Expect(3) = 3e-72, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ DE I+ YI++
Sbjct  78    MDVFNVTDREGNKLKDEGILEYIRK  102



>gb|KDP41357.1| hypothetical protein JCGZ_15764 [Jatropha curcas]
Length=447

 Score =   150 bits (380),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 108/181 (60%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T HTA+E+TG+DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V D+     ITD
Sbjct  123   TGHTAIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMQVTDEETGSAITD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R+++I+  L NV++  + +   ++V     +   THTERRLHQ+M ADRDYE+     
Sbjct  183   PERLSRIKGLLCNVLKGSNKSRGAKTV----VSHGATHTERRLHQMMFADRDYERADDDV  238

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDM+YVVFHA+I +    + 
Sbjct  239   LDEKQRPNVSVVNLYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAY  298

Query  1070  Q  1068
             Q
Sbjct  299   Q  299


 Score =   139 bits (351),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VD +T++S+RQ IG T+
Sbjct  358  ENSLTVTRAEVTTRDGKALNTFYVRDASGYPVDAKTIDSIRQVIGQTI  405


 Score = 32.0 bits (71),  Expect(3) = 4e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+V DQ G KI+DE+I+ YI++
Sbjct  78    MDVFNVRDQDGNKIIDEAILDYIRK  102



>gb|KHN29949.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=452

 Score =   150 bits (380),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 109/181 (60%), Gaps = 30/181 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+ GTDRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITDP
Sbjct  128   DHTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEESGSAITDP  187

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R++ I+  L NV+   +     ++V ++D A   THTERRLHQ+M ADRDYE+      
Sbjct  188   QRLSIIKELLCNVLGGGNKKRGAKTV-VTDEA---THTERRLHQMMFADRDYERVNDDDD  243

Query  1187  ----------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                          WS           +DRPKLLFDTVC LTDMQYVVFHA+I +    + 
Sbjct  244   FAEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAY  303

Query  1070  Q  1068
             Q
Sbjct  304   Q  304


 Score =   142 bits (357),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYYIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  363  ENSLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTI  410


 Score = 29.3 bits (64),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VT Q G K+ DE+I+ YI++
Sbjct  82    MDVFNVTGQDGNKVTDEAILDYIRK  106



>ref|XP_010249096.1| PREDICTED: uncharacterized protein LOC104591777 [Nelumbo nucifera]
Length=453

 Score =   148 bits (374),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 110/159 (69%), Gaps = 15/159 (9%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RHKDGC ++ E+ER+R+  CL+AA +RR++ G+RL++C+++R+GLLSDVTR+FRE
Sbjct  303  QEYYIRHKDGCPISSEAERQRLIHCLVAAIQRRSTEGIRLELCSEDRVGLLSDVTRIFRE  362

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGL +TRAE+ T G +A+  FYV D+SG  V  ET+E+VR EIG T  ++H     +T  
Sbjct  363  NGLVVTRAEVTTCGSQAVNVFYVMDSSGNPVKSETIEAVRSEIGQT--ILHVKEEMYTN-  419

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                      +  + E+G+  FSLG+L  ++ E++  N 
Sbjct  420  ----------KTPAQENGR--FSLGNLFRSRSEKILYNL  446


 Score =   142 bits (357),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 110/185 (59%), Gaps = 36/185 (19%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SEI AVL ++ C++ AA  WTHN+R A +VY+ D++    I D 
Sbjct  125   EHTTVELTGRDRPGLLSEIFAVLMDLKCNVVAAEIWTHNSRMASVVYINDEATGSSIDDG  184

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAAS--RTHTERRLHQLMAADRDYEQ----  1191
              R+A+I+  L  V++        R +R ++ A S   THT+RRLHQ+M ADRDY++    
Sbjct  185   DRLARIKQLLLYVLKGD------RDMRTANTAVSVGATHTQRRLHQMMYADRDYDKDYYV  238

Query  1190  -----------CCPVWS-------------RDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                        C  V +             +DRPKLLFDTVC LTDMQYVVFHA++++  
Sbjct  239   DGVPTTDRSKPCVMVENCVDKGYTVVNLRCQDRPKLLFDTVCTLTDMQYVVFHATVNTEG  298

Query  1082  STSVQ  1068
               + Q
Sbjct  299   PEACQ  303


 Score = 32.0 bits (71),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV DQ G K+ DE +I  IQQ
Sbjct  77    MDVFHVIDQNGNKLSDEKVIDRIQQ  101



>ref|XP_004490253.1| PREDICTED: uncharacterized protein LOC101508719 isoform X4 [Cicer 
arietinum]
Length=450

 Score =   150 bits (380),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  119   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  177

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  178   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  233

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  234   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  293

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  294   NIDAEGPQAYQ  304


 Score =   138 bits (348),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  303  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  363  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  410


 Score = 32.7 bits (73),  Expect(3) = 6e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  83    MDVFNVTDQDGNKVTDEAILDYIRK  107



>ref|XP_004490254.1| PREDICTED: uncharacterized protein LOC101508719 isoform X5 [Cicer 
arietinum]
Length=450

 Score =   150 bits (380),  Expect(3) = 7e-72, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  119   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  177

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  178   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  233

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  234   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  293

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  294   NIDAEGPQAYQ  304


 Score =   138 bits (348),  Expect(3) = 7e-72, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  303  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  363  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  410


 Score = 32.7 bits (73),  Expect(3) = 7e-72, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  83    MDVFNVTDQDGNKVTDEAILDYIRK  107



>ref|XP_002978936.1| hypothetical protein SELMODRAFT_109915, partial [Selaginella 
moellendorffii]
 gb|EFJ19893.1| hypothetical protein SELMODRAFT_109915, partial [Selaginella 
moellendorffii]
Length=452

 Score =   141 bits (356),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 107/196 (55%), Gaps = 34/196 (17%)
 Frame = -1

Query  1568  IGRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV  1389
             +GR V  R   TE TA+E+ G DRPGL+S+IS VL +M C++ AA  WTHN R AC+VYV
Sbjct  116   LGRRVSLRSN-TEQTAIELCGRDRPGLLSDISGVLKDMMCNVVAAEVWTHNLRVACVVYV  174

Query  1388  EDDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAA  1209
              D+   GPI D  ++A I+A+L   ++        ++    D   +  HTERRLHQ+M+A
Sbjct  175   TDEVTGGPIEDEKKLAVIKARLSQALQGDESGKGSKT----DIPMAVLHTERRLHQIMSA  230

Query  1208  DR----------------------DYEQCCP-------VWSRDRPKLLFDTVCALTDMQY  1116
             D                         + C         V   DRPKLLFDTVC LTDM+Y
Sbjct  231   DFAAIQPESTNTFVAAADKTRPAISVQNCAEKGYSVVNVRCNDRPKLLFDTVCTLTDMKY  290

Query  1115  VVFHASISSHDSTSVQ  1068
             VVFHA+I S  S + Q
Sbjct  291   VVFHAAIRSEGSFAYQ  306


 Score =   138 bits (347),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+R  DGCTL  E+E+  V +CL AA ERR   G+RL++CT++R+GLLSDVTR+FR
Sbjct  305  YQEYYIRLMDGCTLKSEAEQEYVVKCLEAAIERRTGGGIRLELCTKDRVGLLSDVTRIFR  364

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRA++ TQG++A+  FYV D SG  VD   +E+ R+EIG ++
Sbjct  365  ENGLSVTRADVSTQGDKAVNVFYVTDASGNPVDRRIVEATRKEIGQSI  412


 Score = 42.0 bits (97),  Expect(3) = 8e-72, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQLG K+ DE II YIQQ
Sbjct  75    MDVFHVTDQLGNKLTDEGIIDYIQQ  99



>ref|XP_010270359.1| PREDICTED: uncharacterized protein LOC104606716 [Nelumbo nucifera]
 ref|XP_010270360.1| PREDICTED: uncharacterized protein LOC104606716 [Nelumbo nucifera]
Length=450

 Score =   156 bits (394),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 110/185 (59%), Gaps = 31/185 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA + C++ AA AWTHN R AC+ YV DD+    + 
Sbjct  127   IGDHTAIELIGKDRPGLLSEISAVLANLHCNVVAAEAWTHNMRVACVFYVNDDTTCQAVD  186

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+N++  H  +G+      S      TH +RRLHQ+M ADRDYE     
Sbjct  187   DPIRLSAMEEQLKNILRGHEDDGKAAQTSFS---MGLTHMDRRLHQMMFADRDYEAGGVT  243

Query  1193  ----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                             +C         V  +DR KL+FD VC LTDMQYVVFHA+ISS  
Sbjct  244   GDIDYAPSFRPIITVDRCEDKGYSVVTVRCKDRSKLMFDIVCTLTDMQYVVFHAAISSDG  303

Query  1082  STSVQ  1068
              +++Q
Sbjct  304   PSALQ  308


 Score =   132 bits (331),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RH DGC L+ E E+ RV +CL AA  RR   GL L++C ++R+GLLS+VTRV R
Sbjct  307  LQEYYIRHMDGCLLDTEGEKERVVKCLEAAVRRRVCEGLSLELCARDRVGLLSEVTRVLR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRA + T G +A+  FYVKD SG  VD +T+E++R+EIG T+
Sbjct  367  ENGLSVTRAGVTTVGGQAMNIFYVKDASGNPVDMKTIEALRKEIGHTM  414


 Score = 33.5 bits (75),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHVTDQ G K+ D   I YI++V
Sbjct  76    MDVFHVTDQQGNKVTDTKTIEYIEKV  101



>gb|KHG02132.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score =   147 bits (371),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 109/180 (61%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+     I+DP
Sbjct  122   DHTAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEETETAISDP  181

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+++I++ L NV++  + +   ++V     + S THTERRLHQ+M ADRDYE+      
Sbjct  182   ERLSRIKSLLCNVLKGSNKSSLAKTV----VSHSVTHTERRLHQMMFADRDYERTGGDVL  237

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFDTVC LTDM YVVFHA+I +    S Q
Sbjct  238   DDRQRPNVDVVNWHDKDYSVVTIGCKDRPKLLFDTVCTLTDMDYVVFHANIDTLGPDSYQ  297


 Score =   141 bits (355),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RVTQCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  296  YQEYYIRHLDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  355

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VD +T++S+RQ +G T+
Sbjct  356  ENSLTVTRAEVTTKAGKAVNTFYVRDASGYPVDVKTIDSIRQVLGQTI  403


 Score = 32.7 bits (73),  Expect(3) = 9e-72, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G KI+DE I+ YI++
Sbjct  76    MDVFNVTDQDGNKILDEGILDYIRK  100



>ref|XP_004490255.1| PREDICTED: uncharacterized protein LOC101508719 isoform X6 [Cicer 
arietinum]
Length=442

 Score =   150 bits (379),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  111   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  169

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  170   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  225

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  226   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  285

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  286   NIDAEGPQAYQ  296


 Score =   138 bits (348),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  295  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  354

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  355  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  402


 Score = 32.7 bits (73),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  75    MDVFNVTDQDGNKVTDEAILDYIRK  99



>ref|XP_004490250.1| PREDICTED: uncharacterized protein LOC101508719 isoform X1 [Cicer 
arietinum]
Length=480

 Score =   150 bits (380),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  149   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  207

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  208   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  263

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  264   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  323

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  324   NIDAEGPQAYQ  334


 Score =   138 bits (348),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  333  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  392

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  393  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  440


 Score = 32.3 bits (72),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  113   MDVFNVTDQDGNKVTDEAILDYIRK  137



>ref|XP_004490251.1| PREDICTED: uncharacterized protein LOC101508719 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   150 bits (380),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  149   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  207

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  208   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  263

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  264   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  323

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  324   NIDAEGPQAYQ  334


 Score =   138 bits (348),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  333  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  392

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  393  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  440


 Score = 32.3 bits (72),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  113   MDVFNVTDQDGNKVTDEAILDYIRK  137



>ref|XP_004490252.1| PREDICTED: uncharacterized protein LOC101508719 isoform X3 [Cicer 
arietinum]
Length=472

 Score =   150 bits (379),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 111/191 (58%), Gaps = 30/191 (16%)
 Frame = -1

Query  1565  GRDVRPRYVLTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVE  1386
             GR V  +  + +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V 
Sbjct  141   GRSVGVKQTM-DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVN  199

Query  1385  DDSKHGPITDPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             D+     ITDP R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M AD
Sbjct  200   DEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFAD  255

Query  1205  RDYEQC-------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHA  1101
             RDYE+                            + S+DRPKLLFDTVC LTDMQYVVFHA
Sbjct  256   RDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHA  315

Query  1100  SISSHDSTSVQ  1068
             +I +    + Q
Sbjct  316   NIDAEGPQAYQ  326


 Score =   138 bits (347),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L+ICT +R+GLLS+VTR+FR
Sbjct  325  YQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFR  384

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  385  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTI  432


 Score = 32.3 bits (72),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE+I+ YI++
Sbjct  105   MDVFNVTDQDGNKVTDEAILDYIRK  129



>ref|XP_008339767.1| PREDICTED: uncharacterized protein LOC103402787 [Malus domestica]
Length=447

 Score =   146 bits (369),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 107/180 (59%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             + T +E+TG+DRPGL+SE+SAVL    C++ +A  WTHN RAA +++V D+     ITDP
Sbjct  124   DSTVIELTGSDRPGLLSEVSAVLTNHKCNVVSAEVWTHNTRAASVMHVTDEETGLAITDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A I+  L NV++  +     R+V     + + THTERRLHQ+M ADRDYE+      
Sbjct  184   QRLAXIKELLCNVLKGSNKARGARTV----VSHAVTHTERRLHQMMFADRDYERVHDGVL  239

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDMQYV+FHASI +    + Q
Sbjct  240   DDKQRPDVSVVNWHDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVIFHASIDAEGPEAYQ  299


 Score =   143 bits (361),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VD +T+ES+RQ IG T+
Sbjct  358  ENSLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQVIGQTI  405


 Score = 31.2 bits (69),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDHDGNKVTDEEVLDYIQK  102



>ref|XP_010066809.1| PREDICTED: uncharacterized protein LOC104453874 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64855.1| hypothetical protein EUGRSUZ_G02423 [Eucalyptus grandis]
Length=446

 Score =   144 bits (363),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 108/180 (60%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA +++V D+     +TDP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSAVTDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+ +I+  L NV++  + +   ++V     +   T T RRLHQ+M ADRDYE+      
Sbjct  184   ERLTRIRELLCNVLKGSNKSRGAKTV----VSHGVTLTTRRLHQMMFADRDYERTDDDML  239

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDMQYVVFHA+I +    + Q
Sbjct  240   DEKQRPNVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  299


 Score =   144 bits (363),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH+DG  +N ++ER R+  CL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  298  YQEYYIRHQDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L++TRAE+ T+  +A+ TFYV+D SG  VDP+T++S+R+ IG T+  V  +SG    
Sbjct  358  ENSLTVTRAEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTILHVKGNSGESKP  417

Query  637  A  635
            A
Sbjct  418  A  418


 Score = 32.3 bits (72),  Expect(3) = 1e-71, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VF+VTDQ G KI+++ I+ YI++V
Sbjct  78    MDVFNVTDQDGNKIMNDEILDYIKKV  103



>ref|XP_010066810.1| PREDICTED: uncharacterized protein LOC104453874 isoform X2 [Eucalyptus 
grandis]
Length=442

 Score =   144 bits (363),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 108/180 (60%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA +++V D+     +TDP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSAVTDP  179

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+ +I+  L NV++  + +   ++V     +   T T RRLHQ+M ADRDYE+      
Sbjct  180   ERLTRIRELLCNVLKGSNKSRGAKTV----VSHGVTLTTRRLHQMMFADRDYERTDDDML  235

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDMQYVVFHA+I +    + Q
Sbjct  236   DEKQRPNVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  295


 Score =   144 bits (363),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH+DG  +N ++ER R+  CL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  294  YQEYYIRHQDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L++TRAE+ T+  +A+ TFYV+D SG  VDP+T++S+R+ IG T+  V  +SG    
Sbjct  354  ENSLTVTRAEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTILHVKGNSGESKP  413

Query  637  A  635
            A
Sbjct  414  A  414


 Score = 32.3 bits (72),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VF+VTDQ G KI+++ I+ YI++V
Sbjct  74    MDVFNVTDQDGNKIMNDEILDYIKKV  99



>ref|XP_006573170.1| PREDICTED: uncharacterized protein LOC100787134 isoform X2 [Glycine 
max]
Length=452

 Score =   150 bits (380),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 109/182 (60%), Gaps = 30/182 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+H A+E+ GTDRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITD
Sbjct  127   TDHIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITD  186

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R++ I+  L NV+   +     ++V ++D A   THTERRLHQ+M ADRDYE+     
Sbjct  187   PQRLSIIKELLCNVLGGGNKKRGAKTV-VTDEA---THTERRLHQMMFADRDYERVNDDD  242

Query  1187  -----------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                           WS           +DRPKLLFDTVC LTDMQYVVFHA+I +    +
Sbjct  243   DFDEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEA  302

Query  1073  VQ  1068
              Q
Sbjct  303   YQ  304


 Score =   140 bits (353),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYYIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  363  ENSLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTI  410


 Score = 29.3 bits (64),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VT Q G K+ DE+I+ YI++
Sbjct  82    MDVFNVTGQDGNKVTDEAILDYIRK  106



>ref|XP_003518790.2| PREDICTED: uncharacterized protein LOC100813551 isoform 1 [Glycine 
max]
Length=452

 Score =   149 bits (376),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 109/181 (60%), Gaps = 30/181 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+ GTDRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     I+DP
Sbjct  128   DHTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEETGSAISDP  187

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R++ I+  L NV+   +     ++V ++D A   THTERRLHQ+M ADRDYE+      
Sbjct  188   QRLSIIKELLCNVLGGGNKKRGAKTV-VTDEA---THTERRLHQMMFADRDYERVNDDDD  243

Query  1187  ----------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                          WS           +DRPKLLFDTVC LTDMQYVVFHA+I +    + 
Sbjct  244   FAEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAY  303

Query  1070  Q  1068
             Q
Sbjct  304   Q  304


 Score =   142 bits (357),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYYIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  363  ENSLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTI  410


 Score = 29.3 bits (64),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VT Q G K+ DE+I+ YI++
Sbjct  82    MDVFNVTGQDGNKVTDEAILDYIRK  106



>ref|XP_011039651.1| PREDICTED: uncharacterized protein LOC105136133 [Populus euphratica]
 ref|XP_011039652.1| PREDICTED: uncharacterized protein LOC105136133 [Populus euphratica]
Length=475

 Score =   149 bits (377),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 109/196 (56%), Gaps = 40/196 (20%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              EHTA+EM+G DRPGL SEISA LA++ C+I  A AW+HNA  AC+ Y+ D S H PI D
Sbjct  131   NEHTAIEMSGADRPGLFSEISATLADLHCNIVEAHAWSHNACLACVAYISDQSSHTPIED  190

Query  1355  PYRVAQIQAQLENVVEAHH--------YNGERRSVRLSDPAASR---THTERRLHQLMAA  1209
             P+R+A I+  L  V+ A+         +  + R V+     A     T+ ERRLHQLM +
Sbjct  191   PHRLASIEDHLITVLRANMEPSISTGPFQIKNREVKTGGFLAGEGTMTNVERRLHQLMLS  250

Query  1208  DRDY----------------------EQC-------CPVWSRDRPKLLFDTVCALTDMQY  1116
              RD+                      E C         +  +DRP+L+FDTVC LTDMQY
Sbjct  251   VRDFDGPRSSTEMNITERGTKMAVSIENCDQKGYSIVTIECKDRPRLMFDTVCTLTDMQY  310

Query  1115  VVFHASISSHDSTSVQ  1068
             V+FHAS+ SHD  + Q
Sbjct  311   VIFHASVVSHDGRAFQ  326


 Score =   140 bits (354),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 105/160 (66%), Gaps = 13/160 (8%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH DG  LN ESE++RV +CL AA ERR   G+ L +C +NR+GLLSD+TRV R
Sbjct  325  FQEYFIRHDDGYPLNTESEKQRVIKCLEAAIERRVCEGVWLKLCAENRVGLLSDITRVLR  384

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA+I T+G++A+  FYV+D SG  VD   ++S+++E+ G + +  K+  +  +
Sbjct  385  ENGLAVVRADIATKGKKAVNAFYVRDISGNEVDMGFIKSMKKEM-GLIDLEVKNDNKTRR  443

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               S +             +  FSLG LL +QLER S+NF
Sbjct  444  KNISSHE------------RHSFSLGDLLKSQLERFSHNF  471


 Score = 30.0 bits (66),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+++I+ IQQ
Sbjct  78    MDVFHVQDEQGKKLRDQNVINCIQQ  102



>ref|XP_003516462.1| PREDICTED: uncharacterized protein LOC100787134 isoform X1 [Glycine 
max]
Length=449

 Score =   150 bits (380),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 109/182 (60%), Gaps = 30/182 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+H A+E+ GTDRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITD
Sbjct  124   TDHIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITD  183

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R++ I+  L NV+   +     ++V ++D A   THTERRLHQ+M ADRDYE+     
Sbjct  184   PQRLSIIKELLCNVLGGGNKKRGAKTV-VTDEA---THTERRLHQMMFADRDYERVNDDD  239

Query  1187  -----------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                           WS           +DRPKLLFDTVC LTDMQYVVFHA+I +    +
Sbjct  240   DFDEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEA  299

Query  1073  VQ  1068
              Q
Sbjct  300   YQ  301


 Score =   140 bits (353),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  300  YQEYYIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  360  ENSLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTI  407


 Score = 29.3 bits (64),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VT Q G K+ DE+I+ YI++
Sbjct  79    MDVFNVTGQDGNKVTDEAILDYIRK  103



>gb|KHN02615.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=438

 Score =   150 bits (380),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 109/182 (60%), Gaps = 30/182 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+H A+E+ GTDRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITD
Sbjct  113   TDHIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITD  172

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R++ I+  L NV+   +     ++V ++D A   THTERRLHQ+M ADRDYE+     
Sbjct  173   PQRLSIIKELLCNVLGGGNKKRGAKTV-VTDEA---THTERRLHQMMFADRDYERVNDDD  228

Query  1187  -----------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                           WS           +DRPKLLFDTVC LTDMQYVVFHA+I +    +
Sbjct  229   DFDEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEA  288

Query  1073  VQ  1068
              Q
Sbjct  289   YQ  290


 Score =   140 bits (353),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  289  YQEYYIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFR  348

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  349  ENSLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTI  396


 Score = 29.3 bits (64),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VT Q G K+ DE+I+ YI++
Sbjct  68    MDVFNVTGQDGNKVTDEAILDYIRK  92



>ref|XP_006847223.1| hypothetical protein AMTR_s00017p00256400 [Amborella trichopoda]
 gb|ERN08804.1| hypothetical protein AMTR_s00017p00256400 [Amborella trichopoda]
Length=444

 Score =   157 bits (396),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 110/174 (63%), Gaps = 24/174 (14%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TA+E+ G+DRPGL+SEISA+LA + C++ AA  WTH  R AC+VYV D +   P+ DP R
Sbjct  132   TAIELVGSDRPGLLSEISAILASLDCNVVAAEVWTHRTRIACVVYVTDSTTSRPLDDPAR  191

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY----------  1197
             +A ++ QL NV++    +G+RRS R ++ +    HT+RRLHQ+M ADRDY          
Sbjct  192   LAAVEEQLRNVLKGR--DGDRRSAR-TNFSLGFMHTDRRLHQMMFADRDYEEEGEEEEAP  248

Query  1196  ----EQC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                 + C         V  +DRPKLLFDTVC LTDM YVVFHASI S    ++Q
Sbjct  249   LVSVDTCGERGYSVVNVRCKDRPKLLFDTVCTLTDMHYVVFHASIVSQGPHALQ  302


 Score =   132 bits (331),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RHKDGC L+ +SE++RV +CL AA +RR S+GL L++C  +R+GLLSDVTRVFR
Sbjct  301  LQEYYIRHKDGCILDGDSEKQRVIKCLEAAIQRRVSNGLTLEMCASDRVGLLSDVTRVFR  360

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTS-GQSVDPETLESVRQEIGGTV  674
            ENGLS+TRA + T G +A+  FYV+  S G+ VD +T+E++R+EIG  +
Sbjct  361  ENGLSVTRAGVTTIGGKAMNVFYVRYASTGEPVDTKTIEALRREIGNAM  409


 Score = 31.2 bits (69),  Expect(3) = 2e-71, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVT+Q+G K+ D   + YI++
Sbjct  76    MDVFHVTNQMGQKLTDTKTMEYIEK  100



>gb|ACL53099.1| unknown [Zea mays]
 tpg|DAA45794.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=440

 Score =   147 bits (372),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DGC +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  293  YQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  352

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G+ A+ TFYV+D +G +V+  TLE++RQEIG TV
Sbjct  353  ENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTV  400


 Score =   143 bits (361),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D      ++D
Sbjct  114   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  173

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               RV +I+ +L NV     + G  R  + +      TH ERRLHQ+M  DRDYE+     
Sbjct  174   AERVGRIKGRLYNV-----FRGRSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDD  228

Query  1190  ---------CCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                        PV S                RDRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  229   GRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTE  288

Query  1085  DSTSVQ  1068
                + Q
Sbjct  289   GPEAYQ  294


 Score = 28.1 bits (61),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQ  1640
             + VF VT+Q G+KI DES++  I+
Sbjct  64    MDVFTVTNQSGHKITDESVLQGIK  87



>ref|XP_008668558.1| PREDICTED: ACR4 isoform X1 [Zea mays]
 tpg|DAA45791.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=459

 Score =   148 bits (373),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DGC +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  312  YQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  371

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G+ A+ TFYV+D +G +V+  TLE++RQEIG TV
Sbjct  372  ENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTV  419


 Score =   143 bits (360),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D      ++D
Sbjct  133   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  192

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               RV +I+ +L NV     + G  R  + +      TH ERRLHQ+M  DRDYE+     
Sbjct  193   AERVGRIKGRLYNV-----FRGRSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDD  247

