BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24575_g2_i1 len=1620 path=[7763:0-1093 1350:1094-1131
8894:1132-1619]

Length=1620
                                                                      Score     E

ref|XP_009631968.1|  PREDICTED: uncharacterized protein LOC104121...    355   2e-111   
ref|XP_009768785.1|  PREDICTED: uncharacterized protein LOC104219...    354   1e-110   
ref|XP_009631973.1|  PREDICTED: uncharacterized protein LOC104121...    352   7e-110   
ref|XP_006344983.1|  PREDICTED: uncharacterized protein LOC102601...    352   7e-110   
ref|XP_009768805.1|  PREDICTED: uncharacterized protein LOC104219...    350   3e-109   
ref|XP_009595854.1|  PREDICTED: uncharacterized protein LOC104092070    350   4e-109   
ref|XP_006344985.1|  PREDICTED: uncharacterized protein LOC102601...    348   1e-108   
ref|XP_009784004.1|  PREDICTED: uncharacterized protein LOC104232478    348   2e-108   
gb|AHX26274.1|  Rac5-interacting sub-apical pollen tube protein         347   3e-108   
ref|XP_010318953.1|  PREDICTED: uncharacterized protein LOC101263...    344   5e-107   
emb|CDP14909.1|  unnamed protein product                                342   6e-106   
ref|XP_010318954.1|  PREDICTED: uncharacterized protein LOC101263...    341   1e-105   
ref|XP_009616413.1|  PREDICTED: uncharacterized protein LOC104108954    341   1e-105   
gb|EYU42505.1|  hypothetical protein MIMGU_mgv1a003405mg                340   2e-105   
ref|XP_009789178.1|  PREDICTED: uncharacterized protein LOC104236857    340   4e-105   
ref|XP_011071775.1|  PREDICTED: uncharacterized protein LOC105157...    330   1e-101   
ref|XP_011071774.1|  PREDICTED: uncharacterized protein LOC105157...    330   2e-101   
ref|XP_006354808.1|  PREDICTED: uncharacterized protein LOC102594354    323   1e-98    
ref|XP_004241555.1|  PREDICTED: uncharacterized protein LOC101246638    322   3e-98    
ref|XP_006339978.1|  PREDICTED: uncharacterized protein LOC102605...    303   3e-92    
ref|XP_006339979.1|  PREDICTED: uncharacterized protein LOC102605...    303   3e-92    
ref|XP_011042659.1|  PREDICTED: uncharacterized protein LOC105138308    304   9e-92    
ref|XP_010314142.1|  PREDICTED: uncharacterized protein LOC101260615    299   1e-90    
ref|XP_002318621.1|  hypothetical protein POPTR_0012s07520g             301   2e-90    Populus trichocarpa [western balsam poplar]
gb|KDO69844.1|  hypothetical protein CISIN_1g037589mg                   298   5e-90    
ref|XP_006439710.1|  hypothetical protein CICLE_v10024191mg             298   6e-90    
ref|XP_006477536.1|  PREDICTED: uncharacterized protein LOC102627363    297   1e-89    
ref|XP_002511483.1|  hypothetical protein RCOM_1512920                  296   2e-88    Ricinus communis
ref|XP_004489974.1|  PREDICTED: uncharacterized protein LOC101494328    288   2e-86    
emb|CAN74948.1|  hypothetical protein VITISV_000263                     286   2e-84    Vitis vinifera
ref|XP_002266065.1|  PREDICTED: uncharacterized protein LOC100251925    285   4e-84    Vitis vinifera
ref|XP_010533436.1|  PREDICTED: uncharacterized protein LOC104809233    283   1e-83    
ref|XP_010028475.1|  PREDICTED: uncharacterized protein LOC104418736    280   1e-83    
gb|EPS58435.1|  hypothetical protein M569_16379                         281   2e-83    
ref|XP_006578598.1|  PREDICTED: intracellular protein transport p...    281   5e-83    
gb|KHN19356.1|  hypothetical protein glysoja_012276                     279   4e-82    
gb|KEH16489.1|  zein-binding protein                                    277   4e-82    
ref|XP_006581945.1|  PREDICTED: uncharacterized protein LOC100793806    278   9e-82    
emb|CBI15308.3|  unnamed protein product                                276   5e-81    
ref|XP_010087740.1|  hypothetical protein L484_008937                   275   8e-81    
ref|XP_008393130.1|  PREDICTED: uncharacterized protein LOC103455326    275   3e-80    
ref|XP_008239683.1|  PREDICTED: uncharacterized protein LOC103338...    270   2e-78    
ref|XP_008374499.1|  PREDICTED: uncharacterized protein LOC103437776    269   2e-78    
ref|XP_008239682.1|  PREDICTED: uncharacterized protein LOC103338...    269   2e-78    
ref|XP_007138138.1|  hypothetical protein PHAVU_009G183400g             268   3e-78    
ref|XP_007210877.1|  hypothetical protein PRUPE_ppa003082mg             269   4e-78    
gb|EYU24446.1|  hypothetical protein MIMGU_mgv1a003615mg                267   9e-78    
ref|XP_008437815.1|  PREDICTED: uncharacterized protein LOC103483...    267   1e-77    
ref|XP_004301292.1|  PREDICTED: uncharacterized protein LOC101306928    269   1e-77    
ref|XP_008437805.1|  PREDICTED: uncharacterized protein LOC103483...    267   1e-77    
ref|XP_008437788.1|  PREDICTED: uncharacterized protein LOC103483...    268   2e-77    
ref|XP_010428475.1|  PREDICTED: uncharacterized protein LOC104713121    265   3e-77    
ref|XP_009369392.1|  PREDICTED: uncharacterized protein LOC103958796    263   3e-76    
ref|XP_004152544.1|  PREDICTED: uncharacterized protein LOC101220477    262   9e-76    
ref|XP_010471574.1|  PREDICTED: uncharacterized protein LOC104751351    260   2e-75    
ref|NP_173333.1|  uncharacterized protein                               259   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157842.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    259   9e-75    
gb|KGN64272.1|  hypothetical protein Csa_1G045700                       260   1e-74    
ref|XP_010471575.1|  PREDICTED: uncharacterized protein LOC104751352    255   6e-74    
ref|XP_002322137.1|  hypothetical protein POPTR_0015s07970g             251   6e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006416545.1|  hypothetical protein EUTSA_v10007355mg             253   6e-73    
ref|XP_006390385.1|  hypothetical protein EUTSA_v10019533mg             253   1e-72    
