BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24578_g2_i1 len=633 path=[2169:0-232 2401:233-274 2100:275-632]

Length=633
                                                                      Score     E

dbj|BAG80542.1|  glycosyltransferase                                    308   3e-99   Lycium barbarum [goji berry]
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   3e-97   
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   4e-97   
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          301   2e-96   
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       300   2e-96   
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   4e-96   
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    299   9e-96   
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    298   3e-95   
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       294   1e-93   
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             292   5e-93   
ref|XP_008219404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       288   1e-92   
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       291   1e-92   
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       290   2e-92   
emb|CDP01076.1|  unnamed protein product                                290   2e-92   
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       290   2e-92   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             290   3e-92   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       290   4e-92   
gb|KCW66550.1|  hypothetical protein EUGRSUZ_F00348                     285   4e-92   
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       288   1e-91   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         288   1e-91   Populus trichocarpa [western balsam poplar]
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             288   2e-91   
ref|XP_010064219.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    287   2e-91   
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     286   3e-91   
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    287   4e-91   Vitis vinifera
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    287   4e-91   Vitis vinifera
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       286   6e-91   
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    286   7e-91   
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             286   8e-91   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       286   1e-90   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       286   1e-90   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    285   2e-90   
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                285   3e-90   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             285   3e-90   
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                285   4e-90   
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    284   5e-90   
ref|XP_008391482.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       278   8e-90   
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            284   9e-90   
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             284   9e-90   
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          283   1e-89   
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    283   1e-89   Vitis vinifera
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    283   1e-89   Vitis vinifera
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    283   1e-89   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       283   2e-89   
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             283   2e-89   
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    283   2e-89   
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    283   2e-89   
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             283   2e-89   Prunus dulcis [sweet almond]
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    282   2e-89   
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    282   3e-89   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       282   4e-89   
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    282   4e-89   
dbj|BAG80547.1|  glycosyltransferase                                    282   4e-89   Lycium barbarum [goji berry]
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    282   5e-89   
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       281   5e-89   
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         281   6e-89   
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         281   7e-89   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             281   9e-89   
gb|AIL51400.1|  glycosyltransferase                                     281   1e-88   
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    281   1e-88   
gb|KCW45338.1|  hypothetical protein EUGRSUZ_L009912                    275   1e-88   
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    280   2e-88   
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       281   2e-88   
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    280   2e-88   
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             280   2e-88   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       280   2e-88   
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       280   2e-88   
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    279   5e-88   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       279   6e-88   
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  279   8e-88   
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    278   9e-88   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         278   1e-87   
ref|XP_008219460.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       269   1e-87   
dbj|BAD93690.1|  glycosyltransferase                                    278   2e-87   Nicotiana tabacum [American tobacco]
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       278   2e-87   
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    278   2e-87   
gb|ABW96222.1|  glucosyltransferase                                     278   2e-87   Linum usitatissimum
ref|XP_004300654.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       278   2e-87   
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               278   2e-87   
ref|XP_004299645.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       277   2e-87   
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    277   2e-87   
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       277   3e-87   
gb|AAB99950.1|  UDP-glucuronosyltransferase                             273   3e-87   Pisum sativum [garden pea]
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    277   4e-87   
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       277   4e-87   
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    276   6e-87   
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       279   6e-87   
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       276   8e-87   
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    276   9e-87   
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      277   9e-87   
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    276   9e-87   
ref|XP_008342285.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       270   2e-86   
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       275   2e-86   
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    275   2e-86   
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             275   4e-86   
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    274   5e-86   
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       274   5e-86   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    273   6e-86   
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    273   8e-86   
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    273   8e-86   
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              273   9e-86   Ricinus communis
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            272   1e-85   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       273   1e-85   
gb|AFJ52994.1|  UDP-glycosyltransferase 1                               272   1e-85   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  273   1e-85   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             273   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_004172439.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       267   2e-85   
gb|AFK34769.1|  unknown                                                 273   2e-85   
ref|XP_006433963.1|  hypothetical protein CICLE_v10001630mg             268   2e-85   
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             272   2e-85   
gb|KCW44219.1|  hypothetical protein EUGRSUZ_L023571                    263   2e-85   
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       272   3e-85   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    272   3e-85   
ref|XP_004305884.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       271   4e-85   
gb|AFK33787.1|  unknown                                                 271   7e-85   
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     270   7e-85   
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   8e-85   
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              268   9e-85   Ricinus communis
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     269   9e-85   
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          271   1e-84   
gb|ACJ84649.1|  unknown                                                 270   1e-84   Medicago truncatula
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   1e-84   
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   1e-84   
gb|ADG65641.1|  glycosyltransferase                                     270   1e-84   
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    271   1e-84   
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          270   1e-84   
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   1e-84   
ref|XP_008373152.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       270   1e-84   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       270   2e-84   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            270   2e-84   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            270   2e-84   
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   2e-84   
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     269   2e-84   
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       270   2e-84   
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     270   2e-84   
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   2e-84   
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     269   2e-84   
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   2e-84   
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    270   2e-84   
ref|XP_004173933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       259   3e-84   
ref|XP_004303931.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       270   3e-84   
ref|XP_002307921.2|  hypothetical protein POPTR_0006s02440g             268   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       269   3e-84   
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    270   3e-84   
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       269   3e-84   
ref|XP_002323757.2|  hypothetical protein POPTR_0017s07890g             265   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             270   3e-84   
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    269   3e-84   
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   4e-84   
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       269   4e-84   
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   4e-84   
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   5e-84   
gb|KCW45703.1|  hypothetical protein EUGRSUZ_L005082                    263   5e-84   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       268   5e-84   
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    269   6e-84   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    269   6e-84   
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       269   6e-84   
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     268   6e-84   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    268   7e-84   Vitis vinifera
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          268   7e-84   
ref|XP_004305887.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       268   8e-84   
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   9e-84   
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    268   9e-84   
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             270   9e-84   
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       268   1e-83   
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       268   1e-83   
ref|XP_008229793.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       268   1e-83   
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       268   1e-83   
emb|CDO97426.1|  unnamed protein product                                268   1e-83   
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             268   1e-83   
emb|CDY46643.1|  BnaA07g10530D                                          268   2e-83   
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       268   2e-83   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       268   2e-83   
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   2e-83   
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    268   2e-83   
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   2e-83   
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   2e-83   
dbj|BAB86928.1|  glucosyltransferase-10                                 267   3e-83   Vigna angularis [azuki bean]
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     267   3e-83   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    267   3e-83   
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   4e-83   
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             266   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       266   4e-83   
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       266   4e-83   
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       267   5e-83   
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       266   5e-83   
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      266   5e-83   
gb|AFK37311.1|  unknown                                                 266   5e-83   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               266   6e-83   
emb|CDY21357.1|  BnaA09g30700D                                          260   6e-83   
gb|KCW66548.1|  hypothetical protein EUGRSUZ_F003462                    260   7e-83   
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       266   7e-83   
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    266   7e-83   
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    266   8e-83   
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   8e-83   
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       266   8e-83   
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    266   9e-83   
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    266   9e-83   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    265   9e-83   
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      265   1e-82   
ref|XP_004303932.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       265   1e-82   
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             265   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   2e-82   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   2e-82   
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   2e-82   
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    264   2e-82   Vitis vinifera
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    264   3e-82   
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   3e-82   
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              264   3e-82   Ricinus communis
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       264   3e-82   
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     263   3e-82   
ref|XP_004305879.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       265   3e-82   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             264   3e-82   
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    265   4e-82   
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    264   4e-82   
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    264   4e-82   
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       264   4e-82   
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       263   6e-82   
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             263   7e-82   Populus trichocarpa [western balsam poplar]
ref|XP_004154178.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       256   7e-82   
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                263   7e-82   
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             263   7e-82   
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       272   7e-82   
ref|XP_008375649.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       263   8e-82   
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     263   8e-82   
ref|XP_002893220.1|  UDP-glucuronosyltransferase                        261   9e-82   
emb|CDY62992.1|  BnaC07g48400D                                          263   9e-82   
ref|XP_010094135.1|  UDP-glycosyltransferase 85A2                       259   1e-81   
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   1e-81   
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   1e-81   
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    261   2e-81   
emb|CDP01079.1|  unnamed protein product                                262   2e-81   
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             262   2e-81   Populus trichocarpa [western balsam poplar]
emb|CDO97427.1|  unnamed protein product                                258   2e-81   
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       262   2e-81   
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             262   2e-81   
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    262   2e-81   
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    262   2e-81   
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   2e-81   
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    262   2e-81   
ref|XP_004155440.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    262   2e-81   
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       262   3e-81   
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    262   3e-81   
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   3e-81   
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             261   3e-81   
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            261   4e-81   Stevia rebaudiana
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   4e-81   
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        261   4e-81   Lycium barbarum [goji berry]
ref|XP_004303933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       261   5e-81   
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   5e-81   
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    261   5e-81   Vitis vinifera
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    261   5e-81   
ref|XP_006416207.1|  hypothetical protein EUTSA_v100074990mg            256   5e-81   
emb|CDY41486.1|  BnaA08g20880D                                          261   5e-81   
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    261   6e-81   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          261   6e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             261   6e-81   Populus trichocarpa [western balsam poplar]
ref|XP_009377935.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   6e-81   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       261   6e-81   
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   6e-81   
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    261   6e-81   Vitis vinifera
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    261   6e-81   
emb|CDX91674.1|  BnaC08g05930D                                          261   7e-81   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       261   7e-81   
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    261   8e-81   
gb|ADV71371.1|  glycosyltransferase GT14M03                             261   8e-81   
ref|XP_011010110.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   8e-81   
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         261   8e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  260   1e-80   
gb|EYU39132.1|  hypothetical protein MIMGU_mgv1a025300mg                255   1e-80   
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   1e-80   
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   1e-80   
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             260   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       260   2e-80   
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             259   2e-80   
ref|XP_002530117.1|  UDP-glucuronosyltransferase, putative              258   2e-80   Ricinus communis
ref|XP_003618644.1|  Cytokinin-O-glucosyltransferase                    259   2e-80   
gb|AHL38933.1|  glycosyltransferase                                     259   2e-80   
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    259   2e-80   
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  259   2e-80   
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       259   2e-80   
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         259   2e-80   
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         259   2e-80   
emb|CAN60444.1|  hypothetical protein VITISV_032467                     259   2e-80   
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       259   3e-80   
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       260   3e-80   
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             259   3e-80   
ref|XP_004155441.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    259   3e-80   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       259   4e-80   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    267   4e-80   
ref|XP_004295677.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       256   4e-80   
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    258   5e-80   
gb|KCW45699.1|  hypothetical protein EUGRSUZ_L00503                     257   5e-80   
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       259   5e-80   
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       258   6e-80   
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   7e-80   
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            257   8e-80   
ref|XP_004303934.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       258   8e-80   
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    258   8e-80   
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              258   9e-80   
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             258   9e-80   
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       258   1e-79   
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       258   1e-79   
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    258   1e-79   
emb|CDP01073.1|  unnamed protein product                                257   1e-79   
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          258   1e-79   
ref|XP_008342462.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       257   1e-79   
emb|CDY38225.1|  BnaC05g17420D                                          257   1e-79   
ref|XP_008375675.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       257   2e-79   
ref|XP_008229791.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       251   2e-79   
gb|KFK44619.1|  hypothetical protein AALP_AA1G282400                    253   2e-79   
gb|KDO60734.1|  hypothetical protein CISIN_1g022329mg                   251   2e-79   
ref|XP_004303929.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       258   2e-79   
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          256   2e-79   
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              256   2e-79   
ref|XP_008357979.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       256   3e-79   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       257   3e-79   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    256   3e-79   
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   3e-79   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   3e-79   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       256   3e-79   
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               257   3e-79   
ref|XP_002891115.1|  predicted protein                                  256   3e-79   
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            256   3e-79   
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             256   3e-79   
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    256   4e-79   
emb|CDP01082.1|  unnamed protein product                                260   4e-79   
ref|XP_008380092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       254   5e-79   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            256   5e-79   
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         256   5e-79   
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    256   5e-79   
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    256   6e-79   
ref|XP_002307922.1|  hypothetical protein POPTR_0006s02450g             255   6e-79   
ref|XP_008229471.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       253   7e-79   
emb|CDP01087.1|  unnamed protein product                                255   8e-79   
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       255   8e-79   
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    255   9e-79   
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    255   1e-78   
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   1e-78   
ref|XP_006388605.1|  hypothetical protein POPTR_0140s002101g            247   1e-78   
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              254   1e-78   
emb|CDP01078.1|  unnamed protein product                                255   2e-78   
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             254   2e-78   
ref|XP_009341630.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    250   2e-78   
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       255   2e-78   
emb|CDP01486.1|  unnamed protein product                                250   2e-78   
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       254   2e-78   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   3e-78   
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    254   3e-78   
ref|XP_011004477.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   3e-78   
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            254   3e-78   
ref|XP_008789394.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       254   3e-78   
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       254   3e-78   
gb|AIS39470.1|  flavonoid UDP-glucosyltransferase 1                     248   3e-78   
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             254   4e-78   
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         254   4e-78   
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       253   4e-78   
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   4e-78   
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            253   4e-78   
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   5e-78   
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   5e-78   
dbj|BAF75889.1|  glucosyltransferase                                    254   5e-78   
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    253   7e-78   
ref|XP_009350114.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   8e-78   
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    253   8e-78   
ref|XP_009351417.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   9e-78   
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              253   9e-78   
gb|KDO58793.1|  hypothetical protein CISIN_1g022321mg                   247   9e-78   
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    254   1e-77   
ref|NP_001149205.1|  cytokinin-O-glucosyltransferase 2                  251   1e-77   
ref|XP_006852717.1|  hypothetical protein AMTR_s00033p00056330          252   1e-77   
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             252   1e-77   
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       252   2e-77   
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   2e-77   
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          252   2e-77   
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       252   2e-77   
emb|CDY21360.1|  BnaA09g30670D                                          252   2e-77   
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       252   2e-77   
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       252   2e-77   
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       252   2e-77   
ref|XP_006466242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       247   2e-77   
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             251   2e-77   
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             251   3e-77   
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             251   3e-77   
dbj|BAF49299.1|  putative glycosyltransferase                           251   3e-77   
gb|EAY87581.1|  hypothetical protein OsI_08991                          251   4e-77   
gb|KGN43734.1|  hypothetical protein Csa_7G063980                       251   4e-77   
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       251   4e-77   
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       251   5e-77   
ref|XP_008347719.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       251   5e-77   
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    251   5e-77   
ref|NP_001048165.1|  Os02g0755900                                       251   6e-77   
gb|AAV32498.1|  UDP-glucuronosyltransferase                             249   6e-77   
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       251   6e-77   
gb|KDP40911.1|  hypothetical protein JCGZ_24910                         250   6e-77   
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       250   7e-77   
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             250   7e-77   
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       250   8e-77   
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    250   8e-77   
gb|EMT11733.1|  Cytokinin-O-glucosyltransferase 2                       251   9e-77   
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             249   1e-76   
ref|XP_002530114.1|  UDP-glucuronosyltransferase, putative              249   1e-76   
gb|AAF87258.1|AC068562_5  Strong similarity to UDP-glucose glucos...    249   1e-76   
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   1e-76   
ref|XP_010030928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   2e-76   
ref|XP_008229744.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       249   2e-76   
ref|XP_006853212.1|  hypothetical protein AMTR_s00038p00215430          239   2e-76   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    249   2e-76   
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       249   2e-76   
gb|KDP43116.1|  hypothetical protein JCGZ_26649                         239   3e-76   
emb|CAN65645.1|  hypothetical protein VITISV_012510                     251   3e-76   
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       249   4e-76   
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   5e-76   
ref|XP_007148403.1|  hypothetical protein PHAVU_006G205600g             248   5e-76   
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   5e-76   
gb|KHN42558.1|  UDP-glycosyltransferase 85A2                            247   6e-76   
ref|XP_009377938.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-76   
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    248   6e-76   
ref|XP_004953966.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   7e-76   
emb|CDJ26664.1|  unnamed protein product                                248   8e-76   
ref|XP_003618651.1|  UDP-glucuronosyltransferase 2A3                    247   1e-75   
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       247   1e-75   
emb|CDO97432.1|  unnamed protein product                                247   1e-75   
ref|XP_004137056.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       253   1e-75   
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       247   2e-75   
gb|AFW64425.1|  cytokinin-O-glucosyltransferase 2                       247   2e-75   
gb|EMT19728.1|  Cytokinin-O-glucosyltransferase 2                       243   2e-75   
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       246   2e-75   
gb|AFW64426.1|  hypothetical protein ZEAMMB73_179381                    247   2e-75   
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      247   2e-75   
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    246   2e-75   
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             253   3e-75   
ref|XP_004303930.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       246   3e-75   
ref|XP_008347720.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       246   3e-75   
gb|AAF87254.1|AC068562_1  Strong similarity to UDP-glucose glucos...    236   4e-75   
ref|XP_002452530.1|  hypothetical protein SORBIDRAFT_04g027470          246   4e-75   
gb|AFK38894.1|  unknown                                                 246   4e-75   
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-75   
ref|XP_006853232.1|  hypothetical protein AMTR_s00038p00222700          241   4e-75   
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-75   
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-75   
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    246   4e-75   
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       246   4e-75   
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-75   
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       246   5e-75   
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   5e-75   
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    247   5e-75   
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    245   5e-75   
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             245   6e-75   
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          245   6e-75   
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       245   7e-75   
ref|XP_006373648.1|  hypothetical protein POPTR_0016s021501g            240   7e-75   
ref|XP_004231354.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-75   
ref|XP_011008544.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-75   
emb|CDP01480.1|  unnamed protein product                                245   8e-75   
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         245   9e-75   
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   9e-75   
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             245   9e-75   
ref|XP_010064959.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   9e-75   
ref|NP_564170.1|  UDP-glucosyl transferase 85A5                         239   1e-74   
gb|KCW62091.1|  hypothetical protein EUGRSUZ_H04762                     243   1e-74   
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         245   1e-74   
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             244   1e-74   
ref|XP_004305882.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       243   1e-74   
ref|XP_002446588.1|  hypothetical protein SORBIDRAFT_06g018490          245   1e-74   
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             244   1e-74   
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             244   1e-74   
ref|XP_010937419.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   2e-74   
ref|XP_004489448.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    244   2e-74   
ref|XP_003618661.1|  Cytokinin-O-glucosyltransferase                    244   2e-74   
gb|KCW45700.1|  hypothetical protein EUGRSUZ_L005042                    235   2e-74   
ref|XP_002322562.2|  hypothetical protein POPTR_0016s02270g             244   2e-74   
ref|XP_003545681.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       244   2e-74   
ref|XP_007151395.1|  hypothetical protein PHAVU_004G042900g             244   2e-74   
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            243   3e-74   
ref|XP_006603934.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       243   3e-74   
ref|XP_010063159.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    244   3e-74   
ref|XP_008224047.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    243   3e-74   
ref|XP_011008539.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    241   3e-74   
ref|XP_008362352.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       243   4e-74   
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   4e-74   
ref|XP_004489450.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   4e-74   
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   4e-74   
gb|KEH17949.1|  UDP-glucosyltransferase family protein                  241   4e-74   
dbj|BAF02177.1|  putative UDP-glucose glucosyltransferase               234   4e-74   
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   4e-74   
ref|XP_006366314.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       243   4e-74   
ref|XP_006853259.1|  hypothetical protein AMTR_s00038p00231120          243   5e-74   
ref|XP_011014887.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   5e-74   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             243   5e-74   
gb|AFJ53003.1|  UDP-glycosyltransferase 1                               243   6e-74   
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          243   6e-74   
gb|ABK95289.1|  unknown                                                 243   7e-74   
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       242   8e-74   
gb|EMS50281.1|  UDP-glycosyltransferase 85A2                            241   8e-74   
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             242   9e-74   
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       242   1e-73   
ref|XP_003618668.1|  Cytokinin-O-glucosyltransferase                    241   1e-73   
ref|XP_009377949.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   1e-73   
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     242   1e-73   
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  242   1e-73   



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QL+EFAWGLANS++ FLWIIRPD VSG+EA++PPEF+EETK+RGMLASWC
Sbjct  301  FGSITVMTPNQLIEFAWGLANSQQDFLWIIRPDIVSGDEAILPPEFVEETKKRGMLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T WG+GMEI+
Sbjct  361  SQEEVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWGVGMEID  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVESLV+ELM GEKGK+MK+K +EWK LAQ+SA  ++GSSYVN+E++ N +LLS
Sbjct  421  NNVKRDEVESLVRELMVGEKGKQMKKKTIEWKNLAQESAKQSTGSSYVNIEKVVNDILLS  480