Query  1190  ---------CCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                        PV S                RDRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  248   GRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTE  307

Query  1085  DSTSVQ  1068
                + Q
Sbjct  308   GPEAYQ  313


 Score = 28.5 bits (62),  Expect(3) = 3e-71, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQ  1640
             + VF VT+Q G+KI DES++  I+
Sbjct  83    MDVFTVTNQSGHKITDESVLQGIK  106



>ref|XP_002266641.1| PREDICTED: uncharacterized protein LOC100250497 [Vitis vinifera]
 emb|CBI38152.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   145 bits (366),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 103/175 (59%), Gaps = 36/175 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              EHT +E+TG DRPGL+SE+ AVLA++ C++ AA  WTHN+R A +VY+ DD    PI D
Sbjct  123   NEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGLPIDD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R+ +I+  L  V++      ++RS   +    S T+T+RRLHQ+M ADRDY+      
Sbjct  183   PDRLVKIKQLLLYVLKGDR---DKRSANTAVSVGS-TNTQRRLHQMMYADRDYDMDSGST  238

Query  1187  ------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                                     CP    DRPKLLFDTVC LTDMQYVVFHA++
Sbjct  239   NDRSKPLVTVENFADKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVFHATV  289


 Score =   144 bits (364),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 95/128 (74%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E+E++RV  CL AA  RR S G+RL++C+++R+GLLSDVTR+FR
Sbjct  297  YQEYYIRHVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRIFR  356

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV---------KVV  665
            ENGLS+TRAE+ T+G +A+  FYV D+SG  V  ET+E+VR+EIG T+         K  
Sbjct  357  ENGLSVTRAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIGLTILRVKDDAYSKSP  416

Query  664  HKSSGRFT  641
             + SGRF+
Sbjct  417  PQESGRFS  424


 Score = 29.3 bits (64),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++ +   IQQ
Sbjct  77    MDVFHVTDQKGNKLSEDDVAERIQQ  101



>gb|ACG25547.1| ACR4 [Zea mays]
Length=458

 Score =   148 bits (373),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DGC +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  311  YQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  370

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G+ A+ TFYV+D +G +V+  TLE++RQEIG TV
Sbjct  371  ENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTV  418


 Score =   142 bits (359),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D      ++D
Sbjct  132   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  191

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               RV +I+ +L NV     + G  R  + +      TH ERRLHQ+M  DRDYE+     
Sbjct  192   AERVGRIKGRLYNV-----FRGRSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDD  246

Query  1190  ---------CCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                        PV S                RDRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  247   GRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTE  306

Query  1085  DSTSVQ  1068
                + Q
Sbjct  307   GPEAYQ  312


 Score = 28.5 bits (62),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQ  1640
             + VF VT+Q G+KI DES++  I+
Sbjct  82    MDVFTVTNQSGHKITDESVLQGIK  105



>tpg|DAA45793.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=433

 Score =   147 bits (372),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DGC +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  286  YQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  345

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G+ A+ TFYV+D +G +V+  TLE++RQEIG TV
Sbjct  346  ENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTV  393


 Score =   143 bits (361),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D      ++D
Sbjct  107   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  166

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               RV +I+ +L NV     + G  R  + +      TH ERRLHQ+M  DRDYE+     
Sbjct  167   AERVGRIKGRLYNV-----FRGRSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDD  221

Query  1190  ---------CCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                        PV S                RDRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  222   GRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTE  281

Query  1085  DSTSVQ  1068
                + Q
Sbjct  282   GPEAYQ  287


 Score = 28.5 bits (62),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQ  1640
             + VF VT+Q G+KI DES++  I+
Sbjct  57    MDVFTVTNQSGHKITDESVLQGIK  80



>ref|NP_001142223.1| ACR4 [Zea mays]
 gb|ACF87927.1| unknown [Zea mays]
 gb|ACN27877.1| unknown [Zea mays]
 tpg|DAA45792.1| TPA: ACR4 [Zea mays]
Length=458

 Score =   148 bits (373),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DGC +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  311  YQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  370

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G+ A+ TFYV+D +G +V+  TLE++RQEIG TV
Sbjct  371  ENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTV  418


 Score =   142 bits (359),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TGTDRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D      ++D
Sbjct  132   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  191

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               RV +I+ +L NV     + G  R  + +      TH ERRLHQ+M  DRDYE+     
Sbjct  192   AERVGRIKGRLYNV-----FRGRSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDD  246

Query  1190  ---------CCPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                        PV S                RDRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  247   GRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTE  306

Query  1085  DSTSVQ  1068
                + Q
Sbjct  307   GPEAYQ  312


 Score = 28.5 bits (62),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQ  1640
             + VF VT+Q G+KI DES++  I+
Sbjct  82    MDVFTVTNQSGHKITDESVLQGIK  105



>emb|CAN83845.1| hypothetical protein VITISV_001862 [Vitis vinifera]
Length=465

 Score =   145 bits (365),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 103/175 (59%), Gaps = 36/175 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              EHT +E+TG DRPGL+SE+ AVLA++ C++ AA  WTHN+R A +VY+ DD    PI D
Sbjct  123   NEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGLPIDD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P R+ +I+  L  V++      ++RS   +    S T+T+RRLHQ+M ADRDY+      
Sbjct  183   PDRLVKIKQLLLYVLKGDR---DKRSANTAVSVGS-TNTQRRLHQMMYADRDYDMDSGST  238

Query  1187  ------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                                     CP    DRPKLLFDTVC LTDMQYVVFHA++
Sbjct  239   NDRSKPLVTVENFADKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVFHATV  289


 Score =   144 bits (364),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 95/128 (74%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E+E++RV  CL AA  RR S G+RL++C+++R+GLLSDVTR+FR
Sbjct  297  YQEYYIRHVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRIFR  356

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV---------KVV  665
            ENGLS+TRAE+ T+G +A+  FYV D+SG  V  ET+E+VR+EIG T+         K  
Sbjct  357  ENGLSVTRAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIGLTILRVKDDAYSKSP  416

Query  664  HKSSGRFT  641
             + SGRF+
Sbjct  417  PQESGRFS  424


 Score = 29.6 bits (65),  Expect(3) = 4e-71, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++ +   IQQ
Sbjct  77    MDVFHVTDQKGNKLSEDDVAERIQQ  101



>ref|XP_006302244.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
 gb|EOA35142.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
Length=455

 Score =   145 bits (366),  Expect(3) = 8e-71, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 105/185 (57%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C + +A  WTHN RAA ++ V DD     I+D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLNHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCGISD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYEQ     
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTV----VSQGEVHTDRRLHQMMFEDRDYEQTVVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   139 bits (351),  Expect(3) = 8e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 33.1 bits (74),  Expect(3) = 8e-71, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>gb|EPS70014.1| hypothetical protein M569_04746, partial [Genlisea aurea]
Length=447

 Score =   144 bits (364),  Expect(3) = 9e-71, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 101/179 (56%), Gaps = 26/179 (15%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T HT++E+ GTDRPGL+SE+ AVL  + C++  A  WTHN RAA ++ V ++   G ITD
Sbjct  129   TNHTSIELIGTDRPGLLSEVCAVLTNLKCNVVNAEVWTHNTRAAAVMQVTEEDAGGAITD  188

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCP--  1182
             P +++ ++  L NV++            +S  A   THTERRLHQ+M  DRDYE+     
Sbjct  189   PEKLSLVKKLLCNVLKGSSSKSREAKTGVSHGA---THTERRLHQMMFDDRDYERMGDNE  245

Query  1181  ---------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                  +  +DRPKLLFD VC LTDMQYVVFH S+ S  S + Q
Sbjct  246   SAHRPNVTIDDWHDRDYSVVMIRCKDRPKLLFDVVCTLTDMQYVVFHGSVESRGSEAYQ  304


 Score =   141 bits (356),  Expect(3) = 9e-71, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY +RH DG ++  ++ER+RV QCL AA  RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYCIRHVDGSSVKSDAERQRVVQCLEAAIRRRVSEGLKLELCTNDRVGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+D SG +VDP+ ++S+RQ IG TV
Sbjct  363  ENSLTVTRAEVSTRGGKAVNTFYVRDASGYAVDPKIIDSIRQSIGQTV  410


 Score = 32.3 bits (72),  Expect(3) = 9e-71, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G KI DE I+ YIQ+
Sbjct  83    MDVFNVTDLDGNKITDEGILEYIQK  107



>ref|XP_011086838.1| PREDICTED: uncharacterized protein LOC105168447 isoform X1 [Sesamum 
indicum]
Length=462

 Score =   147 bits (371),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 103/177 (58%), Gaps = 38/177 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHT +E++G DRPGL+SE+ AVL ++ C++ AA  WTHN+R A +VY+ D++   PI D
Sbjct  136   SEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEANGSPIND  195

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-------  1197
             P R+A I+  L  V++      E RS   S  +   THT+RRLHQ+M ADRDY       
Sbjct  196   PERLANIKQLLLYVLKGDR---EWRSAN-SAVSVGSTHTQRRLHQMMYADRDYDVQNVDN  251

Query  1196  ------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                         E C           CP    DRPKLLFDTVC LTDMQYVVFH +I
Sbjct  252   ATTERTKPLVTVENCVEKGYTVVNLSCP----DRPKLLFDTVCTLTDMQYVVFHGTI  304


 Score =   143 bits (361),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGC ++ E+ER+RV  CL AA +RR S G+RL++C+ +R+GLLSDVTR+FRE
Sbjct  313  QEYYIRHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCSDDRVGLLSDVTRIFRE  372

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            NGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VR+EIG T+
Sbjct  373  NGLSVTRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIGLTI  419


 Score = 27.3 bits (59),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ ++++   IQQ
Sbjct  90    MDVFYVTDEFGNKVYEDNVSERIQQ  114



>ref|XP_009105454.1| PREDICTED: uncharacterized protein LOC103831311 isoform X1 [Brassica 
rapa]
Length=454

 Score =   144 bits (362),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 104/184 (57%), Gaps = 32/184 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DD     ++D
Sbjct  123   TDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I++ L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKSLLRNVLKGSNTPKEAKTV----VSLGEVHTDRRLHQMMFEDRDYENLDDES  238

Query  1190  ------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                         C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  +
Sbjct  239   SNVQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  298

Query  1079  TSVQ  1068
              + Q
Sbjct  299   EAYQ  302


 Score =   140 bits (354),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  301  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  360

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHK  659
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+ KV +K
Sbjct  361  ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNK  414


 Score = 33.1 bits (74),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_011086839.1| PREDICTED: uncharacterized protein LOC105168447 isoform X2 [Sesamum 
indicum]
Length=449

 Score =   147 bits (370),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 103/177 (58%), Gaps = 38/177 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHT +E++G DRPGL+SE+ AVL ++ C++ AA  WTHN+R A +VY+ D++   PI D
Sbjct  123   SEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEANGSPIND  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-------  1197
             P R+A I+  L  V++      E RS   S  +   THT+RRLHQ+M ADRDY       
Sbjct  183   PERLANIKQLLLYVLKGDR---EWRSAN-SAVSVGSTHTQRRLHQMMYADRDYDVQNVDN  238

Query  1196  ------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                         E C           CP    DRPKLLFDTVC LTDMQYVVFH +I
Sbjct  239   ATTERTKPLVTVENCVEKGYTVVNLSCP----DRPKLLFDTVCTLTDMQYVVFHGTI  291


 Score =   143 bits (361),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGC ++ E+ER+RV  CL AA +RR S G+RL++C+ +R+GLLSDVTR+FRE
Sbjct  300  QEYYIRHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCSDDRVGLLSDVTRIFRE  359

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            NGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VR+EIG T+
Sbjct  360  NGLSVTRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIGLTI  406


 Score = 27.3 bits (59),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ ++++   IQQ
Sbjct  77    MDVFYVTDEFGNKVYEDNVSERIQQ  101



>ref|XP_004297204.1| PREDICTED: uncharacterized protein LOC101300715 [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   143 bits (361),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 108/181 (60%), Gaps = 30/181 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HT LE++GTDRPGL+SE+SAVLA + C++  A  WTHN RAA ++++ ++     ITDP
Sbjct  124   DHTTLELSGTDRPGLLSEVSAVLAILKCNVVGAQVWTHNTRAASVMHITNEETGLAITDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A I+  + NV++    +   R+V     + + TH ERRLHQ+M ADRDY++      
Sbjct  184   ERLASIRESVCNVLKGSIKSRGSRTV----VSHTVTHPERRLHQMMFADRDYDRIKDESV  239

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDMQYVV+HA+I +    + 
Sbjct  240   LDDKQRPDVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVYHANIDAEGPEAY  299

Query  1070  Q  1068
             Q
Sbjct  300   Q  300


 Score =   143 bits (361),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  299  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV++ SG  VD +T+ES+RQEIG T+
Sbjct  359  ENSLTVTRAEVTTKAGKAVNTFYVREASGNPVDSKTIESIRQEIGQTI  406


 Score = 30.8 bits (68),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YI++
Sbjct  78    MDVFNVTDQDGNKVTDEGVLDYIRK  102



>ref|XP_010099846.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB80723.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=490

 Score =   141 bits (356),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 111/210 (53%), Gaps = 55/210 (26%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPI-TD  1356
             EHTA+EMTGTDRPGL SEISA LA++GC+I  A AW+HNAR AC+ Y+ D S   PI  D
Sbjct  135   EHTAIEMTGTDRPGLFSEISAALADLGCNIVEAHAWSHNARLACVAYISDQSAETPIAAD  194

Query  1355  PYRVAQIQAQLENVVEAHHYNGE--RRSVRL-----SDPAASRTHTERRLHQLMAADRDY  1197
              +R+A I+ +L  V+ A     E  R S +L     S  AA+ T+ ERRLHQLM + RD+
Sbjct  195   SHRIASIEDRLTTVLRASTSTAETSRASNQLWNEAKSSAAATSTNVERRLHQLMLSVRDF  254

Query  1196  ----------------------------------------EQC-------CPVWSRDRPK  1158
                                                     E C         V  +DR +
Sbjct  255   DAAARTLPFGLDGGGEGLGKRRQPHDEGINMKKRRCRVRIESCEEKGYWIVSVECKDRSR  314

Query  1157  LLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
             L+FDTVC LTDM Y++FHAS+SS D  + Q
Sbjct  315   LMFDTVCTLTDMHYLIFHASLSSTDGFAFQ  344


 Score =   139 bits (350),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 99/160 (62%), Gaps = 16/160 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH DG  L  E E+ R+ +CL AA ERR   G+RL++  +NR+GLLSD+TRV R
Sbjct  343  FQEYFIRHVDGKALTTEREKERIVKCLEAAIERRVCEGIRLELWAENRVGLLSDITRVLR  402

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ TQGE+A+  FYV+D SG  VD ET+ES++++I   V  V  +S    K
Sbjct  403  ENGLAVVRADVATQGEKAVNAFYVRDISGNEVDMETVESMKKQISPIVLQVITTSTTDDK  462

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +                  +   SLG  L +Q ER S+NF
Sbjct  463  SK----------------SRTYVSLGDKLKSQFERFSHNF  486


 Score = 36.6 bits (83),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G KI D+++I+YIQQ
Sbjct  78    MDVFHVKDEHGNKITDDNVINYIQQ  102



>ref|XP_002512031.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF50700.1| amino acid binding protein, putative [Ricinus communis]
Length=443

 Score =   147 bits (371),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 109/181 (60%), Gaps = 31/181 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HT++E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D+     I DP
Sbjct  120   DHTSIELTGSDRPGLLSELSAVLTHLKCNVVSAEVWTHNMRAAAVMQVTDEETGSAIIDP  179

Query  1352  YRVAQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
              R+++I+  L NV++  + + G +  V     +   THTERRLHQ+M ADRDYE+     
Sbjct  180   ERLSRIKELLCNVLKGSNKFRGAKTVV-----SHGVTHTERRLHQMMFADRDYERADDEV  234

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDM+YVVFHA+I +    + 
Sbjct  235   LDEKQRPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAY  294

Query  1070  Q  1068
             Q
Sbjct  295   Q  295


 Score =   139 bits (350),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  294  YQEYYIRHIDGSPVKSDAERMRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +AI TFYV+D SG  VD +T+ES+RQ IG T+
Sbjct  354  ENSLTVTRAEVTTRDGKAINTFYVRDASGYLVDGKTIESIRQVIGQTI  401


 Score = 30.8 bits (68),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+V DQ G KI DE+I+ YI++
Sbjct  74    MDVFNVRDQDGNKITDEAILDYIRK  98



>ref|XP_004310107.1| PREDICTED: uncharacterized protein LOC101292961 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   147 bits (370),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 106/180 (59%), Gaps = 43/180 (24%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHT +E+TG DR GL+SE+ AVLAE+ C++ A   WTHN+R A +VY+ D+    PI D
Sbjct  123   SEHTTIELTGRDRAGLLSEVFAVLAELKCNVVAGEVWTHNSRMASVVYITDEETGKPIDD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAAS--RTHTERRLHQLMAADRDY-----  1197
             P R+++I+  L NV++A       + +R ++ A S   TH ERRLHQ+M ADRDY     
Sbjct  183   PLRLSEIKEFLLNVLKAD------KDMRTANTAVSVGSTHKERRLHQMMYADRDYDLHSA  236

Query  1196  ---------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                            E C           CP    DRPKLLFDTVC LTDMQYVV+HA++
Sbjct  237   DSGSASDRTKPFVTVENCADKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVYHATV  292


 Score =   138 bits (348),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA  RR S G+RL++C  +R GLLSDVTR+FR
Sbjct  300  YQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV---------KVV  665
            EN LS+TRAE+ T+G +A+  FYV   SG  V  ET+E+VRQEIG T+         K  
Sbjct  360  ENSLSVTRAEVMTRGSQAVNVFYVTGASGNPVTSETIEAVRQEIGLTILRVEEDMYSKSP  419

Query  664  HKSSGRFT  641
             + SGRF+
Sbjct  420  PQESGRFS  427


 Score = 32.0 bits (71),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  77    MDVFHVTDQQGNKLYDDGIAECIQQ  101



>ref|XP_009105455.1| PREDICTED: uncharacterized protein LOC103831311 isoform X2 [Brassica 
rapa]
Length=450

 Score =   143 bits (361),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 104/184 (57%), Gaps = 32/184 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DD     ++D
Sbjct  119   TDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSD  178

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I++ L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  179   PERLSRIKSLLRNVLKGSNTPKEAKTV----VSLGEVHTDRRLHQMMFEDRDYENLDDES  234

Query  1190  ------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                         C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  +
Sbjct  235   SNVQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  294

Query  1079  TSVQ  1068
              + Q
Sbjct  295   EAYQ  298


 Score =   140 bits (354),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  297  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  356

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHK  659
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+ KV +K
Sbjct  357  ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNK  410


 Score = 33.1 bits (74),  Expect(3) = 1e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEVVLDYIQK  98



>ref|XP_006391062.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
 gb|ESQ28348.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
Length=455

 Score =   144 bits (362),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 104/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  123   TDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTV----VSQGEVHTDRRLHQMMFEDRDYEHRVVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   140 bits (354),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +TL+S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQTI  409


 Score = 33.1 bits (74),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>dbj|BAJ33767.1| unnamed protein product [Thellungiella halophila]
Length=451

 Score =   144 bits (362),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 104/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  119   TDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISD  178

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  179   PERLSRIKNLLRNVLKGSNTPREAKTV----VSQGEVHTDRRLHQMMFEDRDYEHRVVDD  234

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  235   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDG  294

Query  1082  STSVQ  1068
             + + Q
Sbjct  295   TEAYQ  299


 Score =   140 bits (353),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  298  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +TL+S+RQ IG T+
Sbjct  358  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQTI  405


 Score = 33.1 bits (74),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEVVLDYIQK  98



>emb|CDX95965.1| BnaA07g27660D [Brassica napus]
Length=455

 Score =   143 bits (360),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 104/184 (57%), Gaps = 32/184 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DD     ++D
Sbjct  124   TDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSD  183

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I++ L NV++  +   E ++V     +    HT+RRLHQ+M  DRDY+      
Sbjct  184   PERLSRIKSLLRNVLKGSNTPKEAKTV----VSLGEVHTDRRLHQMMFEDRDYKNLDDES  239

Query  1190  ------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                         C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  +
Sbjct  240   SNVQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1079  TSVQ  1068
              + Q
Sbjct  300   EAFQ  303


 Score =   141 bits (355),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRH DG  +  ++E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  FQEYYVRHIDGSPVKSDAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHK  659
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+ KV +K
Sbjct  362  ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNK  415


 Score = 33.1 bits (74),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  79    MDVFNVTDQDGNKVTDEVVLDYIQK  103



>ref|XP_002887219.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63478.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   144 bits (362),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 104/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCGISD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTV----VSHGEVHTDRRLHQMMFEDRDYEHRLVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   140 bits (352),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTSDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 32.7 bits (73),  Expect(3) = 2e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_010257936.1| PREDICTED: uncharacterized protein LOC104597875 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   151 bits (381),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 108/181 (60%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T HT++E+TGTDRPGL+SE+ AVL  + C++     WTHN RAA ++ V D+     ITD
Sbjct  138   TNHTSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETGAAITD  197

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++ ++   E ++V     +   THTERRLHQ+M ADRDYE+     
Sbjct  198   PERLSKIKEMLCNVLKGNNKTREAKTV----VSLGVTHTERRLHQMMFADRDYERSDSDT  253

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    +  +DRPKLLFDTVC LTDMQYVVFHA++ +  + + 
Sbjct  254   LDEKLRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEAY  313

Query  1070  Q  1068
             Q
Sbjct  314   Q  314


 Score =   144 bits (363),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  313  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  372

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+TRAE+ T+  +AI TFYV+D +G  VD +T++S+R+ IG T+
Sbjct  373  ENSLSVTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTI  420



>ref|XP_008811478.1| PREDICTED: uncharacterized protein LOC103722634 [Phoenix dactylifera]
Length=451

 Score =   148 bits (374),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 32/177 (18%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDRPGL+SE+ AVLA++GC +  A  WTHN R A ++++ D+    PI D +R
Sbjct  113   TALELTGTDRPGLLSEVFAVLADLGCGVVEAKVWTHNGRIAALIFIRDEDSGSPIEDAHR  172

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +++A+L +V++ H  +  R +   + P+ S TH++RRLHQLM ADRDYE+        
Sbjct  173   IRRVEARLRHVLKGHR-DDVRGAKTTTVPSPSLTHSDRRLHQLMFADRDYERISSAEAAS  231

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                       +  RDRPKLLFD VC LTDM+YVVFH +I +
Sbjct  232   SSPSSSSSQPSISVQNWLERGYSIVNIQCRDRPKLLFDIVCTLTDMEYVVFHGTIDT  288


 Score =   133 bits (334),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            +E+Y+RH DG  ++ E+ER+RV QCL AA ERRAS GLRL++C  +R GLL+DVTR FRE
Sbjct  295  EEFYIRHSDGSPISSEAERQRVIQCLQAAIERRASEGLRLELCAMDRRGLLADVTRTFRE  354

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGLS+TRAE+ T+G+ AI  FYV D +G   DP+ + +V ++IG
Sbjct  355  NGLSVTRAEVSTKGQMAINVFYVTDAAGHPADPKIIHAVIEKIG  398


 Score = 34.7 bits (78),  Expect(3) = 3e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD +G K+ D+S+I YI+ 
Sbjct  70    MDVFHVTDPVGRKLTDDSVISYIEH  94



>ref|XP_010257938.1| PREDICTED: uncharacterized protein LOC104597875 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   150 bits (380),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 108/181 (60%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T HT++E+TGTDRPGL+SE+ AVL  + C++     WTHN RAA ++ V D+     ITD
Sbjct  124   TNHTSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETGAAITD  183

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++ ++   E ++V     +   THTERRLHQ+M ADRDYE+     
Sbjct  184   PERLSKIKEMLCNVLKGNNKTREAKTV----VSLGVTHTERRLHQMMFADRDYERSDSDT  239

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    +  +DRPKLLFDTVC LTDMQYVVFHA++ +  + + 
Sbjct  240   LDEKLRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEAY  299

Query  1070  Q  1068
             Q
Sbjct  300   Q  300


 Score =   144 bits (363),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  299  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+TRAE+ T+  +AI TFYV+D +G  VD +T++S+R+ IG T+
Sbjct  359  ENSLSVTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTI  406



>ref|XP_011102236.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
 ref|XP_011102238.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
Length=448

 Score =   145 bits (366),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 105/180 (58%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HT++E+ G+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+   G ITDP
Sbjct  125   DHTSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGAITDP  184

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A ++  L NV++  + + E ++V     +   THTERRLHQ+M  DRDYE+      
Sbjct  185   ERLAMVKRLLCNVLKGSNKSREAKTV----VSVGATHTERRLHQMMFDDRDYERMGNDSA  240

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFD VC LTDMQYVVFH ++ +    + Q
Sbjct  241   DEKERPNVNVVNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQ  300


 Score =   138 bits (347),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY +RH DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  299  YQEYCIRHIDGSPVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VDP+ ++S+RQ IG T+
Sbjct  359  ENSLTVTRAEVATRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTI  406


 Score = 32.3 bits (72),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G KI DE I+ YIQ+
Sbjct  78    MDVFNVTDHDGNKITDEGILDYIQK  102



>ref|XP_007043904.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
 gb|EOX99735.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
Length=450

 Score =   147 bits (371),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 16/160 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA +RRAS G+RL++C+++R+GLLSDVTR+FR
Sbjct  300  YQEYYIRHMDGCPVSSEPERQRVINCLEAAIKRRASEGIRLELCSEDRVGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS+TRAE+ T+G +A+  F V D SG  V  ET+E+VR+E+G T  ++H     ++K
Sbjct  360  ENGLSVTRAEVTTRGSQAVNAFCVTDASGDPVKSETIEAVRKELGLT--ILHVKDDAYSK  417

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +               E G  GFSLG+L  ++ E+   N 
Sbjct  418  S------------PPQESG--GFSLGTLFKSRSEKFLYNL  443