ref|XP_011028725.1|  PREDICTED: uncharacterized protein LOC105128660    250   2e-72    
ref|XP_007099756.1|  Uncharacterized protein TCM_045761                 253   1e-71    
ref|XP_002888993.1|  hypothetical protein ARALYDRAFT_316417             249   3e-71    
gb|AAD55293.1|AC008263_24  F25A4.20                                     248   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|NP_177621.2|  uncharacterized protein                               248   4e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301094.1|  hypothetical protein CARUB_v10021488mg             247   1e-70    
dbj|BAC42795.1|  unknown protein                                        246   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416341.1|  PREDICTED: uncharacterized protein LOC104702212    246   3e-70    
ref|XP_002893026.1|  hypothetical protein ARALYDRAFT_472122             244   2e-69    
ref|XP_010477102.1|  PREDICTED: uncharacterized protein LOC104756242    241   2e-68    
ref|XP_010459554.1|  PREDICTED: uncharacterized protein LOC104740600    240   3e-68    
ref|XP_004508804.1|  PREDICTED: uncharacterized protein LOC101500585    239   5e-68    
emb|CDY19266.1|  BnaC05g14670D                                          239   8e-68    
ref|XP_010498305.1|  PREDICTED: uncharacterized protein LOC104776015    237   4e-67    
emb|CDX73116.1|  BnaC06g35640D                                          238   5e-67    
gb|KFK41919.1|  hypothetical protein AALP_AA2G189100                    240   9e-67    
emb|CDY26705.1|  BnaA06g13170D                                          235   2e-66    
gb|KFK44044.1|  hypothetical protein AALP_AA1G208200                    235   2e-66    
ref|XP_006306072.1|  hypothetical protein CARUB_v10011395mg             235   2e-66    
ref|XP_009149381.1|  PREDICTED: uncharacterized protein LOC103872703    234   6e-66    
ref|XP_009106137.1|  PREDICTED: uncharacterized protein LOC103831941    234   2e-65    
emb|CDY45396.1|  BnaA07g31760D                                          233   3e-65    
ref|XP_003622396.1|  hypothetical protein MTR_7g036980                  229   4e-64    
ref|XP_009117572.1|  PREDICTED: uncharacterized protein LOC103842670    228   1e-63    
emb|CDX68162.1|  BnaA07g22020D                                          224   2e-62    
emb|CDX81908.1|  BnaC08g36930D                                          223   6e-62    
ref|XP_010272236.1|  PREDICTED: uncharacterized protein LOC104608071    223   2e-61    
ref|XP_009104742.1|  PREDICTED: uncharacterized protein LOC103830682    220   5e-61    
emb|CDX85859.1|  BnaC06g22750D                                          220   5e-61    
ref|XP_010264937.1|  PREDICTED: uncharacterized protein LOC104602809    209   1e-55    
ref|XP_010678645.1|  PREDICTED: uncharacterized protein LOC104894167    147   7e-35    
ref|XP_006843144.1|  hypothetical protein AMTR_s00146p00025270          137   7e-31    
ref|XP_008351834.1|  PREDICTED: uncharacterized protein LOC103415268    123   2e-27    
ref|XP_010670133.1|  PREDICTED: uncharacterized protein LOC104887...    117   2e-24    
ref|XP_010670134.1|  PREDICTED: uncharacterized protein LOC104887...    116   4e-24    
ref|XP_006828397.1|  hypothetical protein AMTR_s00060p00048940          107   8e-21    
ref|XP_003616291.1|  hypothetical protein MTR_5g078300                  106   1e-20    
gb|ABM68547.1|  IFA binding protein                                     105   3e-20    Lilium longiflorum [Easter lily]
ref|XP_010675058.1|  PREDICTED: uncharacterized protein LOC104891107    104   3e-20    
ref|XP_008788172.1|  PREDICTED: uncharacterized protein LOC103706017    103   1e-19    
gb|KDP31175.1|  hypothetical protein JCGZ_11551                       97.4    6e-19    
ref|XP_010043260.1|  PREDICTED: uncharacterized protein LOC104432...    100   8e-19    
ref|XP_011007254.1|  PREDICTED: uncharacterized protein LOC105112992  99.4    2e-18    
gb|KDO41531.1|  hypothetical protein CISIN_1g001327mg                 99.0    3e-18    
ref|XP_006423971.1|  hypothetical protein CICLE_v10027718mg           98.6    4e-18    
ref|XP_010278089.1|  PREDICTED: uncharacterized protein LOC104612396  97.8    7e-18    
ref|XP_009386128.1|  PREDICTED: uncharacterized protein LOC103973323  97.4    7e-18    
ref|XP_007032995.1|  Uncharacterized protein TCM_019131               97.4    8e-18    
ref|XP_006838814.1|  hypothetical protein AMTR_s00002p00262300        96.3    1e-17    
ref|XP_002521947.1|  hypothetical protein RCOM_0607680                96.7    2e-17    Ricinus communis
ref|XP_006487767.1|  PREDICTED: putative leucine-rich repeat-cont...  96.7    2e-17    
ref|XP_010265637.1|  PREDICTED: uncharacterized protein LOC104603303  96.7    2e-17    
emb|CBI35190.3|  unnamed protein product                              95.9    2e-17    
ref|XP_004236946.1|  PREDICTED: cingulin isoform X1                   96.3    2e-17    
ref|XP_010319389.1|  PREDICTED: cingulin isoform X2                   96.3    2e-17    
ref|XP_010660132.1|  PREDICTED: uncharacterized protein LOC100258...  95.9    2e-17    
ref|XP_011038542.1|  PREDICTED: myosin-9-like                         95.9    3e-17    
ref|XP_002263011.2|  PREDICTED: uncharacterized protein LOC100258...  95.5    3e-17    Vitis vinifera
ref|XP_010032708.1|  PREDICTED: uncharacterized protein LOC104422...  95.5    4e-17    
ref|XP_010032706.1|  PREDICTED: uncharacterized protein LOC104422...  95.1    4e-17    
ref|XP_002319088.1|  hypothetical protein POPTR_0013s04060g           95.1    5e-17    Populus trichocarpa [western balsam poplar]
ref|XP_006355075.1|  PREDICTED: calponin homology domain-containi...  94.7    6e-17    
ref|XP_006355076.1|  PREDICTED: calponin homology domain-containi...  94.7    6e-17    
ref|XP_010274148.1|  PREDICTED: uncharacterized protein LOC104609...  94.7    6e-17    