Query  92   PK  87
             K
Sbjct  481  SK  482



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWC
Sbjct  302  FGSITVMTANQLIEFAWGLANSEMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+
Sbjct  362  PQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVESLV+ELM GEKGK+MK+KAMEWKKLA+++A   +GSSYVN++++ N++LL
Sbjct  422  NNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKLAEEAAAKPAGSSYVNIDKLINEILL  480



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT + L+EFAWGLANS+  FLWIIRPD V GEEA++PPEFLEETKERGMLASWC
Sbjct  305  FGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEEAILPPEFLEETKERGMLASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QEKVL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQ TNCW+C T  GIGMEIN
Sbjct  365  QQEKVLNHPAIGGFLTHSGWNSTLESISNGVPMICWPFFAEQPTNCWFCCTKLGIGMEIN  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE+LV+ELM GEKGKEMK KA EWKKLA+++A   +GSSYVN++++ N++LL+
Sbjct  425  NNVKRDEVEALVRELMTGEKGKEMKNKATEWKKLAEEAAAKPAGSSYVNIDKLINEILLA  484

Query  92   PK  87
            PK
Sbjct  485  PK  486



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTPDQL+EFAWGLANSKK FLWI+RPD V+GE A++PPEFLEETK+RGML+SWC
Sbjct  303  YGSITVMTPDQLLEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSSWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNC Y  + WGIG EI+
Sbjct  363  SQEQVLNHPAIGGFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EVE LV+ELM+GEKG EMK+KAMEWKKLA+++AT++ GSS++N++++ N  LL 
Sbjct  423  SNVKRDEVEKLVRELMEGEKGGEMKKKAMEWKKLAEEAATSSIGSSHINIDKLINLHLLP  482

Query  92   PK  87
            PK
Sbjct  483  PK  484



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWC
Sbjct  302  FGSITVMTANQLVEFAWGLANSQIQFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+
Sbjct  362  PQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVESLV+EL+ GEKGK+MK+KAMEWKKL +++A   +GSSYVN++++ N++LL
Sbjct  422  NNVKRDEVESLVRELIVGEKGKDMKKKAMEWKKLTEEAAAKPTGSSYVNIDKLINEILL  480



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGL NS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWC
Sbjct  302  FGSITVMTANQLTEFAWGLVNSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+
Sbjct  362  PQEQILSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTKWGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR EVESLV+ELM GEKGK+MK+KAMEWKK A+++A   +GSSYVN++++ N++LLS
Sbjct  422  NNVKRAEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKTTGSSYVNIDKLINEILLS  481

Query  92   PK  87
             K
Sbjct  482  SK  483



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWC
Sbjct  302  FGSITVMTANQLIEFAWGLANSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+
Sbjct  362  PQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVESLV+ELM GEKGK+MK+KAMEWKK A+++A   +GSSYVN++++ N++L 
Sbjct  422  NNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKPTGSSYVNIDKLINEILF  480



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP QLVEFAWGLANSK+TFLWIIRPD VSG+ A++PPEFLEETK+RG+LASWC
Sbjct  302  FGSITVMTPGQLVEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCW+C T W  G+EI+
Sbjct  362  PQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVESLV ELM GEKG +MK+KA+EWK  A+++A ++ GSSY NLE++  +VLLS
Sbjct  422  NNVKRDEVESLVTELMVGEKGMDMKKKALEWKNKAEEAAKSSGGSSYSNLEKVV-QVLLS  480



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EF WGLANS K FLW+IRPD V GE AVVPPEFLEETKERG+ ASWC
Sbjct  302  FGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVCGESAVVPPEFLEETKERGLFASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNS+LES+C GVPMICWPFFAEQQTNC +C   WG+G+EI 
Sbjct  362  PQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCREWGVGIEIE  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV+ LM+GEKGKEM++KAMEWKKLA+++AT  +G S++ L+ + N+VLLS
Sbjct  422  GDVKRNYIEDLVRTLMEGEKGKEMRKKAMEWKKLAEEAATGPNGLSFLALDNMINRVLLS  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EF+WGLANS +TF W+IRPD V GE AVVPPEF++ETKERG+LASWC
Sbjct  301  FGSITVMTAEQLIEFSWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQ  NC +C   WGIGMEI 
Sbjct  361  PQEQVLSHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN VE LV++LM+GE+GKEM+RKA+EWKKLA+++ T  +G S+V LE++ N+VLLS
Sbjct  421  GDVKRNYVEELVRKLMEGEEGKEMRRKALEWKKLAKEATTGPNGLSFVGLEKLVNQVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>ref|XP_008219404.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Prunus 
mume]
Length=385

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WC
Sbjct  203  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWC  262

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQ NC +C   WGIGMEI 
Sbjct  263  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQINCRFCCKEWGIGMEIE  322

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV++LM+GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N+VLLS
Sbjct  323  GDVKRNYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVGLDKLVNQVLLS  382

Query  92   PK  87
            P+
Sbjct  383  PR  384



>ref|XP_004299648.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANSKKTFLW+IRPD V G  AVVP EF+EET+ER MLA+WC
Sbjct  306  FGSITVMTETQLIEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRERSMLATWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNSTLESIC GVPMICWPFFAEQQTNC +C   WGIGMEI 
Sbjct  366  PQEEVLRHPAVGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEWGIGMEIE  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             + KR+ VE LV++LM+GE+GKEMK+KA+EWK+LA ++AT   GSS+VNL+++ N+VLL+
Sbjct  426  GDPKRDYVEGLVRKLMEGEEGKEMKKKALEWKRLAMEAATGPKGSSFVNLDKMVNQVLLA  485

Query  92   PK  87
            P+
Sbjct  486  PR  487



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF++ETKERG+LASWC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQ  NC +C   WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN VE LV++LM+GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N+VLLS
Sbjct  421  GDVKRNYVEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVCLDKLVNQVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGL NSK+TFLWIIRPD VSG+ A++PPEFLEE K+RG+LASWC
Sbjct  302  FGSITVMTADQLVEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRGLLASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCW+C T WG G+EI+
Sbjct  362  PQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWGNGLEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR  VESLV ELM   KGK+MK+KA+EWK  A+++A ++ GSSY NLE++  +VLLS
Sbjct  422  NNVKREGVESLVTELMVRGKGKDMKKKALEWKNKAEEAAKSSGGSSYANLEKVV-QVLLS  480



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS KTFLW+IRPD V GE AVVPPEF+EETKER +L +WC
Sbjct  300  FGSITVMTSEQLIEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+CAGVPM+CWPFFAEQQTNC YC   WGIGMEI 
Sbjct  360  PQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIE  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +V R+ +E LV +LM+GE+GKEM++KAMEWKKLA+++AT  +G S+++L+++ N+VLLS
Sbjct  420  GDVHRSNIEELVTKLMEGEEGKEMRKKAMEWKKLAKEAATGPNGLSFLDLDKMVNEVLLS  479

Query  92   PK  87
             K
Sbjct  480  KK  481



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+VKRN VE LV++LM+GE+GK+M++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLS
Sbjct  421  NDVKRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAME-ATSPNGSSFVALDKMINQVLLS  479

Query  92   PK  87
            P+
Sbjct  480  PR  481



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGLANS+  FLWIIRPD VSGE+A +P EF+EETKERGML SWC
Sbjct  305  FGSITVMTANQLTEFAWGLANSQMDFLWIIRPDTVSGEKATLPSEFMEETKERGMLTSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFF EQQTNCW+  T W IGMEI+
Sbjct  365  AQEQVLSHPAIGGFLTHSGWNSTLESISNGVPMICWPFFTEQQTNCWFKCTQWRIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVE LV++LM GEKGK+MK+KAMEWKKLA+++A  ++GSSYVN++++ N++LL
Sbjct  425  NNVKRDEVERLVRDLMVGEKGKDMKKKAMEWKKLAEEAAAKSTGSSYVNIDKLINEILL  483



>gb|KCW66550.1| hypothetical protein EUGRSUZ_F00348 [Eucalyptus grandis]
Length=356

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWC
Sbjct  174  FGSITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWC  233

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+
Sbjct  234  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEID  293

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKRNEVE  VKELM+GEKGK MKRKAM+WK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  294  SNVKRNEVERQVKELMEGEKGKHMKRKAMKWKEMARE-ATRPSGSSFLNLDEVINKVLLS  352

Query  92   PK  87
            PK
Sbjct  353  PK  354



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIK  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLS
Sbjct  421  SDVKRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLS  479

Query  92   PK  87
            P+
Sbjct  480  PR  481



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL EFAWGLANS +TFLW+IRPD V+G+ A++PPEF+  TKERG+ ASWC
Sbjct  302  FGSITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTH+GWNST+ESIC GVPMICWPFFAEQQTNC YC T WGIGMEIN
Sbjct  362  SQEQVLSHPSIGGFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEIN  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR EVESLV+ELM GEKG EMK+K  EWKK+A+++ T ++GSS +NL+ + NKVLLS
Sbjct  422  SDVKRGEVESLVRELMGGEKGSEMKKKTREWKKMAEEAIT-STGSSCMNLDDMINKVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EF WGLANS K FLW+IRPD V GE AVVPPEFLEET+ERG+ +SWC
Sbjct  302  FGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVLGESAVVPPEFLEETEERGLFSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNS+LES+C GVPMICWPFFAEQQTNC +C   WG+G+EI 
Sbjct  362  PQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCKEWGVGIEIE  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV+ LM+GEKGKEM++KA EWKKLA+++AT  +G S++ L+ + N+VLLS
Sbjct  422  GDVKRNYIEDLVRTLMEGEKGKEMRKKATEWKKLAEEAATGPNGLSFLALDNMINRVLLS  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_010064219.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=449

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWC
Sbjct  267  FGSITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWC  326

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+
Sbjct  327  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEID  386

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKRNEVE  VKELM+GEKGK MKRKAM+WK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  387  SNVKRNEVERQVKELMEGEKGKHMKRKAMKWKEMARE-ATRPSGSSFLNLDEVINKVLLS  445

Query  92   PK  87
            PK
Sbjct  446  PK  447



>gb|KCW45340.1| hypothetical protein EUGRSUZ_L00994 [Eucalyptus grandis]
Length=461

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWC
Sbjct  279  FGSITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWC  338

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+
Sbjct  339  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEID  398

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRNEVE  VKELM+GEKGK MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  399  SDVKRNEVERQVKELMEGEKGKHMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLS  457

Query  92   PK  87
            PK
Sbjct  458  PK  459



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   287 bits (734),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM P+ L+EFAWGL+NSK+ FLWIIRPD VSG  A++PPEFL ETK+RG+LASWC
Sbjct  296  FGSITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWC  355

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VLGHPAVGGFLTH+GWNS LES+C GV MICWPFFAEQQTNC YC T WGIGMEI+
Sbjct  356  SQEQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEID  415

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR++VE LV+ELM+GEKG+EMK+K MEWKK+A ++ TA SGSS+ NL+++  ++LL
Sbjct  416  GDVKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLLL  474



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM P+ L+EFAWGL+NSK+ FLWIIRPD VSG  A++PPEFL ETK+RG+LASWC
Sbjct  314  FGSITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWC  373

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VLGHPAVGGFLTH+GWNS LES+C GV MICWPFFAEQQTNC YC T WGIGMEI+
Sbjct  374  SQEQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEID  433

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR++VE LV+ELM+GEKG+EMK+K MEWKK+A ++ TA SGSS+ NL+++  ++LL
Sbjct  434  GDVKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLLL  492



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   286 bits (733),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF++ET ERG+LASWC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQ NC +C   WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV++LM+GE+GKEM++KA+EWKKLA+++ +  +GSS+V L+++ N++LLS
Sbjct  421  GDVKRNYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATSGPNGSSFVGLDKLVNQMLLS  480



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWC
Sbjct  304  FGSITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+
Sbjct  364  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRNEVE  VKELM+GEKGK MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  424  SDVKRNEVERQVKELMEGEKGKHMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLS  482

Query  92   PK  87
            PK
Sbjct  483  PK  484



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W++RPD V GE AVVPPEF+EETKERG+LASWC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVVRPDLVGGEAAVVPPEFMEETKERGLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIGMEI 
Sbjct  361  PQEQVLSHAAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCREWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN VE LV++LM GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N++LLS
Sbjct  421  GDVKRNYVEGLVRKLMAGEEGKEMRKKALEWKKLAKEATTGPNGFSFVGLDKLVNQMLLS  480

Query  92   PK  87
             +
Sbjct  481  TR  482



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLA+S +TF W+IRPD V G+ AVVPPEF+EETKER +LA WC
Sbjct  301  FGSITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIK  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN +E LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLS
Sbjct  421  SDVKRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLS  479

Query  92   PK  87
            P+
Sbjct  480  PR  481



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLA+S +TF W+IRPD V G+ AVVPPEF+EETKER +LA WC
Sbjct  301  FGSITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIK  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN +E LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLS
Sbjct  421  SDVKRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLS  479

Query  92   PK  87
            P+
Sbjct  480  PR  481



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL EFAWGLANS +TFLW+IRPD V+G+ A++PPEF+  TKERG+ +SWC
Sbjct  302  FGSITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTHSGWNST+ESIC GVPMICWPFFAEQQTNC YC T WGIGMEIN
Sbjct  362  SQEQVLSHPSIGGFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEIN  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR EVESLV+ELM G+KG+EMK+K  E KK+A+++ T ++GSS +NL+ + NKVLLS
Sbjct  422  SDVKRGEVESLVRELMGGDKGREMKKKTRELKKMAEEAIT-STGSSCMNLDDMINKVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTPDQL EFAWGLANSK+ FLWIIRP+ VSGE+AV+P  FL+ TKERGMLA+WC
Sbjct  305  FGSITVMTPDQLNEFAWGLANSKQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+
Sbjct  365  PQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKRN VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+ + ++VLL
Sbjct  425  SDVKRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKNLIDQVLL  480



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WC
Sbjct  295  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWC  354

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGI MEI 
Sbjct  355  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIDMEIE  414

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLS
Sbjct  415  SDVKRNHVEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNEVLLS  473

Query  92   P  90
            P
Sbjct  474  P  474



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 3/180 (2%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTPDQL EFAWGLANS + FLWIIRP+ VSGE+AV+P  FL+ TKERGMLA+WC
Sbjct  308  FGSITVMTPDQLNEFAWGLANSMQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+
Sbjct  368  PQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEID  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+++ ++VLLS
Sbjct  428  SDVKRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKKLIDQVLLS  484



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL+EFAWGLANS   FLWIIRPD VSG++AV+PPEFLE TKERG+LA+WC
Sbjct  303  FGSITVMTSDQLLEFAWGLANSNLPFLWIIRPDLVSGDKAVLPPEFLEATKERGLLANWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T W IGMEI+
Sbjct  363  PQERVLRHPSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWNIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EVE LV++LM GE+G+EMKR+AMEWKKLA  SA ++S     NLE++ ++VLL+
Sbjct  423  SNVKRDEVEILVRKLMIGEEGQEMKRRAMEWKKLAVASAQSSSSE---NLEKVISRVLLA  479

Query  92   P  90
            P
Sbjct  480  P  480



>ref|XP_008391482.1| PREDICTED: UDP-glycosyltransferase 85A1-like, partial [Malus 
domestica]
Length=317

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM  +QL+EFAWGLAN +KTFLW+IRPD V G+  VVPPEF+EETK+R +LASWC
Sbjct  135  FGSITVMKSEQLIEFAWGLANCRKTFLWVIRPDLVGGDSDVVPPEFVEETKDRSLLASWC  194

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFL HSGWNSTLES+C GVP+ICWPFFAEQQTNC +    WGIG+EI 
Sbjct  195  PQEQVLSHPAIGGFLMHSGWNSTLESVCCGVPVICWPFFAEQQTNCRFSCKDWGIGLEIE  254

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR  VE LV++LMDGE+GK+M++KA+EWKKLA+ + +   GSS+VN +++ N+VLLS
Sbjct  255  GDVKRKYVEELVRKLMDGEEGKQMRKKALEWKKLAKQAISGPDGSSFVNFDKMVNQVLLS  314

Query  92   PK  87
            P+
Sbjct  315  PR  316



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL EFAWGLANS +TFLWIIRPD V+G+ AV+PPEF++ TKERGML +WC
Sbjct  306  FGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDMTKERGMLTNWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH+GWNST ESI AGVPMICWPFFAEQQTNC YC T WGIGMEI+
Sbjct  366  PQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR E+E  V+ELM+G+KGKEM+++A EWKKL  D+A   SGSS+ NL  + +KVLL
Sbjct  426  SDVKREEIEKQVRELMEGDKGKEMRKRAQEWKKLMADAAEPHSGSSFRNLNHLVHKVLL  484



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWC
Sbjct  302  FGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+
Sbjct  362  PQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
              VKR+ ++ LV+ LMDGE+GK+M++KA+EWKKLA+D ATA  GSSY+ LE + +KVLLS
Sbjct  422  GEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATAPKGSSYLALENVVSKVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTP QL+EFAWGLANS ++FLWI+RPD VSGE A++PPEF+ ET++RG+LA WC
Sbjct  295  YGSITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWC  354

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTH+GWNST+E +CAGVPMICWPFFAEQQTNC YC T WG+GMEI+
Sbjct  355  PQEQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEID  414

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR+EV  LV+ELM GEKGK MK+K MEWK  A+ + T   GSSY+NLE+IF +VLL
Sbjct  415  SDVKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVLL  473



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTP QL+EFAWGLANS ++FLWI+RPD VSGE A++PPEF+ ET++RG+LA WC
Sbjct  295  YGSITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWC  354

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTH+GWNST+E +CAGVPMICWPFFAEQQTNC YC T WG+GMEI+
Sbjct  355  PQEQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEID  414

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR+EV  LV+ELM GEKGK MK+K MEWK  A+ + T   GSSY+NLE+IF +VLL
Sbjct  415  SDVKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVLL  473



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEFAWGLANS K FLWIIRPD V G+  ++PPEF+ ET +RG++A WC
Sbjct  296  FGSITVMTPEQLVEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWC  355

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HP+VGGFLTHSGWNST+ESICAGVPMICWPFFAEQQTNC Y  T WG+GMEI+
Sbjct  356  PQEKVLNHPSVGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEID  415

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNV+R+EVE LVKELM+GEKGK MK+ AMEW+  A++ ATA  GSSY+NL+++ + +L  
Sbjct  416  NNVERDEVEKLVKELMEGEKGKSMKKAAMEWRTKAEE-ATAPCGSSYLNLDKLVDILLTK  474

Query  92   P  90
            P
Sbjct  475  P  475



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +L SWC
Sbjct  305  FGSITVMSPVQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH+GWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+
Sbjct  365  PQERVLSHSAVGGFLTHNGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKRNEVE  VKELM+GEKGK+MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  425  NNVKRNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLS  483

Query  92   PK  87
             +
Sbjct  484  TR  485



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL EFAWGLANS +TFLWIIRPD V+G+ AV+PPEF++ TKERGML +WC
Sbjct  305  FGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERGMLTNWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH+GWNST ESI AGVPMICWPFFAEQQTNC YC T WGIGME++
Sbjct  365  PQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEVD  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR E+E  VKELM+GEKGKEM+ +A EWKKL  D+AT  SGSS  NL  + +KVLL
Sbjct  425  SDVKREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAATPHSGSSSRNLNDLVHKVLL  483



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    W IGMEI 
Sbjct  361  PQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE LV++LM+G++GKEM++KA+EWKKLA + A + +GSS+V L+++ N+VLLS
Sbjct  421  SDVKRNYVEGLVRKLMEGDEGKEMRKKALEWKKLATE-AISPNGSSFVGLDKMVNQVLLS  479

Query  92   P  90
            P
Sbjct  480  P  480



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEFAWGLANS  TFLW+IRPD V G+ A++PP+F+ +T+ERG+LASWC
Sbjct  304  FGSITVMTPEQLVEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++G FLTH+GWNST+ESIC GVPMICWPFFAEQQTNC Y  T WG+GMEI+
Sbjct  364  PQEQVLNHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EVESLVK++M+GEKGKEMK++ +EWKK A++ AT   GSSY NL+++  +VLLS
Sbjct  424  SNVKRDEVESLVKQIMEGEKGKEMKKRTLEWKKKAEE-ATYQDGSSYSNLDKMIKEVLLS  482