 Score =   140 bits (353),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 33/175 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TG DRPGL+SE+ AVL ++ C++ AA  WTHN+R A +VY+ D++    I +
Sbjct  123   SKHTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSSIDN  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDP-AASRTHTERRLHQLMAADRDYEQ----  1191
             P R+ +I+  L  V++     G+R  +R +   +   THTERRLHQ+M ADRDY+     
Sbjct  183   PERLTKIKQLLLYVLK-----GDRDQMRANTAVSVGSTHTERRLHQMMYADRDYDMNDAD  237

Query  1190  --CCPVWSR---------------------DRPKLLFDTVCALTDMQYVVFHASI  1095
                   WS+                     DRPKLLFDTVC LTDMQYVV+HA++
Sbjct  238   SGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFDTVCTLTDMQYVVYHATV  292


 Score = 28.1 bits (61),  Expect(3) = 4e-70, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ +  +   IQQ
Sbjct  77    MDVFHVTDQYGNKLSEVDVAERIQQ  101



>ref|XP_011102239.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
 ref|XP_011102240.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
Length=438

 Score =   145 bits (366),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 105/180 (58%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HT++E+ G+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+   G ITDP
Sbjct  115   DHTSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGAITDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A ++  L NV++  + + E ++V     +   THTERRLHQ+M  DRDYE+      
Sbjct  175   ERLAMVKRLLCNVLKGSNKSREAKTV----VSVGATHTERRLHQMMFDDRDYERMGNDSA  230

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFD VC LTDMQYVVFH ++ +    + Q
Sbjct  231   DEKERPNVNVVNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQ  290


 Score =   138 bits (347),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY +RH DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  289  YQEYCIRHIDGSPVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFR  348

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VDP+ ++S+RQ IG T+
Sbjct  349  ENSLTVTRAEVATRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTI  396


 Score = 32.3 bits (72),  Expect(3) = 5e-70, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G KI DE I+ YIQ+
Sbjct  68    MDVFNVTDHDGNKITDEGILDYIQK  92



>ref|NP_001145757.1| hypothetical protein [Zea mays]
 gb|ACL52535.1| unknown [Zea mays]
 gb|AFW67709.1| hypothetical protein ZEAMMB73_506779 [Zea mays]
Length=494

 Score =   142 bits (359),  Expect(4) = 5e-70, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 107/198 (54%), Gaps = 53/198 (27%)
 Frame = -1

Query  1523  ALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRV  1344
             ALE T  DRPGL+S I++VLA+ GCH+++  AWTHN RAA ++YV       P+  P R 
Sbjct  136   ALEFTVNDRPGLLSSITSVLADSGCHVASGQAWTHNGRAAGVLYVTP-----PL--PSRW  188

Query  1343  AQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC---CPV-  1179
             A+++  +E VV A  +  GER   R+S PA  R HTERRLHQLM  DRDYE      PV 
Sbjct  189   ARVERLVEAVVGARENVAGERHWTRVSGPARGRVHTERRLHQLMRDDRDYESGPAPTPVD  248

Query  1178  ------------------------------W-----------SRDRPKLLFDTVCALTDM  1122
                                           W           SRDRP LLFDTVCALTDM
Sbjct  249   EGLFGVGDKAATTARTARRARAATRVSVDSWEERGYVVVKMTSRDRPSLLFDTVCALTDM  308

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QYVVFHA++ S    ++Q
Sbjct  309   QYVVFHATVGSQGVLAIQ  326


 Score =   132 bits (333),  Expect(4) = 5e-70, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 101/163 (62%), Gaps = 3/163 (2%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RHKDG T++  +ER++V++CL+AA ERRA+HG+R+++   +R GLLSD TRV R
Sbjct  325  IQEYYIRHKDGGTVDSSAERQKVSRCLVAAVERRATHGVRVEVHAADRSGLLSDFTRVLR  384

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQ---EIGGTVKVVHKSSGR  647
            E+GLS+ R E+    + A G FY+   +G  V  E L +V+    E+G ++ VV ++   
Sbjct  385  EHGLSLLRVELKRHRDEAFGVFYLDTDTGGEVRTEALRAVQMRVAEMGISLDVVKETKAP  444

Query  646  FTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                    +  +          KP  SLGSLLW+ LE+LSNNF
Sbjct  445  GWPPVRKTSVPAPPVAGQQPQEKPRPSLGSLLWSNLEKLSNNF  487


 Score = 33.5 bits (75),  Expect(4) = 5e-70, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 3/32 (9%)
 Frame = -2

Query  1705  VFHVTDQLGYKIVDESIIHYIQQVCVAIFNFH  1610
             VFHVTD+ G K+ D S+  +IQ+   A+  FH
Sbjct  78    VFHVTDRTGRKLTDPSLPEFIQR---ALVRFH  106


 Score = 27.7 bits (60),  Expect(4) = 5e-70, Method: Compositional matrix adjust.
 Identities = 9/9 (100%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -1

Query  1799  CSDGGWLMD  1773
             CSDGGWLMD
Sbjct  69    CSDGGWLMD  77



>ref|XP_010048170.1| PREDICTED: uncharacterized protein LOC104437016 [Eucalyptus grandis]
Length=488

 Score =   146 bits (368),  Expect(4) = 6e-70, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 100/159 (63%), Gaps = 14/159 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DGC L+ E E+ RV +CL AA ERR   G +L++C  NR+GLLSD+TRV R
Sbjct  339  YQEYFIRHVDGCALSTEGEKDRVMKCLEAAIERRVCEGFKLELCANNRIGLLSDITRVLR  398

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ TQGE+A+  FY+KDTSG  VD E +E +++E+G     V   + R   
Sbjct  399  ENGLAVVRADVETQGEKAVNAFYLKDTSGNEVDMEFVERIKREMGPINLAVQTETKRHGL  458

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNN  521
            A               +   P  SLG  L +Q+ERLS+N
Sbjct  459  A--------------EKPNTPFSSLGGFLKSQIERLSHN  483


 Score =   133 bits (335),  Expect(4) = 6e-70, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 102/193 (53%), Gaps = 47/193 (24%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              EHTA+EMTGTDRPGL SEISA LA++ C+I  A AW+HN R AC+ Y+ D   + PI D
Sbjct  138   NEHTAIEMTGTDRPGLFSEISATLADLHCNIVEAHAWSHNTRLACVAYISDQRTNTPIED  197

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRS-------VRLSDPAASR---THTERRLHQLMAAD  1206
               R+A I   L  V+ A   +G  R+       V+ SD        T+ ERRLHQLM + 
Sbjct  198   RSRLATIADHLTMVLRAKSTSGSPRATVPNQQEVKASDLQGGEGMTTNVERRLHQLMLSV  257

Query  1205  RDY-----EQCCPV---------------------WS-----------RDRPKLLFDTVC  1137
             RD+     E   P+                     W+           +DR +L+FDTVC
Sbjct  258   RDFDEPASESSSPIVMPMGLGPDRNGQNLRISIEEWNEKGYSVVNIKCKDRRRLMFDTVC  317

Query  1136  ALTDMQYVVFHAS  1098
              LTDMQYV+FHAS
Sbjct  318   TLTDMQYVIFHAS  330


 Score = 33.1 bits (74),  Expect(4) = 6e-70, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G KI D+ +I YIQQ
Sbjct  78    MDVFHVKDEHGNKIGDQRVIDYIQQ  102


 Score = 23.5 bits (49),  Expect(4) = 6e-70, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  72    SDGGWFMD  79



>gb|KDP33571.1| hypothetical protein JCGZ_07142 [Jatropha curcas]
Length=475

 Score =   150 bits (379),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 106/163 (65%), Gaps = 18/163 (11%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH DG  LN ESE+ RV +CL AA ERR   GL+L++C +NR+GLLSD+TRV R
Sbjct  330  FQEYFIRHIDGYALNTESEKERVIKCLEAAIERRVCEGLKLELCAENRVGLLSDITRVLR  389

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA+I TQGE+A+  FYVKD SG  VD E +E +++E+G  + +  K+  R   
Sbjct  390  ENGLTVVRADIATQGEKAVNAFYVKDMSGNEVDKEFIECMKKEMG-LIDLEVKNDMRSPT  448

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFRVP  509
            +                  +  FS+G +  +Q+ER+SNNF VP
Sbjct  449  SRE----------------RSPFSIGDMFKSQIERVSNNF-VP  474


 Score =   143 bits (361),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 105/194 (54%), Gaps = 38/194 (20%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+G DRPGL SEI A L ++ C+I  A AW+HNAR AC+ Y+ D S    I D
Sbjct  138   SEHTAIEMSGADRPGLFSEILAALVDLHCNIVEAHAWSHNARLACVAYISDQSTDNRIDD  197

Query  1355  PYRVAQIQAQLENVVE---AHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY----  1197
             P R+A I+  L  V+    AH  N E +S  +     + T+ ERRLHQL+ + RD+    
Sbjct  198   PLRLATIEDHLTTVIRASGAHPNNQEVKSGGIVGVEVTMTNVERRLHQLLLSLRDFDGPP  257

Query  1196  ------------------------EQC-------CPVWSRDRPKLLFDTVCALTDMQYVV  1110
                                     E C         +  +DRP+L+FDTVC LTDMQYV+
Sbjct  258   DSPTSGSGSVSESEEEWRKTVVSIENCEEKGYSIVSIECKDRPRLMFDTVCTLTDMQYVI  317

Query  1109  FHASISSHDSTSVQ  1068
             FHASI S D  + Q
Sbjct  318   FHASIGSRDDFAFQ  331



>ref|NP_177067.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|Q8LJW3.1|ACR4_ARATH RecName: Full=ACT domain-containing protein ACR4; AltName: Full=Protein 
ACT DOMAIN REPEATS 4 [Arabidopsis thaliana]
 gb|AAM93429.1| ACR4 [Arabidopsis thaliana]
 gb|ABJ17112.1| At1g69040 [Arabidopsis thaliana]
 gb|AEE34878.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=451

 Score =   141 bits (356),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V DD     I+D
Sbjct  119   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISD  178

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  179   PERLSRIKNLLRNVLKGSNTPREAKTV----VSHGEVHTDRRLHQMMFEDRDYEHRLVDD  234

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  235   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  294

Query  1082  STSVQ  1068
             + + Q
Sbjct  295   TEAFQ  299


 Score =   140 bits (354),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  298  FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  358  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  405


 Score = 32.7 bits (73),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEVVLDYIQK  98



>ref|XP_010277393.1| PREDICTED: uncharacterized protein LOC104611849 isoform X1 [Nelumbo 
nucifera]
Length=445

 Score =   143 bits (361),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (59%), Gaps = 32/179 (18%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDRPGL+SE+ AVLAE+ C++  A  WTHN R A ++YV+D +   PI D  +
Sbjct  114   TALELTGTDRPGLLSEVFAVLAELQCNVVDAKVWTHNGRIASLIYVKDCNSGFPIEDTQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASR--THTERRLHQLMAADRDYEQ------  1191
             + +I+ +L NV++  +       +R +  A S   THTERRLHQ+M ADRDYE+      
Sbjct  174   INRIEGRLRNVLKGDN------DIRSAKTAVSMAVTHTERRLHQMMFADRDYERRSRTES  227

Query  1190  ------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                  V  +DR KLLFD VC LTDM+YVVFH ++ +  + + Q
Sbjct  228   ATPSPSVTVQNWAERGYSVVNVQCKDRSKLLFDIVCTLTDMEYVVFHGTLDTTGNQAYQ  286


 Score =   132 bits (333),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E+E++RV QCL AA ERR S G+RL++ T +R GLLSDVTR FR
Sbjct  285  YQEFYIRHNDGSPISSEAEKQRVIQCLQAAIERRTSEGVRLELRTVDRWGLLSDVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGL++TRAEI T    A+  FYV D +GQ VDP+ +E+VR+ IG +   V +SS 
Sbjct  345  ENGLNVTRAEISTTRNMAVNVFYVTDAAGQPVDPKIIEAVRERIGFSDLKVKESSS  400


 Score = 38.9 bits (89),  Expect(3) = 6e-70, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I YI+Q
Sbjct  73    MDVFHVTDQNGEKLTDESVISYIEQ  97



>ref|NP_974107.1| ACT domain-containing protein [Arabidopsis thaliana]
 gb|AEE34879.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=455

 Score =   141 bits (356),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V DD     I+D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTV----VSHGEVHTDRRLHQMMFEDRDYEHRLVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAFQ  303


 Score =   140 bits (354),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 32.7 bits (73),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_009411127.1| PREDICTED: uncharacterized protein LOC103992926 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   147 bits (370),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 110/181 (61%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT++E+TGTDRPGL+SE+SAVL ++ C++ +A  WTHN+RAA ++ V D+     ITD
Sbjct  128   SDHTSIELTGTDRPGLLSEVSAVLTDLRCNVVSAEVWTHNSRAAAVMQVTDEETGSAITD  187

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P ++++I+  L NV++ ++ + E ++      +   T TERRLHQLM  DRDYE+     
Sbjct  188   PEKLSRIKELLCNVLKGNNRSREAKTT----VSVGVTQTERRLHQLMFDDRDYERSDEDS  243

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    V  +DRPKLLFDTVC LTDMQYVVFH ++ +    + 
Sbjct  244   RNEHHRPKVTVVNWFDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEAY  303

Query  1070  Q  1068
             Q
Sbjct  304   Q  304


 Score =   147 bits (370),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY +RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLL+DVTR+FR
Sbjct  303  YQEYCIRHVDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRMGLLTDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRAE+ T+  +AI TFYV+D +G  VDP+TL+ +R EIG TV
Sbjct  363  ENGLSVTRAEVTTRSGKAINTFYVRDAAGNPVDPKTLDDIRAEIGQTV  410



>dbj|BAC43240.1| unknown protein [Arabidopsis thaliana]
Length=425

 Score =   141 bits (356),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V DD     I+D
Sbjct  93    TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISD  152

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  153   PERLSRIKNLLRNVLKGSNTPREAKTV----VSHGEVHTDRRLHQMMFEDRDYEHRLVDD  208

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  209   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  268

Query  1082  STSVQ  1068
             + + Q
Sbjct  269   TEAFQ  273


 Score =   140 bits (354),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  272  FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  331

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  332  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  379


 Score = 32.7 bits (73),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  48    MDVFNVTDQDGNKVTDEVVLDYIQK  72



>ref|XP_010936426.1| PREDICTED: uncharacterized protein LOC105056061 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   152 bits (384),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++ RAE+ TQG +AI TFYV+D +G SVD +TLE++RQ IG TV
Sbjct  363  ENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTV  410


 Score =   141 bits (356),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 107/182 (59%), Gaps = 31/182 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+     I D
Sbjct  128   SDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEETGLAIID  187

Query  1355  PYRVAQIQAQLENVVEAHHYN-GERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----  1191
             P R+++I+  L NV++ ++   G + +V +       THT+RRLHQ+M ADRDYE+    
Sbjct  188   PERLSRIKELLCNVLKGNNITRGAKTAVSMG-----VTHTDRRLHQMMFADRDYERSDKD  242

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     +  +DRPKLLFDTVC LTDMQYVVFH ++ +    +
Sbjct  243   TANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEA  302

Query  1073  VQ  1068
              Q
Sbjct  303   YQ  304



>ref|XP_002324307.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
 gb|EEF02872.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
Length=2221

 Score =   142 bits (359),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 44/200 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+GTDRPGL SEISA LA++ C+I    AW+HNAR AC+ Y+ D S H PI D
Sbjct  1866  SEHTAIEMSGTDRPGLFSEISAALADLQCNIVEVHAWSHNARLACVAYISDPSSHTPIED  1925

Query  1355  PYRVAQIQAQLENVVEAHHY----------NGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             P+R+A I+  L  V+ A+            N E ++        + ++ ERRLHQLM + 
Sbjct  1926  PHRLASIEDHLTTVLRANTVRSAGEPSQINNREVKTGGFLGGEGTVSNVERRLHQLMLSV  1985

Query  1205  RDY--------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             RD+                          E C         +  +DR +L+FDT+C L D
Sbjct  1986  RDFDGPISSSSTGTGLNNNKGGSKMVVSIENCDQKEYSIVNIECKDRRRLMFDTICTLND  2045

Query  1124  MQYVVFHASISS-HDSTSVQ  1068
             MQYV+FHAS+SS HD  + Q
Sbjct  2046  MQYVIFHASVSSDHDGRAFQ  2065


 Score =   136 bits (343),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  997   FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             FQEY++RHKDG   N ESE+ RV +CL AA ERR S G+ L +  +NRLGLLSD+TRV R
Sbjct  2064  FQEYFIRHKDGYARNTESEKERVIKCLEAAIERRVSEGVLLKLRAENRLGLLSDITRVLR  2123

Query  817   ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
             ENGL++ RA++ T+GE+A+  FYV+D SG  VD   ++S+++E+G T   V K+    T 
Sbjct  2124  ENGLAVVRADVATEGEKAVNAFYVRDISGNEVDMGFIKSMKKEMGLTDLEVIKNDTSTTT  2183

Query  637   AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             + +   +            +  FS G LL +Q+ER S+NF
Sbjct  2184  SPTRTITNISPHE------RHRFSFGDLLKSQIERFSHNF  2217


 Score = 35.8 bits (81),  Expect(3) = 7e-70, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHV D+ G K+ D+++I+YIQQV
Sbjct  1814  MDVFHVKDEHGKKLRDQNVINYIQQV  1839



>ref|XP_010277394.1| PREDICTED: uncharacterized protein LOC104611849 isoform X2 [Nelumbo 
nucifera]
Length=373

 Score =   144 bits (362),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (59%), Gaps = 32/179 (18%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDRPGL+SE+ AVLAE+ C++  A  WTHN R A ++YV+D +   PI D  +
Sbjct  42    TALELTGTDRPGLLSEVFAVLAELQCNVVDAKVWTHNGRIASLIYVKDCNSGFPIEDTQK  101

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASR--THTERRLHQLMAADRDYEQ------  1191
             + +I+ +L NV++  +       +R +  A S   THTERRLHQ+M ADRDYE+      
Sbjct  102   INRIEGRLRNVLKGDN------DIRSAKTAVSMAVTHTERRLHQMMFADRDYERRSRTES  155

Query  1190  ------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                  V  +DR KLLFD VC LTDM+YVVFH ++ +  + + Q
Sbjct  156   ATPSPSVTVQNWAERGYSVVNVQCKDRSKLLFDIVCTLTDMEYVVFHGTLDTTGNQAYQ  214


 Score =   132 bits (332),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E+E++RV QCL AA ERR S G+RL++ T +R GLLSDVTR FR
Sbjct  213  YQEFYIRHNDGSPISSEAEKQRVIQCLQAAIERRTSEGVRLELRTVDRWGLLSDVTRTFR  272

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGL++TRAEI T    A+  FYV D +GQ VDP+ +E+VR+ IG +   V +SS 
Sbjct  273  ENGLNVTRAEISTTRNMAVNVFYVTDAAGQPVDPKIIEAVRERIGFSDLKVKESSS  328


 Score = 38.9 bits (89),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I YI+Q
Sbjct  1     MDVFHVTDQNGEKLTDESVISYIEQ  25



>ref|XP_010936425.1| PREDICTED: uncharacterized protein LOC105056061 isoform X1 [Elaeis 
guineensis]
Length=453

 Score =   152 bits (384),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  304  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIFR  363

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++ RAE+ TQG +AI TFYV+D +G SVD +TLE++RQ IG TV
Sbjct  364  ENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTV  411


 Score =   141 bits (355),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 107/182 (59%), Gaps = 31/182 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+     I D
Sbjct  129   SDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEETGLAIID  188

Query  1355  PYRVAQIQAQLENVVEAHHYN-GERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----  1191
             P R+++I+  L NV++ ++   G + +V +       THT+RRLHQ+M ADRDYE+    
Sbjct  189   PERLSRIKELLCNVLKGNNITRGAKTAVSMG-----VTHTDRRLHQMMFADRDYERSDKD  243

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     +  +DRPKLLFDTVC LTDMQYVVFH ++ +    +
Sbjct  244   TANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEA  303

Query  1073  VQ  1068
              Q
Sbjct  304   YQ  305



>gb|AAF27052.1|AC008262_1 F4N2.2 [Arabidopsis thaliana]
Length=445

 Score =   141 bits (356),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C +  A  WTHN RAA ++ V DD     I+D
Sbjct  113   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISD  172

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  173   PERLSRIKNLLRNVLKGSNTPREAKTV----VSHGEVHTDRRLHQMMFEDRDYEHRLVDD  228

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  229   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  288

Query  1082  STSVQ  1068
             + + Q
Sbjct  289   TEAFQ  293


 Score =   140 bits (354),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  292  FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  351

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  352  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  399


 Score = 32.7 bits (73),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  68    MDVFNVTDQDGNKVTDEVVLDYIQK  92



>gb|KDO70280.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=372

 Score =   152 bits (384),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 31/182 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D+   G I+DP
Sbjct  47    DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDP  106

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++  + +G  ++    + +   THTERRLHQ+M ADRDYE+      
Sbjct  107   ERLSVIKELLCNVLKGSNKSGLAKT----EVSQDVTHTERRLHQMMFADRDYERTGTDDD  162

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     + S+DRPKL+FDTVC LTDMQYVVFHA+I +    +
Sbjct  163   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  222

Query  1073  VQ  1068
              Q
Sbjct  223   YQ  224


 Score =   131 bits (329),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DG  +  ++ER RV QCL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  223  YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  282

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV   SG  VD + ++S+RQ IG T+
Sbjct  283  ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTI  330


 Score = 31.6 bits (70),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI DE I+ YI++
Sbjct  1     MDVFNVTDEDGNKITDEGILDYIRK  25



>ref|XP_002314917.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
 gb|EEF01088.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
Length=447

 Score =   145 bits (367),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 106/174 (61%), Gaps = 29/174 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+     I DP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSAIIDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              ++++I+  L NV++  + +   ++V     +   THTERRLHQ+M ADRDYE+      
Sbjct  184   EKLSRIKELLCNVLKGSNKSRGAKTV----VSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                   + S+DRPKLLFDTVC LTDM+YVVFHA+I + 
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAE  293


 Score =   139 bits (350),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY++H DG  +  E+ER+R+ QCL AA ERR S GL+L++CT +R+GLLSDVTR+FRE
Sbjct  299  QEYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  358

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS  656
            N L++TRAE+ T+  +A+ TFYV D SG  VD +T++S+RQ IG T+  V  S
Sbjct  359  NSLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKSS  411


 Score = 30.0 bits (66),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G K+ DE+I+ YI +
Sbjct  78    MDVFNVTDPDGNKVTDEAILDYITK  102



>gb|AAS07062.1| putative ACT domain containing protein, ACR4, with alternative 
splicing forms [Oryza sativa Japonica Group]
 gb|ABF96587.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=374

 Score =   145 bits (366),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  226  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  285

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQS-VDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G++A+ TFYV+D +G S VD +TLE++RQEIG TV
Sbjct  286  ENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  334


 Score =   139 bits (350),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  51    SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  110

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+A+I+ +L  V +  + + + ++          THTERRLHQLM  DRDYE+     
Sbjct  111   TQRLARIKERLSYVFKGSNRSQDTKTT----VTMGITHTERRLHQLMLEDRDYERYDKDR  166

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   PV S                +DRPKLLFDTVC LTDMQYVVFH S+ S    + 
Sbjct  167   TNVNPTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAY  226

Query  1070  Q  1068
             Q
Sbjct  227   Q  227


 Score = 30.0 bits (66),  Expect(3) = 8e-70, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYI  1643
             + VF+VTDQ G KI+DES++  I
Sbjct  1     MSVFNVTDQNGQKIMDESVLDEI  23



>gb|EAZ27314.1| hypothetical protein OsJ_11253 [Oryza sativa Japonica Group]
Length=455

 Score =   145 bits (367),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  307  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQS-VDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G++A+ TFYV+D +G S VD +TLE++RQEIG TV
Sbjct  367  ENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  415


 Score =   139 bits (349),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  132   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  191

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+A+I+ +L  V +  + + + ++          THTERRLHQLM  DRDYE+     
Sbjct  192   TQRLARIKERLSYVFKGSNRSQDTKTT----VTMGITHTERRLHQLMLEDRDYERYDKDR  247

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   PV S                +DRPKLLFDTVC LTDMQYVVFH S+ S    + 
Sbjct  248   TNVNPTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAY  307

Query  1070  Q  1068
             Q
Sbjct  308   Q  308


 Score = 30.0 bits (66),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYI  1643
             + VF+VTDQ G KI+DES++  I
Sbjct  82    MDVFNVTDQNGQKIMDESVLDEI  104



>ref|XP_006484247.1| PREDICTED: uncharacterized protein LOC102622082 [Citrus sinensis]
Length=449

 Score =   152 bits (384),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 31/182 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE++AVL  + C++ +A  WTHN RAA ++ V D+   G ITDP
Sbjct  124   DHTAIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAITDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++  + +G  ++    + +   THTERRLHQ+M ADRDYE+      
Sbjct  184   ERLSVIKELLCNVLKGSNKSGLAKT----EVSQDVTHTERRLHQMMFADRDYERTGTGDD  239

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     + S+DRPKL+FDTVC LTDMQYVVFHA+I +    +
Sbjct  240   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  299

Query  1073  VQ  1068
              Q
Sbjct  300   YQ  301


 Score =   131 bits (329),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DG  +  ++ER RV QCL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  300  YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV   SG  VD + ++S+RQ IG T+
Sbjct  360  ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTI  407


 Score = 31.2 bits (69),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI DE I+ YI++
Sbjct  78    MDVFNVTDEDGNKITDEGILDYIRK  102



>gb|KDO70279.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=449

 Score =   152 bits (384),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 31/182 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D+   G I+DP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++  + +G  ++    + +   THTERRLHQ+M ADRDYE+      
Sbjct  184   ERLSVIKELLCNVLKGSNKSGLAKT----EVSQDVTHTERRLHQMMFADRDYERTGTDDD  239