gb|KHG18859.1|  Eukaryotic translation initiation factor 3 subunit E  94.4    7e-17    
ref|XP_009790074.1|  PREDICTED: uncharacterized protein LOC104237...  94.0    1e-16    
ref|XP_004247345.1|  PREDICTED: uncharacterized protein LOC101245695  94.0    1e-16    
ref|XP_009630715.1|  PREDICTED: uncharacterized protein LOC104120...  93.6    1e-16    
ref|XP_009630718.1|  PREDICTED: uncharacterized protein LOC104120...  93.6    1e-16    
ref|XP_009790072.1|  PREDICTED: uncharacterized protein LOC104237...  93.6    1e-16    
ref|XP_009790073.1|  PREDICTED: uncharacterized protein LOC104237...  93.6    1e-16    
ref|XP_006587251.1|  PREDICTED: uncharacterized protein LOC100794...  93.2    2e-16    
ref|XP_003533115.1|  PREDICTED: uncharacterized protein LOC100794...  93.2    2e-16    
gb|KDP23688.1|  hypothetical protein JCGZ_23521                       93.2    2e-16    
ref|XP_010043265.1|  PREDICTED: uncharacterized protein LOC104432...  92.8    2e-16    
ref|XP_008218509.1|  PREDICTED: uncharacterized protein LOC103318854  92.8    2e-16    
ref|XP_006482093.1|  PREDICTED: intracellular protein transport p...  92.8    2e-16    
ref|XP_010531814.1|  PREDICTED: uncharacterized protein LOC104808028  92.8    2e-16    
gb|KDO50780.1|  hypothetical protein CISIN_1g002237mg                 92.8    2e-16    
ref|XP_010274744.1|  PREDICTED: golgin subfamily A member 4           92.8    3e-16    
ref|XP_010528817.1|  PREDICTED: uncharacterized protein LOC104805830  92.8    3e-16    
ref|XP_006351687.1|  PREDICTED: intracellular protein transport p...  92.8    3e-16    
ref|XP_007208094.1|  hypothetical protein PRUPE_ppa001296mg           92.4    3e-16    
ref|XP_009404792.1|  PREDICTED: uncharacterized protein LOC103988...  92.4    3e-16    
ref|XP_009404794.1|  PREDICTED: uncharacterized protein LOC103988...  92.4    4e-16    
ref|XP_006347726.1|  PREDICTED: intracellular protein transport p...  92.0    4e-16    
ref|XP_006347724.1|  PREDICTED: intracellular protein transport p...  92.0    4e-16    
ref|XP_010327558.1|  PREDICTED: uncharacterized protein LOC101255...  92.0    4e-16    
ref|XP_004230077.1|  PREDICTED: uncharacterized protein LOC101255...  92.0    4e-16    
ref|XP_006430570.1|  hypothetical protein CICLE_v10011001mg           92.0    4e-16    
ref|XP_010102267.1|  hypothetical protein L484_024549                 92.0    4e-16    
ref|XP_011087390.1|  PREDICTED: uncharacterized protein LOC105168894  91.7    5e-16    
ref|XP_007030504.1|  Intracellular protein transport protein USO1...  91.7    5e-16    
ref|XP_009397014.1|  PREDICTED: uncharacterized protein LOC103981960  91.7    6e-16    
ref|XP_006469212.1|  PREDICTED: myosin-2 heavy chain, non muscle-...  91.7    6e-16    
ref|XP_008388693.1|  PREDICTED: LOW QUALITY PROTEIN: probable GPI...  91.3    7e-16    
gb|KDO64582.1|  hypothetical protein CISIN_1g001651mg                 91.7    7e-16    
ref|XP_009364471.1|  PREDICTED: uncharacterized protein LOC103954380  90.9    9e-16    
ref|XP_004302068.1|  PREDICTED: uncharacterized protein LOC101309555  90.9    9e-16    
ref|XP_006383693.1|  hypothetical protein POPTR_0005s24190g           90.9    1e-15    
ref|XP_006448212.1|  hypothetical protein CICLE_v10014119mg           90.5    1e-15    
gb|KDO68502.1|  hypothetical protein CISIN_1g002931mg                 90.1    2e-15    
ref|XP_006443890.1|  hypothetical protein CICLE_v10018827mg           90.1    2e-15    
ref|XP_002531180.1|  hypothetical protein RCOM_0012650                89.4    2e-15    Ricinus communis
gb|KDO68503.1|  hypothetical protein CISIN_1g002931mg                 90.1    2e-15    
emb|CDP03712.1|  unnamed protein product                              89.7    2e-15    
ref|XP_010932511.1|  PREDICTED: uncharacterized protein LOC105053151  89.7    2e-15    
ref|XP_004172706.1|  PREDICTED: uncharacterized protein LOC101230686  89.7    2e-15    
ref|XP_010232416.1|  PREDICTED: uncharacterized protein LOC100821...  89.4    3e-15    
ref|XP_004150123.1|  PREDICTED: uncharacterized protein LOC101220314  89.7    3e-15    
ref|XP_003569935.1|  PREDICTED: uncharacterized protein LOC100821...  89.4    3e-15    
ref|XP_010232415.1|  PREDICTED: uncharacterized protein LOC100821...  89.4    3e-15    
gb|KHG12682.1|  Golgin subfamily A member 5                           89.0    3e-15    
ref|XP_009408477.1|  PREDICTED: uncharacterized protein LOC103990...  89.0    4e-15    
ref|XP_009408476.1|  PREDICTED: uncharacterized protein LOC103990...  89.0    4e-15    
ref|XP_009391340.1|  PREDICTED: uncharacterized protein LOC103977516  88.6    4e-15    
ref|XP_007141904.1|  hypothetical protein PHAVU_008G235700g           89.0    5e-15    
ref|XP_008370719.1|  PREDICTED: uncharacterized protein LOC103434...  88.6    5e-15    
ref|XP_008370720.1|  PREDICTED: uncharacterized protein LOC103434...  88.6    5e-15    
ref|XP_011026020.1|  PREDICTED: uncharacterized protein LOC105126...  88.6    5e-15    
ref|XP_011026023.1|  PREDICTED: uncharacterized protein LOC105126...  88.6    5e-15    
ref|XP_007141905.1|  hypothetical protein PHAVU_008G235700g           88.6    5e-15    
ref|XP_004972196.1|  PREDICTED: uncharacterized protein LOC101782733  88.6    5e-15    
ref|XP_009372159.1|  PREDICTED: uncharacterized protein LOC103961...  88.2    6e-15    
gb|KHN31479.1|  hypothetical protein glysoja_035586                   88.6    6e-15    
ref|XP_009372158.1|  PREDICTED: uncharacterized protein LOC103961...  88.2    6e-15    
ref|XP_004139387.1|  PREDICTED: uncharacterized protein LOC101220667  88.2    6e-15    
ref|XP_006370993.1|  hypothetical protein POPTR_0019s02440g           88.2    7e-15    
ref|XP_010679046.1|  PREDICTED: trichohyalin                          88.2    7e-15    
ref|XP_010458143.1|  PREDICTED: uncharacterized protein LOC104739474  88.2    7e-15    