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AVVPPEF+EETK+R +LASWC
Sbjct  301  FGSITVMTNEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPEFVEETKDRSLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +    WGIG+EI 
Sbjct  361  PQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCKEWGIGLEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR  VE LV++LMDGE+GKEM++K++EWKK A+++++  +G S+V+L+++ N+VLL+
Sbjct  421  GDVKRKYVEGLVRKLMDGEEGKEMRKKSLEWKKSAKEASSGPNGLSFVDLDKMVNQVLLT  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWC
Sbjct  302  FGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+
Sbjct  362  PQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
              VKR+ ++ LV+ LMDGE+GK+M++KA+EWKKLA+D AT+  GSSY+ LE + +KVLLS
Sbjct  422  GEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATSPKGSSYLALENVVSKVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGLANS + FLWI RPD V+G+ +V+PPEFLEETK+R ++ASWC
Sbjct  302  FGSITVMTNDQLVEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEETKDRRLIASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QEKVL H A+G FLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+C   WGIG+EIN
Sbjct  362  NQEKVLAHQAIGVFLTHSGWNSTLESISNGVPMICWPFFAEQQTNCWFCCKKWGIGIEIN  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKRNEVE+ V+ELM GEKGKEMKRKA+EWKKLA ++A + +GSSY NL+ +  KVL S
Sbjct  422  VNVKRNEVETQVRELMQGEKGKEMKRKAIEWKKLAHEAAASPNGSSYSNLDNVI-KVLKS  480

Query  92   PK  87
             K
Sbjct  481  KK  482



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EFAWGLANS+  FLWIIRPD V GE+A++PPEF+EETK+R MLASWC
Sbjct  303  FGSIAVVTSNQLIEFAWGLANSRMEFLWIIRPDIVLGEQAILPPEFVEETKDRAMLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH  WNS LESI  GVPMICWPFFAEQ TNCW+C T  GIGMEI+
Sbjct  363  PQEQVLSHPAIGGFLTHGEWNSILESISCGVPMICWPFFAEQPTNCWFCCTKLGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR+EV SLV+ELM G+KGKEMK+KA+EWKKLA+++A   +GSSYVN+++I N++ L
Sbjct  423  SNVKRDEVASLVRELMAGDKGKEMKKKALEWKKLAEEAAKKPTGSSYVNIDKIINEISL  481



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+E+TKER +LA+WC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ES+C+GVPMICWPFFAEQQTNC Y    WGIGMEI 
Sbjct  361  PQEQVLKHPAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS++ L+++ N+VLLS
Sbjct  421  SDVKRNYVEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFLCLDKMVNQVLLS  479

Query  92   P  90
            P
Sbjct  480  P  480



>ref|XP_010676201.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT DQL+EFAWGLANS + FLWI RPD V+G+ +V+PPEFLE+TK+RG++ASWC
Sbjct  302  FGSTTVMTNDQLIEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEKTKDRGLIASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QEKVL H AVGGFLTHSGWNSTLESI  GVPMICWPFFAEQ TNCW+C   WGIGMEIN
Sbjct  362  NQEKVLAHQAVGGFLTHSGWNSTLESISNGVPMICWPFFAEQHTNCWFCCNKWGIGMEIN  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKRNEVE  V+E+M+GEKGKEMKRKAMEWK LA ++AT+  GSSY N+  +  KVL S
Sbjct  422  VNVKRNEVERQVREMMEGEKGKEMKRKAMEWKTLAHEAATSPCGSSYSNMNSLI-KVLQS  480

Query  92   PK  87
             K
Sbjct  481  KK  482



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT MTP+QL+EFAWGLANS+  FLWIIRPD VSG +AV+PPEFLEETKERGMLASWC
Sbjct  304  FGSITPMTPNQLIEFAWGLANSQVDFLWIIRPDIVSGNKAVLPPEFLEETKERGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             Q++VL H AVGGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+C T W IGMEI+
Sbjct  364  QQQQVLSHVAVGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFCCTQWEIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EV+SLV+EL+  EKG EMK+KA+EWKKLA+++A    GSSYVN++++ N++LLS
Sbjct  424  NNVKRDEVKSLVRELLTWEKGNEMKKKALEWKKLAKEAAKKPGGSSYVNIDKLINEILLS  483

Query  92   PK  87
             K
Sbjct  484  SK  485



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP QL+EFAWGLANS  TFLW+IR D V G+ A+VPPEF+ ETKERG++A WC
Sbjct  303  FGSITVMTPQQLIEFAWGLANSMCTFLWVIRSDLVVGDSAIVPPEFVAETKERGLVAGWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNSTL+S+C GVP+ICWPFF+EQQTNCW+C    GIGMEI+
Sbjct  363  PQERVLQHPSIGGFLTHSGWNSTLDSLCCGVPVICWPFFSEQQTNCWFCCNKLGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRNE+ESLV+ELM+G++G+ MK KA EWK+ A+++A + +GSS +NLE++ NKVLL+
Sbjct  423  SDVKRNEIESLVRELMEGDQGQVMKYKAKEWKRKAEEAAASPTGSSCLNLEKMINKVLLA  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>ref|XP_008219457.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWC
Sbjct  302  FGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+
Sbjct  362  PQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
              VKR+ ++ LV+ LMDGE+GK+M++KA+EWKKLA++ ATA  GSSY+ LE + +KVLLS
Sbjct  422  GEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEE-ATAPKGSSYLALENVVSKVLLS  480

Query  92   PK  87
            P+
Sbjct  481  PR  482



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANS KTFLW+IRPD V+G+ AV+PPEF+  TKERG LASWC
Sbjct  303  FGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H ++GGFLTHSGWNSTLE ICAGVPMICWPFFAEQQTNC Y    WGIGMEIN
Sbjct  363  PQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEIN  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE LV+ELM G KG+EMK+KAMEWKK+A+++ T  +GSS+ NL++  N  LLS
Sbjct  423  SDVKRDEVEILVRELMVGVKGQEMKKKAMEWKKMAEEAITCPNGSSFQNLDKFINHHLLS  482



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANS KTFLW+IRPD V+G+ AV+PPEF+  TKERG LASWC
Sbjct  303  FGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H ++GGFLTHSGWNSTLE ICAGVPMICWPFFAEQQTNC Y    WGIGMEIN
Sbjct  363  PQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEIN  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VK +EVE LV+ELM+G KGKEMK+KAMEWKK+A+++ T   GSS+ NL++  N +LLS
Sbjct  423  SDVKGDEVEILVRELMEGVKGKEMKKKAMEWKKMAEEAITCPKGSSFQNLDKFINLLLLS  482



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   281 bits (719),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGL NS K+FLW+IRPD V+GE A++PPEF+++TK RG+L+SWC
Sbjct  299  FGSITVMTSEQLVEFAWGLGNSNKSFLWVIRPDLVAGENAILPPEFVKQTKNRGLLSSWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIGMEI 
Sbjct  359  SQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR+++ESLVKELMDGEKGK+MK KA++WKKLA+ +A+   G+S++NL+ + ++VLL
Sbjct  418  EDVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKTAASGPYGTSFLNLDNMVHEVLL  476



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEFAWGLANS ++FLWIIRPD V GE AV+PPEF+  TKERGMLASW 
Sbjct  302  FGSITVMTPNQLVEFAWGLANSNQSFLWIIRPDLVVGESAVLPPEFVAVTKERGMLASWA  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H +VGGFLTH GWNSTLESI +GV ++CWPFFAEQQTNCWYC    GIGMEI+
Sbjct  362  PQEEVLAHSSVGGFLTHCGWNSTLESISSGVAVVCWPFFAEQQTNCWYCCGELGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR EVE LV+ELM GEKGKEMK +AM WK+LA+++  ++SGSS++NL+++ ++VLLS
Sbjct  422  SDVKREEVERLVRELMVGEKGKEMKERAMGWKRLAEEATQSSSGSSFLNLDKLVHQVLLS  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF+ +TKER +LASWC
Sbjct  304  FGSITVMTREQLVEFAWGLANSNQTFLWVIRPDLVVGDSALLPPEFIRDTKERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ++VL HP+VGGFLTH+GWNST+ESIC+GVPMICWPFFA+QQT C Y  T WG+GMEI+
Sbjct  364  PQKQVLNHPSVGGFLTHNGWNSTVESICSGVPMICWPFFADQQTICRYACTEWGVGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EVESL++ELM+GEKGKEMK KAMEWK+ A+++A      S+ NL+++ N+VLLS
Sbjct  424  SNVKRDEVESLIRELMEGEKGKEMKYKAMEWKRRAEEAAYQGGXPSHTNLDKMINEVLLS  483



>gb|KCW45338.1| hypothetical protein EUGRSUZ_L009912, partial [Eucalyptus grandis]
Length=311

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWC
Sbjct  129  FGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWC  188

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+
Sbjct  189  PQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEID  248

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR++VE  V+ELM+GE+GKEMKRKAMEW+++A++ A   SGSSY+NL+++ +KVLL 
Sbjct  249  GDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMARE-AMRPSGSSYLNLDEVMDKVLLL  307

Query  92   PK  87
            P+
Sbjct  308  PR  309



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +L SWC
Sbjct  306  FGSITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    W IGMEI+
Sbjct  366  PQERVLGHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWRIGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRNEVE  VKELM+GEKGK+MKRKAMEWK++A++ AT   G S++NL+++ NKVLLS
Sbjct  426  SDVKRNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPFGPSFLNLDEVINKVLLS  484

Query  92   PK  87
            P+
Sbjct  485  PR  486



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTN  Y    WGIGMEI 
Sbjct  361  PQEQVLSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLS
Sbjct  421  RDVKRNYIEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNQVLLS  479

Query  92   P  90
            P
Sbjct  480  P  480



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLA+S +TFLW+IRPD V G+ A++PPEF   T+ER +LASWC
Sbjct  304  FGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVPM+CWPFF EQQTNC Y    WGIGMEI+
Sbjct  364  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EV   V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +KVLLS
Sbjct  424  SNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDKVLLS  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T  QLVEFAWGL NS KTFLW+IRPD V+GE  V+PPEF+E+TK RG+L+SWC
Sbjct  299  FGSITVVTSAQLVEFAWGLGNSNKTFLWVIRPDLVAGENVVLPPEFVEQTKNRGLLSSWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIGMEI 
Sbjct  359  SQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR+++ESLVKELMDGEKGK+MK KA++WKKLA+ +A+   G+S++NL+ + ++VLL
Sbjct  418  EDVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKSAASGPYGTSFLNLDNMVHEVLL  476



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AVVPP+FLEETK+R +LASWC
Sbjct  301  FGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPKFLEETKDRSLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC      WGIG+EI 
Sbjct  361  PQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRVSCKEWGIGLEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR  VE LV++LMDGE+GKEM++KA+EWKK A++ A+   G SYV+L+++ N+VLL+
Sbjct  421  GDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKSAKE-ASCPIGLSYVDLDKMVNQVLLT  479

Query  92   PK  87
            P+
Sbjct  480  PR  481



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTPDQL+EFAWGLANS++ FLWIIRPD VSG E+++PPEF+EETK RGMLASWC
Sbjct  304  YGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCW+  T WG+GMEI+
Sbjct  364  SQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGVGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVESLV+ELM GEKGKEMK+KAMEWK+LA+ SA  ++GSSYVN+E++ N VLL+
Sbjct  424  NNVKRDEVESLVRELMVGEKGKEMKKKAMEWKELAEISAKKSTGSSYVNIEKVINDVLLA  483

Query  92   PK  87
             K
Sbjct  484  SK  485



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AV+PPEFLEETK+R +LASWC
Sbjct  301  FGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVIPPEFLEETKDRSLLASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL +PA+GGFLTHSGWNSTLES+C GVP+ICWPFFAEQQTNC +    WGIG+EI 
Sbjct  361  PQEQVLNNPAIGGFLTHSGWNSTLESVCGGVPIICWPFFAEQQTNCRFSCKEWGIGLEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR  VE LV++LMDGE+GKEM++KA+EWKKLA++++   +G S+V+ +++ N+VLLS
Sbjct  421  GDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKLAKEASGGPNGLSFVDFDKMVNQVLLS  480

Query  92   PK  87
             K
Sbjct  481  QK  482



>ref|XP_008229739.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=490

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG+LASWC
Sbjct  310  FGSITVMTPNQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLLASWC  369

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H +VGGFLTHSGWNSTLES+ AGVPM+CWPFFA+QQT+C+Y    WGIGMEI+
Sbjct  370  PQEQVLNHASVGGFLTHSGWNSTLESLTAGVPMLCWPFFADQQTDCYYTCNEWGIGMEID  429

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK KAMEWKKLA++ AT   GSS    + + N+VLL
Sbjct  430  NDVKRDEVEKLVKELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTGFDNLVNQVLL  487



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGLANSKKTFLW+IRPD VSG+ AV+P EFLEETK RG+L+SWC
Sbjct  304  FGSITVMTNDQLVEFAWGLANSKKTFLWVIRPDLVSGKNAVLPQEFLEETKNRGLLSSWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH ++GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  364  PQEEVLGHSSIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++E LVKELM+GEKGKEMK KA+  K+LA D+A  A GSS VNL+ + + VLL
Sbjct  423  EDAKRDKIEILVKELMEGEKGKEMKEKALRLKELAHDNAYGAFGSSLVNLDNMIHHVLL  481



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTPDQL+EFAWGLANS+  FLWIIRPD VSG E+++PPEF+EETK RGMLASWC
Sbjct  304  YGSITVMTPDQLIEFAWGLANSQHEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCW+  T WGIGMEI+
Sbjct  364  SQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVESLV+ELM GEKGKEMK+KAMEWKKLA+ SA  ++GSSY N++++ N VLLS
Sbjct  424  NNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVINDVLLS  483

Query  92   PK  87
             K
Sbjct  484  SK  485



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+P+QL+EFAWGLANSKK FLW+IRPD V+G+ A++P EFL+ETKERG+LASW 
Sbjct  311  FGSVTVMSPEQLIEFAWGLANSKKPFLWVIRPDLVNGDSAIIPVEFLQETKERGLLASWS  370

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTH+GWNSTLES+C GVP+ICWPFFAEQQTNCW+C   W IG+EI 
Sbjct  371  SQEEVLRHPSIGGFLTHNGWNSTLESLCGGVPLICWPFFAEQQTNCWFCCNKWKIGIEIE  430

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKRNE+E LV+EL+DG++GKE+K+K MEWK  A+++  +A+GSSY NL+++ N+VLL
Sbjct  431  KDVKRNEIERLVQELIDGKQGKELKKKVMEWKLKAEEATASANGSSYANLDRVINEVLL  489



>ref|XP_008219460.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=210

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  614  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  435
            MT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF++ET ERG+LASWCPQE+VL
Sbjct  1    MTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWCPQEQVL  60

Query  434  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  255
             HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQ NC +C   WGIGMEI  +VKRN
Sbjct  61   SHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKRN  120

Query  254  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +E LV++LM+GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N+V +
Sbjct  121  YIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVGLDKLVNQVCI  173



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QL+EFAWGLANS+++FLWIIRPD VSG+ +++PPEF+EETK+RGMLASWC
Sbjct  303  FGSITVMTPNQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+
Sbjct  363  SQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+EVESLV+ELM G KGK+MK+KAMEWK+LA+ SA   SGSSYVN+E++ N +LLS
Sbjct  423  CDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKVVNDILLS  482

Query  92   PK  87
             K
Sbjct  483  SK  484



>ref|XP_008229741.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=485

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG++ASWC
Sbjct  306  FGSIAVLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL  P+VGGFLTH GWNST+ES+CAGVPM+CWPFFA+QQTNC+Y    WGIG+EIN
Sbjct  366  PQEQVLNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNEWGIGLEIN  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR++VE LVKELM+GEKGK+MK K MEWKKLA++ AT+  GSS  NL+ + N+V+L
Sbjct  426  NDVKRDQVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATSPHGSSSTNLDNLVNQVIL  483



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWC
Sbjct  304  FGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+
Sbjct  364  PQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR++VE  V+ELM+GE+GKEMKRKAMEW+++A++ AT  SGSSY+NL+++ +KVLL 
Sbjct  424  GDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMARE-ATRPSGSSYLNLDEVMDKVLLL  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGLANSKK FLW+IRPD V+GE AV+PPEF+ +T++RG+LASWC
Sbjct  308  FGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H +V GFLTH+GWNSTLES+ AGVPMICWPFFAEQQTNCW+    WG+GMEIN
Sbjct  368  PQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEIN  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE+ V+EL+DG KG EM++KA EWK++A ++ T   GSS+  L+ +  +VLLS
Sbjct  428  SDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGLDSLIERVLLS  487



>ref|XP_004300654.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS  TFLW+IRPD V+G+ AVVPPEF+EETK R  LASWC
Sbjct  300  FGSITVMTDEQLIEFAWGLANSSMTFLWVIRPDLVAGKSAVVPPEFVEETKGRSWLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNS +ES+C GVPMICWPFFA+QQTNC +C   WG+ M+I 
Sbjct  360  PQEQVLNHPAIGGFLTHCGWNSMVESLCGGVPMICWPFFADQQTNCRFCCKEWGVAMQIE  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +E LV++LM G++GK+M++K++EWKKLA+++ TA +GSS++NL ++ N+VLLS
Sbjct  420  GDVKRNYIEDLVRKLMGGQEGKQMRKKSLEWKKLAEEAITAPNGSSFLNLNKMVNQVLLS  479

Query  92   PK  87
            PK
Sbjct  480  PK  481



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGLANSKK FLW+IRPD V+GE AV+PPEF+ +T++RG+LASWC
Sbjct  308  FGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H +V GFLTH+GWNSTLES+ AGVPMICWPFFAEQQTNCW+    WG+GMEIN
Sbjct  368  PQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEIN  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE+ V+EL+DG KG EM++KA EWK++A ++ T   GSS+  L+ +  +VLLS
Sbjct  428  SDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGLDSLIERVLLS  487



>ref|XP_004299645.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS  TFLW+IRPD V+G  AVVPPEF+EETK R  LASWC
Sbjct  300  FGSITVMTDEQLIEFAWGLANSNMTFLWVIRPDLVAGNSAVVPPEFVEETKGRSWLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNST+ES+C GVPMICWPFFA+QQ NC +C   WG+ M+I 
Sbjct  360  PQEQVLNHPAIGGFLTHCGWNSTVESLCGGVPMICWPFFADQQINCRFCCKEWGVAMQIE  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +V+RN +E LV++LM+G++GK+M++K++EWKKLA+++ TA +GSS++NL ++ N+VLLS
Sbjct  420  GDVRRNYIEVLVRKLMEGQEGKQMRKKSLEWKKLAEEAVTAPNGSSFLNLNKMVNQVLLS  479

Query  92   PK  87
            PK
Sbjct  480  PK  481



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QL+EFAWGLANS+  FLWIIRPD VSGE+A++PPEF+ ETKERGMLASWC
Sbjct  304  FGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVSGEQAILPPEFVGETKERGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+ GT WGIGMEI+
Sbjct  364  PQEQVLSHPAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVESLV+ELM GEKGKEMK+KAMEWKKLA+++     GSS+V ++++ N++LL
Sbjct  424  NNVKRDEVESLVRELMAGEKGKEMKKKAMEWKKLAEEATQKPEGSSFVAIDKLINEILL  482



>ref|XP_008229740.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG++ASWC
Sbjct  306  FGSIAVLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL  P+VGGFLTH GWNST+ES+CAGVPM+CWPFFA+QQTNC+Y    WGIG+EIN
Sbjct  366  PQEQVLNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNDWGIGLEIN  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR++VE LVKELM+GEKGK+MK K MEWKK+A++ AT+  GSS  NL+ + N+VLL
Sbjct  426  NDVKRDQVEKLVKELMEGEKGKKMKNKVMEWKKIAEE-ATSPHGSSSRNLDNLVNQVLL  483



>gb|AAB99950.1| UDP-glucuronosyltransferase [Pisum sativum]
Length=347

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
             GSITVMT +Q++EFAWGLANSK  FLW+IRPD V+GE +V+P EFLEETK RGML+SWC
Sbjct  170  LGSITVMTNEQMIEFAWGLANSKIPFLWVIRPDLVAGENSVLPQEFLEETKNRGMLSSWC  229

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  230  PQEEVLDHSAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCHEWGIGLEI-  288

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++ESLVKE+++GEKGKEMK KA+EWKKLA ++A+  +GSS++NLE++F  VLL
Sbjct  289  EDAKRDKIESLVKEMVEGEKGKEMKEKALEWKKLAPNAASGPNGSSFMNLEKMFRDVLL  347



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QL+EFAWGLANS++TFLWIIRPD VSG+ +++PPEF+EETK RGMLASWC
Sbjct  303  FGSITVMTPNQLIEFAWGLANSQQTFLWIIRPDIVSGDASILPPEFVEETKNRGMLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+ GFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+
Sbjct  363  SQEEVLSHPAIVGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVESLV+ELM G KGK+MK+KAMEWK+LA+ SA   SGSSYVN+E++ N +LLS
Sbjct  423  SDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKLVNDILLS  482