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     + S+DRPKL+FDTVC LTDMQYVVFHA+I +    +
Sbjct  240   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  299

Query  1073  VQ  1068
              Q
Sbjct  300   YQ  301


 Score =   131 bits (329),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DG  +  ++ER RV QCL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  300  YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV   SG  VD + ++S+RQ IG T+
Sbjct  360  ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTI  407


 Score = 31.2 bits (69),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI DE I+ YI++
Sbjct  78    MDVFNVTDEDGNKITDEGILDYIRK  102



>ref|XP_010537315.1| PREDICTED: uncharacterized protein LOC104812060 [Tarenaya hassleriana]
 ref|XP_010537316.1| PREDICTED: uncharacterized protein LOC104812060 [Tarenaya hassleriana]
Length=452

 Score =   144 bits (362),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 107/183 (58%), Gaps = 28/183 (15%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             L +HTA+E+ G DRPGL+SEISAVLA++  ++ AA  WTHN R AC++YV DDS    + 
Sbjct  125   LGDHTAIELIGRDRPGLLSEISAVLADLRFNVLAAEVWTHNRRIACVLYVNDDSTSRAVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL NV+       E+  V  +  +   TH +RRLHQ++ AD+DYE     
Sbjct  185   DPSRLSAMEEQLNNVLRGCEEEDEK--VARASFSVGSTHVDRRLHQMLFADKDYEGNKLV  242

Query  1193  --------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDST  1077
                           +C         V  +DR KL+FD VC LTDMQYVVFHA+ISS    
Sbjct  243   DSSSQGFKPEIKVERCEEKDYSVINVSCKDRAKLMFDIVCTLTDMQYVVFHANISSDGPC  302

Query  1076  SVQ  1068
             + Q
Sbjct  303   ASQ  305


 Score =   139 bits (351),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RHKDGCTL+ E+E+ RV +CL AA  RR S GL L++C ++R+GLLS+VTR+ RE
Sbjct  305  QEYYIRHKDGCTLHSEAEKERVIKCLEAAIHRRVSEGLSLELCAKDRMGLLSEVTRILRE  364

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV  668
            +GLS+ RA + T GE+A+  FYV+D SG  VD +T+E++RQEIG T+ +
Sbjct  365  HGLSVMRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRQEIGHTMMI  413


 Score = 30.8 bits (68),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHV D  G KI D   I YI++V
Sbjct  76    MDVFHVLDHQGNKITDSKTIEYIEKV  101



>ref|XP_006437860.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
 gb|ESR51100.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
Length=445

 Score =   152 bits (384),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 31/182 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE++AVL  + C++ +A  WTHN RAA ++ V D+   G ITDP
Sbjct  120   DHTAIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAITDP  179

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++  + +G  ++    + +   THTERRLHQ+M ADRDYE+      
Sbjct  180   ERLSVIKELLCNVLKGSNKSGLAKT----EVSQDVTHTERRLHQMMFADRDYERTGTGDD  235

Query  1190  ---------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     + S+DRPKL+FDTVC LTDMQYVVFHA+I +    +
Sbjct  236   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  295

Query  1073  VQ  1068
              Q
Sbjct  296   YQ  297


 Score =   131 bits (329),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DG  +  ++ER RV QCL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  296  YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  355

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV   SG  VD + ++S+RQ IG T+
Sbjct  356  ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTI  403


 Score = 31.2 bits (69),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI DE I+ YI++
Sbjct  74    MDVFNVTDEDGNKITDEGILDYIRK  98



>ref|NP_001050359.1| Os03g0413100 [Oryza sativa Japonica Group]
 gb|AAS07063.1| putative ACT domain containing protein, ACR4, with alternative 
splicing forms [Oryza sativa Japonica Group]
 gb|ABF96586.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12273.1| Os03g0413100 [Oryza sativa Japonica Group]
 dbj|BAF46923.1| ACT-domain repeat protein 7 [Oryza sativa Japonica Group]
 dbj|BAG88644.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   145 bits (367),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  304  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  363

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQS-VDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G++A+ TFYV+D +G S VD +TLE++RQEIG TV
Sbjct  364  ENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  412


 Score =   139 bits (349),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  129   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  188

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+A+I+ +L  V +  + + + ++          THTERRLHQLM  DRDYE+     
Sbjct  189   TQRLARIKERLSYVFKGSNRSQDTKTT----VTMGITHTERRLHQLMLEDRDYERYDKDR  244

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   PV S                +DRPKLLFDTVC LTDMQYVVFH S+ S    + 
Sbjct  245   TNVNPTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAY  304

Query  1070  Q  1068
             Q
Sbjct  305   Q  305


 Score = 30.0 bits (66),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYI  1643
             + VF+VTDQ G KI+DES++  I
Sbjct  79    MDVFNVTDQNGQKIMDESVLDEI  101



>ref|XP_009394314.1| PREDICTED: uncharacterized protein LOC103979823 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   149 bits (377),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  303  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRMGLLSDVTRIFR  362

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G +    FYV+D +G SVDP+TL+ +R EIG TV
Sbjct  363  ENGLTVTRAEVTTKGGKVFNIFYVRDAAGNSVDPKTLDDIRAEIGQTV  410


 Score =   143 bits (361),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 106/181 (59%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT++E+TGTDRPGL+SE+ AVL+++ C++  A  WTHN RAA ++ V D      I D
Sbjct  128   SDHTSIELTGTDRPGLLSEVCAVLSDLECNVVNAEVWTHNTRAAAVMQVSDKGTGTAIAD  187

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
             P ++++I+  L NV++  + + E ++      +   THTERRLHQ+M  DRDYE+     
Sbjct  188   PEKLSRIKKLLYNVLKGSNKSREAKTA----VSVGATHTERRLHQMMFDDRDYERSGEDD  243

Query  1187  ---------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    +  +DRPKLLFDTVC LTDMQYVVFH ++ +    + 
Sbjct  244   GNVCHRPKVTVVNWFDKDYSMVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEAY  303

Query  1070  Q  1068
             Q
Sbjct  304   Q  304



>ref|XP_008222209.1| PREDICTED: uncharacterized protein LOC103322107 [Prunus mume]
Length=524

 Score =   144 bits (364),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER RV  CL AA  RR S G+RL++C ++R+GLLSDVTR+FR
Sbjct  374  YQEYYIRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFR  433

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VRQEIG T+
Sbjct  434  ENGLSVTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTI  481


 Score =   138 bits (348),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 103/179 (58%), Gaps = 43/179 (24%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SEI AVL+++ C++  A  WTHN+R A +V++ D++   PI DP
Sbjct  198   EHTTIELTGRDRPGLLSEIFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDP  257

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAAS--RTHTERRLHQLMAADRDY------  1197
               +++I+  L  V++        R  R ++ A S   TH ERRLHQ+M ADRDY      
Sbjct  258   DHLSKIKKLLLYVLKGD------RDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDGAD  311

Query  1196  --------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                           E C           CP    DRPKLLFDTVC LTDMQYVV+HA++
Sbjct  312   CGSASDRSKPLVTVENCVDKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVYHATV  366


 Score = 31.6 bits (70),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  151   MDVFHVTDQQGNKLSDDGIAERIQQ  175



>ref|XP_011009617.1| PREDICTED: uncharacterized protein LOC105114683 isoform X1 [Populus 
euphratica]
Length=447

 Score =   145 bits (366),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 106/174 (61%), Gaps = 29/174 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG+DRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D+     I DP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSAIIDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              ++++I+  L NV++  + +   ++V     +   THTERRLHQ+M ADRDYE+      
Sbjct  184   EKLSRIKELLCNVLKGSNKSRGAKTV----VSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                   + S+DRPKLLFDTVC LTDM+YVVFHA+I + 
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAE  293


 Score =   139 bits (349),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY++H DG  +  E+ER+R+ QCL AA ERR S GL+L++CT +R+GLLSDVTR+FRE
Sbjct  299  QEYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  358

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            N L++TRAE+ T+  +A+ TFYV D SG  VD +T++S+RQ IG T+
Sbjct  359  NSLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTI  405


 Score = 30.0 bits (66),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD  G K+ DE+I+ YI +
Sbjct  78    MDVFNVTDPDGNKVTDEAILDYITK  102



>gb|EAY90442.1| hypothetical protein OsI_12028 [Oryza sativa Indica Group]
Length=455

 Score =   145 bits (367),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+RV QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  307  YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQS-VDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G++A+ TFYV+D +G S VD +TLE++RQEIG TV
Sbjct  367  ENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  415


 Score =   138 bits (348),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  132   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRETGLAISD  191

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+A+I+ +L  V +  + + + ++          THTERRLHQLM  DRDYE+     
Sbjct  192   TQRLARIKERLSYVFKGSNRSQDTKTT----VTMGITHTERRLHQLMLEDRDYERYDKDR  247

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   PV S                +DRPKLLFDTVC LTDMQYVVFH S+ S    + 
Sbjct  248   TNVNPTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAY  307

Query  1070  Q  1068
             Q
Sbjct  308   Q  308


 Score = 30.0 bits (66),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYI  1643
             + VF+VTDQ G KI+DES++  I
Sbjct  82    MDVFNVTDQNGQKIMDESVLDEI  104



>ref|XP_009599622.1| PREDICTED: uncharacterized protein LOC104095244 [Nicotiana tomentosiformis]
Length=449

 Score =   142 bits (357),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 102/172 (59%), Gaps = 30/172 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SEI AVLA+   ++ AA  WTHN+R A +VY+ D+     ITDP
Sbjct  124   EHTTIELTGRDRPGLLSEIFAVLADHKNNVVAAEVWTHNSRMASVVYITDEESGLAITDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----CC  1185
              R+A+I+  L  V++      +RR    +    S THTERRLHQ+M ADRDY++    C 
Sbjct  184   DRLAKIRKLLLYVLKGDR---DRRGANTAVSVGS-THTERRLHQMMYADRDYDKDDTSCV  239

Query  1184  PVWSR----------------------DRPKLLFDTVCALTDMQYVVFHASI  1095
              V  R                      DRPKLLFD VC LTDMQYVV+HA+I
Sbjct  240   SVDQRKPMVTVESCADKGYTVVNLRCADRPKLLFDAVCTLTDMQYVVYHATI  291


 Score =   142 bits (357),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGC ++ E+ER+RV  CL AA +RR S G+RL++C  +R+GLLSDVTR+FRE
Sbjct  300  QEYYIRHMDGCPVSSEAERQRVIHCLEAAVKRRTSTGIRLELCGDDRIGLLSDVTRIFRE  359

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            NGLS++RAE+ T+G +AI  FYV D SG  V  ET+E+VR EIG T+
Sbjct  360  NGLSVSRAEVMTKGSQAINVFYVTDASGSPVKTETIEAVRNEIGMTI  406


 Score = 30.4 bits (67),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++++   IQQ
Sbjct  77    MDVFHVTDQYGNKLSEDNVAERIQQ  101



>gb|KHG23892.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=442

 Score =   148 bits (374),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 108/170 (64%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLAE+ C++  A  WTHN R A ++YV+D +   PI D  R
Sbjct  114   TALELTGTDRVGLLSEVFAVLAELQCNVVDAKVWTHNGRIASLIYVKDCNSGSPIEDSRR  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----QC--  1188
             + +I+A+L NV+     + + RS R S   A  THTERRLHQ+M+AD DYE     QC  
Sbjct  174   IDRIEARLRNVLRG---DNDIRSARTSVSMAV-THTERRLHQMMSADCDYEQKSGLQCWT  229

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+            DRPKLLFD VC LTDM+YVVFHASI++
Sbjct  230   DSPVVNVQNWTERGYSVVNVQCEDRPKLLFDVVCTLTDMEYVVFHASINT  279


 Score =   129 bits (325),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++LE ER R+ QCL AA ERRAS G+RL++CT +R GLL+DVTR FR
Sbjct  285  YLEFYIRHTDGTPISLEPERHRLIQCLQAAIERRASEGIRLELCTSDRQGLLTDVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG-GTVKV  668
            ENGL++TRAEI T    A+  F+V D +    DP+++ESVRQ+IG G +KV
Sbjct  345  ENGLNVTRAEISTAMGVAMNVFHVTDATRNLADPKSIESVRQKIGLGNLKV  395


 Score = 35.8 bits (81),  Expect(3) = 1e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I YI+Q
Sbjct  73    MDVFHVTDLNGNKLTDESVISYIEQ  97



>gb|ABG37643.1| unknown [Populus trichocarpa]
Length=2224

 Score =   143 bits (360),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 44/200 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+GTDRPGL SEISA LA++ C+I    AW+HNAR AC+ Y+ D S H PI D
Sbjct  1869  SEHTAIEMSGTDRPGLFSEISAALADLQCNIVEVHAWSHNARLACVAYISDPSSHTPIED  1928

Query  1355  PYRVAQIQAQLENVVEAHHY----------NGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             P+R+A I+  L  V+ A+            N E ++        + ++ ERRLHQLM + 
Sbjct  1929  PHRLASIEDHLTTVLRANTVRSAGEPSQINNREVKTGGFLGGEGTVSNVERRLHQLMLSV  1988

Query  1205  RDY--------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             RD+                          E C         +  +DR +L+FDT+C L D
Sbjct  1989  RDFDGPISSSSTGTGLNNNKGGSKMVVSIENCDQKEYSIVNIECKDRRRLMFDTICTLND  2048

Query  1124  MQYVVFHASISS-HDSTSVQ  1068
             MQYV+FHAS+SS HD  + Q
Sbjct  2049  MQYVIFHASVSSDHDGRAFQ  2068


 Score =   137 bits (344),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  997   FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             FQEY++RHKDG   N ESE+ RV +CL AA ERR S G+ L +  +NRLGLLSD+TRV R
Sbjct  2067  FQEYFIRHKDGYARNTESEKERVIKCLEAAIERRVSEGVLLKLRAENRLGLLSDITRVLR  2126

Query  817   ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
             ENGL++ RA++ T+GE+A+  FYV+D SG  VD   ++S+++E+G T   V K+    T 
Sbjct  2127  ENGLAVVRADVATEGEKAVNAFYVRDISGNEVDMGFIKSMKKEMGLTDLEVIKNDTSPTT  2186

Query  637   AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             + +   +            +  FS G LL +Q+ER S+NF
Sbjct  2187  SPTRTITNISPHE------RHRFSFGDLLKSQIERFSHNF  2220


 Score = 34.3 bits (77),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+++I+YIQQ
Sbjct  1816  MDVFHVKDEHGKKLRDQNVINYIQQ  1840



>ref|XP_009127699.1| PREDICTED: uncharacterized protein LOC103852547 [Brassica rapa]
Length=457

 Score =   141 bits (356),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 104/187 (56%), Gaps = 35/187 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  123   TDSTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTVL----SHGEVHTDRRLHQMMFEDRDYEHRAVVD  238

Query  1190  ---------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                            C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +
Sbjct  239   DDSSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDT  298

Query  1088  HDSTSVQ  1068
               + + Q
Sbjct  299   EGTEAYQ  305


 Score =   139 bits (351),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA  RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  304  YQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  363

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  364  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  411


 Score = 33.1 bits (74),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_006371753.1| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
 gb|ERP49550.1| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
Length=2224

 Score =   143 bits (360),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 44/200 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+GTDRPGL SEISA LA++ C+I    AW+HNAR AC+ Y+ D S H PI D
Sbjct  1869  SEHTAIEMSGTDRPGLFSEISAALADLQCNIVEVHAWSHNARLACVAYISDPSSHTPIED  1928

Query  1355  PYRVAQIQAQLENVVEAHHY----------NGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             P+R+A I+  L  V+ A+            N E ++        + ++ ERRLHQLM + 
Sbjct  1929  PHRLASIEDHLTTVLRANTVRSAGEPSQINNREVKTGGFLGGEGTVSNVERRLHQLMLSV  1988

Query  1205  RDY--------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             RD+                          E C         +  +DR +L+FDT+C L D
Sbjct  1989  RDFDGPISSSSTGTGLNNNKGGSKMVVSIENCDQKEYSIVNIECKDRRRLMFDTICTLND  2048

Query  1124  MQYVVFHASISS-HDSTSVQ  1068
             MQYV+FHAS+SS HD  + Q
Sbjct  2049  MQYVIFHASVSSDHDGRAFQ  2068


 Score =   136 bits (343),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  997   FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             FQEY++RHKDG   N ESE+ RV +CL AA ERR S G+ L +  +NRLGLLSD+TRV R
Sbjct  2067  FQEYFIRHKDGYARNTESEKERVIKCLEAAIERRVSEGVLLKLRAENRLGLLSDITRVLR  2126

Query  817   ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
             ENGL++ RA++ T+GE+A+  FYV+D SG  VD   ++S+++E+G T   V K+    T 
Sbjct  2127  ENGLAVVRADVATEGEKAVNAFYVRDISGNEVDMGFIKSMKKEMGLTDLEVIKNDTSTTT  2186

Query  637   AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             + +   +            +  FS G LL +Q+ER S+NF
Sbjct  2187  SPTRTITNISPHE------RHRFSFGDLLKSQIERFSHNF  2220


 Score = 34.3 bits (77),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+++I+YIQQ
Sbjct  1816  MDVFHVKDEHGKKLRDQNVINYIQQ  1840



>emb|CDY65806.1| BnaA02g35780D [Brassica napus]
Length=453

 Score =   141 bits (355),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 104/187 (56%), Gaps = 35/187 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  119   TDSTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISD  178

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  179   PERLSRIKNLLRNVLKGSNTPREAKTVL----SHGEVHTDRRLHQMMFEDRDYEHRAVVD  234

Query  1190  ---------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                            C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +
Sbjct  235   DDSSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDT  294

Query  1088  HDSTSVQ  1068
               + + Q
Sbjct  295   EGTEAYQ  301


 Score =   139 bits (351),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA  RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  300  YQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  360  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  407


 Score = 33.1 bits (74),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEVVLDYIQK  98



>gb|ACG60681.1| unknown protein [Brassica oleracea var. alboglabra]
Length=446

 Score =   141 bits (356),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 104/186 (56%), Gaps = 34/186 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V DDS    I+D
Sbjct  113   TDSTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISD  172

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE      
Sbjct  173   PERLSRIKNLLRNVLKGSNTPREAKTVL----SHGEVHTDRRLHQMMFEDRDYEHRAVVD  228

Query  1190  --------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                           C   W            +DRPKLLFDTVC LTDMQYVVFH S+ + 
Sbjct  229   DDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTE  288

Query  1085  DSTSVQ  1068
              + + Q
Sbjct  289   GTEAYQ  294


 Score =   139 bits (350),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA  RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  293  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  352

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  353  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  400


 Score = 32.7 bits (73),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  68    MDVFNVTDQDGNKVTDEVVLDYIQK  92



>ref|XP_010415531.1| PREDICTED: uncharacterized protein LOC104701533 [Camelina sativa]
Length=455

 Score =   140 bits (354),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 105/185 (57%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C + +A  WTHN RAA +++V DD     ++D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCGVSD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E +++     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTL----VSHGEVHTDRRLHQMMFEDRDYELRVVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   140 bits (352),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 32.7 bits (73),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_007222095.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
 gb|EMJ23294.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
Length=450

 Score =   144 bits (363),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER RV  CL AA  RR S G+RL++C ++R+GLLSDVTR+FR
Sbjct  300  YQEYYIRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VRQEIG T+
Sbjct  360  ENGLSVTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTI  407


 Score =   137 bits (346),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 103/179 (58%), Gaps = 43/179 (24%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SE+ AVL+++ C++  A  WTHN+R A +V++ D++   PI DP
Sbjct  124   EHTTIELTGRDRPGLLSEVFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAAS--RTHTERRLHQLMAADRDY------  1197
               +++I+  L  V++        R  R ++ A S   TH ERRLHQ+M ADRDY      
Sbjct  184   DHLSKIKKLLLYVLKGD------RDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDGAD  237

Query  1196  --------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                           E C           CP    DRPKLLFDTVC LTDMQYVV+HA++
Sbjct  238   CGSASDRSKPLVTVENCVDKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVYHATV  292


 Score = 31.6 bits (70),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  77    MDVFHVTDQQGNKLSDDGIAERIQQ  101



>ref|XP_002324305.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
 gb|EEF02870.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa]
Length=2245

 Score =   142 bits (359),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 44/200 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+GTDRPGL SEISA LA++ C+I    AW+HNAR AC+ Y+ D S H PI D
Sbjct  1890  SEHTAIEMSGTDRPGLFSEISAALADLQCNIVEVHAWSHNARLACVAYISDPSSHTPIED  1949

Query  1355  PYRVAQIQAQLENVVEAHHY----------NGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             P+R+A I+  L  V+ A+            N E ++        + ++ ERRLHQLM + 
Sbjct  1950  PHRLASIEDHLTTVLRANTVRSAGEPSQINNREVKTGGFLGGEGTVSNVERRLHQLMLSV  2009

Query  1205  RDY--------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             RD+                          E C         +  +DR +L+FDT+C L D
Sbjct  2010  RDFDGPISSSSTGTGLNNNKGGSKMVVSIENCDQKEYSIVNIECKDRRRLMFDTICTLND  2069

Query  1124  MQYVVFHASISS-HDSTSVQ  1068
             MQYV+FHAS+SS HD  + Q
Sbjct  2070  MQYVIFHASVSSDHDGRAFQ  2089


 Score =   136 bits (343),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 6/160 (4%)
 Frame = -2

Query  997   FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             FQEY++RHKDG   N ESE+ RV +CL AA ERR S G+ L +  +NRLGLLSD+TRV R
Sbjct  2088  FQEYFIRHKDGYARNTESEKERVIKCLEAAIERRVSEGVLLKLRAENRLGLLSDITRVLR  2147

Query  817   ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
             ENGL++ RA++ T+GE+A+  FYV+D SG  VD   ++S+++E+G T   V K+    T 
Sbjct  2148  ENGLAVVRADVATEGEKAVNAFYVRDISGNEVDMGFIKSMKKEMGLTDLEVIKNDTSTTT  2207

Query  637   AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             + +   +            +  FS G LL +Q+ER S+NF
Sbjct  2208  SPTRTITNISPHE------RHRFSFGDLLKSQIERFSHNF  2241


 Score = 33.9 bits (76),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+++I+YIQQ
Sbjct  1837  MDVFHVKDEHGKKLRDQNVINYIQQ  1861



>ref|XP_010470880.1| PREDICTED: uncharacterized protein LOC104750738 [Camelina sativa]
Length=455

 Score =   140 bits (354),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 105/185 (57%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C + +A  WTHN RAA +++V DD     ++D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCGVSD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E +++     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTL----VSHGEVHTDRRLHQMMFEDRDYELRVVDD  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTKG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   139 bits (351),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 32.7 bits (73),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>ref|XP_002281251.1| PREDICTED: uncharacterized protein LOC100242743 [Vitis vinifera]
 emb|CAN62364.1| hypothetical protein VITISV_031924 [Vitis vinifera]
Length=444

 Score =   140 bits (354),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 103/170 (61%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  117   TALELTGTDRLGLLSEVFAVLADLECNVVESKMWTHNGRIASLIYVKDCDSGNPIEDSQK  176

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+ +L NV++    + + RS + S   A  THTERRLHQ+M ADRDYE+        
Sbjct  177   IDRIEGRLRNVLKG---DNDIRSAKTSVSLAV-THTERRLHQMMFADRDYEREPIIRSAS  232

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDMQYVVFHA+I++
Sbjct  233   ESPAVTVQNWVERGYSVVNVQCKDRRKLLFDVVCTLTDMQYVVFHATINT  282


 Score =   135 bits (341),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E+ER+RV QCL AA ERRAS G+RL++CT++R GLL+DVTR FR
Sbjct  288  YLEFYIRHTDGSPISSEAERQRVIQCLQAAIERRASEGVRLELCTEDRRGLLADVTRTFR  347

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T  E A+  FYV D  G   DP+ +E+VRQ+IG
Sbjct  348  ENGLNVTRAEISTTSEIALNVFYVTDAMGNPADPKIIEAVRQKIG  392


 Score = 36.6 bits (83),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I+YI+Q
Sbjct  76    MDVFHVTDLNGNKLTDESVINYIEQ  100



>ref|XP_008231090.1| PREDICTED: uncharacterized protein LOC103330312 isoform X2 [Prunus 
mume]
Length=443

 Score =   147 bits (372),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 32/177 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT++E++GTDRPGL+SE+ AVLA++ C++  A  WTHNARAA +V+V DDS    I DP
Sbjct  115   EHTSIELSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A I+  L NV+     N E ++ +++      T+ +RRLHQLM ADRDYE+      
Sbjct  175   NRLATIKELLCNVLRG---NSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAEL  231

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                       + S+DRPKLLFD +C LTDMQYVVFH  +++
Sbjct  232   QRIEDKGSRPHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNT  288


 Score =   144 bits (363),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E+ER RV QCL AA ERRAS GL L +CT +R+GLLSD+TR+FR
Sbjct  294  YQEFYIRHVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L + RAEI T+G +AI TFYV D +G +VDP+ ++SVR++IG T+  V  +S    K
Sbjct  354  ENSLCVKRAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIGQTILQVKLNSSPPPK  413

Query  637  A  635
            A
Sbjct  414  A  414



>ref|XP_009373348.1| PREDICTED: uncharacterized protein LOC103962372 [Pyrus x bretschneideri]
Length=443

 Score =   139 bits (351),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRVGLLSEVFAVLADLQCNVVESKVWTHNGRIASLIYVKDCDSGSPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+A+L NV++    + + RS + S   A  THTERRLHQ+M ADRDY++        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTSVSMAV-THTERRLHQMMFADRDYDRKPVLQLRT  229

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM YVVFHA+I +
Sbjct  230   DSPVITVQNWAERGYSIVNIQCKDRAKLLFDVVCTLTDMDYVVFHATIKT  279


 Score =   134 bits (337),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA +RRAS G+RL++CT++R GLL+ VTR FR
Sbjct  285  YMEFYIRHTDGTPISSEPERQRVIQCLQAAVQRRASEGVRLELCTEDRQGLLAYVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T  ++A+  FYV D  G   DP+T+ESVRQ+IG
Sbjct  345  ENGLNVTRAEISTTMDKALNVFYVTDAVGNPADPKTIESVRQKIG  389