ref|XP_010420374.1|  PREDICTED: caldesmon-like                        87.8    7e-15    
ref|XP_008781005.1|  PREDICTED: uncharacterized protein LOC103700...  88.2    8e-15    
ref|XP_008780997.1|  PREDICTED: uncharacterized protein LOC103700...  88.2    8e-15    
ref|XP_006644792.1|  PREDICTED: uncharacterized protein LOC102717474  87.8    8e-15    
ref|XP_002468151.1|  hypothetical protein SORBIDRAFT_01g040510        87.8    8e-15    Sorghum bicolor [broomcorn]
ref|XP_004490812.1|  PREDICTED: cingulin-like isoform X1              87.8    8e-15    
gb|KEH42589.1|  zein-binding protein                                  87.8    8e-15    
ref|XP_010926157.1|  PREDICTED: enolase-phosphatase E1-like           87.8    8e-15    
ref|XP_008456276.1|  PREDICTED: uncharacterized protein LOC103496267  87.0    1e-14    
ref|XP_008467120.1|  PREDICTED: protein SGM1 isoform X2               87.0    1e-14    
ref|XP_008467119.1|  PREDICTED: intracellular protein transport p...  87.0    1e-14    
ref|XP_009791148.1|  PREDICTED: uncharacterized protein LOC104238...  87.0    1e-14    
ref|XP_010916145.1|  PREDICTED: uncharacterized protein LOC105041051  87.0    2e-14    
ref|XP_009791149.1|  PREDICTED: myosin-4 isoform X2                   87.0    2e-14    
ref|XP_004984946.1|  PREDICTED: nuclear autoantigenic sperm prote...  87.0    2e-14    
ref|XP_007147191.1|  hypothetical protein PHAVU_006G103500g           87.0    2e-14    
gb|EYU45803.1|  hypothetical protein MIMGU_mgv1a018076mg              86.3    2e-14    
ref|XP_004984945.1|  PREDICTED: nuclear autoantigenic sperm prote...  87.0    2e-14    
ref|XP_004984944.1|  PREDICTED: nuclear autoantigenic sperm prote...  87.0    2e-14    
emb|CDX69426.1|  BnaA10g17750D                                        86.7    2e-14    
gb|EYU30090.1|  hypothetical protein MIMGU_mgv1a001097mg              86.7    2e-14    
ref|XP_004984947.1|  PREDICTED: nuclear autoantigenic sperm prote...  86.7    2e-14    
ref|XP_008813559.1|  PREDICTED: uncharacterized protein LOC103724165  86.7    2e-14    
gb|EEC71569.1|  hypothetical protein OsI_03934                        86.3    2e-14    Oryza sativa Indica Group [Indian rice]
ref|XP_010274150.1|  PREDICTED: uncharacterized protein LOC104609...  86.3    3e-14    
ref|XP_010489401.1|  PREDICTED: uncharacterized protein LOC104767...  86.7    3e-14    
ref|XP_010274149.1|  PREDICTED: uncharacterized protein LOC104609...  86.3    3e-14    
ref|XP_010905452.1|  PREDICTED: uncharacterized protein LOC105032650  86.3    3e-14    
ref|XP_006287176.1|  hypothetical protein CARUB_v10000344mg           86.3    3e-14    
ref|XP_006287177.1|  hypothetical protein CARUB_v10000344mg           85.9    3e-14    
ref|XP_010453837.1|  PREDICTED: probable serine/threonine-protein...  85.9    3e-14    
ref|XP_010489386.1|  PREDICTED: uncharacterized protein LOC104767...  86.3    3e-14    
ref|XP_010492592.1|  PREDICTED: caldesmon-like                        85.9    3e-14    
gb|KDP33181.1|  hypothetical protein JCGZ_13446                       86.3    3e-14    
ref|XP_006577299.1|  PREDICTED: uncharacterized protein LOC100800...  85.9    3e-14    
ref|XP_009110874.1|  PREDICTED: uncharacterized protein LOC103836375  86.3    3e-14    
ref|XP_009421192.1|  PREDICTED: uncharacterized protein LOC104000786  86.3    3e-14    
ref|XP_009148133.1|  PREDICTED: uncharacterized protein LOC103871621  85.9    4e-14    
emb|CAC01836.1|  putative protein                                     85.5    4e-14    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31126.1|  BnaA08g26760D                                        81.6    4e-14    
gb|AAF99773.1|AC003981_23  F22O13.29                                  85.9    4e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050382.1|  Uncharacterized protein TCM_004165               85.5    5e-14    
dbj|BAC42783.1|  unknown protein                                      85.5    5e-14    Arabidopsis thaliana [mouse-ear cress]
emb|CDX93536.1|  BnaA06g05120D                                        85.5    5e-14    
ref|NP_172357.2|  uncharacterized protein                             85.5    5e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100076.1|  Cytochrome P450 94A1                             85.5    6e-14    
ref|XP_011002939.1|  PREDICTED: myosin-9                              85.1    6e-14    
ref|NP_001044407.1|  Os01g0775200                                     85.1    6e-14    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009611490.1|  PREDICTED: uncharacterized protein LOC104104...  84.7    7e-14    
ref|NP_197174.2|  uncharacterized protein                             84.7    7e-14    Arabidopsis thaliana [mouse-ear cress]
gb|KDO68504.1|  hypothetical protein CISIN_1g002931mg                 84.7    8e-14    
gb|KDO68505.1|  hypothetical protein CISIN_1g002931mg                 84.7    8e-14    
ref|XP_009403743.1|  PREDICTED: uncharacterized protein LOC103987227  85.1    8e-14    
gb|EYU26862.1|  hypothetical protein MIMGU_mgv1a001409mg              84.7    8e-14    
ref|XP_009611491.1|  PREDICTED: uncharacterized protein LOC104104...  84.7    8e-14    
ref|XP_010475694.1|  PREDICTED: uncharacterized protein LOC104755067  84.7    1e-13    
ref|XP_002871733.1|  hypothetical protein ARALYDRAFT_909657           84.3    1e-13    
gb|KEH24568.1|  zein-binding protein                                  84.3    1e-13    
gb|EMS51185.1|  hypothetical protein TRIUR3_35012                     84.3    1e-13    
ref|XP_006347727.1|  PREDICTED: intracellular protein transport p...  84.0    1e-13    
ref|XP_010525069.1|  PREDICTED: midasin-like                          84.0    1e-13    
ref|XP_002521003.1|  hypothetical protein RCOM_0992860                84.0    1e-13    Ricinus communis