Query  92   PK  87
             K
Sbjct  483  SK  484



>ref|XP_004299646.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QL+EFAWGLA+S KTF W+IRPD V GE  V+PPEF+E+TKERG+LASWC
Sbjct  304  FGSSTVMTDEQLIEFAWGLADSSKTFFWVIRPDLVGGESPVLPPEFIEQTKERGLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNST+ES+C GVPMICWPF  EQQTNC YC   WGIG+E+ 
Sbjct  364  CQEQVLSHPAIGGFLTHSGWNSTIESVCGGVPMICWPFNGEQQTNCRYCCKEWGIGIEME  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRN +ES+V++LM+GE+GKEM++K+MEWKKLA+ + T   GSS+++L+ + N+VLLS
Sbjct  424  GDVKRNYIESVVRKLMEGEEGKEMRKKSMEWKKLAEKATTGPHGSSFLDLDNMVNQVLLS  483

Query  92   PK  87
            P+
Sbjct  484  PR  485



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTPDQL+EFAWGLANSK  FLWIIRPD VSG E+++PPEF+EETK RGMLASWC
Sbjct  304  YGSITVMTPDQLIEFAWGLANSKLEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCWY  T W +GMEI+
Sbjct  364  SQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWDVGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVESLV+ELM GEKGKEMK+KAMEWKKLA+ SA  ++GSSY N++++ N VLL+
Sbjct  424  NNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVVNDVLLA  483

Query  92   PK  87
             K
Sbjct  484  SK  485



>ref|XP_008219468.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=577

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVS-GEEAVVPPEFLEETKERGMLASW  456
            FGS TVMT +QL EFAWGLANSKK F W+IRPD V  G+  VV PEF+EETKERG+LASW
Sbjct  394  FGSSTVMTSEQLTEFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASW  453

Query  455  CPQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI  276
            CPQE+VL HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIGMEI
Sbjct  454  CPQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCKEWGIGMEI  513

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
              +VKRN VE LV++LM+GE+GKEM++KA+EWKKLA+++    +G S+V L+++ N+VLL
Sbjct  514  EGDVKRNYVEGLVRKLMEGEEGKEMRKKALEWKKLAKEATIGPNGLSFVGLDKLVNQVLL  573

Query  95   SPK  87
            SP+
Sbjct  574  SPR  576


 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF+EETKERG+LASWC
Sbjct  301  FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMEETKERGLLASWC  360

Query  452  PQEKVLG  432
            PQE+ +G
Sbjct  361  PQEQSIG  367



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT + L+EFAWGLANS+  FLWIIRPD V GE+A++PPEF+EETKERGMLASWC
Sbjct  306  FGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEQAILPPEFVEETKERGMLASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QEKVL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQ TNCW+C T  GIGMEIN
Sbjct  366  QQEKVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQPTNCWFCCTKLGIGMEIN  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR EVE+LV+ELM GEKGKEMK+KAMEWK LA+++A   +GSSYVN++++ N++LLS
Sbjct  426  NNVKRGEVEALVRELMTGEKGKEMKKKAMEWKILAEEAAAKPAGSSYVNIDKLINEILLS  485

Query  92   PK  87
            PK
Sbjct  486  PK  487



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP QL+EFAWGLANS+++FLWIIRPD VSG+ +++PPEF+EETK+RGMLASWC
Sbjct  303  FGSITVMTPSQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+
Sbjct  363  SQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+EVESLV+ELM G KGK+MK+K MEWK+LA+ SA   SGSSYVN+E++ N +LLS
Sbjct  423  CDVKRDEVESLVRELMVGGKGKKMKKKTMEWKELAEASAKEHSGSSYVNIEKVVNDILLS  482

Query  92   PK  87
             K
Sbjct  483  SK  484



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLANSK TFLWIIRPD V G+ +++PPEFLEET+ERG++ASWC
Sbjct  299  FGSITVMTAQQLVEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERGLMASWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+ GFLTHSGWNST+ESI  GVPMI WPFFAEQQTNC +  T WG+GMEI+
Sbjct  359  PQEQVLNHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGMEID  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR EVE LV+ELM+GEKGK M+ KAMEWKK A+ +A+  +GSS++NLE++   VLL
Sbjct  419  NNVKREEVERLVRELMEGEKGKGMRNKAMEWKKKAEQAAS-PNGSSFLNLEKLIKDVLL  476



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWC
Sbjct  304  FGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+
Sbjct  364  PQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR++VE  V+ELM+GE+GKEMKRKAMEW+++A++ A   SGSSY+NL+++ +KVLL 
Sbjct  424  GDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMARE-AMRPSGSSYLNLDEVMDKVLLL  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>ref|XP_008342285.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=317

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP  L EF WGLANSK  F W+IRPD V GE A++PPEF+ ETKER ++ASWC
Sbjct  137  FGSITVMTPAHLAEFGWGLANSKMPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWC  196

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    WG+GMEI+
Sbjct  197  PQEQVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEIS  256

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE L++ELMDGEKGK+MK KAMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  257  NDVKRDEVEKLIRELMDGEKGKKMKNKAMEWKKLAEE-ATSPHGSSSKNLDNLVNQVLL  314



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 5/182 (3%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGLANS+KTFLWIIRPD V G+ A+VPPEF+ ETK+RG++ SWC
Sbjct  303  FGSITVMTSEQLVEFAWGLANSQKTFLWIIRPDLVVGDAAIVPPEFVSETKDRGLMPSWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGHPA+GGFLTH GWNST+ESI  GVP+ICWPFFAEQQTNC YC   WGIGMEI 
Sbjct  363  PQEQVLGHPAIGGFLTHCGWNSTIESISCGVPVICWPFFAEQQTNCRYCCRAWGIGMEI-  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NV+R  +E LV++LMDGEKGKEMK++AMEWKK  +DS      SS +NL+++  +VLL+
Sbjct  422  ENVERGNIERLVRKLMDGEKGKEMKKRAMEWKKSTEDSI----ASSQLNLDKMIEQVLLA  477

Query  92   PK  87
            P+
Sbjct  478  PR  479



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++P EF   T+ER +LASWC
Sbjct  304  FGSITVMSPTQLVEFAWGLANSGQMFLWVIRPDLVVGDTAILPSEFSATTRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNST+ESI AGVPM+CWPFFAEQQTNC Y    WGIGMEI+
Sbjct  364  PQERVLNHPAVGGFLTHSGWNSTIESITAGVPMLCWPFFAEQQTNCRYSCEEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR++VE  V+ELM+GE GKEMKRKAMEW+++A++ AT  SGSS +NL+++ +KVLLS
Sbjct  424  GDVKRDKVEKQVRELMEGETGKEMKRKAMEWQEMARE-ATRPSGSSCLNLDEVMDKVLLS  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGLANS K+FLW+IRPD V GE  V+PPEF+E+TK+RG L+SWC
Sbjct  308  FGSITVMTSEQLNEFAWGLANSNKSFLWVIRPDVVGGENVVLPPEFVEQTKDRGFLSSWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  368  PQEQVLAHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEI-  426

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR+++E LV+ELMDGEKGKEMK KA++WK LA  +     GSS++NLE +  +VL+
Sbjct  427  EDVKRDKIERLVRELMDGEKGKEMKEKAIQWKDLAVSATYGPHGSSFLNLENMIREVLV  485



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T+ER +LASWC
Sbjct  303  FGSITVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ  NC Y    WGIGMEI+
Sbjct  363  PQERVLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE  V+ELM+GE+GKEMKRKAMEWK++A+++A   SG S++NL+++ N VL  
Sbjct  423  SDVKRDEVERQVRELMEGERGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVLRL  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_008229481.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 152/177 (86%), Gaps = 1/177 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+EETKER ++ASWC
Sbjct  303  FGSITVMTPNQLVEFGWGLANSKLHFFWVIRPDLVIGESAILPPEFVEETKERSLIASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH+GWNST+ES+ AGVPM+CWPFFA+QQTNC Y    WGIGMEIN
Sbjct  363  PQEQVLNHPSVGGFLTHNGWNSTIESLSAGVPMLCWPFFADQQTNCHYTCKEWGIGMEIN  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKV  102
            N+VKR++VE LV+ELM+GEKGK++K KAMEWK LA++ AT+  GSS  NL+ + N++
Sbjct  423  NDVKRDDVEKLVRELMEGEKGKKIKNKAMEWKTLAEE-ATSLHGSSSTNLDNLANQM  478



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEETK RG+L+SWC
Sbjct  302  FGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH ++GGFLTH+GWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  362  PQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  421  EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF   T+ER +LASWC
Sbjct  303  FGSVTVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ +VL H A+GGFLTHSGWNST+ESI AGVP++CWPFFAEQQ NC Y    WGIGMEI+
Sbjct  363  PQVQVLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +KVLLS
Sbjct  423  GDVKRDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDKVLLS  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T+ER +LASWC
Sbjct  303  FGSVTVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ  NC Y    WGIGMEI+
Sbjct  363  PQEQVLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE  V+ELM+GE+GKEMKRK MEWK++A++ AT  SG S++NL+++ N VL  
Sbjct  423  SDVKRDEVERQVRELMEGERGKEMKRKVMEWKEMARE-ATCPSGPSFLNLDELINSVLRL  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVMTP QLVEFAWGLANSKKTFLW+IRPD V+GE A++PPEFL+ETKERG+LA+WC
Sbjct  315  FGSVTVMTPQQLVEFAWGLANSKKTFLWVIRPDLVTGESAIIPPEFLKETKERGLLANWC  374

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNST+ES+  GVPMICWPFFAEQQTN W+C   W IGMEI+
Sbjct  375  PQEEVLMHPSIGGFLTHSGWNSTIESLAGGVPMICWPFFAEQQTNSWFCCNKWCIGMEID  434

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+  R E+E LVKELM+ + G E+K KAMEWK  A++ AT+ +GSSY+NL+++   VL
Sbjct  435  NDANRTEIERLVKELMNSKPGSEVKNKAMEWKMKAEE-ATSRTGSSYMNLDKMITMVL  491



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT +QL+EFAWGLANS KTFLW+IRPD V+GE A++P EF+++T++RG+L+SWC
Sbjct  274  FGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWC  333

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNCW+C   WGIG+EI 
Sbjct  334  SQEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-  392

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R+++ESLV+ELMDGEKGKEMK KA++WK+LA+ +A    GSS+ NL+ +   VLL
Sbjct  393  EDVERDKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVLL  451



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANS  TFLW IRPD V GE AVVP EF++ETKER +LA+WC
Sbjct  301  FGSITVMTSEQLIEFAWGLANSMHTFLWAIRPDLVGGESAVVPKEFVDETKERSLLANWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +    WGIG+EI+
Sbjct  361  PQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCREWGIGLEID  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+ VE LV++LM+GE+GKEM++K +EWKKLA+++ T  SG S+V+ E++ ++V+L+
Sbjct  421  PDVKRDYVEGLVRKLMEGEEGKEMRKKTLEWKKLAKEATTGPSGLSFVDFEKVVSQVILA  480

Query  92   PK  87
             +
Sbjct  481  QR  482



>gb|AFJ52994.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP QLVEFAWGLA SKKTFLW+IRPD V G  A++P EF +E KERG+L SWC
Sbjct  276  FGSITVMTPHQLVEFAWGLAKSKKTFLWVIRPDLVQGASAILPGEFSDEVKERGLLVSWC  335

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ++VL HP++GGFLTH GWNSTLES+ +GVPMICWPFFAEQQTNCW+    W +G+EI+
Sbjct  336  PQDRVLKHPSIGGFLTHCGWNSTLESLTSGVPMICWPFFAEQQTNCWFVCNKWRVGVEID  395

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+E++ LVKEL+DG KGKEMK  AMEWK+LA+++A    G +Y+NLE + N VLL+
Sbjct  396  SDVKRDEIDELVKELIDGVKGKEMKETAMEWKRLAEEAAQCEIGHAYLNLESVINNVLLN  455



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVMT +Q++EFAWGL+NSKK FLW+IRPD V+GE AV+P EFLEETK+RG+L+SWC
Sbjct  302  FGSVTVMTKEQMIEFAWGLSNSKKPFLWVIRPDLVAGENAVLPLEFLEETKDRGLLSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             Q +VL H A+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   W IG+EI 
Sbjct  362  LQGEVLAHSAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGLEI-  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++ESLVKEL+DGEKGKEMK KA++WKKLA ++A+   GSS++NLE +F  VLL
Sbjct  421  EDAKRDKIESLVKELLDGEKGKEMKAKALQWKKLAHNAASGPHGSSFMNLENLFRDVLL  479



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVMTP QL+EFAWGLANSK TFLW+IRPD V G+ A+VPPEF+ ETKERG+LA WC
Sbjct  303  FGSVTVMTPQQLIEFAWGLANSKCTFLWVIRPDLVVGDSAIVPPEFVAETKERGLLAGWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNSTL+S+C GVPMICWPFFAEQQTNCW+C    GIGMEI+
Sbjct  363  PQEQVLQHPSIGGFLTHSGWNSTLDSLCGGVPMICWPFFAEQQTNCWFCCNKLGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRNE+ESLV+ELM+G++G+ MK KA +WK+  +++  + +GSS +NLE++ NKVLL+
Sbjct  423  SDVKRNEIESLVRELMEGDQGQVMKYKAKKWKRKVEEATASPTGSSCLNLEKMINKVLLA  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>ref|XP_004172439.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=312

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP Q+VEFAWGLA+S K FLWI RPD + G+ A++P EF+ +TK+R +++SWC
Sbjct  129  FGSITVMTPQQMVEFAWGLADSGKPFLWITRPDLIVGDSAIMPQEFVTQTKDRSLISSWC  188

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTHSGWNSTLESICAGVPMI WPFFAEQQTNC YC T WGIGMEI+
Sbjct  189  SQEQVLNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEID  248

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKRNEVE LV+ELMDGEKGK+MK   M  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  249  NNVKRNEVEELVRELMDGEKGKKMKENVMYLKSKAEE-AYKPGGSAYKQLDKLINEVLLS  307



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT +Q+VEFAWGLANS KTFLW+IRPD V+G+ AV+P EF+  T +RG L+SW 
Sbjct  303  FGSIAVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGKHAVLPEEFVAATNDRGRLSSWT  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HPA+GGFLTHSGWNSTLESIC GVPMICWPFFAEQQTNC YC   WGIG+EI 
Sbjct  363  PQEDVLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGLEI-  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             + KR+ VESLV+ELMDGEKGK MK  A++WKKLA DSA    GSS+VNLE +F  VLL 
Sbjct  422  EDAKRDRVESLVRELMDGEKGKLMKENALKWKKLAHDSAVGPKGSSFVNLENMFRGVLLL  481

Query  92   PK  87
             K
Sbjct  482  EK  483



>ref|XP_006433963.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
 gb|ESR47203.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
Length=358

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANSK+TF+W+IRPD V G+ A++PPEF+ ETKER +LASWC
Sbjct  176  FGSITVMTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWC  235

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESIC GVP+ICWPFFAEQQTNC Y    WGIGMEI+
Sbjct  236  PQEQVLNHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEID  295

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR EVE LV++LM GEKG+EMK KA+E KK A+++AT   GSSYVNLE++   VLLS
Sbjct  296  SNVKREEVEVLVRDLMVGEKGQEMKLKALELKKKAKEAATGPVGSSYVNLEKLITHVLLS  355

Query  92   P  90
            P
Sbjct  356  P  356



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V T +QL+EFAWGLANSKK FLW+IRPD V GE AVVP EFLEETK+R +LA WC
Sbjct  302  FGSIAVTTNEQLIEFAWGLANSKKKFLWVIRPDLVRGESAVVPAEFLEETKDRSLLAHWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTHSGWNSTLES+C GVP+ICW F  EQ TNC Y    WG+G+E+ 
Sbjct  362  PQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPLICWSFCGEQPTNCRYSCREWGVGLEVG  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKRN VE LV++LM+GE+GK+M++KA+EWKKLA+++ T   GSS+++LEQ+ NKVLLS
Sbjct  422  DDVKRNYVEELVRKLMEGEEGKKMRKKALEWKKLAEEATTGPYGSSFLDLEQMVNKVLLS  481

Query  92   PK  87
             K
Sbjct  482  SK  483



>gb|KCW44219.1| hypothetical protein EUGRSUZ_L023571, partial [Eucalyptus grandis]
Length=214

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGML SWC
Sbjct  34   FGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWC  93

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H A+GGFLTHSGWNSTLES+C GVP+ICWPFFAEQQTNC Y  T WGIGMEI+
Sbjct  94   QQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEID  153

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A    G+SY N++++ ++VL S
Sbjct  154  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMLGGTSYNNVDKLISEVLSS  212



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT +QL+EFAWGLANS KTFLW+IRPD V+GE A++P EF+++T++RG+L+SWC
Sbjct  300  FGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNCW+C   WGIG+EI 
Sbjct  360  SQEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R+++ESLV+ELMDGEKGKEMK KA++WK+LA+ +A    GSS+ NL+ +   VLL
Sbjct  419  EDVERDKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVLL  477



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T ER +LASWC
Sbjct  303  FGSITVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ TNC Y    WG+GMEI+
Sbjct  363  PQERVLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGMGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE  V+ELM+G++GKEMKRKAMEWK++A+++A   SG S++NL+++ N VL  
Sbjct  423  SDVKRDEVERQVRELMEGKRGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVLRL  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>ref|XP_004305884.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP QLVEF WGLANSK +FLW+IRPD V GE A++PPEF+ ETKERG +ASWC
Sbjct  299  FGSVVVMTPKQLVEFGWGLANSKLSFLWVIRPDLVVGESAILPPEFVAETKERGAVASWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+V GFLTHSGWNST+ES+ AGVPM+CWPFFAEQQTN WY     GIGMEI+
Sbjct  359  PQEEVLNHPSVRGFLTHSGWNSTIESLSAGVPMLCWPFFAEQQTNTWYARNGLGIGMEID  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LV+ELM+GEKGKEMK+ A EWKKLA++ AT + GSS++NLE +   +L
Sbjct  419  NDVKRDEVEKLVRELMEGEKGKEMKKNANEWKKLAEE-ATDSQGSSFINLENVVQVLL  475



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEETK RG+L+SWC
Sbjct  302  FGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH ++GGFLTH+ WNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  362  PQEEVLGHSSIGGFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  421  EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>gb|KCW56974.1| hypothetical protein EUGRSUZ_I02647 [Eucalyptus grandis]
Length=464

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WC
Sbjct  282  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWC  341

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  342  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEID  401

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  402  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  459



>ref|XP_009349617.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEF WGLANSK  F W+IRPD V GE  ++ P+F  ETKE+G++ASWC
Sbjct  306  FGSITVMTPEQLVEFGWGLANSKLPFFWVIRPDLVIGESGILSPDFFAETKEKGLIASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFFA+QQTNC+Y    WGIGMEI+
Sbjct  366  PQEQVLNHPSVGGFLTHSGWNSTMESLTAGVPMLCWPFFADQQTNCYYTCNKWGIGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+ V+ L+KELM+GEKGK+MK KAMEWKKLA++ AT   GSS  N + + N VLL
Sbjct  426  NDVKRDGVQKLIKELMEGEKGKKMKNKAMEWKKLAEE-ATGPLGSSSTNFDNLVNNVLL  483



>ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48522.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=385

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQLVEFAWGLANS KTFLW+IRPD V G+ AV+PPEF+  TKERG+LASWC
Sbjct  201  FGSITVMTSDQLVEFAWGLANSNKTFLWVIRPDLVDGDTAVLPPEFVTVTKERGLLASWC  260

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTHSGWNSTLESIC GVPMICWPFFAEQQTNC Y    WGIGMEIN
Sbjct  261  AQEQVLSHPSIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCKYTCNEWGIGMEIN  320

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKRNEVESLV ELMDG+KGK MK+KAMEWKK+A++ A +  GSSY N +++ N+VLLS
Sbjct  321  GDVKRNEVESLVIELMDGDKGKAMKKKAMEWKKMAEE-AVSTKGSSYQNFDKMINQVLLS  379

Query  92   PK  87
             K
Sbjct  380  SK  381



>gb|KCW73113.1| hypothetical protein EUGRSUZ_E01564, partial [Eucalyptus grandis]
Length=433

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T ER +LASWC
Sbjct  259  FGSITVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWC  318

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ TNC Y    WGIGMEI+
Sbjct  319  PQERVLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGIGMEID  378

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFN  108
            ++VKR+EVE  V+ELM+GEKGKEMKRKAMEWK++A+++A   SG S++NL+++ N
Sbjct  379  SDVKRDEVERQVRELMEGEKGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELIN  432