 Score = 39.3 bits (90),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I+YI+Q
Sbjct  73    MDVFHVTDQNGNKLTDESVINYIEQ  97



>ref|XP_010511930.1| PREDICTED: uncharacterized protein LOC104787960 [Camelina sativa]
Length=455

 Score =   140 bits (352),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 104/185 (56%), Gaps = 33/185 (18%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+ T +E+TG DRPGL+SE+SAVL  + C + +A  WTHN RAA ++ V DD     ++D
Sbjct  123   TDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCGVSD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++I+  L NV++  +   E +++     +    HT+RRLHQ+M  DRDYE      
Sbjct  183   PERLSRIKNLLRNVLKGSNTPREAKTL----VSHGEVHTDRRLHQMMFEDRDYELRVVED  238

Query  1190  -------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                          C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +  
Sbjct  239   DSSIQDERQKPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  298

Query  1082  STSVQ  1068
             + + Q
Sbjct  299   TEAYQ  303


 Score =   140 bits (352),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA +RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  302  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  362  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  409


 Score = 32.7 bits (73),  Expect(3) = 3e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  78    MDVFNVTDQDGNKVTDEVVLDYIQK  102



>emb|CAN83103.1| hypothetical protein VITISV_015490 [Vitis vinifera]
Length=416

 Score =   140 bits (353),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 104/181 (57%), Gaps = 39/181 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             T+HT++E+TG+DRPGL+SE+SAVL  + C +  A  WTHN RAA +++V D+     ITD
Sbjct  114   TDHTSIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMHVTDEETGCAITD  173

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
             P R+++++  L N+             RL       THTERRLHQ+M ADRDYE+     
Sbjct  174   PERLSKVKQLLCNL-------------RLWSLHGV-THTERRLHQMMFADRDYERIYNDG  219

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    + S+DRPKLLFDTVC LTDMQYVVFHA++ +    + 
Sbjct  220   SDEAQRPNVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVDAEGPEAY  279

Query  1070  Q  1068
             Q
Sbjct  280   Q  280


 Score =   138 bits (347),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  279  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  338

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+TRAE+ T+  +A+ TF+V+D SG  VD +T++S+R+ IG T+
Sbjct  339  ENSLSVTRAEVTTRAGKAVNTFHVRDASGYPVDAKTIDSIREAIGQTI  386


 Score = 34.3 bits (77),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G KI DE I+ YIQ+
Sbjct  68    MDVFNVTDQDGNKITDEEILDYIQK  92



>emb|CBI34815.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   140 bits (353),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 103/170 (61%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  113   TALELTGTDRLGLLSEVFAVLADLECNVVESKMWTHNGRIASLIYVKDCDSGNPIEDSQK  172

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+ +L NV++    + + RS + S   A  THTERRLHQ+M ADRDYE+        
Sbjct  173   IDRIEGRLRNVLKG---DNDIRSAKTSVSLAV-THTERRLHQMMFADRDYEREPIIRSAS  228

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDMQYVVFHA+I++
Sbjct  229   ESPAVTVQNWVERGYSVVNVQCKDRRKLLFDVVCTLTDMQYVVFHATINT  278


 Score =   135 bits (340),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E+ER+RV QCL AA ERRAS G+RL++CT++R GLL+DVTR FR
Sbjct  284  YLEFYIRHTDGSPISSEAERQRVIQCLQAAIERRASEGVRLELCTEDRRGLLADVTRTFR  343

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T  E A+  FYV D  G   DP+ +E+VRQ+IG
Sbjct  344  ENGLNVTRAEISTTSEIALNVFYVTDAMGNPADPKIIEAVRQKIG  388


 Score = 36.6 bits (83),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I+YI+Q
Sbjct  72    MDVFHVTDLNGNKLTDESVINYIEQ  96



>ref|XP_010089340.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB37665.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=455

 Score =   140 bits (352),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 100/178 (56%), Gaps = 31/178 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HT +E+ G DRPGL+SEISAVLA +  ++  A  WTHN R AC++YV DD     + 
Sbjct  133   IGDHTVVELIGRDRPGLLSEISAVLANLRFNVYVAEVWTHNRRIACVLYVNDDVTCRAVN  192

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC---  1188
             DP R++ ++ QL+N++       +   V  +  +   TH +RRLHQ++ ADRDYE C   
Sbjct  193   DPTRLSAMEEQLKNILRGCE---DDEKVGYTSFSMGFTHIDRRLHQMLFADRDYEGCGLT  249

Query  1187  -------------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                        V  +DR KL+FD VC LTDMQYVVFHA+ISS
Sbjct  250   NEVDSPPSFKPKIAIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  307


 Score =   139 bits (350),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGCTL+ E E+ RV +C+ AA +RR S GLRL++C ++R+GLLS+VTR+ RE
Sbjct  314  QEYYIRHMDGCTLDTEGEKERVVKCIEAAIQRRVSEGLRLELCAKDRVGLLSEVTRILRE  373

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS++RA + T GE+A+  F+V+D SG  VD +T+E++R+EIG T+ +  K     +KA
Sbjct  374  NGLSVSRAGVSTVGEQAVNVFFVRDASGNPVDMKTIEALRKEIGHTMMLSVKKVPTSSKA  433


 Score = 33.1 bits (74),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D   I YI++
Sbjct  84    MDVFHVTDQQGNKITDSKTIDYIEK  108



>emb|CDP13377.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   145 bits (367),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 103/173 (60%), Gaps = 31/173 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EH  +E+TG DRPGL+SE+ AVLA++ C++ AA  WTHN+R A +VY+ D+     I DP
Sbjct  124   EHATIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVNGVAIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----CC  1185
              R+++I+  L +V++    N +RRS   +    S TH ERRLHQ+M ADRDY+     C 
Sbjct  184   ERLSKIKQLLLHVLKG---NKDRRSANTAVSVGS-THKERRLHQMMYADRDYDNDVMDCA  239

Query  1184  PVWSR-----------------------DRPKLLFDTVCALTDMQYVVFHASI  1095
             P   R                       DRPKLLFDTVC LTDMQYVV+H +I
Sbjct  240   PTSDRTKPLVTVEKCADKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVYHGTI  292


 Score =   138 bits (348),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DG  ++ E+ER+R+  CL AA +RR S G+RL++C+++R+GLLSDVTR+FRE
Sbjct  301  QEYYIRHIDGWPISSEAERQRLIHCLEAAIKRRTSEGIRLELCSEDRVGLLSDVTRIFRE  360

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            NGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VR+EIG T+
Sbjct  361  NGLSVTRAEVTTRGSQAVNVFYVTDASGYPVKNETIEAVRKEIGLTI  407


 Score = 28.1 bits (61),  Expect(3) = 4e-69, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++ +   IQQ
Sbjct  77    MDVFHVTDQDGNKLSEDKVAERIQQ  101



>ref|XP_009372243.1| PREDICTED: uncharacterized protein LOC103961427 [Pyrus x bretschneideri]
Length=450

 Score =   146 bits (369),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 16/160 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA  RR S G+RL++C  +R GLLSDVTR+FR
Sbjct  300  YQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VRQEIG T   +H     F+K
Sbjct  360  ENGLSVTRAEVATRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLT--FLHVQDDFFSK  417

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +               E G+  FSLG+LL  + E+   N 
Sbjct  418  S------------PPQESGR--FSLGNLLRIRSEKFLYNL  443


 Score =   134 bits (337),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 107/187 (57%), Gaps = 39/187 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             TEHT +E+TG DRPGL+SE+ AVL+++ C++ A   WTHN+R A +VY+ D++   PI D
Sbjct  123   TEHTTIELTGRDRPGLLSEVFAVLSDLKCNVVAGEVWTHNSRMASVVYITDEATGRPIDD  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLM-------------  1215
             P  +A+I+  L  V++    N ++RS   +    S TH ERRLHQ+M             
Sbjct  183   PEHLAKIKQLLLYVLKG---NRDKRSANTAVSVGS-THKERRLHQMMYADRDYDMDDADC  238

Query  1214  --AADRD-----YEQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
               A+DR       E C           CP    DRPKLLFDTVC LTDM+YVV+HA++ +
Sbjct  239   GSASDRSKPLVTVENCVDKGYTVVNLRCP----DRPKLLFDTVCTLTDMEYVVYHATVIA  294

Query  1088  HDSTSVQ  1068
                 + Q
Sbjct  295   EGPEAYQ  301


 Score = 31.6 bits (70),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  77    MDVFHVTDQQGNKLSDDGIAECIQQ  101



>ref|XP_011036590.1| PREDICTED: uncharacterized protein LOC105134046 [Populus euphratica]
Length=485

 Score =   140 bits (352),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 109/200 (55%), Gaps = 44/200 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HTA+EM+GTDRPGL SEISA LA++ C+I    AW+HNAR AC+ Y+ D S   PI D
Sbjct  131   SDHTAIEMSGTDRPGLFSEISAALADLQCNIVEVHAWSHNARLACVAYISDPSSRTPIED  190

Query  1355  PYRVAQIQAQLENVVEAHHY----------NGERRSVRLSDPAASRTHTERRLHQLMAAD  1206
             P+R+A I+  L  V+ A+            N E ++        + ++ ERRLHQLM + 
Sbjct  191   PHRLASIEDYLTTVLRANTVRSAGEPSQINNREVKTGGFLGGEGTVSNVERRLHQLMLSV  250

Query  1205  RDY--------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             RD+                          E C         +  +DR +L+FDT+C LTD
Sbjct  251   RDFDGPTSSSSTGTGLNNNKGGSKMVVSIENCDQKEYSIVNIKCKDRRRLMFDTICTLTD  310

Query  1124  MQYVVFHASISS-HDSTSVQ  1068
             MQYV+FHAS+SS HD  + Q
Sbjct  311   MQYVIFHASVSSDHDGRAFQ  330


 Score =   138 bits (347),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            FQEY++RH DG  LN ESE+ RV +CL AA ERR S G+ L +  +NRLGLLSD+TRV R
Sbjct  329  FQEYFIRHNDGYALNTESEKERVIKCLEAAIERRVSEGVLLKLRAENRLGLLSDITRVLR  388

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ T+GE+A+  FYV+D SG  VD   ++S+++E+G T   V K+    T 
Sbjct  389  ENGLAVVRADVATEGEKAVNAFYVRDISGNEVDMGFIKSMKKEMGLTDLEVIKNDTTTTT  448

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNFRVP  509
            +  +    S          +  FS G LL +Q+ER S+NF VP
Sbjct  449  SARTITDISPHE-------RHRFSFGDLLKSQIERFSHNF-VP  483


 Score = 33.9 bits (76),  Expect(3) = 5e-69, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G K+ D+++I+YIQQ
Sbjct  78    MDVFHVKDEHGKKLRDQNVINYIQQ  102



>ref|XP_003634395.1| PREDICTED: uncharacterized protein LOC100250578 isoform X2 [Vitis 
vinifera]
Length=465

 Score =   143 bits (361),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 105/185 (57%), Gaps = 31/185 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA++  ++  A  WTHN R AC+VYV DD+    + 
Sbjct  143   VGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATCRAVD  202

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+NV+       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  203   DPTRLSVMEEQLKNVLRGCE---DDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGTT  259

Query  1193  -----------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                                        V  +DRPKL+FD VC LTDMQYVVFHASISS  
Sbjct  260   IEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISSDG  319

Query  1082  STSVQ  1068
               + Q
Sbjct  320   PYASQ  324


 Score =   134 bits (337),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +CL AA  RR S GL L++C ++R+GLLS+VTRV RE
Sbjct  324  QEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVTRVLRE  383

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            +GLS+TRA + T GE+A+  FYV+D SG+ VD +T+E++R+EIG T+
Sbjct  384  HGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTM  430


 Score = 34.3 bits (77),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D  II YI++
Sbjct  94    MDVFHVTDQQGNKITDGKIIDYIEK  118



>ref|XP_010664860.1| PREDICTED: uncharacterized protein LOC100250578 isoform X1 [Vitis 
vinifera]
 emb|CBI19929.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   143 bits (361),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 105/185 (57%), Gaps = 31/185 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA++  ++  A  WTHN R AC+VYV DD+    + 
Sbjct  144   VGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATCRAVD  203

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+NV+       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  204   DPTRLSVMEEQLKNVLRGCE---DDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGTT  260

Query  1193  -----------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                                        V  +DRPKL+FD VC LTDMQYVVFHASISS  
Sbjct  261   IEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISSDG  320

Query  1082  STSVQ  1068
               + Q
Sbjct  321   PYASQ  325


 Score =   134 bits (337),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +CL AA  RR S GL L++C ++R+GLLS+VTRV RE
Sbjct  325  QEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVTRVLRE  384

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            +GLS+TRA + T GE+A+  FYV+D SG+ VD +T+E++R+EIG T+
Sbjct  385  HGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTM  431


 Score = 34.3 bits (77),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D  II YI++
Sbjct  95    MDVFHVTDQQGNKITDGKIIDYIEK  119



>ref|XP_010276411.1| PREDICTED: uncharacterized protein LOC104611164 [Nelumbo nucifera]
Length=445

 Score =   140 bits (352),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 105/177 (59%), Gaps = 28/177 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  A  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRLGLLSEVFAVLADLQCNVMEAKVWTHNGRIASLIYVKDCLSGFPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+ +L NV++  +   +  S + +   A  THTERRLHQ+M ADRDYE+        
Sbjct  174   INRIEGRLRNVLKGDN---DILSAKTTVSMAV-THTERRLHQMMFADRDYERRSRTEATT  229

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                V  +DRPKLLFD VC LTDM+YVVFH +I +  + ++Q
Sbjct  230   VTPSVTVQNWAERGYSVVNVQCKDRPKLLFDIVCTLTDMEYVVFHGTIDTAGNQAIQ  286


 Score =   132 bits (333),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QE+Y+RH DG  ++ E+E++RV QCL AA ERR S G+RL++ T +R GLLSDVTR FR
Sbjct  285  IQEFYIRHSDGSPISSEAEKQRVIQCLQAAIERRTSEGVRLELRTSDRWGLLSDVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRF  644
            ENGL++TRAEI T  + A+  FYV DT+G++ DP+ +++VR+ IG  +  V +S  R 
Sbjct  345  ENGLNVTRAEISTLEDMAVNVFYVTDTAGEAADPKIIKAVRERIGSGILKVKESPSRM  402


 Score = 39.7 bits (91),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I YI+Q
Sbjct  73    MDVFHVTDQSGSKLTDESVISYIEQ  97



>ref|XP_002268570.1| PREDICTED: uncharacterized protein LOC100250578 isoform X3 [Vitis 
vinifera]
 emb|CAN73861.1| hypothetical protein VITISV_007291 [Vitis vinifera]
Length=447

 Score =   143 bits (361),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 103/178 (58%), Gaps = 31/178 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA++  ++  A  WTHN R AC+VYV DD+    + 
Sbjct  125   VGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATCRAVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+NV+       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  185   DPTRLSVMEEQLKNVLRGCE---DDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGTT  241

Query  1193  -----------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                        V  +DRPKL+FD VC LTDMQYVVFHASISS
Sbjct  242   IEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISS  299


 Score =   134 bits (337),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +CL AA  RR S GL L++C ++R+GLLS+VTRV RE
Sbjct  306  QEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVTRVLRE  365

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            +GLS+TRA + T GE+A+  FYV+D SG+ VD +T+E++R+EIG T+
Sbjct  366  HGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTM  412


 Score = 33.9 bits (76),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D  II YI++
Sbjct  76    MDVFHVTDQQGNKITDGKIIDYIEK  100



>ref|XP_010926807.1| PREDICTED: uncharacterized protein LOC105048981 [Elaeis guineensis]
Length=448

 Score =   151 bits (382),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 112/181 (62%), Gaps = 30/181 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             E+T++E+TGTDRPGL+SE+ AVL ++ C++  AV WTHN RAA +V+V D+S    I DP
Sbjct  124   EYTSIELTGTDRPGLLSEVCAVLTDLKCNVVKAVVWTHNTRAAAVVHVTDESTRSAIEDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCPVW-  1176
              R++ I+  L NV++   ++ + R  +++  +   THTERRLHQ+M  DRDYE+   V  
Sbjct  184   KRLSTIKELLCNVLK---WDNDSRRAKMT-VSMGGTHTERRLHQMMFDDRDYERAGLVEE  239

Query  1175  -------------------------SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                      S+DRPKLLFDT+C LTDMQYVVFH ++ + +S + 
Sbjct  240   DDKKSKPQVAVMDCTEKDYSIIILRSKDRPKLLFDTLCTLTDMQYVVFHGTVKTGNSEAY  299

Query  1070  Q  1068
             Q
Sbjct  300   Q  300


 Score =   130 bits (328),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER R+ QCL AA ERRAS GL L++ T++R+GLLSD+TR+FR
Sbjct  299  YQEYYIRHIDGHPVNSEAERHRLIQCLEAAIERRASGGLELELITEDRIGLLSDITRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGL I RA+I T+G +A+ TFYV + SG  VD +T++ +R++ G  +  V +S  
Sbjct  359  ENGLCIRRAQISTKGGKAVDTFYVSEMSGSPVDAKTIDLIRRQTGQMILRVKQSPS  414


 Score = 29.3 bits (64),  Expect(3) = 6e-69, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ D+ I++YIQ+
Sbjct  77    MDVFNVTDRNGNKLRDKEILNYIQK  101



>ref|XP_002467694.1| hypothetical protein SORBIDRAFT_01g032575 [Sorghum bicolor]
 gb|EER94692.1| hypothetical protein SORBIDRAFT_01g032575 [Sorghum bicolor]
Length=427

 Score =   145 bits (367),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +Q+YY+RH DG  +N E+ER+R+  CL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  280  YQDYYIRHIDGSPVNSEAERKRIIHCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  339

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G++AI TFYV+D +G SV+ +TLE++RQEIG TV
Sbjct  340  ENGLTVTRAEVSTKGDKAINTFYVRDAAGSSVELKTLEAIRQEIGQTV  387


 Score =   136 bits (343),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 102/181 (56%), Gaps = 31/181 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  107   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAELWTHNERAAAVMQVTDRKSGLAISD  166

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               R+ +I+ +L NV     + G  R  + +  A   THTERRLHQ+M  DRDY++     
Sbjct  167   AERLGRIKERLCNV-----FKGRSRDAKTT-VAMGITHTERRLHQMMLEDRDYDRHDKDR  220

Query  1190  --------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                                    +  +DRPKLLFDTVC LTDMQYVVFH S+ +    + 
Sbjct  221   ASGSPTSMVSVVNWLQKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPDAY  280

Query  1070  Q  1068
             Q
Sbjct  281   Q  281


 Score = 29.3 bits (64),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 1/28 (4%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCV  1628
             + VF+VT+Q G+KI+DES++  I+  C+
Sbjct  57    MDVFNVTNQGGHKIMDESVLEGIKD-CI  83



>ref|XP_010260456.1| PREDICTED: uncharacterized protein LOC104599557 isoform X2 [Nelumbo 
nucifera]
Length=449

 Score =   150 bits (380),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 108/185 (58%), Gaps = 31/185 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVL ++ C++ +A  WTHN R AC++YV DD+    + 
Sbjct  127   IGDHTAIELIGRDRPGLLSEISAVLTDLHCNVVSAEVWTHNMRLACVLYVNDDTTCRAVD  186

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+N++      G+      S      TH +RRLHQ+M ADRDYE     
Sbjct  187   DPIRLSAMEEQLKNLLGGRDDGGKAARTNFS---MGFTHMDRRLHQMMFADRDYEIDVVT  243

Query  1193  ----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHD  1083
                             +C         V  +DRPKLLFD VC LTDMQYVVFHASISS  
Sbjct  244   KDTDYAPSFQPIITVDRCEDKGYSVVNVRCKDRPKLLFDIVCTLTDMQYVVFHASISSDG  303

Query  1082  STSVQ  1068
               ++Q
Sbjct  304   PYALQ  308


 Score =   131 bits (330),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RH DGC L+ E E+ RV +CL AA  RR   GL L++C ++R+GLLS+VTR+ R
Sbjct  307  LQEYYIRHMDGCILDTEGEKERVVKCLEAAVRRRVCEGLSLELCARDRVGLLSEVTRILR  366

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV  668
            ENGLS+ RA + T GE+A+  FYV+D SG +VD +T+E++R+EIG T+ +
Sbjct  367  ENGLSVRRAGVTTVGEQAMNVFYVRDASGNAVDMKTIEALRKEIGHTMML  416


 Score = 29.3 bits (64),  Expect(3) = 7e-69, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D   I +I+ 
Sbjct  76    MDVFHVTDQQGNKVTDTKTIEHIEM  100



>ref|XP_007153472.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
 gb|ESW25466.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
Length=451

 Score =   144 bits (362),  Expect(3) = 9e-69, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 105/180 (58%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HT +E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITDP
Sbjct  128   DHTVIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEETGSAITDP  187

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ ++  L NV+   +     ++V ++D     THTERRLHQ+M ADRDYE+      
Sbjct  188   KRLSIVKELLCNVLGGGNKKRGAKTV-VTDEV---THTERRLHQMMFADRDYERDSDDAF  243

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFDTVC LTDM+YVVFHA I +    + Q
Sbjct  244   DEKQRPNVNVVNWSDNNYSVVTIQCKDRPKLLFDTVCTLTDMEYVVFHAKIDAEGPEAYQ  303


 Score =   139 bits (351),  Expect(3) = 9e-69, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY+++H DG  +  ++ER+RV QCL AA ERR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  302  YQEYFIKHIDGSPMKSDAERQRVIQCLAAAIERRVSDGLKLELCTTDRVGLLSDVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  362  ENSLTVTRAEVSTKGGKAVNTFYVRGASGFPVDLKTIESIRQTIGNTI  409


 Score = 27.7 bits (60),  Expect(3) = 9e-69, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             +  F+VT Q G K+ DE+I+ YI++
Sbjct  82    MDAFNVTGQDGNKVTDEAILDYIRK  106



>ref|XP_008231089.1| PREDICTED: uncharacterized protein LOC103330312 isoform X1 [Prunus 
mume]
Length=465

 Score =   148 bits (373),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 32/177 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT++E++GTDRPGL+SE+ AVLA++ C++  A  WTHNARAA +V+V DDS    I DP
Sbjct  115   EHTSIELSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A I+  L NV+     N E ++ +++      T+ +RRLHQLM ADRDYE+      
Sbjct  175   NRLATIKELLCNVLRG---NSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAEL  231

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                       + S+DRPKLLFD +C LTDMQYVVFH  +++
Sbjct  232   QRIEDKGSRPHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNT  288


 Score =   142 bits (358),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            ++E+Y+RH DG  ++ E+ER RV QCL AA ERRAS GL L +CT +R+GLLSD+TR+FR
Sbjct  316  YREFYIRHVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFR  375

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L + RAEI T+G +AI TFYV D +G +VDP+ ++SVR++IG T+  V  +S    K
Sbjct  376  ENSLCVKRAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIGQTILQVKLNSSPPPK  435

Query  637  A  635
            A
Sbjct  436  A  436



>ref|XP_008373875.1| PREDICTED: uncharacterized protein LOC103437194 [Malus domestica]
Length=446

 Score =   138 bits (347),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRVGLLSEVFAVLADLQCNVVESKVWTHNGRIASLIYVKDCDSGCPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+A+L NV++    + + RS + S   A  THTERRLHQ+M ADRDY++        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTSVSMAV-THTERRLHQMMFADRDYDRKPVLQLXT  229

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM YVVFHA+I +
Sbjct  230   DFPVITVQNWAERGYSIVNIQCKDRAKLLFDVVCTLTDMDYVVFHATIKT  279


 Score =   134 bits (336),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA +RRAS G+RL++CT++R GLL+ VTR FR
Sbjct  285  YMEFYIRHTDGTPISSEPERQRVIQCLQAAVQRRASEGVRLELCTEDRQGLLAYVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T  ++A+  FYV D  G   DP+T+ESVRQ+IG
Sbjct  345  ENGLNVTRAEISTTMDKALNVFYVTDAVGNPADPKTIESVRQKIG  389


 Score = 39.3 bits (90),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I+YI+Q
Sbjct  73    MDVFHVTDQNGNKLTDESVINYIEQ  97



>ref|XP_004984033.1| PREDICTED: uncharacterized protein LOC101763377 isoform X1 [Setaria 
italica]
Length=445

 Score =   151 bits (381),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  306  YQEYYIRHIDGSPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  365

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G +AI TFYV+DT+G SV+ +TLE++RQEIG TV
Sbjct  366  ENGLTVTRAEVATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTV  413


 Score =   138 bits (348),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 31/181 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  133   SDYTLIELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISD  192

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+ +I+  L NV     + G  R  + +  A   THTERRLHQ+M  DRDYE+     
Sbjct  193   ADRLGRIKEWLRNV-----FKGRSRDAKTT-VAMGITHTERRLHQMMLEDRDYERYDKDR  246

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   P+ S                +DRPKLLFDTVC LTDMQYVV+H S+ +    + 
Sbjct  247   ANANPMPMVSVVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAY  306

Query  1070  Q  1068
             Q
Sbjct  307   Q  307



>ref|XP_009346780.1| PREDICTED: uncharacterized protein LOC103938500 [Pyrus x bretschneideri]
Length=443

 Score =   145 bits (367),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 111/184 (60%), Gaps = 32/184 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             E+T++E++GTDRPGL+SE+ AVLA++ C++  A  WTHNARAA +V+V DDS    I DP
Sbjct  115   EYTSIELSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIEDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC--CPV  1179
              R+A I+  L NV++    N E ++ +++      T+ +RRLHQ+M ADRDYE+     +
Sbjct  175   IRLATIKELLCNVLKV---NSELKAAKMTLATPGVTNRDRRLHQIMFADRDYERVERAEL  231

Query  1178  W---------------------------SRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
             W                           S+DRPKLLFD +C LTDMQYVVFH  +++  +
Sbjct  232   WRVEDKGSKPHVTALDCSQKDYTIITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRT  291