gb|KHN43176.1|  hypothetical protein glysoja_001759                   84.0    2e-13    
gb|KFK25901.1|  hypothetical protein AALP_AA8G177300                  83.6    2e-13    
ref|XP_003554713.2|  PREDICTED: putative leucine-rich repeat-cont...  84.0    2e-13    
ref|XP_011083011.1|  PREDICTED: uncharacterized protein LOC105165633  84.0    2e-13    
ref|XP_009121457.1|  PREDICTED: probable serine/threonine-protein...  83.6    2e-13    
ref|XP_008778023.1|  PREDICTED: uncharacterized protein LOC103697860  83.6    2e-13    
emb|CDX95032.1|  BnaC05g06390D                                        83.6    2e-13    
ref|XP_002466282.1|  hypothetical protein SORBIDRAFT_01g004990        83.2    2e-13    Sorghum bicolor [broomcorn]
emb|CDP06842.1|  unnamed protein product                              82.8    3e-13    
ref|XP_006651231.1|  PREDICTED: nuclear autoantigenic sperm prote...  83.2    3e-13    
ref|XP_010651951.1|  PREDICTED: uncharacterized protein LOC104879...  82.8    3e-13    
gb|EYU46486.1|  hypothetical protein MIMGU_mgv1a001994mg              82.8    3e-13    
ref|XP_010651952.1|  PREDICTED: uncharacterized protein LOC104879...  82.8    3e-13    
emb|CAN75727.1|  hypothetical protein VITISV_031407                   82.8    3e-13    Vitis vinifera
ref|XP_011028757.1|  PREDICTED: uncharacterized protein LOC105128...  82.8    4e-13    
ref|XP_011028755.1|  PREDICTED: uncharacterized protein LOC105128...  82.8    4e-13    
emb|CBI17960.3|  unnamed protein product                              82.4    4e-13    
gb|KDP21347.1|  hypothetical protein JCGZ_21818                       82.4    4e-13    
ref|XP_002527786.1|  hypothetical protein RCOM_0629030                82.4    4e-13    Ricinus communis
ref|XP_010228844.1|  PREDICTED: uncharacterized protein LOC100838...  82.4    5e-13    
ref|XP_010228845.1|  PREDICTED: uncharacterized protein LOC100838...  82.4    5e-13    
ref|XP_009351516.1|  PREDICTED: uncharacterized protein LOC103943047  82.4    5e-13    
ref|XP_008221434.1|  PREDICTED: uncharacterized protein LOC103321416  82.0    5e-13    
ref|XP_007227024.1|  hypothetical protein PRUPE_ppa000840mg           82.0    6e-13    
ref|XP_006306639.1|  hypothetical protein CARUB_v10008154mg           82.0    6e-13    
ref|XP_002892472.1|  hypothetical protein ARALYDRAFT_470953           82.0    7e-13    
emb|CDY32134.1|  BnaCnng06430D                                        81.6    7e-13    
ref|XP_008660322.1|  PREDICTED: nuclear autoantigenic sperm prote...  81.6    8e-13    
ref|XP_008660321.1|  PREDICTED: nuclear autoantigenic sperm prote...  81.6    8e-13    
gb|EAZ26328.1|  hypothetical protein OsJ_10208                        81.6    8e-13    
gb|AFW88917.1|  putative DUF593 domain containing family protein      81.6    8e-13    
gb|EAY89321.1|  hypothetical protein OsI_10824                        81.6    8e-13    
ref|XP_008660320.1|  PREDICTED: nuclear autoantigenic sperm prote...  81.6    8e-13    
emb|CDY31127.1|  BnaA08g26770D                                        81.3    9e-13    
ref|XP_004981413.1|  PREDICTED: uncharacterized protein LOC101761...  81.3    9e-13    
gb|EMT06845.1|  hypothetical protein F775_12157                       81.3    1e-12    
ref|XP_010679195.1|  PREDICTED: uncharacterized protein LOC104894613  80.9    1e-12    
ref|NP_001049616.1|  Os03g0259900                                     81.3    1e-12    
dbj|BAJ99230.1|  predicted protein                                    81.3    1e-12    
ref|XP_004494716.1|  PREDICTED: uncharacterized protein LOC101506...  80.9    1e-12    
ref|XP_007153277.1|  hypothetical protein PHAVU_003G021800g           80.9    1e-12    
emb|CDM84413.1|  unnamed protein product                              80.9    1e-12    
ref|XP_010415762.1|  PREDICTED: protein IFH1-like isoform X1          80.5    1e-12    
ref|XP_006300400.1|  hypothetical protein CARUB_v10019836mg           80.5    2e-12    
emb|CDP00811.1|  unnamed protein product                              80.5    2e-12    
ref|XP_010415763.1|  PREDICTED: protein IFH1-like isoform X2          80.5    2e-12    
emb|CDY16985.1|  BnaC09g41120D                                        80.1    2e-12    
ref|XP_002977063.1|  hypothetical protein SELMODRAFT_443425           80.5    2e-12    
ref|XP_008666503.1|  PREDICTED: uncharacterized protein LOC100272...  79.7    2e-12    
gb|KGN47902.1|  hypothetical protein Csa_6G410080                     80.1    2e-12    
ref|XP_010558602.1|  PREDICTED: intracellular protein transport p...  80.1    2e-12    
ref|XP_004495123.1|  PREDICTED: kinesin-related protein 8-like is...  80.1    3e-12    
ref|XP_010558604.1|  PREDICTED: ESF1 homolog isoform X3               79.7    3e-12    
ref|XP_010558603.1|  PREDICTED: ESF1 homolog isoform X2               79.7    3e-12    
ref|XP_004495124.1|  PREDICTED: kinesin-related protein 8-like is...  79.7    3e-12    
emb|CDY11550.1|  BnaC06g31890D                                        79.7    3e-12    
ref|XP_007144711.1|  hypothetical protein PHAVU_007G178800g           79.7    3e-12    
ref|XP_006296395.1|  hypothetical protein CARUB_v10025568mg           79.3    3e-12    
ref|XP_008449933.1|  PREDICTED: LOW QUALITY PROTEIN: probable GPI...  79.7    3e-12    
gb|AAM15784.1|AC104428_5  Hypothetical protein                        79.3    3e-12    
ref|XP_010427864.1|  PREDICTED: uncharacterized protein LOC104712...  79.3    3e-12    
ref|XP_010427865.1|  PREDICTED: uncharacterized protein LOC104712...  79.3    4e-12    
ref|XP_006417646.1|  hypothetical protein EUTSA_v10006726mg           79.7    4e-12    
ref|XP_007144710.1|  hypothetical protein PHAVU_007G178800g           79.3    4e-12    
ref|NP_193099.2|  uncharacterized protein                             79.0    4e-12    
ref|XP_010471076.1|  PREDICTED: uncharacterized protein LOC104750913  79.3    4e-12    