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +TP+QL+EFAWGLANSKK F+WIIRPD V G+ A++P EF+EET+ER +++SWC
Sbjct  305  FGSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNSTLES+ AGVPMICWPFFAEQQTNC +   +WG GMEIN
Sbjct  365  PQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCNYWGSGMEIN  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             NVKR++VE LV+ELMDGEKG +M+ KAMEWK  A + AT   GSS VNL+ I +KVL+
Sbjct  425  PNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLV  482



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEET+ RG+L+SWC
Sbjct  302  FGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH ++GGFLTH+GWNSTLES+C GVPMICWPFF EQQTNC +C   WGIG+EI 
Sbjct  362  PQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  421  EDAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL+EFAWGLANS + FLWI RPD V G+ AV+PP+FLEETK RG++ SWC
Sbjct  303  FGSITVMTNDQLIEFAWGLANSNQPFLWIARPDLVIGDSAVLPPDFLEETKNRGLITSWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE VL HPA+GGFLTH GWNST+E++  GVP++CWPFFAEQQTNCWY  T WGIGMEI+
Sbjct  363  DQEHVLAHPAIGGFLTHCGWNSTIETLINGVPIVCWPFFAEQQTNCWYSCTKWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKR+EVE  V+ELM+GE+GKEMKR AM+WKKLA ++   ++GSSY NL+++  K+L S
Sbjct  423  ANVKRSEVERQVRELMEGEQGKEMKRNAMKWKKLAYEATAVSTGSSYNNLDEVI-KILGS  481

Query  92   PK  87
             K
Sbjct  482  IK  483



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT DQL+EFAWGLANS + FLWIIRPD V G+ AV+PPEF+EETK RG++ASWC
Sbjct  306  FGSITVMTNDQLIEFAWGLANSNQPFLWIIRPDLVIGDSAVLPPEFIEETKNRGLIASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             Q++VL HPAVGGFLTH GWNS +E++  G P+ICWPFFAEQQTNCW+    WGIGMEI+
Sbjct  366  NQDQVLAHPAVGGFLTHCGWNSIIETLINGAPIICWPFFAEQQTNCWFSCNKWGIGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
             NVKR+EVE  V+ELMDGEKGKEMKRK MEW+KL  ++  A +GSSY NL+++  KVL
Sbjct  426  VNVKRSEVERQVRELMDGEKGKEMKRKVMEWRKLGHEATAAPNGSSYKNLDKVI-KVL  482



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTPDQL+EFAWGLANS++ FLWIIRPD VSG E+++PP+F+EETK RGMLA WC
Sbjct  303  FGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPDFVEETKNRGMLAGWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTH+GWNSTLESIC+GVPMICWPFFAEQQTNCWY  T W IGMEI+
Sbjct  363  SQEEVLNHPAIGGFLTHNGWNSTLESICSGVPMICWPFFAEQQTNCWYTVTKWDIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM GEKGKEMK+KAM+WK LA+ SA  + GSSYVN+E++ N +LLS
Sbjct  423  NNVKRDEVECLVRELMVGEKGKEMKKKAMKWKTLAEISAQKSEGSSYVNIEKVVNDILLS  482

Query  92   PK  87
             K
Sbjct  483  SK  484



>ref|XP_010030029.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WC
Sbjct  307  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWC  366

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  367  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEID  426

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  427  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  484



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +TP+QL+EFAWGLANSKK F+WIIRPD V G+ A++P EF+EET+ER +++SWC
Sbjct  305  FGSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNSTLES+ AGVPMICWPFFAEQQTNC +   +WG GMEIN
Sbjct  365  PQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCDYWGSGMEIN  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             NVKR++VE LV+ELMDGEKG +M+ KAMEWK  A + AT   GSS VNL+ I +KVL+
Sbjct  425  PNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLV  482



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WC
Sbjct  305  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  365  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  425  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  482



>ref|XP_008373152.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
 ref|XP_008373153.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=478

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+  +TP QL+EF WGLANSK  FLW IRPD V GE A+ PPEF  ETKERG+LASWC
Sbjct  298  FGSLISLTPQQLLEFGWGLANSKLPFLWAIRPDLVIGESAIFPPEFEFETKERGLLASWC  357

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFFA+Q TNC+Y    WGIGMEI+
Sbjct  358  PQEQVLNHPSVGGFLTHSGWNSTIESLSAGVPMLCWPFFADQTTNCYYTCNEWGIGMEID  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELM+GEKGK+MK K MEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  418  NDVKRDEVEKLVRELMEGEKGKKMKNKVMEWKKLAEE-ATSPQGSSTRNLDNLVNQVLL  475



>ref|XP_008779905.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSIT+MT +QL+EFAWGLANSK  FLW+IRPD V G+  V+P EFL ETKERG+LASWC
Sbjct  300  YGSITMMTNEQLIEFAWGLANSKHDFLWVIRPDLVKGDSTVLPQEFLSETKERGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++GGFLTHSGWNSTLESIC+GVP I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  360  PQEAVLSHPSIGGFLTHSGWNSTLESICSGVPTISWPFFAEQQTNCRYACTEWGIGMEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR EVE LV+ELM+GEKGKEM+R+A+EWK  A  SAT   GSS+ N +++ N+ LL
Sbjct  420  SNVKREEVERLVRELMEGEKGKEMRRRAVEWKGSAI-SATQPGGSSFQNFDRLVNEALL  477



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGE-EAVVPPEFLEETKERGMLASW  456
            FGSI VMT DQL E AWGLANS K FLW+IRPD V+GE    +P EF++ETK+RGMLASW
Sbjct  294  FGSIMVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASW  353

Query  455  CPQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI  276
            CPQE+VL HPAVGGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +C   WGIG+EI
Sbjct  354  CPQEEVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI  413

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
              +VKR +VE+LV+ELM+GEKGKEMK +A+EWKKLA ++A++  GSS+VN++ +  +VL+
Sbjct  414  -EDVKREKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLM  472

Query  95   S  93
            +
Sbjct  473  N  473



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGE-EAVVPPEFLEETKERGMLASW  456
            FGSI VMT DQL E AWGLANS K FLW+IRPD V+GE    +P EF++ETK+RGMLASW
Sbjct  294  FGSIMVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASW  353

Query  455  CPQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI  276
            CPQE+VL HPAVGGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +C   WGIG+EI
Sbjct  354  CPQEEVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI  413

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
              +VKR +VE+LV+ELM+GEKGKEMK +A+EWKKLA ++A++  GSS+VN++ +  +VL+
Sbjct  414  -EDVKREKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLM  472

Query  95   S  93
            +
Sbjct  473  N  473



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 155/182 (85%), Gaps = 3/182 (2%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF++ TKERG+LA+WC
Sbjct  305  FGSITVMTGEQLVEFAWGLANSNQTFLWVIRPDLVKGDSALLPPEFVQHTKERGLLANWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGT--HWGIGME  279
            PQE++L HP++G FLTH GWNSTLESIC GVPM+CWPFFAEQQTNC Y  T   WGIGME
Sbjct  365  PQEQILNHPSIGVFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCRYTCTESEWGIGME  424

Query  278  INNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            INN+VKR++VESLV++L++G+KGKE+K K MEWKK AQ+ A    GSS +N +++ ++VL
Sbjct  425  INNDVKRDDVESLVRQLINGDKGKELKNKVMEWKKKAQE-AICLGGSSRLNFDKMIDQVL  483

Query  98   LS  93
            LS
Sbjct  484  LS  485



>gb|KCW66542.1| hypothetical protein EUGRSUZ_F00339 [Eucalyptus grandis]
Length=460

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV++P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +LASWC
Sbjct  278  FGSITVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWC  337

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH GWNS +ESI A VP++CWPFFA+QQTNC Y    WGIGMEI+
Sbjct  338  PQERVLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEID  397

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+V+R+EVE  V+ELM+G +GKEMKRK MEWK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  398  NDVRRDEVERQVRELMEGGRGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVINKVLLS  456

Query  92   PK  87
            P+
Sbjct  457  PR  458



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMTP+QL+EFAWGLANS++ FLWIIRPD V+GE A++PP+F+ ETK+RGMLASWC
Sbjct  305  YGSITVMTPEQLIEFAWGLANSQRQFLWIIRPDLVAGETAILPPDFVSETKDRGMLASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFL+H GWNSTLES+C GVPM+CWPFFAEQQ NC +   +WGIGMEI+
Sbjct  365  PQEQVLKHPSIGGFLSHMGWNSTLESLCCGVPMVCWPFFAEQQLNCRFACRNWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKR +VE LV+EL++GEKG EMK KAMEWK+ A++ A    GSS+ NLE++  +VL +
Sbjct  425  TNVKREDVEKLVRELLEGEKGMEMKTKAMEWKREAEE-AIRPGGSSFQNLEKLVAEVLQT  483

Query  92   PK  87
             K
Sbjct  484  DK  485



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLA+S +TFLW+IRPD V G+ A++PPEF   T+ER +LASWC
Sbjct  304  FGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTHSGWNST+ESI AGVPM+CWPFF EQQTNC Y    WGIGMEI+
Sbjct  364  PQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  105
            +NVKR+EV   V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +K
Sbjct  424  SNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  478



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGLAN KKTFLW+IRPD V G+ AVVP EF+EETK+R ++ASWC
Sbjct  301  FGSITVMTNEQLTEFAWGLANCKKTFLWVIRPDLVGGDSAVVPQEFVEETKDRSLMASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +     GIG+EI 
Sbjct  361  PQEQVLSHPAIGGFLTHCGWNSTLESVCGGVPMVCWPFFAEQQTNCRFSCKELGIGLEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR  VE LV++LMDG++GKEM++KA+EWKKLA+++++  +G S+V+ + + N+VLLS
Sbjct  421  GDVKRKYVEGLVRKLMDGKEGKEMRKKALEWKKLAKEASSGPNGLSFVDFDTMVNQVLLS  480

Query  92   PK  87
             K
Sbjct  481  QK  482



>gb|KCW45705.1| hypothetical protein EUGRSUZ_L00511 [Eucalyptus grandis]
Length=462

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G+  V+P EFL ETK+RGMLA WC
Sbjct  280  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWC  339

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  340  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEID  399

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + + VL+
Sbjct  400  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSHVLV  457



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QL+EFAWGLANS+  FLWIIRPD V+GE+A++P EF+E+TKERGMLASWC
Sbjct  304  FGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVTGEQAILPSEFVEQTKERGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H A+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+ GT WGIGMEI+
Sbjct  364  PQEQVLSHSAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EV+SLV+ELM GEKGKEMK+K+MEWKKLA+++     GSS+V ++++ N++LL
Sbjct  424  NNVKRDEVKSLVRELMAGEKGKEMKKKSMEWKKLAEEATQKPEGSSFVAIDKLINEILL  482



>ref|XP_008229475.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Prunus 
mume]
Length=485

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+QLVEF WGLAN+K  F W+IRPD V GE A++PPEF+ ETKER ++A WC
Sbjct  305  FGSIAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_004173933.1| PREDICTED: UDP-glycosyltransferase 85A3-like, partial [Cucumis 
sativus]
Length=187

 Score =   259 bits (663),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP Q++EFAWGLA+S K FLWI RPD + G+ A++  EF+ +TK+R ++ASWC
Sbjct  4    FGSITVMTPQQMIEFAWGLADSAKPFLWITRPDLIVGDSAIMSQEFVTQTKDRSLIASWC  63

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGF+THSGWNSTLESICAGVPMICWPFF+EQQTNC YC T WGIGMEI+
Sbjct  64   SQEQVLSHPSIGGFVTHSGWNSTLESICAGVPMICWPFFSEQQTNCRYCCTEWGIGMEID  123

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNV R+EVE LV+ELMDGEKGK+MK   M  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  124  NNVIRSEVEELVRELMDGEKGKKMKENVMYLKSKAEE-AYKPGGSAYKQLDKLINEVLLS  182



>ref|XP_004303931.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VM+P +LVEF WGLANS  +F+W+IRPD V GE A++PPEF+ ETKERG++ASWC
Sbjct  308  FGSIAVMSPQKLVEFGWGLANSNVSFIWVIRPDLVLGESAILPPEFVAETKERGLIASWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS +ES+CAGVPM+CWPFFA+QQTNCWY    WGIGMEI+
Sbjct  368  PQEQVLNHPSVGGFLTHCGWNSMIESLCAGVPMLCWPFFADQQTNCWYACNEWGIGMEIS  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LVKELM GE G +M+ KA+EWKKLA+D ATA   SS  NL+ + N +L
Sbjct  428  NDVKRDEVEKLVKELMKGEMGVKMRNKALEWKKLAED-ATAPHASSSKNLDNVVNLML  484



>ref|XP_002307921.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
 gb|EEE91444.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
Length=453

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFA GLANSK +FLWIIRPD V G+ A++P EF  ET++RG +ASWC
Sbjct  271  FGSITVMTAEQLVEFAMGLANSKISFLWIIRPDLVIGDSAILPAEFAVETQKRGFIASWC  330

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNST+ES+CAGVPMICWPFFA+Q  NC Y G+ WG+GMEI+
Sbjct  331  PQEEVLNHPSIGGFLTHSGWNSTVESLCAGVPMICWPFFADQAINCSYSGSEWGVGMEID  390

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N VKR EVE LV+ELM+GEKG++M+ KAMEWKKLA+++A A  GSS +NL++  N++L S
Sbjct  391  NKVKREEVEKLVRELMEGEKGEKMRGKAMEWKKLAEEAA-APHGSSSINLDKFINEILQS  449



>ref|XP_008219458.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=471

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVS-GEEAVVPPEFLEETKERGMLASW  456
            FGS TVMT +QL EFAWGLANSKK F W+IRPD V  G+  VV PEF+EETKERG+LASW
Sbjct  288  FGSSTVMTSEQLTEFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASW  347

Query  455  CPQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI  276
            CPQE+VL HPA+GGFLTH+GWNST+ES+  GVPMICWPF A+QQTNC +C + WGIG+EI
Sbjct  348  CPQEQVLSHPAIGGFLTHNGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEI  407

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
              +VKR  +E LV+ELM+GE+GK++++KA EWKKLA+++ T ++GSS+++L+Q+ NKVLL
Sbjct  408  EGDVKRYYIEGLVRELMEGEEGKKLRKKASEWKKLAKEATTGSNGSSFLDLDQMVNKVLL  467

Query  95   SPK  87
            SP+
Sbjct  468  SPR  470



>ref|XP_009377941.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP  LVEF WGLANSK  F W+IRPD V GE  ++PPEF+ ETKER ++ASWC
Sbjct  305  FGSITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESMILPPEFVAETKERSLVASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    WG+GMEI 
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEIG  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELMDGEKGK+MK +AMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVLL  482



>ref|XP_008229792.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=484

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+ LVEF WGLANSK  FLWIIRPD V G  A++PPEF+ ETKER ++ASWC
Sbjct  304  FGSIAVMTPECLVEFGWGLANSKNPFLWIIRPDLVVGASAILPPEFVAETKERALIASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNST+ES+ AGVPM+CWP FA+Q  NCWY    WG GMEI+
Sbjct  364  PQEQVLNHPSIGGFLTHSGWNSTIESLSAGVPMVCWPLFADQPINCWYTCNEWGCGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             NVKR EVE LV+ELM+GEKGK+MK KAMEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  424  KNVKREEVEKLVRELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  481



>ref|XP_002323757.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
 gb|EEF03890.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
Length=330

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T  Q++EFAWGLANS K FLWIIRPD + GE A++PPEFL  TK+R +L SWC
Sbjct  149  FGSITVITAQQMIEFAWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWC  208

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW+  T WGIGMEI 
Sbjct  209  PQEQVLKHPSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIE  268

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM+GEKGK+MKRKAMEWK  A+++A     +S+ NL+++  KVL S
Sbjct  269  NNVKRDEVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWTGD-ASHRNLDRLV-KVLAS  326



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EFAWGLANSK+TF+W+IRPD V G+ A++PPEF+ ETKER +LASWC
Sbjct  304  FGSITVMTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLESIC GVP+ICWPFFAEQQTNC Y    WGIGMEI+
Sbjct  364  PQEQVLNHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR EVE LV++LM GEKG+EMK KA+E KK A+++AT   GSSYVNLE++   VLLS
Sbjct  424  SNVKREEVEVLVRDLMVGEKGQEMKLKALELKKKAKEAATGPVGSSYVNLEKLITHVLLS  483

Query  92   P  90
            P
Sbjct  484  P  484



>ref|XP_008229476.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X2 [Prunus 
mume]
Length=485

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+QLVEF WGLAN+K  F W+IRPD V GE A++PPEF+ ETKER ++A WC
Sbjct  305  FGSIAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_009349618.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP  LVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKER ++ASWC
Sbjct  305  FGSITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLVASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    W +GMEI 
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWDVGMEIG  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELMDGEKGK+MK +AMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVLL  482



>ref|XP_009103241.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=488

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV +  QL EFA GLA S K FLW+IRPD V+GE AVVPPEFL ET++RGM+ASWC
Sbjct  304  FGSITVTSAKQLAEFALGLAGSGKEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPAVGGFLTH GWNS LES+C GVPMICWPFFAEQ TNC +C   WG+GMEIN
Sbjct  364  PQEKVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCEEWGVGMEIN  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKR E+E++VKELMDGEKG++M+ KA EW++LA+ +  +  GSS +N E + +KV+L 
Sbjct  424  ENVKREEIEAVVKELMDGEKGRKMREKAREWRRLAEKATESKYGSSVINFETVVSKVVLR  483

Query  92   PK  87
             +
Sbjct  484  QR  485



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G+  V+P EFL ETK+RGMLA WC
Sbjct  305  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  365  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + + VL+
Sbjct  425  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSHVLV  482



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV++P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +LASWC
Sbjct  303  FGSITVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH GWNS +ESI A VP++CWPFFA+QQTNC Y    WGIGMEI+
Sbjct  363  PQERVLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+V+R+EVE  V+ELM+G +GKEMKRK MEWK++A++ AT  SGSS++NL+++ NKVLLS
Sbjct  423  NDVRRDEVERQVRELMEGGRGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVINKVLLS  481

Query  92   PK  87
            P+
Sbjct  482  PR  483



>gb|KCW45703.1| hypothetical protein EUGRSUZ_L005082, partial [Eucalyptus grandis]
Length=303

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC
Sbjct  129  FGSITVMTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWC  188

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H A+GGFLTHSGWNSTLES+C+GVP+ICWPFF +QQTNC Y  T WGIGMEI+
Sbjct  189  RQEEVLKHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEID  248

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  105
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A   SG+SY N++++ ++
Sbjct  249  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPSGTSYNNVDKLISE  303



>ref|XP_008372493.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QLVEF+WGLANS KTFLWIIRP  V+G+ AVVPPEFLEET  RG LASWC
Sbjct  294  FGSTTVMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDSAVVPPEFLEETXGRGKLASWC  353

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC Y   HWGIG+EI 
Sbjct  354  PQEQVLTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACKHWGIGIEIE  413

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            + VKR+ +E LV+ LM+GE+GKEM++ A+ WKK   + AT+  GSS ++L+ + N+VL++
Sbjct  414  DEVKRDYIEGLVRRLMEGEEGKEMRKNALGWKK-KIEKATSPKGSSVLDLDNLINQVLIA  472

Query  92   P  90
            P
Sbjct  473  P  473



>ref|XP_009349615.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP  LVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKER ++ASWC
Sbjct  305  FGSITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    WG+GMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCHYTCKEWGVGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELM GEKGK+MK KAMEWKKLA++ AT+  GSS  NL+ + ++VLL
Sbjct  425  NDVKRDEVEKLVRELMAGEKGKKMKNKAMEWKKLAEE-ATSPHGSSSKNLDNLVHQVLL  482



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VPPEFL+ET  R ML SWC
Sbjct  304  FGSITVMTAKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLKETAGRRMLVSWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +    W +GMEI 
Sbjct  364  PQEKVLSHPAIGGFLTHNGWNSTLESLCGGVPMVCWPFFAEQQTNCKFTCDEWEVGMEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR EVE++V+ELMDGEKGK+M+ KA EW++LA ++     GSS VN E + NK LL 
Sbjct  424  GDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAGEATEHKLGSSVVNFETVVNKALLG  483

Query  92   PK  87
             K
Sbjct  484  QK  485



>ref|XP_008245954.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+TP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETK R ++A WC
Sbjct  305  FGSIAVITPEQLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKGRSLIAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ESI AGVPM+CWPFFA+QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFADQQMDCRYTCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>gb|KCW66544.1| hypothetical protein EUGRSUZ_F00340 [Eucalyptus grandis]
Length=460