Query  1079  TSVQ  1068
              + Q
Sbjct  292   EAYQ  295


 Score =   144 bits (362),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  +N E+ER RV QCL AA ERRAS GL L +CT +R+GLLSD+TR+FR
Sbjct  294  YQEFYIRHVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L +TRAEI T+  +AI TFYV D +G  VDP+ ++SVR++IG T+  V  +S    K
Sbjct  354  ENSLRVTRAEISTKNGKAIDTFYVTDVTGSPVDPKIIDSVRRQIGQTILQVKCNSSPPPK  413

Query  637  A  635
             
Sbjct  414  P  414



>ref|XP_008389912.1| PREDICTED: uncharacterized protein LOC103452175 [Malus domestica]
Length=449

 Score =   141 bits (356),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA  RR S G+RL++C  +R GLLSDVTR+FR
Sbjct  299  YQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV---------KVV  665
            ENGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VRQEIG  +         K  
Sbjct  359  ENGLSVTRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALLSLQDDFCSKSP  418

Query  664  HKSSGRFT  641
             + SGRF+
Sbjct  419  PQESGRFS  426


 Score =   137 bits (346),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 100/176 (57%), Gaps = 38/176 (22%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SE+ AVL+ + C++ A   WTHN+R A +VY+ D+    PI DP
Sbjct  124   EHTTIELTGRDRPGLLSEVFAVLSNLKCNVVAGEVWTHNSRMASVVYITDEETGRPIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY--------  1197
               + +I+  L  V++      ++RS   +    S TH ERRLHQ+M ADRDY        
Sbjct  184   EHLTKIKQLLLYVLKGDR---DKRSANTAVSVGS-THKERRLHQMMYADRDYDMDNADSV  239

Query  1196  -----------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                        E C           CP    DRPKLLFDTVC LTDM+YVV+HA++
Sbjct  240   ASDRSKPLVTVENCVDKGYTVVNLRCP----DRPKLLFDTVCTLTDMEYVVYHATV  291


 Score = 31.6 bits (70),  Expect(3) = 1e-68, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  77    MDVFHVTDQQGNKLSDDGIAERIQQ  101



>ref|XP_004984034.1| PREDICTED: uncharacterized protein LOC101763377 isoform X2 [Setaria 
italica]
Length=441

 Score =   151 bits (381),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER+R+ QCL AA ERR S GL+L++ T +R+GLLSDVTR+FR
Sbjct  302  YQEYYIRHIDGSPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFR  361

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            ENGL++TRAE+ T+G +AI TFYV+DT+G SV+ +TLE++RQEIG TV
Sbjct  362  ENGLTVTRAEVATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTV  409


 Score =   138 bits (348),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 31/181 (17%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +++T +E+TGTDRPGL+SE+SAVL  + C++  A  WTHN RAA ++ V D      I+D
Sbjct  129   SDYTLIELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISD  188

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC----  1188
               R+ +I+  L NV     + G  R  + +  A   THTERRLHQ+M  DRDYE+     
Sbjct  189   ADRLGRIKEWLRNV-----FKGRSRDAKTT-VAMGITHTERRLHQMMLEDRDYERYDKDR  242

Query  1187  -----CPVWS----------------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                   P+ S                +DRPKLLFDTVC LTDMQYVV+H S+ +    + 
Sbjct  243   ANANPMPMVSVVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAY  302

Query  1070  Q  1068
             Q
Sbjct  303   Q  303



>ref|XP_010108109.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXC17841.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=441

 Score =   138 bits (348),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 105/170 (62%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRVGLLSEVFAVLADLQCNVVESKVWTHNGRIASLIYVKDCDSGCPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----QCC-  1185
             + +I+  L NV++    + + R+ + S   A  THTERRLHQ+M ADRDYE     Q C 
Sbjct  174   INRIEGLLRNVLKG---DNDIRTAKTSVSMAV-THTERRLHQMMFADRDYERKPILQYCA  229

Query  1184  --PV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM YVVFHA+I++
Sbjct  230   DSPVVTVQNWTERGYSVVNIQCKDRTKLLFDVVCTLTDMDYVVFHATINT  279


 Score =   133 bits (335),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -2

Query  991  EYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFREN  812
            E+Y++HKDG  ++ E ER+RV QCL AA +RRAS G+RL++CT +R  LL+DVTR FREN
Sbjct  287  EFYIKHKDGTPISSEPERQRVIQCLQAAIKRRASEGVRLELCTADRQCLLADVTRTFREN  346

Query  811  GLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            GL++TRAEI T GE A   FYV D  G   DP+T+ESVRQ+IG
Sbjct  347  GLNVTRAEISTSGEMARNVFYVTDAVGNPADPKTIESVRQKIG  389


 Score = 38.9 bits (89),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVAI  1622
             + VFHVTDQ G K+ DES+I YI++  V I
Sbjct  73    MDVFHVTDQNGNKLTDESVISYIEKSLVTI  102



>emb|CDX81587.1| BnaC02g18910D [Brassica napus]
Length=453

 Score =   139 bits (350),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYYVRH DG  +  E+E++RV QCL AA  RR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  300  YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV D SG S+D +T++S+RQ IG T+
Sbjct  360  ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTI  407


 Score =   138 bits (348),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 104/187 (56%), Gaps = 35/187 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYV-EDDSKHGPIT  1359
             TE T +E+TG DRPGL+SE++AVL  + C +  A  WTHN RAA ++ V  DDS    I+
Sbjct  119   TESTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTTDDSTGCAIS  178

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ----  1191
             DP R+++I+  L NV++  +   E ++V     +    HT+RRLHQ+M  DRDYE     
Sbjct  179   DPERLSRIKNLLRNVLKGSNTPREAKTVL----SHGEVHTDRRLHQMMFEDRDYEHRAVV  234

Query  1190  ---------------CCPVW-----------SRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                            C   W            +DRPKLLFDTVC LTDMQYVVFH S+ +
Sbjct  235   DDDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDT  294

Query  1088  HDSTSVQ  1068
               + + Q
Sbjct  295   EGTEAYQ  301


 Score = 32.7 bits (73),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YIQ+
Sbjct  74    MDVFNVTDQDGNKVTDEVVLDYIQK  98



>gb|EYU32470.1| hypothetical protein MIMGU_mgv1a006244mg [Erythranthe guttata]
Length=451

 Score =   147 bits (370),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 109/188 (58%), Gaps = 32/188 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + ++TA+E+ G DRPGL+SEISAVLA +  ++ AA  WTHN R AC++YV DD  +  + 
Sbjct  123   MGDYTAIELIGRDRPGLLSEISAVLANLQINVVAAEVWTHNRRIACVLYVNDDITNRAVE  182

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSV--RLSDPAASRTHTERRLHQLMAADRDYEQC-  1188
             D  R++ +Q QL+N++     + +  SV  R S    S TH +RRLHQL+ ADRDYE   
Sbjct  183   DESRLSAMQDQLKNILRIGGGSDDDDSVLGRTSFSVGS-THVDRRLHQLLFADRDYEGAY  241

Query  1187  ---------CP-------------------VWSRDRPKLLFDTVCALTDMQYVVFHASIS  1092
                      CP                   V  RDRPKL+FD VC LTDMQYVVFHAS+S
Sbjct  242   VAGNDGEADCPIKPKVTIERCEEKDYFVVNVRCRDRPKLMFDIVCTLTDMQYVVFHASVS  301

Query  1091  SHDSTSVQ  1068
             S    + Q
Sbjct  302   SEGPYASQ  309


 Score =   134 bits (336),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYYVRH DG TL+ E E+ +V +CL AA  RR S GL L++C ++R+GLLS+VTRV RE
Sbjct  309  QEYYVRHIDGFTLDTEGEKEKVVKCLEAAIRRRISEGLSLELCAKDRVGLLSEVTRVLRE  368

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV-VHKSSGRFTK  638
            NGLS+TRA + T GE+A+  FYV D SG+SVD +T+E +R+EIG T+ + V K+     K
Sbjct  369  NGLSVTRAGVTTVGEQAMNVFYVSDASGKSVDAKTIEELRKEIGHTMMLNVKKAPTNAAK  428

Query  637  A  635
            A
Sbjct  429  A  429


 Score = 30.0 bits (66),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D   I +I++
Sbjct  74    MDVFHVTDQQGQKITDTRTIEHIER  98



>ref|XP_007208916.1| hypothetical protein PRUPE_ppa1027134mg [Prunus persica]
 gb|EMJ10115.1| hypothetical protein PRUPE_ppa1027134mg [Prunus persica]
Length=441

 Score =   137 bits (346),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRLGLLSEVFAVLADLQCNVVESKVWTHNGRIASLIYVKDCDSGCPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+A+L NV++    + + RS + S   A  THTERRLHQ+M ADRDY++        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTSVSMAV-THTERRLHQMMFADRDYDRKPILQHST  229

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM YVVFHA+I +
Sbjct  230   DSPVITVQNWAERGYSIVNIQCKDRAKLLFDVVCTLTDMDYVVFHATIKT  279


 Score =   131 bits (329),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
             E+Y+RH DG  ++ E ER+RV QCL AA +RRAS G+RL++CT++R GLL+ VTR FRE
Sbjct  286  MEFYIRHTDGTPISSEPERQRVIQCLQAAIQRRASEGVRLELCTEDRPGLLAYVTRTFRE  345

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGL++TRAEI T  + A+  FYV D  G   DP T+ESVRQ+IG
Sbjct  346  NGLNVTRAEISTTKDNALNVFYVTDAMGNPADPNTIESVRQKIG  389


 Score = 41.6 bits (96),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+IHYI+Q
Sbjct  73    MDVFHVTDQNGDKLTDESVIHYIEQ  97



>ref|XP_011081540.1| PREDICTED: uncharacterized protein LOC105164564 [Sesamum indicum]
Length=484

 Score =   146 bits (369),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 107/160 (67%), Gaps = 15/160 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DGC LN ESE+ +V +CL AA ERR   G+RL++C  NR+GLLSD+TRV R
Sbjct  336  YQEYFIRHADGCALNTESEKDKVIKCLEAAIERRVCEGVRLELCAYNRVGLLSDITRVLR  395

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ T+GE+++  FYV+D SG +VD + ++S+++E+G     V + +  +  
Sbjct  396  ENGLAVLRADVATRGEKSVNAFYVRDISGNNVDLDFIKSMKREMGEIDLSVMEETTNYRP  455

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
             ++                +P FS+G +L +Q+ER S++F
Sbjct  456  TSTE---------------RPKFSIGEMLKSQIERFSHSF  480


 Score =   129 bits (323),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 102/199 (51%), Gaps = 44/199 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              E  A+EMTG DRPGL SEISAVLA++GC+I  A AW+HNA  AC+VY+ D S   PI D
Sbjct  140   NEPKAIEMTGKDRPGLFSEISAVLADLGCNIIEAHAWSHNAHLACVVYISDKSTDTPIDD  199

Query  1355  PYRVAQIQAQLENVV--------EAHHYNGERRSVRL-SDPAASRTHTERRLHQLMAADR  1203
              +R+  I+  L  V+        E H    E +   L      + T  ERRLHQLM + R
Sbjct  200   -HRLHAIEDHLTTVLRATSSAATEEHANQQEVKPAGLPKGQLCTTTKVERRLHQLMVSVR  258

Query  1202  DY---------------------------EQC-------CPVWSRDRPKLLFDTVCALTD  1125
             D+                           E C         +  +DR +L+FDTVC LTD
Sbjct  259   DFDVPVQHKRSPTSAADSDEEDRKASISIESCIEKGYSIVTIQCKDRRRLMFDTVCTLTD  318

Query  1124  MQYVVFHASISSHDSTSVQ  1068
             MQYV+FHASI S+   + Q
Sbjct  319   MQYVIFHASIDSYGGYAYQ  337


 Score = 35.0 bits (79),  Expect(3) = 2e-68, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G KI D+ +I+YIQQ
Sbjct  93    MDVFHVKDERGNKITDQRVINYIQQ  117



>ref|XP_006368726.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|ERP65295.1| ACT domain-containing family protein [Populus trichocarpa]
Length=442

 Score =   137 bits (346),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA ERRAS G+RL++CT +R GLL+DVTR FR
Sbjct  285  YLEFYIRHTDGTPISSEPERQRVIQCLQAAVERRASEGVRLELCTPDRQGLLADVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T G+ A+  FYV D  G   DP+ +ESVRQ+IG
Sbjct  345  ENGLNVTRAEISTAGDMALNVFYVTDAVGNPADPKLIESVRQKIG  389


 Score =   135 bits (340),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 102/170 (60%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  A  WTHN R A ++YV+D +   PI D   
Sbjct  114   TALELTGTDRIGLLSEVFAVLADLQCSVVDAKVWTHNGRIASLMYVKDCNSGSPIEDTQH  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+A+L NV++    + + RS +     A  THTERRLHQ+M ADRDYE+        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTMVSMAV-THTERRLHQVMFADRDYERKPILQPSG  229

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDM+Y+VFHA+I++
Sbjct  230   DSPVVTVQNWVERGYSVVNVQCKDRTKLLFDVVCTLTDMEYIVFHATINT  279


 Score = 36.6 bits (83),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I+YI+Q
Sbjct  73    MDVFHVTDLNGNKLTDESVINYIEQ  97



>ref|XP_011029105.1| PREDICTED: uncharacterized protein LOC105128946 [Populus euphratica]
Length=442

 Score =   137 bits (346),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA ERRAS G+RL++CT +R GLL+DVTR FR
Sbjct  285  YLEFYIRHTDGTPISSEPERQRVIQCLQAAVERRASEGVRLELCTPDRQGLLADVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T G+ A+  FYV D  G   DP+ +ESVRQ+IG
Sbjct  345  ENGLNVTRAEISTAGDMALNVFYVTDAVGNPADPKLIESVRQKIG  389


 Score =   135 bits (341),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 102/170 (60%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  A  WTHN R A ++YV+D +   PI D   
Sbjct  114   TALELTGTDRIGLLSEVFAVLADLQCSVVDAKVWTHNGRIASLMYVKDCNSGSPIEDTQH  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+A+L NV++    + + RS +     A  THTERRLHQ+M ADRDYE+        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTMVSMAV-THTERRLHQVMFADRDYERKPILQPSG  229

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDM+Y+VFHA+I++
Sbjct  230   DSPVVTVQNWVERGYSVVNVQCKDRTKLLFDVVCTLTDMEYIVFHATINT  279


 Score = 36.2 bits (82),  Expect(3) = 3e-68, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I+YI+Q
Sbjct  73    MDVFHVTDLNGNKLTDESVINYIEQ  97



>ref|XP_007040015.1| ACT domain repeat 8 [Theobroma cacao]
 gb|EOY24516.1| ACT domain repeat 8 [Theobroma cacao]
Length=441

 Score =   143 bits (360),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 104/170 (61%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  A  WTHN R A ++YV+D +   PI D  +
Sbjct  114   TALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQ  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ--------  1191
             + +I+A+L NV++    + + RS + S   A  THTERRLHQ+M ADRDYE+        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTSVSMAV-THTERRLHQMMFADRDYERKPILQHRA  229

Query  1190  ----------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V S+DR  LLFD VC LTDMQYVVFHA+I++
Sbjct  230   DSPVVTVQNWVERGYSVVNVQSKDRTNLLFDVVCTLTDMQYVVFHATINT  279


 Score =   130 bits (327),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER RV QCL AA ERRAS G+RL++CT +R GLL+DVTR FR
Sbjct  285  YLEFYIRHTDGTPISSEPERHRVIQCLQAAVERRASEGIRLELCTDDRQGLLADVTRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG-GTVKV  668
            ENGL++TRAEI T  + A   FYV D  G   DP+ +E+VRQ+IG G +K+
Sbjct  345  ENGLNVTRAEISTTRDMAKNVFYVTDAIGNLADPKIIEAVRQKIGLGKLKI  395


 Score = 35.4 bits (80),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I YI+Q
Sbjct  73    MDVFHVTDLNGNKLTDESVISYIEQ  97



>ref|NP_565146.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_849896.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_849897.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_001031289.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_001117608.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 sp|O49285.1|ACR3_ARATH RecName: Full=ACT domain-containing protein ACR3; AltName: Full=Protein 
ACT DOMAIN REPEATS 3 [Arabidopsis thaliana]
 gb|AAK26032.1|AF360322_1 unknown protein [Arabidopsis thaliana]
 gb|AAC00631.1| Similar to uridylyl transferases [Arabidopsis thaliana]
 gb|AAM44939.1| unknown protein [Arabidopsis thaliana]
 gb|AAM93428.1| ACR3 [Arabidopsis thaliana]
 dbj|BAH20041.1| AT1G76990 [Arabidopsis thaliana]
 gb|AEE35917.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35918.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35919.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35920.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35921.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
Length=453

 Score =   141 bits (356),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 106/184 (58%), Gaps = 29/184 (16%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             L +HT++E+   DRPGL+SE+SAVLA++  ++ AA AWTHN R AC++YV D++    + 
Sbjct  125   LGDHTSIEIIARDRPGLLSEVSAVLADLNINVVAAEAWTHNRRIACVLYVNDNATSRAVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCP-  1182
             DP R++ ++ QL NV+       E+ + R S    S TH +RRLHQ+  ADRDYE     
Sbjct  185   DPERLSSMEEQLNNVLRGCEEQDEKFA-RTSLSIGS-THVDRRLHQMFFADRDYEAVTKL  242

Query  1181  --------------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                                       V   DRPKL+FD VC LTDMQY+VFHA+ISS  S
Sbjct  243   DDSASCGFEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSSGS  302

Query  1079  TSVQ  1068
              + Q
Sbjct  303   HASQ  306


 Score =   134 bits (336),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHKDGCTL+ E E+ RV +CL AA  RR S G  L++C ++R+GLLS+VTR+ RE
Sbjct  306  QEYFIRHKDGCTLDTEGEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVTRILRE  365

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS  656
            +GLS++RA + T GE+A+  FYVKD SG  VD +T+E++R EIG ++ +  K+
Sbjct  366  HGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKN  418


 Score = 33.9 bits (76),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHVTDQ G K+ D   I YI++V
Sbjct  76    MDVFHVTDQQGNKVTDSKTIDYIEKV  101



>ref|XP_008798512.1| PREDICTED: uncharacterized protein LOC103713383 [Phoenix dactylifera]
Length=378

 Score =   145 bits (365),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (60%), Gaps = 29/174 (17%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDRPGL+SE+ AVLA++ C +  A  WTHN R A +++V D+    PI DP+R
Sbjct  44    TALELTGTDRPGLLSEVFAVLADLCCAVVEAKVWTHNGRIAALIFVRDEDSGSPIDDPHR  103

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +++A+L +V++  H    R +   + P+ S TH++RRLHQLM ADRDYE+        
Sbjct  104   IRRVEARLRHVLKGDH--DVRGAKTAAVPSPSLTHSDRRLHQLMFADRDYERVSSAETAS  161

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSH  1086
                                   +   DRPKLLFD VC LTDM YVVFH +I ++
Sbjct  162   SSSSQPSVSVQNWIERGYSIVNIQCGDRPKLLFDIVCTLTDMDYVVFHGTIDTN  215


 Score =   127 bits (320),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QE+Y+RH DG  ++ E+ER+RV QCL AA ERRAS GLRL++ T +R GLL+DVTR FRE
Sbjct  221  QEFYIRHLDGSPISSEAERQRVIQCLQAAIERRASEGLRLELHTVDRRGLLADVTRTFRE  280

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGLS+TRA++ T+G+ A   FYV D +G   DP+ ++SV + IG
Sbjct  281  NGLSVTRADVSTKGQMATNVFYVTDAAGHPADPKMIDSVIERIG  324


 Score = 36.6 bits (83),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD LG K+ D+S+I YI+ 
Sbjct  1     MDVFHVTDHLGRKLADDSVISYIEH  25



>ref|XP_009343127.1| PREDICTED: uncharacterized protein LOC103935102 [Pyrus x bretschneideri]
Length=449

 Score =   141 bits (356),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA  RR S G+RL++C  +R GLLSDVTR+FR
Sbjct  299  YQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV---------KVV  665
            ENGLS+TRAE+ T+G +A+  FYV D SG  V  ET+E+VRQEIG  +         K  
Sbjct  359  ENGLSVTRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALLSLQDDFCSKSP  418

Query  664  HKSSGRFT  641
             + SGRF+
Sbjct  419  PQESGRFS  426


 Score =   135 bits (341),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 99/176 (56%), Gaps = 38/176 (22%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TG DRPGL+SE+ AVL+ + C++     WTHN+R A +VY+ D+    PI DP
Sbjct  124   EHTTIELTGRDRPGLLSEVFAVLSNLKCNVVTGEVWTHNSRMASVVYITDEETGRPIDDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY--------  1197
               + +I+  L  V++      ++RS   +    S TH ERRLHQ+M ADRDY        
Sbjct  184   EHLTKIKQLLLYVLKGDR---DKRSANTAVSVGS-THKERRLHQMMYADRDYDMDAADCG  239

Query  1196  -----------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                        E C           CP    DRPKLLFDTVC LTDM+YVV+HA++
Sbjct  240   ASDRSKPLVTVENCVDKGYTVVNLRCP----DRPKLLFDTVCTLTDMEYVVYHATV  291


 Score = 31.6 bits (70),  Expect(3) = 4e-68, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+ I   IQQ
Sbjct  77    MDVFHVTDQQGNKLSDDGIAERIQQ  101



>ref|XP_008379088.1| PREDICTED: uncharacterized protein LOC103442112 [Malus domestica]
Length=443

 Score =   144 bits (363),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 110/184 (60%), Gaps = 32/184 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             E+T++E++GTDRPGL+SE+ AVLA++ C++  A  WTHNARAA +V+V DDS    I DP
Sbjct  115   EYTSIELSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIEDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+A I+  L NV++    N E ++ +++      T+ +RRLHQ+M ADRDYE+      
Sbjct  175   IRLATIKELLCNVLKV---NSELKAAKMTLATPGVTNRDRRLHQIMFADRDYERVERAEL  231

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                                       + S+DRPKLLFD +C LTDMQYVVFH  +++  +
Sbjct  232   RRVEDKGSKPHVTALDCSQKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRT  291

Query  1079  TSVQ  1068
              + Q
Sbjct  292   EAYQ  295


 Score =   144 bits (362),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  +N E+ER RV QCL AA ERRAS GL L +CT +R+GLLSD+TR+FR
Sbjct  294  YQEFYIRHVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L +TRAEI T+  +AI TFYV D +G  VDP+ ++SVR++IG T+  V  +S    K
Sbjct  354  ENSLRVTRAEISTKSGKAIDTFYVTDVTGSPVDPKIIDSVRRQIGQTILQVKCNSSPAPK  413

Query  637  A  635
             
Sbjct  414  P  414



>ref|XP_003614264.1| ACR4 [Medicago truncatula]
 gb|AES97222.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=451

 Score =   142 bits (359),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 104/180 (58%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+ G+DRPGL+SE+SAVL  + C+I  A  WTHN RAA +++V D+     ITD 
Sbjct  130   DHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVTDEETGSAITDS  189

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R++ I+  L NV+   +     ++V   D     THT+RRLHQ+M  DRDYE+      
Sbjct  190   QRLSLIKELLCNVLGGGNRKRGAKTVVTDDS----THTDRRLHQMMFDDRDYERVDDDDF  245

Query  1187  ---------CPVWS-----------RDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                         WS           RDRPKL+FDTVC LTDMQYVVFHA+I +    + Q
Sbjct  246   DEKQRPNVDVVNWSDKDYSVVTIECRDRPKLVFDTVCTLTDMQYVVFHANIDAEGPQAYQ  305


 Score =   135 bits (339),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY++H DG  +  ++ER+RV  CL AA ERR S GL+L++CT +R+GLLS+VTR+FR
Sbjct  304  YQEYYIKHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  363

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+G +A+ TFYV+  SG  VD +T+ES+RQ IG T+
Sbjct  364  ENSLTVTRAEVTTKGGKAVNTFYVRGASGCIVDSKTIESIRQTIGNTI  411


 Score = 31.6 bits (70),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE I+ YI++
Sbjct  84    MDVFNVTDQDGNKVTDEVILDYIRK  108



>ref|XP_003631797.2| PREDICTED: uncharacterized protein LOC100852414 isoform X1 [Vitis 
vinifera]
Length=484

 Score =   148 bits (373),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 6/160 (4%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEY++RH DGCT+N E E+  V +CL AA ERR   G+RL++C  NRLGLLSD+TRV R
Sbjct  326  MQEYFIRHIDGCTVNSEGEKEHVVKCLEAAIERRVCEGVRLELCANNRLGLLSDITRVLR  385

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ TQGE+A+  FYVKD SG  VD E  E  ++E    ++ V K  G    
Sbjct  386  ENGLAVVRADVETQGEKAVNAFYVKDLSGNDVDTEFTEPKKKE--KFIESVKKEMGPIDL  443

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            A         +   S  D +P FS+  ++ + ++RLSNNF
Sbjct  444  A----VKKEITSSPSSPDHRPRFSVADMVKSHVDRLSNNF  479


 Score =   128 bits (321),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 104/198 (53%), Gaps = 42/198 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+G DRPGL SEISA LA++  +I  A AWTHN R AC+ Y+ D S    I D
Sbjct  130   SEHTAIEMSGADRPGLFSEISAALADLQVNIVEAHAWTHNERLACVAYITDQSTDSRIED  189

Query  1355  PYRVAQIQAQLENVVEAHHYN----GERRSVRLSDPAASRTHTERRLHQLMAADRDYE--  1194
             P+R+A+I+  L  V+ A + +     E +   L    A+ T  ERRLHQLM +  D+E  
Sbjct  190   PHRLAKIENHLATVLGAANISRANHQEVKGADLHVGEATTTCAERRLHQLMLSVEDFEGP  249

Query  1193  ----------------------------QCC--------PVWSRDRPKLLFDTVCALTDM  1122
                                         + C         +  +DR +L+FD VC +TDM
Sbjct  250   SAPTTSSSETPLGLDEDDDEGSKTIVSIESCNERGYSIVSIECKDRLRLMFDVVCTITDM  309