ref|NP_001051575.1|  Os03g0799200                                     79.3    4e-12    
dbj|BAK03583.1|  predicted protein                                    79.3    4e-12    
emb|CAB36827.1|  putative protein                                     79.0    4e-12    
ref|XP_002964991.1|  hypothetical protein SELMODRAFT_439187           78.6    4e-12    
gb|EMT32491.1|  hypothetical protein F775_13062                       79.3    4e-12    
gb|EAY88672.1|  hypothetical protein OsI_10146                        79.3    4e-12    
emb|CDX96274.1|  BnaA07g28850D                                        79.3    4e-12    
ref|XP_009105742.1|  PREDICTED: uncharacterized protein LOC103831609  79.3    4e-12    
ref|XP_008372336.1|  PREDICTED: golgin IMH1-like                      78.6    5e-12    
ref|XP_006594007.1|  PREDICTED: putative leucine-rich repeat-cont...  79.0    5e-12    
gb|KHN44990.1|  hypothetical protein glysoja_023562                   79.0    5e-12    
ref|XP_006594009.1|  PREDICTED: putative leucine-rich repeat-cont...  79.0    5e-12    
ref|XP_010552696.1|  PREDICTED: uncharacterized protein LOC104822999  79.0    6e-12    
gb|KFK31262.1|  hypothetical protein AALP_AA6G089600                  78.6    7e-12    
gb|EMS59831.1|  hypothetical protein TRIUR3_34703                     78.2    7e-12    
gb|EPS59621.1|  hypothetical protein M569_15183                       76.3    8e-12    
ref|XP_004982020.1|  PREDICTED: myosin-11-like                        78.2    9e-12    
ref|XP_002879276.1|  hypothetical protein ARALYDRAFT_344831           77.8    1e-11    
ref|XP_008372337.1|  PREDICTED: dentin sialophosphoprotein-like       77.8    1e-11    
ref|XP_008382926.1|  PREDICTED: uncharacterized protein LOC103445694  77.8    1e-11    
ref|XP_009377732.1|  PREDICTED: uncharacterized protein LOC103966305  77.4    1e-11    
ref|XP_009367782.1|  PREDICTED: uncharacterized protein LOC103957355  77.8    1e-11    
ref|XP_010066600.1|  PREDICTED: uncharacterized protein LOC104453689  77.4    2e-11    
ref|XP_009139608.1|  PREDICTED: uncharacterized protein LOC103863615  77.0    2e-11    
ref|XP_010510304.1|  PREDICTED: lateral signaling target protein ...  77.4    2e-11    
ref|XP_009776217.1|  PREDICTED: centromere protein F-like isoform X2  77.4    2e-11    
emb|CBI26867.3|  unnamed protein product                              77.4    2e-11    
gb|KHN03856.1|  hypothetical protein glysoja_011085                   77.4    2e-11    
ref|XP_009776216.1|  PREDICTED: centromere protein F-like isoform X1  77.4    2e-11    
ref|XP_002868347.1|  hypothetical protein ARALYDRAFT_355453           77.0    2e-11    
emb|CDY01147.1|  BnaA04g06720D                                        76.6    2e-11    
ref|XP_006410170.1|  hypothetical protein EUTSA_v10016299mg           77.0    2e-11    
gb|EAY92198.1|  hypothetical protein OsI_13916                        77.0    2e-11    
ref|XP_011028758.1|  PREDICTED: uncharacterized protein LOC105128...  77.0    2e-11    
ref|XP_006588663.1|  PREDICTED: putative leucine-rich repeat-cont...  77.0    2e-11    
gb|AAO37541.1|  unknown protein                                       77.0    2e-11    
ref|XP_002531179.1|  conserved hypothetical protein                   76.3    2e-11    
gb|EMS64328.1|  hypothetical protein TRIUR3_05569                     77.0    2e-11    
emb|CDY67896.1|  BnaCnng56840D                                        77.0    2e-11    
ref|XP_010654341.1|  PREDICTED: uncharacterized protein LOC100268019  77.0    2e-11    
emb|CDY10753.1|  BnaA05g11830D                                        76.6    2e-11    
gb|AAD01202.1|  IFA-binding protein                                   74.3    2e-11    
gb|KHN17964.1|  hypothetical protein glysoja_035050                   73.6    2e-11    
ref|XP_009144279.1|  PREDICTED: golgin candidate 1-like               76.6    2e-11    
ref|XP_006596506.1|  PREDICTED: desmoplakin-like isoform X2           77.0    2e-11    
ref|XP_006596505.1|  PREDICTED: desmoplakin-like isoform X1           77.0    2e-11    
ref|XP_011001583.1|  PREDICTED: uncharacterized protein PFB0145c-...  77.0    2e-11    
emb|CDY68842.1|  BnaAnng28530D                                        76.3    3e-11    
gb|KHN39457.1|  hypothetical protein glysoja_016844                   77.0    3e-11    
ref|XP_011001584.1|  PREDICTED: kinectin-like isoform X2              77.0    3e-11    
ref|XP_010234724.1|  PREDICTED: uncharacterized protein LOC100836350  76.3    3e-11    
gb|EMT33041.1|  hypothetical protein F775_16334                       76.6    3e-11    
dbj|BAK06695.1|  predicted protein                                    76.3    3e-11    
ref|XP_002464015.1|  hypothetical protein SORBIDRAFT_01g010580        76.6    3e-11    
gb|EAY78477.1|  hypothetical protein OsI_33566                        76.3    3e-11    
ref|NP_001064597.1|  Os10g0414800                                     76.3    3e-11    
ref|XP_010231022.1|  PREDICTED: uncharacterized protein LOC100833217  76.6    3e-11    
emb|CDY47125.1|  BnaC04g13820D                                        76.3    3e-11    
ref|XP_007045209.1|  Uncharacterized protein isoform 1                76.3    4e-11    
ref|XP_006650738.1|  PREDICTED: uncharacterized protein LOC102713997  75.9    4e-11    
ref|XP_002888793.1|  hypothetical protein ARALYDRAFT_894893           76.3    4e-11    
ref|XP_009392654.1|  PREDICTED: polyamine-modulated factor 1-bind...  75.9    4e-11    
ref|XP_009623575.1|  PREDICTED: uncharacterized protein LOC104114763  75.5    4e-11    
ref|XP_006649447.1|  PREDICTED: uncharacterized protein LOC102717878  75.9    4e-11    
gb|AAC02740.1|  unknown protein                                       75.9    4e-11    
ref|XP_008665281.1|  PREDICTED: protein IWS1 homolog isoform X2       76.3    4e-11    