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +L SWC
Sbjct  278  FGSITVMSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWC  337

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH GWNS +ESI A VP+ CWPFFA+QQTNC Y    WGIGMEI+
Sbjct  338  PQERVLSHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEID  397

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++V+R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS++NL+++ +KVLLS
Sbjct  398  SDVRRDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVLLS  456

Query  92   PK  87
             +
Sbjct  457  SR  458



>ref|XP_002271368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP QL E AWGLANS K FLWIIRPD V G+ A +PPEF+ ET++RG+LASWC
Sbjct  303  FGSVIVMTPQQLTELAWGLANSNKPFLWIIRPDLVPGDSAPLPPEFVTETRDRGLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGF+THSGWNST E IC GVP+IC PF AEQ TNC YC + WGIGMEI+
Sbjct  363  PQEQVLKHPAVGGFVTHSGWNSTSEGICGGVPLICMPFRAEQPTNCRYCCSEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKR++VE LV+ELMDGE GK+MK+KAMEWKKLA++ A    GSSY N  ++ + VLLS
Sbjct  423  GNVKRDKVEKLVRELMDGENGKKMKKKAMEWKKLAEE-AIMPGGSSYNNFNKLLSDVLLS  481

Query  92   PK  87
             K
Sbjct  482  KK  483



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +TP+QLVEFAWGLANSKK F+WIIRPD V G+ A++P EF+EET+ER +++SWC
Sbjct  305  FGSITAVTPEQLVEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNSTLES+ AGVP ICWPFFAEQQTNC +   +WG GMEIN
Sbjct  365  PQEEVLSHPAIGGFLTHCGWNSTLESLSAGVPTICWPFFAEQQTNCKFLCDYWGSGMEIN  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             NVKR++VE LV+ELMDGEKG +M+ KAMEWK  A + AT   GSS VNL+ I +KVL+
Sbjct  425  PNVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLV  482



>ref|XP_004305887.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   268 bits (686),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+TP QLVEF WGLA +K  FLW+IRPD V GE AV+PPEF+ ETKERG++ASWC
Sbjct  312  FGSIVVLTPQQLVEFGWGLAKTKLPFLWVIRPDLVVGESAVLPPEFVAETKERGLIASWC  371

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+CAGVPM+  PFFAEQQTNC+Y    WGIGMEIN
Sbjct  372  PQEQVLNHPSVGGFLTHSGWNSTIESLCAGVPMLSLPFFAEQQTNCYYTCRKWGIGMEIN  431

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKV  102
            N+VKR+EV+ LVKELM+ EKGKEM+ K MEW KLA++ ATA  GSS  NL+++  ++
Sbjct  432  NDVKRDEVQKLVKELMEREKGKEMRNKVMEWNKLAEE-ATAPHGSSSKNLDKLVKRL  487



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +L SWC
Sbjct  303  FGSITVMSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH GWNS +ESI A VP+ CWPFFA+QQTNC Y    WGIGMEI+
Sbjct  363  PQERVLSHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++V+R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS++NL+++ +KVLLS
Sbjct  423  SDVRRDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVLLS  481

Query  92   PK  87
             +
Sbjct  482  SR  483



>ref|XP_009377940.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=491

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEF WGLANSK  F W+IRPD V GE  ++ P+F  ETKE+G++ASWC
Sbjct  306  FGSITVMTPEQLVEFGWGLANSKLPFFWVIRPDLVIGESGILSPDFFAETKEKGLIASWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF++QQTNC+Y    WGIGMEI+
Sbjct  366  PQEQVLNHPSVGGFLTHSGWNSTMESLTAGVPMLCWPFFSDQQTNCYYTCNKWGIGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+VKR+EVE LV+ELM+GEKG +MK KA+EWKKLA++ AT   GSS  NL+ +  ++LL+
Sbjct  426  NDVKRDEVEKLVRELMEGEKGNKMKNKAIEWKKLAEE-ATGPHGSSSKNLDNLVKQLLLN  484



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T +QLVEFAWGLANSK+ FLW+IRPD V+   AV+  EF+EETK+RGMLASWC
Sbjct  367  FGSITVLTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWC  426

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HPAVGGFLTH GWNST+ES+C+GV M+CWPFFAEQQTNCW+C T WG+G+E+N
Sbjct  427  PQEQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVN  486

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
                R E+E  V+ELM+G+ GK MK KA+EWK LA+ +A   +GSSYVNL+++ N VLL+
Sbjct  487  PRADRVEIEKRVRELMEGDSGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDKLINDVLLT  546



>ref|XP_008229788.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI ++TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ET+ER ++A WC
Sbjct  305  FGSIAIVTPQQLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETRERSLIAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ESI AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_004305885.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP+ LVEF WGLANSK  FLW+IRPD V GE A++PPEF+ ETK RG++ASWC
Sbjct  298  FGSVVVMTPEHLVEFGWGLANSKHPFLWVIRPDLVVGESAILPPEFVAETKGRGIIASWC  357

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH+GWNST+ES+ AGVPM+CWPFFAEQQTNCWY     GIGMEI+
Sbjct  358  PQEEVLNHPSVGGFLTHNGWNSTIESVTAGVPMLCWPFFAEQQTNCWYVCNGLGIGMEID  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVE LV+ELM+G+ G+EM+ KA   KKLA+++A    GSSY NL+++ N+VLL
Sbjct  418  NNVKRDEVEKLVRELMEGQNGEEMRNKANVLKKLAEEAAD-PQGSSYKNLDKVVNQVLL  475



>ref|XP_008229793.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=493

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VM P QLVEF WGLANSK  FLW+IRPD + GE A++PPEF  ETK+RG++ASWC
Sbjct  314  FGSLVVMAPQQLVEFGWGLANSKVPFLWVIRPDLIVGESAILPPEFEFETKDRGLIASWC  373

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWP FAEQ TNC+Y    WG G+EI+
Sbjct  374  PQEQVLNHPSVGGFLTHSGWNSTIESLTAGVPMLCWPVFAEQHTNCYYTCNEWGSGLEID  433

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVE LV+EL +GEKGK+MK KAMEW+KLA++ AT   GSS +N++ + N+VLL
Sbjct  434  NNVKRDEVEKLVRELTEGEKGKKMKIKAMEWRKLAEE-ATGPHGSSSINMDNLVNQVLL  491



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFAWGLANSKK FLW++RPD V+GE AV+PPEF EET ERG L SWC
Sbjct  277  FGSITVMTSEQLVEFAWGLANSKKEFLWVLRPDLVAGESAVLPPEFSEETSERGFLTSWC  336

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVLGHPAVGGFLTH GWNST+ESIC+GVPM+CWPFFAEQQTNCWY    WGIGMEI+
Sbjct  337  PQEKVLGHPAVGGFLTHCGWNSTIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGMEID  396

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQD  162
             + KR E+E +V+ELMDGEKG+EMKR+  +WK+LA++
Sbjct  397  GDAKREEIERIVRELMDGEKGREMKRRVEKWKRLAEE  433



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL EFAWGLANSKK+FLWIIRPD V+G+ A++PPEF+ ETKERG LASWC
Sbjct  303  FGSITVMTAHQLTEFAWGLANSKKSFLWIIRPDIVAGDTAMLPPEFVTETKERGKLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GG LTHSGWNSTLES+C GVP+ICWPFFAEQQTNC Y    W +GMEI+
Sbjct  363  PQEEVLKHPAIGGSLTHSGWNSTLESVCGGVPVICWPFFAEQQTNCRYSCVEWEMGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELMDGEKG++M+ KA+EWK  A+ +A    G  + NL+Q+ N +LL
Sbjct  423  NDVKRDEVELLVRELMDGEKGEKMRNKALEWKSKAE-AAAGPDGPCFQNLDQLINDLLL  480



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +T +QLVEFAWGLANSK+ FLW+IRPD V+   AV+  EF+EETK+RGMLASWC
Sbjct  310  FGSITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWC  369

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HPAVGGFLTH GWNST+ES+C+GV M+CWPFFAEQQTNCW+C T WG+G+E+N
Sbjct  370  PQEQILSHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVN  429

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
                R E+E  V+ELM+GE GK MK KA+EWK LA+ +A   +GSSYVNL+ + N VLL+
Sbjct  430  PRGDRVEIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDNLINDVLLT  489



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA S+K FLW+IRPD V+GEEAV+P EFL ET+ R ML SWC
Sbjct  304  FGSITVMTAKQLVEFAWGLAASRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPAVGGFLTH+GWNSTLESI AGVPM+CWPFFAEQQTN  YC   WG+GMEI 
Sbjct  364  PQEKVLSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE++V+ELMDGEKGK+++ KA EW++LA+ +     GSS VN + + +K+LL
Sbjct  424  EDVKREEVEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKTVVDKILL  482



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA S+K FLW+IRPD V+GEEAV+P EFL ET+ R ML SWC
Sbjct  304  FGSITVMTAKQLVEFAWGLATSRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPAVGGFLTH+GWNSTLESI AGVPM+CWPFFAEQQTN  YC   WG+GMEI 
Sbjct  364  PQEKVLSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE++V+ELMDGEKGK+++ KA EW++LA+ +     GSS VN + + +K+L+
Sbjct  424  EDVKREEVEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKMVVDKILI  482



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T +QL EFAWGLANS +TFLW+IRPD + GE AVVP EF EETKER ++ASWC
Sbjct  301  FGSITVLTEEQLTEFAWGLANSNQTFLWVIRPDLLVGESAVVPSEFSEETKERSLVASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ++VL HPA+GGFLTHSGWNS LES+C GVPMICWPFFAEQQ NC +    WGIGMEI 
Sbjct  361  PQQEVLSHPAIGGFLTHSGWNSILESLCGGVPMICWPFFAEQQMNCRFSCKVWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+ +E LV+++M+GE+GKEM++KA+EWKKLA ++ T+ +G+S+V+L+++ ++VL S
Sbjct  421  GDVKRDYIEGLVRKIMEGEEGKEMRKKALEWKKLATEATTSPNGTSFVDLDRMASQVLQS  480

Query  92   P  90
            P
Sbjct  481  P  481



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T  Q++EFAWGLANS K FLWIIRPD + GE A++PPEFL  TK+R +L SWC
Sbjct  301  FGSITVITAQQMIEFAWGLANSNKPFLWIIRPDLIGGEAAMLPPEFLSATKDRSLLVSWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HP++GGFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW+  T WGIGMEI 
Sbjct  361  PQEQILKHPSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM+GEKGK+MKRKAMEWK  A+++A     +SY NL+++  KVL S
Sbjct  421  NNVKRDEVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWTGD-ASYRNLDRLV-KVLAS  478



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FG I VM+  QLVEFAWGLA S K FLW+IRPD V+G+ AV+PPEFL ET++R MLASWC
Sbjct  304  FGCIAVMSAKQLVEFAWGLAASGKDFLWVIRPDLVAGDAAVIPPEFLAETEDRRMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTH GWNSTLES+C GVPMICWPFFAEQ TNC +C   WG+GMEI 
Sbjct  364  PQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             NVKR E+E++V+ELMDGEKGK+M+ KA EW+ LA+++     GSS VN   + NKVLL
Sbjct  424  GNVKREELETVVRELMDGEKGKKMREKAEEWRHLAEEATKDKLGSSVVNFNTLVNKVLL  482



>ref|XP_009349616.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP+ ++EF WGLANSK  FLWIIRPD V+GE A++PP+F+ +TKERGM+ SWC
Sbjct  301  FGSLAVMTPEHVIEFGWGLANSKHPFLWIIRPDLVAGETAILPPDFVADTKERGMIVSWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HP+VGGFLTHSGWNST+ES+ AGVPM+CWP F +QQTNC++    WG GMEIN
Sbjct  361  PQEKVLNHPSVGGFLTHSGWNSTIESLSAGVPMLCWPLFGDQQTNCYFTCNEWGSGMEIN  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            + VKR+EVE LV+ELM+GEKGK+MK KA+EWKKLA++ AT   GSS  NL+ +  +VLL+
Sbjct  421  SKVKRDEVEKLVRELMEGEKGKKMKNKAIEWKKLAEE-ATGPHGSSSKNLDNLVKQVLLN  479



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC
Sbjct  310  FGSITVMTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWC  369

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H A+GGFLTHSGWNSTLES+C+GVP+ICWPFF +QQTNC Y  T WGIGMEI+
Sbjct  370  RQEEVLKHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEID  429

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A   SG+SY N++++ ++VL
Sbjct  430  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPSGTSYNNVDKLISEVL  486



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVMT +Q++EFAWGLANSKK+F+W+IRPD V GE AV+P EF+ +TK RGML+ WC
Sbjct  300  FGSVTVMTNEQMIEFAWGLANSKKSFVWVIRPDLVVGERAVLPQEFVTQTKNRGMLSGWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGHPA+G FLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIG+EI 
Sbjct  360  PQEQVLGHPAIGVFLTHSGWNSTLESLCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEI-  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
             +V+R+ +E LV+ +MDGEKGK+MKRKA+ WK LA+ +A+A +GSS+V  +++  +VL
Sbjct  419  EDVERDHIERLVRAMMDGEKGKDMKRKAVNWKILAEKAASAPTGSSFVQFQKLIREVL  476



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WC
Sbjct  305  FGSIAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+
Sbjct  365  PQERVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  105
            N+V+R EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++
Sbjct  425  NSVRREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQ  479



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VPPEFL ET +R MLASWC
Sbjct  304  FGSITVMTAKQLVEFAWGLAGSGKQFLWVIRPDLVAGEEAMVPPEFLTETADRRMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTHSGWNSTLES+  GVPM+CWPFFAEQQTNC +    W +G+EI 
Sbjct  364  PQEKVLSHPAIGGFLTHSGWNSTLESLSGGVPMVCWPFFAEQQTNCKFTCDEWEVGIEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS VN E + NK  L 
Sbjct  424  GDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAKEATEHKLGSSVVNFETVVNKAFLG  483

Query  92   PK  87
             +
Sbjct  484  QR  485



>ref|XP_010676253.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT MT + L+EFAWGLANSK  FLWI+RPD VSG+ AV+PPEFL ETK+RG++ SWC
Sbjct  308  FGSITTMTNENLIEFAWGLANSKHPFLWILRPDIVSGDSAVIPPEFLAETKDRGLITSWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE VL H ++G FLTH GWNS L++IC+GVP+ICWPFFAEQQTNCW+    WGIGMEI+
Sbjct  368  DQETVLDHASIGAFLTHCGWNSILDTICSGVPVICWPFFAEQQTNCWFISEKWGIGMEID  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNV+R+EVE  V+ELM+ EKG EM RKAMEWKKLA+++A   SGSS  N + + N+V+L 
Sbjct  428  NNVRRSEVEKQVRELMEEEKGGEMTRKAMEWKKLAEEAAATPSGSSCSNFDNLVNQVILP  487

Query  92   PK  87
             K
Sbjct  488  LK  489



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+TP Q++EFAWGLANS K FLWIIRPD V GE A++P EF+ ETK+RGMLA+WC
Sbjct  293  FGSITVITPQQMMEFAWGLANSNKPFLWIIRPDLVEGESAMLPSEFVSETKKRGMLANWC  352

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++GGFL H GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+
Sbjct  353  PQELVLKHPSIGGFLCHMGWNSTMDSICAGVPLICWPFFADQQTNCMFACTEWGIGMQID  412

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM+GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +   +   
Sbjct  413  NNVKRDEVEKLVRELMEGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALVKVLACK  471

Query  92   PKC  84
              C
Sbjct  472  QTC  474



>ref|XP_008380053.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP+ LVEF WGLANSK  FLW+IRPD V GE A++PPEF+ ETKER ++A WC
Sbjct  306  FGSVVVMTPEHLVEFGWGLANSKHHFLWVIRPDLVIGESAILPPEFVAETKERCLIAGWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+ WPFFAEQQTNCWY     G GMEI+
Sbjct  366  PQEEVLNHPSVGGFLTHSGWNSTIESVTAGVPMLSWPFFAEQQTNCWYTCNGLGTGMEID  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LV+ELM+GEKGK+MKRKA EWKKLA++ AT   GSS  NL+ + N VL
Sbjct  426  NDVKRDEVEKLVRELMEGEKGKKMKRKANEWKKLAEE-ATGPHGSSIKNLDFVVNNVL  482



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+  QLVEFAWGLA S+K FLW+IRPD V G+ AVVPPEF+ ET +RGMLA+WC
Sbjct  305  FGSITVMSEKQLVEFAWGLAGSRKEFLWVIRPDLVGGDAAVVPPEFMAETADRGMLANWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH+GWNST+ESI  GVPMICWPFFAEQQ NC +C   WG G EI 
Sbjct  365  PQEEVLSHPAVGGFLTHNGWNSTIESISGGVPMICWPFFAEQQMNCKFCCDEWGTGKEIG  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE++V+ELMDGE GK+M+ KA EW++ A+ S  A SGSS+VN E + ++VLL
Sbjct  425  GDVKRGEVEAVVRELMDGEMGKKMRNKAEEWRRSAEASVAAPSGSSFVNFEAVVDRVLL  483



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +T +QLVEFAWGLANSK+ FLW+IRPD V+   AV+  EF+EETK+RGMLASWC
Sbjct  310  FGSITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWC  369

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HPAVGGFLTH GWNST+ES+C+GV M+CWPFFAEQQTNCW+C T WG+G+E+N
Sbjct  370  PQEQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVN  429

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
                R E+E  V+ELM+GE GK MK KA EWK LA+ +A   +GSSYVNL+++ N VLL+
Sbjct  430  PRADRVEIEKRVRELMEGESGKLMKEKAWEWKLLAEKAAAGPNGSSYVNLDKLMNDVLLT  489



>ref|XP_008455179.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=488

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP Q++EFAWGLA+S K FLWI RPD + G+ A++P EF+ +TK+R ++A+WC
Sbjct  305  FGSITVMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSLIANWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTHSGWNSTLESICAGVPMI WPFFAEQQTNC YC T WGIGMEI+
Sbjct  365  CQEQVLNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKRNEVE LV+ELMDGEKGK+MK   M  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  425  NNVKRNEVEELVRELMDGEKGKKMKENVMYLKSKAEE-AYKPDGSAYKQLDKLINEVLLS  483



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT DQL EFAWGLANS +TFLW+IRPD V GE AVVP EF+ ETK+RG++A+WC
Sbjct  303  FGSIAVMTADQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPAEFVAETKDRGLMATWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ESI  GVPMICWPFFAEQQTNC Y  T WGIGMEIN
Sbjct  363  PQEQVLSHPSVGGFLTHSGWNSTIESISGGVPMICWPFFAEQQTNCRYSCTKWGIGMEIN  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE LV+ELM+GEKGKEMK+KA+EWK+ A+++  ++ GSSY NL+Q+ N+VLLS
Sbjct  423  SDVKRDEVEGLVRELMEGEKGKEMKKKALEWKRKAEEATGSSKGSSYKNLDQMINQVLLS  482

Query  92   PK  87
            P+
Sbjct  483  PR  484



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEET+ RG+L+SWC
Sbjct  302  FGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VLGH ++GGFLTH+GWNSTLES+C GVPMICWPFF EQQTNC +C   WGIG+EI 
Sbjct  362  PQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             + KR+++E  VKELM+GEKGKEMK KA++WKKLA ++A    GSS++NLE + + V L
Sbjct  421  EDAKRDKIEIFVKELMEGEKGKEMKEKALQWKKLAHNAAFGPHGSSFMNLENLIHDVFL  479



>gb|AFJ52995.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=489

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVMT  QLVEFAWGLA+S K FLW+IR D V GE A++P EF EE KERG+L SWC
Sbjct  305  FGSVTVMTSHQLVEFAWGLAHSGKPFLWVIRSDLVKGESAILPREFSEEIKERGLLVSWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL H ++GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNCW+     G+G+EI+
Sbjct  365  PQEKVLKHASIGGFLTHCGWNSTLESLTNGVPMICWPFFAEQHTNCWFVCEKLGVGLEID  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N++KR E++ LV+ELMDGEKGKEMKR+AMEWKK A+D+    SG +Y+NLE + N +LL
Sbjct  425  NDIKREEIDELVRELMDGEKGKEMKRRAMEWKKSAEDATLGESGLAYLNLEDMINNILL  483



>emb|CDY21357.1| BnaA09g30700D [Brassica napus]
Length=290

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FG ITVM+ +QL EFAWGLA S K FLW+IRPD V+GE A VPPEF+ ET++RGM+ASWC
Sbjct  113  FGCITVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWC  172

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNC +C   WG+GMEI 
Sbjct  173  PQEKVLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIG  232