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QY++FH S +SH   ++Q
Sbjct  310   QYLIFHGSTASHGGYAMQ  327


 Score = 33.1 bits (74),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1705  VFHVTDQLGYKIVDESIIHYIQQ  1637
             VFHV D+ G K+ D+ +I+YIQQ
Sbjct  83    VFHVRDEHGNKLTDQRVINYIQQ  105



>ref|XP_007043903.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
 gb|EOX99734.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
Length=473

 Score =   147 bits (372),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 16/160 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DGC ++ E ER+RV  CL AA +RRAS G+RL++C+++R+GLLSDVTR+FR
Sbjct  323  YQEYYIRHMDGCPVSSEPERQRVINCLEAAIKRRASEGIRLELCSEDRVGLLSDVTRIFR  382

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS+TRAE+ T+G +A+  F V D SG  V  ET+E+VR+E+G T  ++H     ++K
Sbjct  383  ENGLSVTRAEVTTRGSQAVNAFCVTDASGDPVKSETIEAVRKELGLT--ILHVKDDAYSK  440

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            +               E G  GFSLG+L  ++ E+   N 
Sbjct  441  S------------PPQESG--GFSLGTLFKSRSEKFLYNL  466


 Score =   140 bits (353),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 33/175 (19%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             ++HT +E+TG DRPGL+SE+ AVL ++ C++ AA  WTHN+R A +VY+ D++    I +
Sbjct  146   SKHTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSSIDN  205

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDP-AASRTHTERRLHQLMAADRDYEQ----  1191
             P R+ +I+  L  V++     G+R  +R +   +   THTERRLHQ+M ADRDY+     
Sbjct  206   PERLTKIKQLLLYVLK-----GDRDQMRANTAVSVGSTHTERRLHQMMYADRDYDMNDAD  260

Query  1190  --CCPVWSR---------------------DRPKLLFDTVCALTDMQYVVFHASI  1095
                   WS+                     DRPKLLFDTVC LTDMQYVV+HA++
Sbjct  261   SGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFDTVCTLTDMQYVVYHATV  315



>ref|XP_003622131.1| Amino acid binding protein, putative [Medicago truncatula]
 gb|AES78349.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=442

 Score =   139 bits (351),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 105/183 (57%), Gaps = 31/183 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TGTDRPGL+SEI AVLA++ C++  A  WTHN RAA +V+V DDS    I DP
Sbjct  115   EHTVIELTGTDRPGLLSEICAVLADLRCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIEDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV+     + +     LS P    T+ +RRLHQ+M ADRDYE+      
Sbjct  175   SRLSTIRDLLCNVLRGSD-DPKTAKTALSHPGV--TYRDRRLHQIMFADRDYERVERAGL  231

Query  1190  ---------------CCP-------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDST  1077
                            C         + ++DRPKLLFD VC LTDMQYVVFH  + +  + 
Sbjct  232   RERDKGPFPHVTVSDCTERDYTVVIMRAKDRPKLLFDIVCTLTDMQYVVFHGVVQTERTG  291

Query  1076  SVQ  1068
             + Q
Sbjct  292   AYQ  294


 Score =   139 bits (350),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E+ER R+ QCL AA ERRAS G+ L++CT++R+GLLSD+TR+FR
Sbjct  293  YQEFYIRHVDGFPISSEAERERLIQCLEAAIERRASEGMELELCTEDRVGLLSDITRIFR  352

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHKSS  653
            EN L I RAEI T+  +A  TFYV D +G  VDP++++S+R++IG TV +V H SS
Sbjct  353  ENSLCIKRAEISTENGKAKDTFYVTDVTGNPVDPKSIDSIRRQIGDTVLQVKHNSS  408


 Score = 30.0 bits (66),  Expect(3) = 5e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI D+ +I YIQ+
Sbjct  68    MDVFNVTDRNGNKIKDKEVIDYIQR  92



>ref|XP_008445429.1| PREDICTED: uncharacterized protein LOC103488452 [Cucumis melo]
Length=448

 Score =   140 bits (352),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 104/182 (57%), Gaps = 32/182 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             ++TA+E+ G DR GL+SE+SAVL  + C++  A  WTHN RAA +++V DD     ITD 
Sbjct  124   DYTAIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSAITDL  183

Query  1352  YRVAQIQAQLENVVEAHHY--NGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
              R+++I+  L NV+   +   NG +  V     +   TH ERRLHQ+M ADRDYE     
Sbjct  184   ERLSRIKGLLSNVLRGSNSRSNGAKTVV-----SHGVTHIERRLHQMMFADRDYELLDED  238

Query  1193  --------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                     + S+DRPKLLFDTVC LTDMQYVVFHA++ +  + +
Sbjct  239   AMEDQQRPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEA  298

Query  1073  VQ  1068
              Q
Sbjct  299   YQ  300


 Score =   138 bits (347),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA  RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  299  YQEYYIRHIDGSPVKSDAERQRVIQCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG  650
            EN L++TRAE+ T+  +AI TFYV+D SG  VD +T++S+R+ IG T+  V  SS 
Sbjct  359  ENSLTVTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTILKVKGSSS  414


 Score = 30.8 bits (68),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ DE ++ YI++
Sbjct  78    MDVFNVTDQDGNKVTDEGVLDYIKR  102



>gb|KDP26845.1| hypothetical protein JCGZ_18003 [Jatropha curcas]
Length=449

 Score =   140 bits (353),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 103/178 (58%), Gaps = 39/178 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             TE+T +E+TG DRPGL+SE+ AVL ++ C++ AA  WTHN+R A +VY+ D++   PI +
Sbjct  123   TENTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGLPIDN  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-------  1197
             P R+ +I+  L  V+       ++RS   +    S TH ERRLHQ+M ADRDY       
Sbjct  183   PERLTKIKQLLLYVLMGDR---DKRSANTAVSVGS-THKERRLHQMMYADRDYDMEDTEC  238

Query  1196  -------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                          E C           CP    DRPKLLFDTVC LTDMQYVV+HA+I
Sbjct  239   GTSNERRKPLVTVENCTDKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVYHATI  292


 Score =   139 bits (349),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 17/160 (11%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  ++ E+ER+RV  CL AA  RR   G+RL++C+++R+GLLS+VTR+FR
Sbjct  300  YQEYYIRHMDGSPVSSEAERQRVINCLEAAIRRRTPEGIRLELCSEDRVGLLSEVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGLS+TRAE+ T+G +A+  FYV D SG SV  ET+E+VR+EIG T+  V         
Sbjct  360  ENGLSVTRAEVTTRGSQAVNVFYVTDASGYSVKSETIEAVRKEIGLTILCVKDDE-----  414

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
                            E GK  FSLG+L  ++ E+   N 
Sbjct  415  ----------QSSPPQERGK--FSLGNLFRSRSEKFLYNL  442


 Score = 29.3 bits (64),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++ +   IQQ
Sbjct  77    MDVFHVTDQQGNKLSEDDVAERIQQ  101



>ref|XP_010648677.1| PREDICTED: uncharacterized protein LOC100852414 isoform X2 [Vitis 
vinifera]
Length=481

 Score =   147 bits (372),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 6/160 (4%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEY++RH DGCT+N E E+  V +CL AA ERR   G+RL++C  NRLGLLSD+TRV R
Sbjct  323  MQEYFIRHIDGCTVNSEGEKEHVVKCLEAAIERRVCEGVRLELCANNRLGLLSDITRVLR  382

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ TQGE+A+  FYVKD SG  VD E  E  ++E    ++ V K  G    
Sbjct  383  ENGLAVVRADVETQGEKAVNAFYVKDLSGNDVDTEFTEPKKKE--KFIESVKKEMGPIDL  440

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
            A         +   S  D +P FS+  ++ + ++RLSNNF
Sbjct  441  A----VKKEITSSPSSPDHRPRFSVADMVKSHVDRLSNNF  476


 Score =   128 bits (321),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 104/198 (53%), Gaps = 42/198 (21%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +EHTA+EM+G DRPGL SEISA LA++  +I  A AWTHN R AC+ Y+ D S    I D
Sbjct  127   SEHTAIEMSGADRPGLFSEISAALADLQVNIVEAHAWTHNERLACVAYITDQSTDSRIED  186

Query  1355  PYRVAQIQAQLENVVEAHHYN----GERRSVRLSDPAASRTHTERRLHQLMAADRDYE--  1194
             P+R+A+I+  L  V+ A + +     E +   L    A+ T  ERRLHQLM +  D+E  
Sbjct  187   PHRLAKIENHLATVLGAANISRANHQEVKGADLHVGEATTTCAERRLHQLMLSVEDFEGP  246

Query  1193  ----------------------------QCC--------PVWSRDRPKLLFDTVCALTDM  1122
                                         + C         +  +DR +L+FD VC +TDM
Sbjct  247   SAPTTSSSETPLGLDEDDDEGSKTIVSIESCNERGYSIVSIECKDRLRLMFDVVCTITDM  306

Query  1121  QYVVFHASISSHDSTSVQ  1068
             QY++FH S +SH   ++Q
Sbjct  307   QYLIFHGSTASHGGYAMQ  324


 Score = 33.1 bits (74),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  1705  VFHVTDQLGYKIVDESIIHYIQQ  1637
             VFHV D+ G K+ D+ +I+YIQQ
Sbjct  80    VFHVRDEHGNKLTDQRVINYIQQ  102



>ref|XP_008238666.1| PREDICTED: uncharacterized protein LOC103337282 [Prunus mume]
Length=441

 Score =   137 bits (344),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 105/170 (62%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C++  +  WTHN R A ++YV+D     PI D  +
Sbjct  114   TALELTGTDRLGLLSEVFAVLADLQCNVVESKVWTHNGRIASLIYVKDCDSGCPIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+A+L NV++    + + RS + S   A  THTERRLHQ+M ADRDY++        
Sbjct  174   IDRIEARLRNVLKG---DNDIRSAKTSVSMAV-THTERRLHQMMFADRDYDRKPILQHST  229

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM YVVFHA++ +
Sbjct  230   DSPVITVQNWAERGYSIVNIQCKDRAKLLFDVVCTLTDMDYVVFHATVKT  279


 Score =   130 bits (326),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
             E+Y+RH DG  ++ E ER+RV QCL AA +RRAS G+RL++CT++R GLL+ VTR FRE
Sbjct  286  MEFYIRHTDGTPISSEPERQRVIQCLQAAIQRRASEGVRLELCTEDRPGLLAYVTRTFRE  345

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGL++TRAEI T    A+  FYV D  G   DP T+ESVRQ+IG
Sbjct  346  NGLNVTRAEISTTKANALNVFYVTDAIGNPADPNTIESVRQKIG  389


 Score = 41.6 bits (96),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+IHYI+Q
Sbjct  73    MDVFHVTDQNGDKLTDESVIHYIEQ  97



>gb|KHN42726.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=425

 Score =   138 bits (348),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 101/170 (59%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  +  WTHN R A ++YV+D S    I D  +
Sbjct  98    TALELTGTDRVGLLSEVFAVLADLQCDVVESKVWTHNGRIASLIYVKDSSSGSAIEDSQK  157

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+ +L NV++    + + RS ++S   A   HTERRLHQLM  DRDYE+        
Sbjct  158   INKIELRLRNVLKG---DNDIRSAKISFSMAV-MHTERRLHQLMFVDRDYERAPILKLTS  213

Query  1187  -----------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDM+YVVFHA+I++
Sbjct  214   DNASVTVQNWEGRGYSVVNVQCKDRTKLLFDIVCNLTDMEYVVFHATINT  263


 Score =   129 bits (325),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RHKDG  ++ E ER+RV QCL AA ERRAS G+RL++CT++R GLL++V R FR
Sbjct  269  YLEFYIRHKDGTPISSEPERQRVIQCLKAAVERRASEGVRLELCTEDRQGLLAEVVRTFR  328

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T G  A   FYV D  G   D + +ESVRQ+IG
Sbjct  329  ENGLNVTRAEISTIGNMAKNIFYVTDAIGNPADSKIIESVRQKIG  373


 Score = 40.4 bits (93),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI+DES++ YI+Q
Sbjct  57    MDVFHVTDQNGNKIIDESVLKYIEQ  81



>ref|XP_007201031.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
 gb|EMJ02230.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
Length=373

 Score =   142 bits (357),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (59%), Gaps = 32/179 (18%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA +  ++ AA  WTHN R AC+VYV D+S   P+ 
Sbjct  50    VGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTCQPVD  109

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+N++       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  110   DPNRLSTMEEQLKNILRGCE---DDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLA  166

Query  1193  -----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                              +C         V  +DR KL+FD VC LTDMQYVVFHA+ISS
Sbjct  167   NEVDDYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  225


 Score =   134 bits (338),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 96/148 (65%), Gaps = 11/148 (7%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +C+ AA  RR S  LRL++C ++R+GLLS+VTR+ RE
Sbjct  232  QEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEVTRILRE  291

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS+TRA + T GE+A+  FYV+D+SG  VD +T+E++R+EIG T     K     +KA
Sbjct  292  NGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSKA  351

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLL  551
              +              GK  F  G+LL
Sbjct  352  PETKGW-----------GKTSFFFGNLL  368


 Score = 32.0 bits (71),  Expect(3) = 7e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D   I YI++
Sbjct  1     MDVFHVTDQQGKKLADSKTIDYIEK  25



>ref|XP_007215389.1| hypothetical protein PRUPE_ppa005796mg [Prunus persica]
 gb|EMJ16588.1| hypothetical protein PRUPE_ppa005796mg [Prunus persica]
Length=443

 Score =   145 bits (367),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E+ER RV QCL AA ERRAS GL L +CT +R+GLLSD+TR+FR
Sbjct  294  YQEFYIRHVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFR  353

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            EN L I RAEI T+G +AI TFYV D +G +VDP+ ++SVR++IG T+  V ++S    K
Sbjct  354  ENSLCIKRAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIGQTILQVRRNSSPPPK  413

Query  637  A  635
            A
Sbjct  414  A  414


 Score =   141 bits (355),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 104/177 (59%), Gaps = 32/177 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT++E++GTDRPGL+SE+ AVLA++ C++  A  WTHNARAA +V+V DDS    I D 
Sbjct  115   EHTSIELSGTDRPGLLSEMCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDL  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R+  I+  L NV+     N E ++ +++      T+ +RRLHQLM ADRDYE+      
Sbjct  175   NRLTTIKELLCNVLRG---NSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAEL  231

Query  1190  -----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                       + S+DRPKLLFD +C LTDMQYVVFH  +++
Sbjct  232   QRIEDKGSRPHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNT  288



>ref|XP_007201032.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
 gb|EMJ02231.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
Length=448

 Score =   142 bits (357),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (59%), Gaps = 32/179 (18%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA +  ++ AA  WTHN R AC+VYV D+S   P+ 
Sbjct  125   VGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTCQPVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+N++       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  185   DPNRLSTMEEQLKNILRGCE---DDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLA  241

Query  1193  -----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                              +C         V  +DR KL+FD VC LTDMQYVVFHA+ISS
Sbjct  242   NEVDDYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300


 Score =   134 bits (338),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 96/148 (65%), Gaps = 11/148 (7%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +C+ AA  RR S  LRL++C ++R+GLLS+VTR+ RE
Sbjct  307  QEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEVTRILRE  366

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS+TRA + T GE+A+  FYV+D+SG  VD +T+E++R+EIG T     K     +KA
Sbjct  367  NGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSKA  426

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLL  551
              +              GK  F  G+LL
Sbjct  427  PETKGW-----------GKTSFFFGNLL  443


 Score = 31.6 bits (70),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D   I YI++
Sbjct  76    MDVFHVTDQQGKKLADSKTIDYIEK  100



>ref|XP_004514319.1| PREDICTED: uncharacterized protein LOC101500937 [Cicer arietinum]
Length=442

 Score =   141 bits (355),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 31/183 (17%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT +E+TGTDRPGL+SEI AVLA++ C++  A  WTHN RAA +V+V DDS    I DP
Sbjct  115   EHTVIELTGTDRPGLLSEICAVLADLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIEDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV+         ++V LS P    T+ +RRLHQ+M ADRDYE+      
Sbjct  175   SRLSTIRDLLCNVLRGSDDPKTAKTV-LSHPGV--TYRDRRLHQIMFADRDYERVERAGM  231

Query  1190  ---------------CCP-------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDST  1077
                            C         + ++DRPKLLFD VC LTDMQYVVFH  + +  + 
Sbjct  232   NERNKSPFPHVTVLDCVERDYTVVIMRAKDRPKLLFDIVCTLTDMQYVVFHGVVQTERTE  291

Query  1076  SVQ  1068
             + Q
Sbjct  292   AYQ  294


 Score =   137 bits (345),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ E ER R+ QCL AA ERRAS G+ L++CT++R+GLLSD+TR+FR
Sbjct  293  YQEFYIRHIDGFPISSEGERERLIQCLEAAIERRASEGMELELCTEDRVGLLSDITRIFR  352

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV-KVVHKSS  653
            EN L I RAEI T+  +A  TFYV D +G  VDP+ ++S+R++IG TV +V H SS
Sbjct  353  ENSLCIKRAEISTENGKAKDTFYVTDVTGSPVDPKIIDSIRRQIGDTVLQVKHNSS  408


 Score = 29.6 bits (65),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G KI D+ +I YIQ+
Sbjct  68    MDVFNVTDRNGNKIKDKEVIDYIQR  92



>ref|XP_008791268.1| PREDICTED: uncharacterized protein LOC103708225 [Phoenix dactylifera]
Length=458

 Score =   143 bits (360),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 100/171 (58%), Gaps = 32/171 (19%)
 Frame = -1

Query  1523  ALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRV  1344
             ALE+TGTDRPGL+SE+ AVLAE+ C +  A  WTHN R AC+++V D+    PI D +R+
Sbjct  128   ALELTGTDRPGLLSEVFAVLAELQCGVVEAKVWTHNGRIACLLFVRDEGSGEPIVDAHRI  187

Query  1343  AQIQAQLENVVEAHHYNGERRSVRLSDPAASR---THTERRLHQLMAADRDYE-------  1194
              +++++L +V++  H       VR +  A S     HT+RRLHQLM ADRDYE       
Sbjct  188   HRVESRLRHVLKGDH------GVRGAKAAVSSLAVAHTDRRLHQLMFADRDYEHTSPSPA  241

Query  1193  ----------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                 V   DRPKLLFD VC LTDM+YVVFH +I +
Sbjct  242   APPPSVSVQNWVERGYSVVTVQCLDRPKLLFDVVCTLTDMEYVVFHGTIDT  292


 Score =   129 bits (325),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QE+Y RHKDG  ++ E+ER+RV QCL AA ERRAS GLR+++C  ++ GLLSDVTR FRE
Sbjct  299  QEFYTRHKDGSPISSEAERQRVIQCLQAAIERRASEGLRVELCAVDQPGLLSDVTRTFRE  358

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGL +TRAE+ T+G+ A   FYV D +GQ  D + +E+VRQ IG
Sbjct  359  NGLLVTRAEVLTKGQMASNVFYVTDATGQPADHDAIEAVRQRIG  402


 Score = 35.0 bits (79),  Expect(3) = 8e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G K+ D+S++ YI+Q
Sbjct  83    MDVFYVTDQFGRKLTDDSVLSYIEQ  107



>ref|XP_008237781.1| PREDICTED: uncharacterized protein LOC103336512 isoform X2 [Prunus 
mume]
 ref|XP_008237782.1| PREDICTED: uncharacterized protein LOC103336512 isoform X2 [Prunus 
mume]
Length=448

 Score =   142 bits (357),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (59%), Gaps = 32/179 (18%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEISAVLA +  ++ AA  WTHN R AC+VYV D+S   P+ 
Sbjct  125   VGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTCQPVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ QL+N++       +   V  +  +   TH +RRLHQ++ ADRDYE     
Sbjct  185   DPNRLSTMEEQLKNILRGCE---DDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLA  241

Query  1193  -----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                              +C         V  +DR KL+FD VC LTDMQYVVFHA+ISS
Sbjct  242   NEVDHYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300


 Score =   134 bits (338),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 96/148 (65%), Gaps = 11/148 (7%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RH DGCTL+ E E+ RV +C+ AA  RR S  LRL++C ++R+GLLS+VTR+ RE
Sbjct  307  QEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEVTRILRE  366

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS+TRA + T GE+A+  FYV+D+SG  VD +T+E++R+EIG T     K     +KA
Sbjct  367  NGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSKA  426

Query  634  tssgnstsrsrrssGEDGKPGFSLGSLL  551
              +              GK  F  G+LL
Sbjct  427  PETKGW-----------GKTSFFFGNLL  443


 Score = 31.6 bits (70),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D   I YI++
Sbjct  76    MDVFHVTDQQGKKLADSKTIDYIEK  100



>ref|XP_006477309.1| PREDICTED: uncharacterized protein LOC102613666 isoform X2 [Citrus 
sinensis]
Length=369

 Score =   142 bits (359),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 108/170 (64%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  A  WTHN R A ++YV+D +   PI D  +
Sbjct  42    TALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQ  101

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+A+L NV++    + + RS +++   A  THTERRLHQ+M ADRDYE+        
Sbjct  102   IDRIEARLRNVLKG---DNDIRSAKMTVSMAV-THTERRLHQMMFADRDYERMPVLRHST  157

Query  1187  -CPV-----WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
               PV     W+           +DR KLLFD VC LTDM+YVVFHA+I++
Sbjct  158   DYPVVTVQNWADRSYSVVNVQCKDRTKLLFDVVCTLTDMEYVVFHATINT  207


 Score =   129 bits (325),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA  RRAS G+RL++C ++R GLL+DVTR FR
Sbjct  213  YLEFYIRHIDGTPISSEPERQRVIQCLEAAVGRRASEGVRLELCMEDRQGLLADVTRTFR  272

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI TQ + A+  FYV D  G   DP+ +E+VRQ+IG
Sbjct  273  ENGLNVTRAEISTQRDEALNIFYVTDEMGNPADPKIIEAVRQKIG  317


 Score = 35.4 bits (80),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I YI+Q
Sbjct  1     MDVFHVTDLNGNKLTDESVISYIEQ  25



>ref|XP_006477308.1| PREDICTED: uncharacterized protein LOC102613666 isoform X1 [Citrus 
sinensis]
Length=444

 Score =   142 bits (359),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 108/171 (63%), Gaps = 30/171 (18%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  A  WTHN R A ++YV+D +   PI D  +
Sbjct  117   TALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQ  176

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCPV----  1179
             + +I+A+L NV++    + + RS +++   A  THTERRLHQ+M ADRDYE+  PV    
Sbjct  177   IDRIEARLRNVLKG---DNDIRSAKMTVSMAV-THTERRLHQMMFADRDYER-MPVLRHS  231

Query  1178  ----------WS-----------RDRPKLLFDTVCALTDMQYVVFHASISS  1089
                       W+           +DR KLLFD VC LTDM+YVVFHA+I++
Sbjct  232   TDYPVVTVQNWADRSYSVVNVQCKDRTKLLFDVVCTLTDMEYVVFHATINT  282


 Score =   130 bits (326),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RH DG  ++ E ER+RV QCL AA  RRAS G+RL++C ++R GLL+DVTR FR
Sbjct  288  YLEFYIRHIDGTPISSEPERQRVIQCLEAAVGRRASEGVRLELCMEDRQGLLADVTRTFR  347

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI TQ + A+  FYV D  G   DP+ +E+VRQ+IG
Sbjct  348  ENGLNVTRAEISTQRDEALNIFYVTDEMGNPADPKIIEAVRQKIG  392


 Score = 35.4 bits (80),  Expect(3) = 9e-68, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTD  G K+ DES+I YI+Q
Sbjct  76    MDVFHVTDLNGNKLTDESVISYIEQ  100



>gb|KDP41794.1| hypothetical protein JCGZ_26812 [Jatropha curcas]
Length=442

 Score =   140 bits (352),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 103/176 (59%), Gaps = 31/176 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             EHT++E+TG DRPGL+SE+ AVL ++ C++  A  WTHNARAA +V V DDS    I DP
Sbjct  115   EHTSIELTGPDRPGLLSEVCAVLTDLHCNVVNAEIWTHNARAAAVVNVTDDSTRCAIKDP  174

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++    N + ++ +++      T  ERRLHQ+M ADRDYE+      
Sbjct  175   KRLSIIRELLCNVLKG---NNDLKAGKMTLSPPGITSRERRLHQIMFADRDYERVERGGL  231

Query  1190  ----------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                      + S+DRPKLLFD VC LTDM+YVVFH  +S+
Sbjct  232   GRHEDKSSRPHVTVLNIEKDYSVITMRSKDRPKLLFDIVCTLTDMEYVVFHGMVST  287


 Score =   132 bits (332),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QE+Y+RH DG  ++ ++ER RV QCL AA ERR S GL L++C+++R+GLLSD+TR+FR
Sbjct  293  YQEFYIRHVDGLPISSDAERERVIQCLEAAIERRGSEGLELELCSEDRVGLLSDITRIFR  352

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGT-VKVVHKSS  653
            EN L I RAEI T+G +   TFYV D +G  VDP+++ S+ Q+IG T ++V H S+
Sbjct  353  ENSLCIKRAEISTKGGKVKDTFYVTDVTGSPVDPKSINSICQQIGETKLQVKHNST  408


 Score = 35.8 bits (81),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTDQ G KI+DE +I YIQ+
Sbjct  68    MDVFNVTDQDGNKIIDEEVISYIQR  92



>ref|XP_003517440.1| PREDICTED: uncharacterized protein LOC100780903 [Glycine max]
Length=441

 Score =   138 bits (347),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 101/170 (59%), Gaps = 28/170 (16%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDR GL+SE+ AVLA++ C +  +  WTHN R A ++YV+D S    I D  +
Sbjct  114   TALELTGTDRVGLLSEVFAVLADLQCDVVESKVWTHNGRIASLIYVKDSSSGSAIEDSQK  173