ref|XP_008665280.1|  PREDICTED: myosin-11-like isoform X1             76.3    4e-11    
emb|CDX89779.1|  BnaA10g03030D                                        75.5    4e-11    
ref|XP_011080015.1|  PREDICTED: uncharacterized protein LOC105163391  75.9    5e-11    
gb|EMS59666.1|  hypothetical protein TRIUR3_10653                     75.9    5e-11    
ref|NP_001051039.2|  Os03g0708700                                     75.9    5e-11    
ref|NP_180627.2|  uncharacterized protein                             75.9    5e-11    
gb|EEC76042.1|  hypothetical protein OsI_13222                        75.9    5e-11    
gb|EMT01163.1|  hypothetical protein F775_16063                       75.5    5e-11    
ref|XP_010450184.1|  PREDICTED: uncharacterized protein LOC104732349  75.5    6e-11    
ref|XP_006390843.1|  hypothetical protein EUTSA_v10018172mg           75.5    6e-11    
ref|XP_009119237.1|  PREDICTED: golgin subfamily A member 4           74.7    6e-11    
ref|XP_008644579.1|  PREDICTED: uncharacterized protein LOC103625...  75.5    6e-11    
ref|XP_007158802.1|  hypothetical protein PHAVU_002G183000g           75.5    6e-11    
ref|XP_008644578.1|  PREDICTED: early endosome antigen 1-like iso...  75.5    6e-11    
ref|XP_009354909.1|  PREDICTED: uncharacterized protein LOC103946...  75.5    6e-11    
ref|XP_009354907.1|  PREDICTED: uncharacterized protein LOC103946...  75.5    6e-11    
ref|XP_006590122.1|  PREDICTED: PERQ amino acid-rich with GYF dom...  72.8    7e-11    
ref|XP_011070603.1|  PREDICTED: uncharacterized protein LOC105156...  75.5    7e-11    
ref|XP_011070602.1|  PREDICTED: uncharacterized protein LOC105156...  75.5    7e-11    
ref|XP_006390844.1|  hypothetical protein EUTSA_v10018172mg           75.1    7e-11    
ref|NP_564999.2|  uncharacterized protein                             75.1    8e-11    
ref|XP_010469812.1|  PREDICTED: filamin A-interacting protein 1-like  75.1    8e-11    
emb|CDY18267.1|  BnaC05g02900D                                        74.7    8e-11    
ref|XP_011097517.1|  PREDICTED: uncharacterized protein LOC105176419  75.1    8e-11    
ref|XP_010108996.1|  hypothetical protein L484_027193                 75.1    8e-11    
ref|XP_010475157.1|  PREDICTED: uncharacterized protein LOC104754632  74.3    8e-11    
ref|XP_010101969.1|  hypothetical protein L484_011987                 75.1    9e-11    
ref|XP_010558605.1|  PREDICTED: intracellular protein transport p...  74.7    1e-10    
ref|XP_009775106.1|  PREDICTED: cingulin-like isoform X2              74.7    1e-10    
ref|XP_008361806.1|  PREDICTED: caldesmon-like                        74.7    1e-10    
gb|KHN46089.1|  hypothetical protein glysoja_030090                   74.7    1e-10    
ref|XP_009775105.1|  PREDICTED: cingulin-like isoform X1              74.7    1e-10    
ref|XP_009775107.1|  PREDICTED: cingulin-like isoform X3              74.7    1e-10    
ref|XP_006575488.1|  PREDICTED: intracellular protein transport p...  74.3    1e-10    
ref|XP_010457548.1|  PREDICTED: uncharacterized protein LOC104739015  73.9    1e-10    
ref|NP_001146289.1|  uncharacterized protein LOC100279864             74.3    2e-10    
ref|XP_002518099.1|  hypothetical protein RCOM_1019660                73.9    2e-10    
ref|XP_008672723.1|  PREDICTED: uncharacterized protein LOC100279...  74.3    2e-10    
ref|XP_006575491.1|  PREDICTED: intracellular protein transport p...  74.3    2e-10    
ref|XP_006840152.1|  hypothetical protein AMTR_s00089p00065300        74.3    2e-10    
ref|XP_003524144.1|  PREDICTED: girdin-like                           74.3    2e-10    
ref|XP_006651735.1|  PREDICTED: uncharacterized protein LOC102710966  73.9    2e-10    
gb|KHN12470.1|  hypothetical protein glysoja_018600                   73.9    2e-10    
ref|XP_006585081.1|  PREDICTED: daple-like protein-like               73.9    2e-10    
ref|XP_002456429.1|  hypothetical protein SORBIDRAFT_03g036130        73.9    2e-10    
ref|XP_010484370.1|  PREDICTED: uncharacterized protein LOC104762713  73.6    2e-10    
ref|XP_008660534.1|  PREDICTED: uncharacterized protein LOC103639581  73.6    2e-10    
ref|XP_002465812.1|  hypothetical protein SORBIDRAFT_01g046220        73.6    2e-10    
gb|AFW89718.1|  putative DUF593 domain containing family protein      73.6    3e-10    
ref|XP_006306024.1|  hypothetical protein CARUB_v10011320mg           73.2    3e-10    
ref|XP_008362506.1|  PREDICTED: myosin-10-like                        73.6    3e-10    
ref|XP_002275447.1|  PREDICTED: uncharacterized protein LOC100257...  73.6    3e-10    
emb|CAN69616.1|  hypothetical protein VITISV_000426                   73.6    3e-10    
ref|XP_006400213.1|  hypothetical protein EUTSA_v10012846mg           73.2    3e-10    
ref|XP_010660311.1|  PREDICTED: uncharacterized protein LOC100257...  73.6    3e-10    
ref|XP_002302067.2|  hypothetical protein POPTR_0002s04360g           73.2    3e-10    
ref|XP_004983179.1|  PREDICTED: kinesin-like protein KIF15-like       73.2    3e-10    
ref|XP_010533337.1|  PREDICTED: uncharacterized protein LOC104809139  73.2    3e-10    
ref|XP_010660312.1|  PREDICTED: uncharacterized protein LOC100257...  73.6    3e-10    
ref|XP_006414872.1|  hypothetical protein EUTSA_v10024808mg           72.8    3e-10    
gb|KHG21870.1|  phosphoribosylaminoimidazole carboxylase              72.8    3e-10    
gb|EMT24689.1|  hypothetical protein F775_24993                       72.8    3e-10    
gb|EEE59783.1|  hypothetical protein OsJ_12294                        72.8    4e-10    
emb|CDO99462.1|  unnamed protein product                              72.8    4e-10    
ref|XP_009627950.1|  PREDICTED: myosin-2 heavy chain, non muscle ...  72.8    5e-10    
ref|XP_009627949.1|  PREDICTED: myosin-2 heavy chain, non muscle ...  72.8    5e-10    