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
             +VKR EVE++++ELMDGEKGK+++ KA +W++LA+++    SGSS V+ E + NKVL
Sbjct  233  GDVKREEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  290



>gb|KCW66548.1| hypothetical protein EUGRSUZ_F003462, partial [Eucalyptus grandis]
Length=312

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QL E AWGLANS + FLW+IRPD V G  A++PP+FL  T++R +L SWC
Sbjct  130  FGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQRSLLVSWC  189

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH GW ST+ESI AGVP++CWPFF EQQ NCWY    WGIG+EI+
Sbjct  190  PQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEWGIGLEID  249

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE  V+ELM+GE+GK MKRK MEW+++A+++A   SGSS  NL+++ +KVLLS
Sbjct  250  DDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEVIDKVLLS  308

Query  92   PK  87
            P+
Sbjct  309  PR  310



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +T +QLVEFAWGLANSK+ FLW+IRPD ++   AV+  EF+EETK+RGMLASWC
Sbjct  310  FGSITALTRNQLVEFAWGLANSKRPFLWVIRPDIINEATAVITQEFVEETKDRGMLASWC  369

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE++L HP+VGGFLTH GWNST+ES+C+GV M+CWPFFAEQQTNCW+C T WG+G+E+N
Sbjct  370  PQEQILRHPSVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVN  429

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
                R ++E  V+ELM+GE GK MK KA+EWK LA+ +A   +GSSYVNL+++ N VLL+
Sbjct  430  PRADRVDIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDKLINDVLLT  489



>ref|XP_008789349.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X2 [Phoenix 
dactylifera]
Length=477

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWC
Sbjct  300  YGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  360  PQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  420  SNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_008789350.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWC
Sbjct  300  YGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  360  PQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  420  SNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGLANS +TFLW+IRPD V GE AVVP EF EETKER ++ASWC
Sbjct  301  FGSITVMTEEQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPSEFSEETKERSLVASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             Q++VL HPA+GGFLTHSGWNSTLES+C GVPMICWP FA+QQ NC +    WGIGMEI 
Sbjct  361  LQQEVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPVFADQQMNCRFSCKEWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR+ +E LV++LM+GE+GKEM++KA EWKKLA ++ T+ +G S+V+L++I ++VL S
Sbjct  421  GDVKRDYIEGLVRKLMEGEEGKEMRKKAQEWKKLATEATTSPNGMSFVDLDRIASQVLQS  480

Query  92   P  90
            P
Sbjct  481  P  481



>ref|XP_008229473.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
 ref|XP_008229474.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=486

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT +QLVEF WGLANSK  F W+IRPD V GE A+ PPEF+ ETKER ++A WC
Sbjct  306  FGSIAVMTSEQLVEFGWGLANSKLPFFWVIRPDLVIGESAIFPPEFVAETKERSLIAGWC  365

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  366  PQEQVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEIS  425

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  426  NDVKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  483



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGML SWC
Sbjct  309  FGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWC  368

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H A+GGFLTHSGWNSTLES+C GVP+ICWPFFAEQQTNC Y  T WGIGMEI+
Sbjct  369  QQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEID  428

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A    G+SY N++++ ++VL S
Sbjct  429  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMLGGTSYNNVDKLISEVLSS  487



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VP +FL ET  R ML SWC
Sbjct  304  FGSITVMTTKQLVEFAWGLARSGKEFLWVIRPDLVAGEEAIVPSDFLTETTGRRMLVSWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTHSGWNSTLES+ +GVPM+CWPFFA+QQTNC +C   W +GMEI 
Sbjct  364  PQEKVLSHPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFADQQTNCKFCCDKWEVGMEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE++V+ELMDGEKGK+M+ KA EW++LA+ ++    GSS +N E + NKVLL
Sbjct  424  GDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAEKASERKLGSSILNFETLVNKVLL  482



>ref|XP_008789348.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X1 [Phoenix 
dactylifera]
Length=477

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWC
Sbjct  300  YGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  360  PQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  420  SNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV++  QLVEFAWGLA S K FLW+IRPD V+GEEAVVPPEFL ETK+R MLASWC
Sbjct  305  FGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAVVPPEFLTETKDRSMLASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTH GWNS LES+ +GVPM+CWPFFA+QQ NC +C   W +G+EI 
Sbjct  365  PQEKVLSHPAIGGFLTHCGWNSILESLSSGVPMVCWPFFADQQMNCKFCCDEWDVGIEIG  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR EVE++V+ELMDGEKGK+M++KA+EW++LA+ +     GSS VN E + +K L+ 
Sbjct  425  GDVKREEVETVVRELMDGEKGKKMRQKAVEWRRLARGATEHKLGSSVVNFETVISKYLVG  484

Query  92   PK  87
             K
Sbjct  485  QK  486



>ref|XP_004303932.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ V+TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ E K+RG+LA WC
Sbjct  297  FGSVAVLTPKQLVEFGWGLANSKFPFFWVIRPDLVVGESAILPPEFVAEIKDRGLLAHWC  356

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQT+C +    WG+GMEI+
Sbjct  357  PQEQVLNHPSVGGFLTHSGWNSTIESLTAGVPMLCWPFFGDQQTDCHFSCKEWGVGMEIS  416

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LVKELM+GEKGK+MK KA+ WK+LAQ+ ATA  G+S  NL+ + N+VLL
Sbjct  417  NDVKRDEVEKLVKELMEGEKGKKMKNKALNWKELAQE-ATAPHGTSSRNLDTLVNQVLL  474



>ref|XP_002308831.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
 gb|EEE92354.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
Length=480

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSIT +T +QLVEF  GLA S   FLWIIRPD V+G+ A++PPEF EETKER  + SWC
Sbjct  302  FGSITTVTKEQLVEFGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTEETKERSFICSWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGW ST+ESI +GVPM+CWPFFA+QQTNC Y  + WGIGMEI+
Sbjct  362  PQEEVLNHPSIGGFLTHSGWGSTIESISSGVPMLCWPFFADQQTNCRYTCSEWGIGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR++VE LV+ELM+GEKGK MK+KAMEWKKLA++ A+  SGSS +NL+++  +VLLS
Sbjct  422  NNVKRDKVEKLVRELMEGEKGKSMKKKAMEWKKLAEE-ASGPSGSSSMNLDKLVKEVLLS  480



>ref|XP_011004479.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=479

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVEFA GLA+SK +FLWIIRPD V G+ A++P EF  ET++RG +ASWC
Sbjct  297  FGSITVMTAEQLVEFAMGLADSKISFLWIIRPDLVIGDSAILPAEFAVETQKRGFIASWC  356

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGWNST+ES+CAGVPMICWPFFA+Q  NC Y G+ WG+GMEI 
Sbjct  357  PQEEVLNHPSIGGFLTHSGWNSTVESLCAGVPMICWPFFADQAINCSYAGSEWGVGMEIG  416

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            N VKR+EVE  V+ELM+GEKG++M+ KAMEWKKLA+++A A  GSS +NL++  N++L S
Sbjct  417  NKVKRDEVEKRVRELMEGEKGEKMRGKAMEWKKLAEEAA-APHGSSSINLDKFINEILQS  475



>ref|XP_008804762.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWC
Sbjct  300  YGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  360  PQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  420  SNVKREEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 2/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+TP Q++EFAWGLANS   FLWIIRPD V GE +++P EF+ ETK+RGMLA+WC
Sbjct  293  FGSITVITPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWC  352

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++GGFL+H+GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+
Sbjct  353  PQELVLKHPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQID  412

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            NNVKR+EVE LV+ELM GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +  KVL
Sbjct  413  NNVKRDEVEKLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALV-KVL  468



>ref|XP_002268162.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=480

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GS+TVM+   L EFAWGLANS+ +FLWIIRPD V G+ AV+P EF EETK+RG+LASWC
Sbjct  300  YGSVTVMSDQHLKEFAWGLANSQYSFLWIIRPDVVMGDSAVLPEEFREETKDRGLLASWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+V  FLTHSGWNSTLE++CAGVP+ICWPFFAEQQTNC Y  T WGIGME+N
Sbjct  360  PQEQVLSHPSVAVFLTHSGWNSTLETVCAGVPVICWPFFAEQQTNCRYACTEWGIGMEVN  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            ++VKR+++E+LVKE+M+GEKGK+MK+ AMEWKK A++ AT   GSSY N +++  +VL
Sbjct  420  HDVKRHDIEALVKEMMEGEKGKQMKKTAMEWKKKAEE-ATGVGGSSYNNFDRLVKEVL  476



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            +GSITVMT +QL+EF WGLANSK  FLW+IRPD V G+ AV+P EFL ETKERG+LA+WC
Sbjct  299  YGSITVMTNEQLIEFTWGLANSKHDFLWVIRPDLVKGDTAVLPQEFLNETKERGLLANWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++G FLTHSGWNSTLESIC GVP+I WPFFAEQQTNC Y  T WGIGMEI+
Sbjct  359  PQEAVLSHPSIGVFLTHSGWNSTLESICGGVPVISWPFFAEQQTNCRYACTEWGIGMEID  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR +VE LV+ELM GEKGKEM+R+A+EWK+ A   AT   GSS+ N E++  + LL
Sbjct  419  NNVKRGDVERLVRELMVGEKGKEMRRRAVEWKESAT-RATQPGGSSFQNFERLVKEALL  476



>ref|XP_004155500.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=491

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGLANSKK+FLWI RPD + G+  ++P EF+ +TK+RG +ASWC
Sbjct  308  FGSITVMTKQQLIEFAWGLANSKKSFLWITRPDLIMGDSTILPHEFVTQTKDRGFIASWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTH+GWNST+ESICAGVPMICWPFF +QQTNC YC T WGIGMEI+
Sbjct  368  CQEQVLKHPSIGGFLTHNGWNSTIESICAGVPMICWPFFGDQQTNCCYCCTEWGIGMEID  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKRNEVE LV+ELMDGEKGK+MK   M WK  A++ A    G ++  L+++  +VLLS
Sbjct  428  NNVKRNEVEELVRELMDGEKGKKMKENVMNWKNKAEE-AYKLGGCAWKQLDKLIKEVLLS  486



>ref|XP_002530115.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF32259.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=483

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMT +QL+EF  GLANSK  FLWIIR D V GE A++PP+F +ETKER ++A WC
Sbjct  303  FGSVAVMTQEQLLEFGMGLANSKHPFLWIIRRDLVIGESAILPPDFFQETKERSLIAHWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFLTHSGW ST+ES+ AGVPM+CWPFFA+Q TNC Y    WG+GMEI+
Sbjct  363  PQEEVLNHPSIGGFLTHSGWGSTMESLSAGVPMLCWPFFADQPTNCRYSCNEWGVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            NNVKR+EVE LV+ELM+GEKGKEM+  AMEWKKLA++ ATA +GSS +NLE+  N+VLL
Sbjct  423  NNVKRDEVEKLVRELMEGEKGKEMRNNAMEWKKLAEE-ATAPNGSSSMNLEKFMNEVLL  480



>ref|XP_008378324.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=488

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+ LVEFAWGLANSK  F W+IRPD   GE A++ PEF+ ETKERG++ASWC
Sbjct  307  FGSIAVMTPEHLVEFAWGLANSKLPFFWVIRPDLXVGESAILSPEFVAETKERGLIASWC  366

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNS  ES+CAGVPM+CWPFFA+QQTN W     W IGMEI+
Sbjct  367  PQEQVLSHPSVGGFLTHSGWNSXXESLCAGVPMLCWPFFADQQTNTWCACNEWDIGMEIS  426

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR EV+ LV+ELM+GEKGK+MK K M+WKKLA++S T+ +GSS  NL+ + N VLL
Sbjct  427  NDVKRVEVQELVRELMEGEKGKKMKIKVMQWKKLAEES-TSPNGSSSTNLDNLVNNVLL  484



>gb|KCW66540.1| hypothetical protein EUGRSUZ_F00337 [Eucalyptus grandis]
Length=460

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VM+P QLVEFAWGLANS + FLW+IRPD + G  A++PP+FL  T+ER +LASWC
Sbjct  278  FGSIIVMSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWC  337

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH  WNST+ESI A VP+ CWPFF +QQTNC Y    WGIGMEI+
Sbjct  338  PQERVLSHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEID  397

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++V+R+EVE  V+ELM+GE+GKEMKRKAMEW++ A++ AT  SGSS++NLE + N+VLLS
Sbjct  398  SDVRRDEVERQVRELMEGERGKEMKRKAMEWQETARE-ATRPSGSSFLNLEGVINEVLLS  456

Query  92   PK  87
            P+
Sbjct  457  PR  458



>ref|XP_004305879.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP QL+EFAWGLANSK  FLW+IRPD ++GE A++PPEF+ ETKERG++ASWC
Sbjct  349  FGSVVVMTPQQLMEFAWGLANSKLPFLWVIRPDLIAGESAILPPEFVAETKERGLIASWC  408

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP VGGFLTHSGWNST+ESI AGVPM+CWP   +Q+ NC Y    WGIGMEI+
Sbjct  409  PQEQVLNHPTVGGFLTHSGWNSTMESISAGVPMLCWPLLGDQRINCRYTCYEWGIGMEIS  468

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR++V+ LV+ELM GEKGKE+K K M WKKLA+D A++  GSS++ L+ + N+VLL
Sbjct  469  NDVKRDKVKKLVEELMKGEKGKELKNKVMIWKKLAED-ASSPLGSSHIALDNLVNQVLL  526



>ref|XP_007224375.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
 gb|EMJ25574.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
Length=487

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAV-SGEEAVVPPEFLEETKERGMLASW  456
            FGS TVMT +QL EFAWGLANS K F W+IRPD V  G+  VV PEF+EETKERG+LASW
Sbjct  304  FGSSTVMTSEQLTEFAWGLANSNKAFFWVIRPDLVCEGKSVVVAPEFVEETKERGLLASW  363

Query  455  CPQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI  276
            CPQE+VL HPA+GGFLTH GWNST+ES+  GVPMICWPF A+QQTNC +C + WGIG+EI
Sbjct  364  CPQEQVLIHPAIGGFLTHCGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEI  423

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
              +VKR  +E LV+ELM+G +GK++++KA+EWKKLA+++ T ++GSS+++L+Q+ NKVLL
Sbjct  424  EGDVKRYYIEGLVRELMEGGEGKKLRKKALEWKKLAKEATTGSNGSSFLDLDQMVNKVLL  483

Query  95   SPK  87
            SP+
Sbjct  484  SPR  486



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+TP Q++EFAWGLANS   FLWIIRPD V GE +++P EF+ ETK+RGMLA+WC
Sbjct  322  FGSITVITPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWC  381

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE VL HP++GGFL+H+GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+
Sbjct  382  PQELVLKHPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQID  441

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +   +   
Sbjct  442  NNVKRDEVEKLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALVKVLACK  500

Query  92   PKC  84
              C
Sbjct  501  QTC  503



>ref|XP_009350671.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=489

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+ LVEFAWGLANSK  F W+IRPD V GE A++  EF+ ETK+RG++ASWC
Sbjct  307  FGSIAVMTPEHLVEFAWGLANSKLPFFWVIRPDLVVGESAILSAEFVAETKDRGLIASWC  366

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNS +ES+CAGVPM+CWPFFA+QQTN W     W IGMEI+
Sbjct  367  PQEQVLSHPSVGGFLTHSGWNSVVESLCAGVPMLCWPFFADQQTNTWCACNEWDIGMEIS  426

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR EVE LV+ELM+GEKGK+MK K M+WKKLA++S T+ +GSS  NL+ + N VLL
Sbjct  427  NDVKRVEVEKLVRELMEGEKGKKMKIKVMQWKKLAEES-TSPNGSSSTNLDNLVNNVLL  484



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VM+P QLVEFAWGLANS + FLW+IRPD + G  A++PP+FL  T+ER +LASWC
Sbjct  298  FGSIIVMSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWC  357

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL H AVGGFLTH  WNST+ESI A VP+ CWPFF +QQTNC Y    WGIGMEI+
Sbjct  358  PQERVLSHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEID  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++V+R+EVE  V+ELM+GE+GKEMKRKAMEW++ A++ AT  SGSS++NLE + N+VLLS
Sbjct  418  SDVRRDEVERQVRELMEGERGKEMKRKAMEWQETARE-ATRPSGSSFLNLEGVINEVLLS  476

Query  92   PK  87
            P+
Sbjct  477  PR  478



>ref|XP_008373154.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP+ ++EF WGLANS   FLWIIRPD V+GE A++PP+F+ +TKERGM+ SWC
Sbjct  301  FGSLAVMTPEHVIEFGWGLANSNHPFLWIIRPDLVAGETAILPPDFVADTKERGMIVSWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HP+VGGFLTHSGWNST+ES+ AGVPM+CWP F +QQTNC++    WG GMEI+
Sbjct  361  PQEKVLNHPSVGGFLTHSGWNSTIESLSAGVPMLCWPLFGDQQTNCYFTCNEWGSGMEID  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            + VKR+EVE LV+ELM+GEKGK+MK KA+EWKKLA++ AT   GSS  NL+ +  +VLL+
Sbjct  421  SKVKRDEVEKLVRELMEGEKGKKMKNKAIEWKKLAEE-ATGPHGSSSKNLDNLVKQVLLN  479



>ref|XP_008386104.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS TVMT +QLVEF+WGLANS KTFLWIIRP  V+G+ AVVPP FLEET+ RG LASWC
Sbjct  294  FGSTTVMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDTAVVPPLFLEETEGRGKLASWC  353

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC Y   HWGIG+EI 
Sbjct  354  PQEQVLTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACEHWGIGIEIE  413

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            + VKR+ +E LV+ LM+G++GKEM++ A+ WKK  ++  T+  GSS ++L+ + N+VL++
Sbjct  414  DEVKRDYIEGLVRRLMEGKEGKEMRKNALGWKKKIEE-VTSRKGSSVLDLDNLINQVLIA  472

Query  92   P  90
            P
Sbjct  473  P  473



>ref|XP_002323978.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
 gb|EEF04111.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
Length=482

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM P QL+EF+WGLANSKK FLWIIRPD V GE AV+PPEFLEET+ERG++ASWC
Sbjct  301  FGSITVMNPQQLLEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QEKVL H ++GGFL+H GWNST+ES+  GVPM+CWPFF+EQQTNC +    WG+GMEI 
Sbjct  361  AQEKVLKHSSIGGFLSHMGWNSTIESMSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            ++  R+EVE LV EL+DGEKGKEMKRKAMEWK  A+ + T  +GSS +N +++ N VL
Sbjct  421  SDANRDEVEKLVIELIDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>ref|XP_004154178.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
Length=260

 Score =   256 bits (654),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P+ LVEFAWGLANS+K FLWI+RPD V GE A++P EFL ETKERGML  WC
Sbjct  72   FGSITVMSPEHLVEFAWGLANSEKPFLWIVRPDLVEGETALLPAEFLAETKERGMLGDWC  131

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP+VGGFLTHSGWNST+ESI  GV MI WPFFAEQQTNC YC T WG G+EI+
Sbjct  132  NQEEVLKHPSVGGFLTHSGWNSTMESIAGGVAMISWPFFAEQQTNCRYCKTEWGNGLEID  191

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NV+R +VE LV+ELM+GEKG++MKR A EWK+ A++ A    GSS  NL+++ +++L S
Sbjct  192  SNVRREDVEKLVRELMEGEKGEDMKRNAEEWKRKAEE-ACKNGGSSLTNLDRVISEILSS  250



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 14/179 (8%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTPDQL EFAWGLANSK+ FLW+           V+P  FLEETKERGMLA+WC
Sbjct  308  FGSITVMTPDQLNEFAWGLANSKQPFLWV-----------VLPRGFLEETKERGMLANWC  356

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+
Sbjct  357  PQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEID  416

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKRN VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+++ ++VLL
Sbjct  417  SDVKRNGVETLVTKLMIGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKKLIDQVLL  472



>ref|XP_006416204.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
 gb|ESQ34557.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
Length=487

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+  QLVEFAWGLA + K FLW+IRPD V+G+ AVVP EFL ET +R MLASWC
Sbjct  299  FGSITVMSAKQLVEFAWGLAATGKDFLWVIRPDLVAGDVAVVPAEFLTETADRRMLASWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+G FLTHSGWNSTLES+C GVPM+CWP+FAEQQTNC +C   W +GMEI 
Sbjct  359  PQEKVLSHPAIGVFLTHSGWNSTLESLCGGVPMVCWPYFAEQQTNCKFCCDEWEVGMEIG  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR E+E +++ELMDGEKGK M+ KA EW++LA+ +     GSS +N + + +KVLL+
Sbjct  419  GDVKREEIEKVIRELMDGEKGKRMREKAEEWRRLAEKATAQKDGSSELNFQMVVDKVLLA  478