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+ +L NV++    + + RS ++S   A   HTERRLHQLM  DRDYE+        
Sbjct  174   INKIELRLRNVLKG---DNDIRSAKISFSMAV-MHTERRLHQLMFVDRDYERAPILKLTS  229

Query  1187  -----------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                V  +DR KLLFD VC LTDM+YVVFHA+I++
Sbjct  230   DNASVTVQNWEGRGYSVVNVQCKDRTKLLFDIVCNLTDMEYVVFHATINT  279


 Score =   129 bits (325),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            + E+Y+RHKDG  ++ E ER+RV QCL AA ERRAS G+RL++CT++R GLL++V R FR
Sbjct  285  YLEFYIRHKDGTPISSEPERQRVIQCLKAAVERRASEGVRLELCTEDRQGLLAEVVRTFR  344

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            ENGL++TRAEI T G  A   FYV D  G   D + +ESVRQ+IG
Sbjct  345  ENGLNVTRAEISTIGNMAKNIFYVTDAIGNPADSKIIESVRQKIG  389


 Score = 40.4 bits (93),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI+DES++ YI+Q
Sbjct  73    MDVFHVTDQNGNKIIDESVLKYIEQ  97



>ref|XP_008796580.1| PREDICTED: uncharacterized protein LOC103711996 [Phoenix dactylifera]
Length=449

 Score =   157 bits (397),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 113/181 (62%), Gaps = 29/181 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             E+T++E+TGTDRPGL+SEI AVLA++ C++  A  WTHN RAA +V+V D+S  G I DP
Sbjct  124   ENTSIELTGTDRPGLLSEIFAVLADLNCNVVKAEVWTHNTRAAAVVHVADESTRGAIEDP  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ------  1191
              R++ I+  L NV++  + +   R+ ++    A+ THTERRLHQ+M  DRDYE+      
Sbjct  184   QRLSTIKKFLFNVLKGDNTS---RTAKMIVSTAALTHTERRLHQMMFDDRDYERLDMTGE  240

Query  1190  -------------CCP-------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSV  1071
                          C         + S+DRPKLLFDTVC LTDMQYVVFH ++ +  S + 
Sbjct  241   GDDKSRPRVAIMDCSEKDYTTVILRSKDRPKLLFDTVCTLTDMQYVVFHGTVHTGSSEAY  300

Query  1070  Q  1068
             Q
Sbjct  301   Q  301


 Score =   129 bits (324),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  ++ E+ER+RV QCL AA ERRAS GL L++ T++R+GLLSD+TR+FR
Sbjct  300  YQEYYIRHVDGLPISSEAERQRVIQCLEAAIERRASEGLELELRTEDRVGLLSDITRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS  656
            ENGL I RA I T G +A+ TFY+ + SG  V+ +T++S+R +IG T+  V ++
Sbjct  360  ENGLCIRRAGISTIGGKAVDTFYLSEMSGNPVEAKTIDSLRNQIGQTILKVKQN  413



>dbj|BAK07373.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   138 bits (347),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 108/167 (65%), Gaps = 16/167 (10%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
             QEYY+RHKDG T++  +ER++V++CL+AA ERRASHG+R+++   +R GLLSD TR  R
Sbjct  330  IQEYYIRHKDGRTVDSYAERQKVSRCLVAAVERRASHGVRVEVRAADRSGLLSDFTRALR  389

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVR---QEIGGTVKVVHKSSG-  650
            E+GLS+ R EI  Q E AIGTF++   +G  V PE L +VR    E+G ++ V  ++ G 
Sbjct  390  EHGLSLLRVEIKRQKEEAIGTFFLVTDTGGEVRPEALRAVRTRVAEMGISLDVAKEAFGW  449

Query  649  ---RFTKAtssgnstsrsrrssGEDGKPGFSLGSLLWAQLERLSNNF  518
               R T+A            S  +  +P +SLGSLLW+ L +LSNNF
Sbjct  450  PPVRKTRA---------LAPSPADQERPRYSLGSLLWSHLGKLSNNF  487


 Score =   134 bits (337),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 103/196 (53%), Gaps = 44/196 (22%)
 Frame = -1

Query  1523  ALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYRV  1344
             +LE T  DRPGL+S I+ VL + GCH+++  AWTH+ RAA ++YV           P R 
Sbjct  136   SLEFTVHDRPGLLSSITQVLVDQGCHVASGQAWTHSGRAAGVLYVTATGADSAALHPSRW  195

Query  1343  AQIQAQLENVVEA-HHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC---CPV-  1179
             A+I+  +  VV+A  + +GERR V +S P   R HTERR+HQLM  D DYE      PV 
Sbjct  196   ARIERLVNAVVDARENMSGERRWVCMSAPVRGRVHTERRMHQLMHDDGDYESSPAPTPVD  255

Query  1178  ----------------------------W-----------SRDRPKLLFDTVCALTDMQY  1116
                                         W           SRDRPKLLFDTVCALTDM Y
Sbjct  256   EEHFCMGDRAATAARSAHRTETRVTIDNWEEKGYAIVKMTSRDRPKLLFDTVCALTDMHY  315

Query  1115  VVFHASISSHDSTSVQ  1068
             VVFHA++ +    ++Q
Sbjct  316   VVFHATVGAQGPLAIQ  331


 Score = 35.0 bits (79),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQVCVAI  1622
             + VFHVTDQ+G K+ D S+  +IQQ  +  
Sbjct  76    MDVFHVTDQIGCKLTDPSLPGFIQQALLPF  105



>gb|EYU28889.1| hypothetical protein MIMGU_mgv1a006953mg [Erythranthe guttata]
Length=424

 Score =   148 bits (373),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 106/180 (59%), Gaps = 28/180 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             + HTA+E+TGTDRPGL+SE+SAVLA + C++  A  WTHN RAA ++ V D++  GPI D
Sbjct  101   SNHTAIELTGTDRPGLLSEVSAVLAHLKCNVVNAEVWTHNTRAAAVMQVTDETTGGPIAD  160

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQ-----  1191
               R+  ++  L NV++  + + E ++V     +   THTERRLHQ+M  DRDYE+     
Sbjct  161   QERLTMVKRLLCNVLKGSNKSREAKTV----VSHGSTHTERRLHQMMFDDRDYERMDGED  216

Query  1190  -------------------CCPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   +  +DRPKLLFD VC LTDMQYVVFH ++ +    + Q
Sbjct  217   DSSERPSVNVVNWNDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVETQGPEAYQ  276


 Score =   138 bits (348),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY +RH DG  +  ++ER+RV QCL AA +RR S GL+L++CT +R+GLLSDVTR+FR
Sbjct  275  YQEYCIRHIDGSPVKSDAERQRVVQCLEAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFR  334

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN LS+TRAE+ T+  +A+ TFYV+D SG  VDP+ ++S+RQ IG T+
Sbjct  335  ENSLSVTRAEVTTRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTI  382



>emb|CDP11981.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   146 bits (369),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 31/176 (18%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             +HTA+E+TG DRPGL+SEI AVLA +  ++ AA  WTHN R AC++YV DDS    + DP
Sbjct  127   DHTAIELTGRDRPGLLSEIFAVLANLHFNVIAAEVWTHNRRIACLLYVNDDSTCRAVDDP  186

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCC----  1185
              R++ ++ QL N++       + R+V  ++ +AS TH +RRLHQ++ ADRDYE  C    
Sbjct  187   SRLSTMEVQLNNILRGCE---DDRNVARTNFSASVTHVDRRLHQMLFADRDYEGGCLSTE  243

Query  1184  ------------------------PVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                      V  +DR KL+FD VC LTDMQYVVFHA+I+S
Sbjct  244   AGYPPSFTPKITIDRCVEKGYSVVTVNCKDRSKLMFDIVCTLTDMQYVVFHATITS  299


 Score =   132 bits (331),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGCTL+ E E++RV +CL AA  RR S  L L++C ++R+GLLS+VTRV RE
Sbjct  306  QEYYIRHMDGCTLDTEGEKQRVIKCLEAAIRRRVSEDLILELCAKDRVGLLSEVTRVLRE  365

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS+TRA + T GE+ I  FYV+D SG  VD +T+E +R+EIG T+ +  K      KA
Sbjct  366  NGLSVTRAGVTTVGEQGIHVFYVRDASGDPVDMKTIEGLRKEIGQTMMLNVKKVQTCVKA  425


 Score = 28.9 bits (63),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI + + I +I++
Sbjct  76    MDVFHVTDQHGNKITESNTIEHIEK  100



>ref|XP_008389382.1| PREDICTED: uncharacterized protein LOC103451737 [Malus domestica]
 ref|XP_008350884.1| PREDICTED: uncharacterized protein LOC103414267 [Malus domestica]
Length=447

 Score =   144 bits (364),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 107/180 (59%), Gaps = 29/180 (16%)
 Frame = -1

Query  1532  EHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDP  1353
             + T +E+TG+DRPGL+SE+SAVL  + C++ +A  WTHN RAA ++ V D+     ITD 
Sbjct  124   DSTVIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMRVTDEETGLAITDS  183

Query  1352  YRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-----  1188
              R+A+I+  L NV++  +     R+V     + + THT+RRLHQ+M ADRDYE+      
Sbjct  184   QRLARIKELLCNVLKGSNKARGARTV----VSHAVTHTDRRLHQMMFADRDYERVDDDVL  239

Query  1187  --------------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                                   + S+DRPKLLFDTVC LTDMQYVVFHASI +    + Q
Sbjct  240   DDKQRPDVSVVNLLDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299


 Score =   141 bits (356),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +  ++ER+RV QCL AA ERR S  L+L++CT +R+GLLSDVTR+FR
Sbjct  298  YQEYYIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEDLKLELCTTDRVGLLSDVTRIFR  357

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTV  674
            EN L++TRAE+ T+  +A+ TFYV+D SG  VD +T+ES+RQ IG T+
Sbjct  358  ENSLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQAIGQTI  405



>ref|XP_010679322.1| PREDICTED: uncharacterized protein LOC104894719 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679331.1| PREDICTED: uncharacterized protein LOC104894719 [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   143 bits (360),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 31/178 (17%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + +HTA+E+ G DRPGL+SEI AVLA++  +I+AA  WTHN R AC++YV DD+ +  + 
Sbjct  122   VGDHTAVELIGRDRPGLLSEIFAVLADLHFNIAAAEVWTHNTRIACVLYVNDDTTYRAVD  181

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE-----  1194
             DP R++ ++ Q++N++     + +      S      TH +RRLHQ+M ADRDYE     
Sbjct  182   DPSRLSLMEEQIKNILGGTQDDEQATHTSFS---MGFTHVDRRLHQMMFADRDYEGAVTA  238

Query  1193  -----------------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                        +  +DRPKL+FD VC LTDMQYVVFHA+ISS
Sbjct  239   TEVEYPLPLKPKIFVEHCKEKGYSVVTLKCKDRPKLMFDIVCTLTDMQYVVFHATISS  296


 Score =   132 bits (333),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGCT+++E E+ RV +CL AA +RR S GL L++C ++R+GLLS+VTR+ RE
Sbjct  303  QEYYIRHVDGCTVDMEGEKDRVIKCLEAAIQRRISDGLSLELCAKDRVGLLSEVTRILRE  362

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKV  668
            +GLS+ RA + T GE+A   FYV+D+SG  VD +T+E++R+EIG T+ +
Sbjct  363  HGLSVMRAGVSTVGEKAKNVFYVRDSSGNPVDVKTIEALRKEIGLTMML  411


 Score = 31.6 bits (70),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D   I YI++
Sbjct  73    MDVFHVTDQNGKKITDSRTIEYIEK  97



>ref|XP_009391844.1| PREDICTED: uncharacterized protein LOC103977913 [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   139 bits (350),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 104/175 (59%), Gaps = 25/175 (14%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             TALE+TGTDRPGL+SE+ AVLA++ C +  A  WTH+ R ACI++++D     P+ D  R
Sbjct  117   TALELTGTDRPGLLSEVFAVLADLQCDVVEATVWTHDGRVACILFLKDQLSGSPLDDEQR  176

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQC-------  1188
             + +I+++L +V++  H     RS + +  + +  H + RLHQLM ADRDY++C       
Sbjct  177   IHRIESRLRHVLKGDH---GVRSGKTAVTSMAVAHPDSRLHQLMLADRDYDRCPSAPASS  233

Query  1187  ---------------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISSHDSTSVQ  1068
                              V  RDRPKLLFD V  LTDMQYVVFH +I +   ++ Q
Sbjct  234   TFVSVQNWDERGYSVVNVQCRDRPKLLFDIVWTLTDMQYVVFHGTIDTDGDSAHQ  288


 Score =   130 bits (326),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QE+Y+RHK+G  ++ E+ER +V QCL AA ERRAS G RL++C ++R GLLSDVTR FRE
Sbjct  288  QEFYIRHKNGSPIDSEAERHQVIQCLQAAIERRASEGTRLELCIEDRPGLLSDVTRTFRE  347

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG-GTVKVVHKSSGRFTK  638
            NGL +TRAE  T+G+ A   FYV D +G++ DP+ +E+VR  IG   +KV  +   RF +
Sbjct  348  NGLLVTRAEASTKGDMASDVFYVTDAAGKAADPKAIEAVRLRIGFDRLKVKEEQRPRFCR  407


 Score = 37.7 bits (86),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ D+S+I Y++Q
Sbjct  74    MDVFHVTDQFGNKLTDDSVISYLEQ  98



>gb|KCW80355.1| hypothetical protein EUGRSUZ_C01720, partial [Eucalyptus grandis]
Length=478

 Score =   138 bits (347),  Expect(4) = 2e-67, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 14/154 (9%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEY++RH DGC L+ E E+ RV +CL AA ERR   G +L++C  NR+GLLSD+TRV R
Sbjct  339  YQEYFIRHVDGCALSTEGEKDRVMKCLEAAIERRVCEGFKLELCANNRIGLLSDITRVLR  398

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTK  638
            ENGL++ RA++ TQGE+A+  FY+KDTSG  VD E +E +++E+G     V   + R   
Sbjct  399  ENGLAVVRADVETQGEKAVNAFYLKDTSGNEVDMEFVERIKREMGPINLAVQTETKRHGL  458

Query  637  AtssgnstsrsrrssGEDGKPGFSLGSLLWAQLE  536
            A               +   P  SLG  L +Q+E
Sbjct  459  A--------------EKPNTPFSSLGGFLKSQIE  478


 Score =   133 bits (335),  Expect(4) = 2e-67, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 102/193 (53%), Gaps = 47/193 (24%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              EHTA+EMTGTDRPGL SEISA LA++ C+I  A AW+HN R AC+ Y+ D   + PI D
Sbjct  138   NEHTAIEMTGTDRPGLFSEISATLADLHCNIVEAHAWSHNTRLACVAYISDQRTNTPIED  197

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRS-------VRLSDPAASR---THTERRLHQLMAAD  1206
               R+A I   L  V+ A   +G  R+       V+ SD        T+ ERRLHQLM + 
Sbjct  198   RSRLATIADHLTMVLRAKSTSGSPRATVPNQQEVKASDLQGGEGMTTNVERRLHQLMLSV  257

Query  1205  RDY-----EQCCPV---------------------WS-----------RDRPKLLFDTVC  1137
             RD+     E   P+                     W+           +DR +L+FDTVC
Sbjct  258   RDFDEPASESSSPIVMPMGLGPDRNGQNLRISIEEWNEKGYSVVNIKCKDRRRLMFDTVC  317

Query  1136  ALTDMQYVVFHAS  1098
              LTDMQYV+FHAS
Sbjct  318   TLTDMQYVIFHAS  330


 Score = 33.1 bits (74),  Expect(4) = 2e-67, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHV D+ G KI D+ +I YIQQ
Sbjct  78    MDVFHVKDEHGNKIGDQRVIDYIQQ  102


 Score = 23.5 bits (49),  Expect(4) = 2e-67, Method: Compositional matrix adjust.
 Identities = 7/8 (88%), Positives = 7/8 (88%), Gaps = 0/8 (0%)
 Frame = -1

Query  1796  SDGGWLMD  1773
             SDGGW MD
Sbjct  72    SDGGWFMD  79



>ref|XP_011101934.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101940.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101941.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101947.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
Length=443

 Score =   139 bits (351),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 106/178 (60%), Gaps = 33/178 (19%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             + ++TA+E+ G DRPGL+SEISAVLA +  ++ AA  WTHN R AC++YV DD+ +  + 
Sbjct  123   MGDYTAIELIGRDRPGLLSEISAVLANLHINVVAAEVWTHNRRIACVLYVNDDTTNRAVD  182

Query  1358  DPYRVAQIQAQLENVVE--AHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYE---  1194
             D  R+A ++ QL+N++    +  N    SV L       TH +RRLHQL+ +DRDYE   
Sbjct  183   DESRLAAMEEQLKNLLRGCGNDDNAGHTSVSLGS-----THVDRRLHQLLFSDRDYEGTF  237

Query  1193  ----------------QC-------CPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                             +C         V  +DRPKL+FD VC LTD+QYVVFHA+ISS
Sbjct  238   AATEPDSPLVPKVTIDRCEEKDYSVVTVRCKDRPKLMFDIVCTLTDLQYVVFHATISS  295


 Score =   137 bits (345),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEYY+RH DGCTL  E E+ +V +CL AA  RR S GL L++C ++R+GLLS+VTRV RE
Sbjct  302  QEYYIRHMDGCTLETEGEKEKVIKCLEAAIRRRISEGLSLELCAKDRVGLLSEVTRVLRE  361

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSGRFTKA  635
            NGLS+TRA + T GE+A+  FYV D SG+ VD +T+E +R+EIG T+++  K +   TKA
Sbjct  362  NGLSVTRAGVTTVGEQAMNIFYVSDASGKPVDGKTIEELRKEIGHTMRLNVKKAPTNTKA  421


 Score = 30.0 bits (66),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G KI D   I +I++
Sbjct  74    MDVFHVTDQQGQKISDSRTIEHIEK  98



>ref|XP_010940980.1| PREDICTED: uncharacterized protein LOC105059401 [Elaeis guineensis]
Length=460

 Score =   137 bits (344),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 99/172 (58%), Gaps = 32/172 (19%)
 Frame = -1

Query  1526  TALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITDPYR  1347
             T LE+TG DRPGL+SE+ AVLA++ C +  A  WTHN R AC+++V D++   PI +  R
Sbjct  127   TVLELTGADRPGLLSEVFAVLADLQCGVVEAKVWTHNGRIACLLFVRDETSGEPIENALR  186

Query  1346  VAQIQAQLENVVEAHHYNGERRSVRLSDPAASR---THTERRLHQLMAADRDYE------  1194
             +  ++++L +V++  H       VR +  A S     HT+RRLHQ+M ADRDYE      
Sbjct  187   IHGVESRLGHVLKGDH------GVRGAKTAVSSLAVAHTDRRLHQMMFADRDYEHPPPSP  240

Query  1193  -----------------QCCPVWSRDRPKLLFDTVCALTDMQYVVFHASISS  1089
                                  V  +DRPKLLFD VC LTDM+YVVFH +I +
Sbjct  241   AAAPPSVSVQNWIERGYSIVTVQCQDRPKLLFDIVCTLTDMEYVVFHGTIDT  292


 Score =   131 bits (329),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QE+Y+RHKDG  ++ E+ER+RV QCL AA ERRAS GLR+++C  +R GLLSD+TR FRE
Sbjct  299  QEFYIRHKDGSPISSEAERQRVIQCLQAAIERRASEGLRVELCAVDRPGLLSDITRTFRE  358

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIG  683
            NGL +TRAE+ T+G+ A   FYV D +G+  D + +E+VRQ IG
Sbjct  359  NGLFVTRAEVSTKGQMASNFFYVIDAAGKPADHDAIEAVRQRIG  402


 Score = 39.3 bits (90),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ DES+I YI+Q
Sbjct  83    MDVFHVTDQFGGKLTDESVISYIEQ  107



>ref|XP_008804075.1| PREDICTED: uncharacterized protein LOC103717456 [Phoenix dactylifera]
Length=448

 Score =   149 bits (376),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 30/182 (16%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
              E+T++E+TGTDRPGL+SE+ AVL ++ C++  A AWTHN RAA +V+V D+S    I D
Sbjct  123   NEYTSIELTGTDRPGLLSEVCAVLTDLKCNVVKAEAWTHNTRAAAVVHVTDESTRSAIED  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCPVW  1176
             P R++ ++  L NV+     +  R  +R+S      THTERRLHQ+M  DRDYE    V 
Sbjct  183   PKRLSTVKELLFNVL-TWDKDSRRAKMRVS---MGGTHTERRLHQMMFDDRDYESVGLVE  238

Query  1175  --------------------------SRDRPKLLFDTVCALTDMQYVVFHASISSHDSTS  1074
                                       S+DRPKLLFDT+C LTDMQYVVFH ++ + +S +
Sbjct  239   EGDKKSRPQVAVMDCTEKDYSIIILRSKDRPKLLFDTLCTLTDMQYVVFHGTVKTGNSEA  298

Query  1073  VQ  1068
              Q
Sbjct  299   YQ  300


 Score =   128 bits (322),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  +N E+ER R+ QCL AA ERRAS GL L++ T++R GLLSD+TR+FR
Sbjct  299  YQEYYIRHIDGHPVNSEAERHRLIQCLEAAIERRASEGLELELVTEDRSGLLSDITRIFR  358

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS  656
            ENGL I RAEI T+G +A+ TF V + SG  VD + ++S+R++ G  +  V +S
Sbjct  359  ENGLCIRRAEISTKGGKAVDTFSVSEMSGSPVDAKIIDSIRRQTGQMILRVKQS  412


 Score = 29.6 bits (65),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VF+VTD+ G K+ D+ I++YIQ+
Sbjct  77    MDVFNVTDRNGNKLRDKEILNYIQK  101



>gb|AAM65519.1| unknown [Arabidopsis thaliana]
Length=453

 Score =   141 bits (355),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 106/184 (58%), Gaps = 29/184 (16%)
 Frame = -1

Query  1538  LTEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPIT  1359
             L +HT++E+   DRPGL+SE+SAVLA++  ++ AA AWTHN R AC++YV D++    + 
Sbjct  125   LGDHTSIEIIARDRPGLLSEVSAVLADLNINVVAAEAWTHNRRIACVLYVNDNATSRAVD  184

Query  1358  DPYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDYEQCCP-  1182
             DP R++ ++ QL NV+       E+ + R S    S TH +RRLHQ+  ADRDYE     
Sbjct  185   DPERLSSMEEQLNNVLRGCEEQDEKFA-RTSLSIGS-THVDRRLHQMFFADRDYEAVTKL  242

Query  1181  --------------------------VWSRDRPKLLFDTVCALTDMQYVVFHASISSHDS  1080
                                       V   DRPKL+FD VC LTDMQY+VFHA+ISS  S
Sbjct  243   DDSASCGFEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSSGS  302

Query  1079  TSVQ  1068
              + Q
Sbjct  303   HASQ  306


 Score =   132 bits (331),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  994  QEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFRE  815
            QEY++RHKDGCTL+ E E+ R  +CL AA  RR S G  L++C ++R+GLLS+VTR+ RE
Sbjct  306  QEYFIRHKDGCTLDTEGEKERXVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVTRILRE  365

Query  814  NGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKS  656
            +GLS++RA + T GE+A+  FYVKD SG  VD +T+E++R EIG ++ +  K+
Sbjct  366  HGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKN  418


 Score = 33.9 bits (76),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQV  1634
             + VFHVTDQ G K+ D   I YI++V
Sbjct  76    MDVFHVTDQQGNKVTDSKTIDYIEKV  101



>ref|XP_002514875.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF47429.1| amino acid binding protein, putative [Ricinus communis]
Length=450

 Score =   142 bits (357),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 104/178 (58%), Gaps = 39/178 (22%)
 Frame = -1

Query  1535  TEHTALEMTGTDRPGLMSEISAVLAEMGCHISAAVAWTHNARAACIVYVEDDSKHGPITD  1356
             +E+T +E+TG DRPGL+SE+ AVLA++ C++ AA  WTHN+R A +VY+ D+    PI +
Sbjct  123   SENTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVTGSPINE  182

Query  1355  PYRVAQIQAQLENVVEAHHYNGERRSVRLSDPAASRTHTERRLHQLMAADRDY-------  1197
             P R+ +I+  L  V++      ++RS   +    S TH ERRLHQ+M ADRDY       
Sbjct  183   PDRLTKIKQLLLYVLKGDR---DKRSANTAVSVGS-THKERRLHQMMYADRDYDIDDGEG  238

Query  1196  -------------EQC-----------CPVWSRDRPKLLFDTVCALTDMQYVVFHASI  1095
                          E C           CP    DRPKLLFDTVC LTDMQYVV+HA+I
Sbjct  239   GSTSERRKPLVTVENCADKGYTVVNLRCP----DRPKLLFDTVCTLTDMQYVVYHATI  292


 Score =   135 bits (341),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -2

Query  997  FQEYYVRHKDGCTLNLESERRRVTQCLIAATERRASHGLRLDICTQNRLGLLSDVTRVFR  818
            +QEYY+RH DG  ++ E+ER+RV  CL AA  RR   G+RL++C+++R+GLLS+VTR+FR
Sbjct  300  YQEYYIRHMDGSPISSEAERQRVINCLEAAIRRRNPEGIRLELCSEDRIGLLSEVTRIFR  359

Query  817  ENGLSITRAEIGTQGERAIGTFYVKDTSGQSVDPETLESVRQEIGGTVKVVHKSSG  650
            ENGLS+TRAE+ T+  +A+  FYV D SG  V  ET+E+VR+EIG T+  V   S 
Sbjct  360  ENGLSVTRAEVTTRDSQAVNAFYVTDASGYPVKSETIEAVRKEIGLTILRVKDDSN  415


 Score = 29.3 bits (64),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1711  LPVFHVTDQLGYKIVDESIIHYIQQ  1637
             + VFHVTDQ G K+ ++ +   IQQ
Sbjct  77    MDVFHVTDQHGNKLSEDDVAERIQQ  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5227254061896