Query  92   PK  87
             K
Sbjct  479  SK  480



>ref|XP_008386293.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=911

 Score =   272 bits (696),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL EFAWGLANS  TFLW+IRPD V G+ +VVP EF  +TKER +LASWC
Sbjct  729  FGSITVMTAEQLTEFAWGLANSNMTFLWVIRPDLVGGDSSVVPAEFFVQTKERSLLASWC  788

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPA+GGFLTH GWNSTLES+C GVPMI WPFFAEQQTNC +C   WG+GMEI 
Sbjct  789  PQEQVLNHPAIGGFLTHCGWNSTLESLCGGVPMIIWPFFAEQQTNCRFCCKEWGVGMEIE  848

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
              VKR+ VE LV++LM+GE+GK M++KA+EWKKLA+++ T  +G S+++L++I N+VLLS
Sbjct  849  GEVKRDYVEGLVRKLMEGEEGKVMRKKALEWKKLAKEATTGPNGLSFLDLDKIINQVLLS  908

Query  92   PK  87
             +
Sbjct  909  RR  910



>ref|XP_008375649.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=490

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+ LVEF WGLANSK  F W+IRPD V G+ A++P EF++ETKER ++ASWC
Sbjct  305  FGSITVMTPEHLVEFGWGLANSKVPFFWVIRPDLVIGQSALLPREFVDETKERSLIASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+V GFLTHSGWNST ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVAGFLTHSGWNSTFESLTAGVPMLCWPFFGDQQMDCRYSCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELMDGEKGK+MK K M WKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVERLVRELMDGEKGKKMKNKVMVWKKLAEE-ATGPHGSSSKNLDTLVNQVLL  482



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF   T+ER +LASWC
Sbjct  303  FGSVTVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ +VL H A+GGFLTHSGWNST+ESI AGVP++CWPFFAEQQ NC Y    WGIGMEI+
Sbjct  363  PQVQVLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  105
             +VKR+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +K
Sbjct  423  GDVKRDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  477



>ref|XP_002893220.1| UDP-glucuronosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69479.1| UDP-glucuronosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FG ITVM+  QLVEFAWGLA S K FLW+IRPD V+GE  V+  EFL ET +RGML SWC
Sbjct  246  FGCITVMSAKQLVEFAWGLAASGKEFLWVIRPDLVAGETIVILSEFLTETADRGMLVSWC  305

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HP VGGFLTH GWNSTLESI  GVPMICWPFFAEQQTNC +C   WG+G+EI 
Sbjct  306  PQEKVLSHPMVGGFLTHCGWNSTLESIAGGVPMICWPFFAEQQTNCKFCCDEWGVGIEIG  365

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE++V+ELMDGEKGK+M+ KA+EW++LA ++     GSS++N E + +KVLL
Sbjct  366  GDVKREEVETVVRELMDGEKGKKMREKAVEWRRLANEATEHKHGSSFLNFETVVSKVLL  424



>emb|CDY62992.1| BnaC07g48400D [Brassica napus]
Length=488

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV +  QL EFA GLA S + FLW+IRPD V+GE AVVPPEFL ET++RGM+ASWC
Sbjct  304  FGSITVTSGKQLAEFALGLAGSGEEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPAVGGFLTH GWNS LES+C GVPMICWPFFAEQ TNC +C   WG+GMEI+
Sbjct  364  PQEKVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIS  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKR E+E++VKELMDGE G++M+ KA EW++LA+ +     GSS +N E + +KV+L 
Sbjct  424  ENVKREEIETVVKELMDGENGRKMREKAREWRRLAEKATENTYGSSVINFETVVSKVVLR  483

Query  92   PK  87
             +
Sbjct  484  QR  485



>ref|XP_010094135.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB55268.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=360

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL+EFAWGL+NSKK F+WIIRPD V+ +  ++PPEF+EET+ERG+LA WC
Sbjct  175  FGSITVMTRQQLIEFAWGLSNSKKPFVWIIRPDLVADDSGILPPEFVEETRERGVLAGWC  234

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE +L HP+VGGFLTH GWNST+ES+  GVP++CWPFFAEQQTNC +    W +GMEI+
Sbjct  235  PQETMLRHPSVGGFLTHCGWNSTIESLTTGVPIVCWPFFAEQQTNCRFSCGEWSVGMEID  294

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR +VE LV+ELMDGEKGKEM+R A+EWK+ A++ AT A GSS  N E++  +VLL
Sbjct  295  SDVKREKVEKLVRELMDGEKGKEMRRNALEWKRKAEE-ATEAGGSSLTNFEKLIEEVLL  352



>ref|XP_009350672.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+ LVEF WGLA SK  F W+IRPD V G+ A++P EF++ETKER ++ASWC
Sbjct  305  FGSITVMTPEHLVEFGWGLAKSKVPFFWVIRPDLVIGQSALLPLEFVDETKERSLIASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+V GFLTHSGWNSTLES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVAGFLTHSGWNSTLESLTAGVPMLCWPFFGDQQMDCRYSCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N+VKR+EVE LV+ELMDGEKGK+MK K M WKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  425  NDVKRDEVERLVRELMDGEKGKKMKNKVMAWKKLAEE-ATGPHGSSSKNLDMLVNQVLL  482



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP+QLVEFAWGLANS++TFLWIIRPD V G+ +++PPEF+EETK RGMLASWC
Sbjct  303  FGSITVMTPNQLVEFAWGLANSQQTFLWIIRPDIVLGDASILPPEFVEETKNRGMLASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HPA+GGFLTHSGWNSTLESI +G+PMICWPFFAEQQTNCW+  T W +GMEI+
Sbjct  363  SQEEVLSHPAIGGFLTHSGWNSTLESISSGLPMICWPFFAEQQTNCWFSVTKWDVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVESLV+ELM GEKGK+MK+KAME K+LA+ SA   SGSSY N+E++ N +LLS
Sbjct  423  SDVKRDEVESLVRELMVGEKGKKMKKKAMELKELAEASAIEHSGSSYENIEKVVNDILLS  482

Query  92   PK  87
             K
Sbjct  483  SK  484



>ref|XP_009145352.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X2 [Brassica 
rapa]
Length=434

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FG ITVM+ +QL EFAWGLA S K FLW+IRPD V+GE A VPPEF+ ET++RGM+ASWC
Sbjct  257  FGCITVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWC  316

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNC +C   WG+GMEI 
Sbjct  317  PQEKVLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIG  376

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
             +VKR EVE++++ELMDGEKGK+++ KA +W++LA+++    SGSS V+ E + NKVL
Sbjct  377  GDVKREEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  434



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMTP+QLVEFAWGLANSK+ FLWI+RPD VSG  A++P EFLEETKER M A WC
Sbjct  303  FGSIAVMTPEQLVEFAWGLANSKQNFLWILRPDLVSGNSAILPSEFLEETKERSMFAGWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HP+VGGFLTHSGWNST+ESI  GVPMICWPFFA+QQTNCW+C T WGIGMEI+
Sbjct  363  PQEKVLSHPSVGGFLTHSGWNSTIESISYGVPMICWPFFADQQTNCWFCCTKWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV ELM GEKGKEMK+KAM+WKKLA+ + T     S +NLE + ++VLL+
Sbjct  423  NNVKRDEVEGLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSNLNLENLIHQVLLN  478

Query  92   P  90
            P
Sbjct  479  P  479



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T  Q++EF+WGLANS K FLWIIRPD + GE A++PPEFL  TK+R +L SWC
Sbjct  301  FGSITVITAQQMIEFSWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWC  360

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGF+ H GWNSTLESIC GVPMICWPFF EQQTNCW+  T WGIGMEI 
Sbjct  361  PQEQVLKHPSIGGFVNHMGWNSTLESICGGVPMICWPFFGEQQTNCWFACTKWGIGMEIE  420

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR+EVE LV+ELM+GEKGK+MKRKAMEWK  A+++A     +S+ NL+++  KVL S
Sbjct  421  NNVKRDEVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWTGD-ASHRNLDRLV-KVLAS  478



>emb|CDO97427.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI V+TP+QLVEFAWGLANS K+FLWI+RPD V G+ A++PPEF EETKERGM+  WC
Sbjct  174  FGSIAVLTPEQLVEFAWGLANSNKSFLWILRPDLVVGDSAILPPEFAEETKERGMITGWC  233

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H + GGFLTHSGWNS LES+C GVP+ICWPFFA+Q  NC Y    WGIGMEI+
Sbjct  234  AQEQVLKHSSTGGFLTHSGWNSILESLCCGVPVICWPFFADQLINCRYSCQEWGIGMEID  293

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             NVKRNEVE +V+EL++G+KG+EMKRKA +W KL  + AT    SSY+N  ++  +V+LS
Sbjct  294  TNVKRNEVEKIVRELIEGDKGREMKRKATDW-KLKAEEATGLDSSSYLNFNRLVKEVILS  352



>ref|XP_009110142.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Brassica rapa]
Length=480

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+   LVEFAWGLA + K FLW+IRPD V G+ AVVPPEFL ET +R M+A+WC
Sbjct  299  FGSITVMSAKHLVEFAWGLAATGKDFLWVIRPDLVDGKLAVVPPEFLTETADRRMIATWC  358

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPA+GGFLTHSGWNSTLES+C GVPM+CWPFFAEQQTNC +C   W +GMEI 
Sbjct  359  PQEKVLSHPAIGGFLTHSGWNSTLESLCCGVPMVCWPFFAEQQTNCKFCRDEWEVGMEIG  418

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EV+++V+ELMDGEKGK+M+ KA +W+ LA+++     GSS +N E + +KVLL
Sbjct  419  GDVKREEVDAVVRELMDGEKGKKMREKAEKWRLLAEEATEPKRGSSELNFETVVDKVLL  477



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+  QLVEFAWGLA+++K FLW+IRPD V+G+ AVVP EFL+ET++R ML+SWC
Sbjct  300  FGSVTVMSAKQLVEFAWGLASTEKDFLWVIRPDLVAGDVAVVPTEFLKETEDRRMLSSWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQ+KVL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNC +C   W +GMEI 
Sbjct  360  PQQKVLSHPAIGGFLTHNGWNSTLESISSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIG  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
             +VKR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS  N + + +KVLL 
Sbjct  420  GDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAENATEHMRGSSGSNFQMVVDKVLLG  479

Query  92   PK  87
             K
Sbjct  480  YK  481



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWC
Sbjct  308  FGSITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWC  367

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI 
Sbjct  368  PQEEVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIG  427

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  428  GDVRREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  485



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWC
Sbjct  305  FGSITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI 
Sbjct  365  PQEEVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIG  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  425  GDVRREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  482



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV+T  QL EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC
Sbjct  303  FGSITVITAGQLTEFAWGLANSQKPFLWIIRPDLVATESAVLPPEFVEEIAGRGMLAHWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL H A+GGFLTHSGWNSTLES+C GVP+ICWPFF +QQTNC Y  T WGIGMEI+
Sbjct  363  RQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFGDQQTNCRYSCTEWGIGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A    G+SY N+E++ ++VL
Sbjct  423  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPGGTSYNNVEKLISEVL  479



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWC
Sbjct  304  FGSITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI 
Sbjct  364  PQEEVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIG  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  424  GDVRREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  481



>ref|XP_004155440.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A2-like 
[Cucumis sativus]
Length=488

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMTP QL+EFAWGLA+S KTFLWI RPD ++G+ A++P EF+ +TK+R ++ASWC
Sbjct  303  FGSITVMTPQQLIEFAWGLADSGKTFLWITRPDLIAGDSAILPHEFVTQTKDRSLIASWC  362

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++GGFLTHSGWNST+ESICAGVPMICWPFFAEQQTNC+YC   W +GMEI+
Sbjct  363  CQEQVLKHPSIGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCYYCCNVWEVGMEID  422

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKRNEVE LV+ELMDGEKG++MK   M  K   ++ A    G ++  L+++ ++VLLS
Sbjct  423  NNVKRNEVEELVRELMDGEKGRKMKENVMSLKSKGEE-AYKLGGCAWKQLDKVIDEVLLS  481

Query  92   PK  87
             K
Sbjct  482  NK  483



>ref|XP_007042950.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98781.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=496

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ V++P QLVEFAWGLANSKK FLWI+RPD V+GE A++PPEF+ ETK+RGMLASWC
Sbjct  304  FGSVAVLSPQQLVEFAWGLANSKKQFLWIMRPDLVAGEAAILPPEFVSETKDRGMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGFL+H GWNST+ESI AGVPM+C P  A+QQTNC    T WGIGMEI+
Sbjct  364  PQEQVLKHPSIGGFLSHMGWNSTIESISAGVPMLCLPVLADQQTNCRLACTEWGIGMEID  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            NNVKR++VE LV+ELM+G+KG EMK  A+EWKK A + A+   G S+ NL+++ N VLLS
Sbjct  424  NNVKRDQVEMLVRELMEGDKGVEMKANALEWKKKAAE-ASRPGGGSFENLDKLLNHVLLS  482

Query  92   PK  87
             K
Sbjct  483  DK  484



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+P QL E AWGLANS + FLW+IRPD V G  A++PP+FL  T++R +L SWC
Sbjct  317  FGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQRSLLVSWC  376

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH GW ST+ESI AGVP++CWPFF EQQ NCWY    WGIG+EI+
Sbjct  377  PQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEWGIGLEID  436

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            ++VKR+EVE  V+ELM+GE+GK MKRK MEW+++A+++A   SGSS  NL+++ +KVLLS
Sbjct  437  DDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEVIDKVLLS  495

Query  92   PK  87
            P+
Sbjct  496  PR  497



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVM+   LVEFAWGLA +KK FLW+IRPD V G+ A+VPPEFL ET +R MLASWC
Sbjct  304  FGSITVMSAKHLVEFAWGLAATKKDFLWVIRPDLVVGDVAMVPPEFLIETADRRMLASWC  363

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQEKVL HPAVGGFLTHSGWNSTLES+  GVPM+CWPFFAEQQTNC YC   W +GMEI+
Sbjct  364  PQEKVLSHPAVGGFLTHSGWNSTLESLSCGVPMLCWPFFAEQQTNCKYCCDEWEVGMEIS  423

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +V+R EVE L++ELMDG+KGK+M+ KA EW++LA+++     GSS  + E +  KVLL
Sbjct  424  GDVRREEVEELIRELMDGDKGKKMREKAEEWRRLAEEATKHMCGSSERSFEMVVGKVLL  482



>ref|XP_007215295.1| hypothetical protein PRUPE_ppa004989mg [Prunus persica]
 gb|EMJ16494.1| hypothetical protein PRUPE_ppa004989mg [Prunus persica]
Length=482

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+ VMTP+QLVEF WGLANSK  FLW+IRPD V G+ A++P EF++ETKERG++ASWC
Sbjct  302  FGSVVVMTPEQLVEFGWGLANSKHFFLWVIRPDLVVGDSAILPAEFVDETKERGLIASWC  361

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWNST+ES+ AGVPMICWPF +EQ TNCWY     G GMEI+
Sbjct  362  PQEQVLNHPSVGGFLTHSGWNSTIESLSAGVPMICWPFVSEQLTNCWYTCNELGCGMEID  421

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  93
            +NVKR+EVE LV+EL++GEKG++M+  A  WKKLA++ AT A GSS +NL+ + N V L 
Sbjct  422  SNVKRDEVEKLVRELIEGEKGEKMRNTADGWKKLAEE-ATGAQGSSVINLDNLVNHVELV  480

Query  92   PK  87
             K
Sbjct  481  SK  482



>gb|AAR06913.1| UDP-glycosyltransferase 85A8 [Stevia rebaudiana]
Length=479

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 145/179 (81%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QL+EF WGLANSKK FLWI RPD V G EA++P EF+EETKERGM+ SWC
Sbjct  300  FGSITVMTKEQLIEFGWGLANSKKDFLWITRPDIVGGNEAMIPAEFIEETKERGMVTSWC  359

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
             QE+VL HP++G FLTHSGWNST+ESI  GVPMICWPFFAEQQTNC YC   W IG+EI+
Sbjct  360  SQEEVLKHPSIGVFLTHSGWNSTIESISNGVPMICWPFFAEQQTNCRYCCVEWEIGLEID  419

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
             +VKR EVE+ V+E+MDG KGK MK KA+EWKK A++ A +  GSSY+N E++   VLL
Sbjct  420  TDVKREEVEAQVREMMDGSKGKMMKNKALEWKKKAEE-AVSIGGSSYLNFEKLVTDVLL  477



>ref|XP_009377942.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=473

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT +QLVE+ WGLAN+K TF W+IRPD + GE A++PP+F++ETK R ++A WC
Sbjct  293  FGSITVMTLEQLVEYGWGLANTKLTFFWVIRPDLIIGESAILPPKFVDETKGRSLIAGWC  352

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTHSGWN T+ES+ AGVPM+CWPFFA+QQTNC Y    WGIGMEI+
Sbjct  353  PQEQVLNHPSVGGFLTHSGWNLTIESVSAGVPMLCWPFFADQQTNCHYSCKEWGIGMEID  412

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            N VKR+E+E LV+ELM+GEKGK+MK KA+EWK LA++ AT   GSS  NLE++ N++ L
Sbjct  413  NKVKRDELEKLVRELMEGEKGKKMKNKAIEWKTLAEE-ATGPHGSSSTNLEKLVNQMQL  470



>dbj|BAG80552.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=490

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGS+TVM+ +QL+EFAWGLAN K  FLWI R D V G+ A++P EFL ETKERG+L  WC
Sbjct  307  FGSVTVMSNEQLIEFAWGLANIKMNFLWITRSDLVMGDSAILPHEFLAETKERGLLGGWC  366

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP++GGF+TH GWNSTLESI  GVPM+CWPFFA+QQTNCW+    WG+GMEI+
Sbjct  367  PQEQVLSHPSIGGFITHCGWNSTLESISFGVPMLCWPFFADQQTNCWFICNRWGVGMEID  426

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            +NVKR  +E LV+ELM GEKGKEMK  A++WKKLA+++ T+++GSSY+N E++ + VLL
Sbjct  427  SNVKREVIEKLVRELMIGEKGKEMKENALKWKKLAEETITSSNGSSYMNFEKLVSHVLL  485



>ref|XP_004303933.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSI VMT  QL+EFAWGLAN+K  F W+IRPD V+GE A++PPEF+ ETKERG++ASWC
Sbjct  305  FGSIMVMTSKQLIEFAWGLANTKLPFFWVIRPDLVAGESAILPPEFVAETKERGLIASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEI-  276
            PQE+VL HPAVGGFLTHSGWNS +ES+ AGVPMICWPFF++QQTN W     WGIG+EI 
Sbjct  365  PQEQVLNHPAVGGFLTHSGWNSVIESVNAGVPMICWPFFSDQQTNTWSACNKWGIGVEIM  424

Query  275  NNNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            +N+VKR+E+E LVKE+M+GEKGK+++ KAMEWKKLA++ AT   GSS  NL+ + N++L
Sbjct  425  SNDVKRDEIEKLVKEVMEGEKGKKLRNKAMEWKKLAEE-ATGPHGSSATNLDNLVNQLL  482



>ref|XP_008378325.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=487

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITV TP+ LVEF WGLANSK  F W+IRPD V G+ A++PPEFL ETKER ++ASWC
Sbjct  305  FGSITVTTPEHLVEFGWGLANSKVPFFWVIRPDLVIGQSALLPPEFLAETKERSLIASWC  364

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HP+VGGFLTH+GWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+
Sbjct  365  PQEQVLNHPSVGGFLTHNGWNSTMESLTAGVPMLCWPFFGDQQMDCRYSCNEWGIGMEIS  424

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  99
            N+VKR+EVE LVKELM+GEKGK+MK K M WKKLA++ AT   GSS  NL  + N+VL
Sbjct  425  NDVKRDEVEKLVKELMEGEKGKKMKNKVMMWKKLAEE-ATEPHGSSSKNLNMLVNQVL  481



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  632  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  453
            FGSITVMT  QL EFAWGL NS +TFLWIIRPD VSG+ A++PPEF+ ETKERG+LA WC
Sbjct  298  FGSITVMTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAGWC  357

Query  452  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  273
            PQE+VL HPAVGGFLTH+GWNST+ES+ AGVPMICWPFFAEQQTNC YC T WGIGMEI+
Sbjct  358  PQEQVLSHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEID  417

Query  272  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  96
            ++VKR+E+E LVKELM+GEKGKE+K+KA+EWK LA+++     GSS+ NL+++  + LL
Sbjct  418  SDVKRDEIERLVKELMEGEKGKELKKKALEWKTLAEEATRGPKGSSFSNLDKMITQALL  476



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 864235928496