ref|XP_011023803.1|  PREDICTED: uncharacterized protein LOC105125171  72.8    5e-10    
ref|XP_010917613.1|  PREDICTED: uncharacterized protein LOC105042190  72.4    5e-10    
ref|XP_001772030.1|  predicted protein                                72.4    5e-10    
ref|XP_002981585.1|  hypothetical protein SELMODRAFT_444892           72.0    5e-10    
ref|XP_002963207.1|  hypothetical protein SELMODRAFT_438396           71.6    7e-10    
ref|XP_002892250.1|  hypothetical protein ARALYDRAFT_470474           71.2    7e-10    
ref|XP_007216913.1|  hypothetical protein PRUPE_ppa019046mg           72.0    8e-10    
ref|XP_002467249.1|  hypothetical protein SORBIDRAFT_01g022030        71.2    9e-10    
gb|ABK96495.1|  unknown                                               69.3    9e-10    
gb|KDP39369.1|  hypothetical protein JCGZ_01126                       71.6    9e-10    
ref|XP_006661772.1|  PREDICTED: uncharacterized protein LOC102716161  71.2    1e-09    
gb|KHG04069.1|  Homeobox-leucine zipper HDG12 -like protein           71.6    1e-09    
gb|EMT17433.1|  hypothetical protein F775_06377                       71.6    1e-09    
ref|XP_006418085.1|  hypothetical protein EUTSA_v10009864mg           70.9    1e-09    
ref|XP_007049771.1|  Uncharacterized protein TCM_002927               71.2    1e-09    
ref|XP_009334431.1|  PREDICTED: uncharacterized protein LOC103927259  71.2    1e-09    
ref|XP_002521088.1|  conserved hypothetical protein                   70.5    2e-09    
ref|XP_008775465.1|  PREDICTED: uncharacterized protein LOC103695825  70.9    2e-09    
dbj|BAJ87751.1|  predicted protein                                    70.9    2e-09    
ref|XP_010069036.1|  PREDICTED: uncharacterized protein LOC104456...  70.9    2e-09    
ref|XP_010069035.1|  PREDICTED: uncharacterized protein LOC104456...  70.9    2e-09    
ref|XP_004289444.1|  PREDICTED: uncharacterized protein LOC101303073  70.9    2e-09    
ref|XP_010943613.1|  PREDICTED: uncharacterized protein LOC105061...  70.9    2e-09    
gb|ACA64810.1|  SKIP interacting protein 8                            70.1    2e-09    
ref|XP_004252993.1|  PREDICTED: uncharacterized protein LOC101261797  70.9    2e-09    
gb|EPS66451.1|  hypothetical protein M569_08326                       66.2    2e-09    
ref|XP_010943615.1|  PREDICTED: uncharacterized protein LOC105061...  70.5    2e-09    
emb|CBI33508.3|  unnamed protein product                              70.5    2e-09    
ref|XP_008368732.1|  PREDICTED: uncharacterized protein LOC103432325  70.5    2e-09    
ref|XP_008368733.1|  PREDICTED: uncharacterized protein LOC103432326  70.5    2e-09    
ref|XP_010550886.1|  PREDICTED: uncharacterized protein LOC104821650  69.3    2e-09    
gb|AAF40448.1|AC004809_6  Contains similarity to the IFA-binding ...  69.7    3e-09    
dbj|BAJ88148.1|  predicted protein                                    70.1    3e-09    
ref|XP_011091435.1|  PREDICTED: uncharacterized protein LOC105171...  70.1    3e-09    
ref|NP_171981.2|  uncharacterized protein                             69.3    3e-09    
ref|XP_011091436.1|  PREDICTED: uncharacterized protein LOC105171...  70.1    3e-09    
ref|XP_011091434.1|  PREDICTED: uncharacterized protein LOC105171...  69.7    3e-09    
ref|XP_008229204.1|  PREDICTED: uncharacterized protein LOC103328584  70.1    4e-09    
ref|XP_010522408.1|  PREDICTED: uncharacterized protein LOC104801032  69.7    4e-09    
ref|XP_008235476.1|  PREDICTED: uncharacterized protein LOC103334...  69.3    4e-09    
ref|XP_008235475.1|  PREDICTED: uncharacterized protein LOC103334...  69.3    4e-09    
ref|XP_008358056.1|  PREDICTED: uncharacterized protein LOC103421793  69.3    4e-09    
ref|XP_007034368.1|  Uncharacterized protein TCM_020328               69.7    4e-09    
ref|XP_010527232.1|  PREDICTED: uncharacterized protein LOC104804609  68.9    4e-09    
ref|XP_010673428.1|  PREDICTED: uncharacterized protein LOC104889811  69.3    5e-09    
ref|XP_004134377.1|  PREDICTED: uncharacterized protein LOC101204513  69.3    5e-09    
ref|XP_009403613.1|  PREDICTED: uncharacterized protein LOC103987131  69.3    5e-09    
gb|KDP38085.1|  hypothetical protein JCGZ_04728                       69.3    5e-09    



>ref|XP_009631968.1| PREDICTED: uncharacterized protein LOC104121637 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631969.1| PREDICTED: uncharacterized protein LOC104121637 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631970.1| PREDICTED: uncharacterized protein LOC104121637 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631971.1| PREDICTED: uncharacterized protein LOC104121637 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631972.1| PREDICTED: uncharacterized protein LOC104121637 isoform X1 [Nicotiana 
tomentosiformis]
Length=598

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 236/527 (45%), Positives = 309/527 (59%), Gaps = 92/527 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ +GR  +F IY++LE+VMI++L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRLVEQKMGRVGVFFIYAILEWVMIIILFIDGFLAFFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYND+ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +KDS     
Sbjct  66    IFIKRNSSFYYNDSICEVHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKDSDCDRY  125

Query  567   dyyaaddvkSVNVFADKPN---------------------FQRCSCCMEFLGGKGKYTRS  683
                     K ++ F D  +                       RCSCC E L  + KY R+
Sbjct  126   KSLVGILHKDIDCFVDGDDQRVSIKSVKNEDEVIKTGAVVILRCSCCGEPLKLRSKYLRN  185

Query  684   MS------QVAPPPSPRA----WRN---------------------NETDHPDDNENATN  770
              S        AP PSPR+    WRN                     N++D PDD E   N
Sbjct  186   SSINENIYSQAPAPSPRSPLTIWRNEESRNLELPHFRYTELKFTSENDSDLPDD-EGHQN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTM  941
               GRDD ++ +V    + E + D SCKTP      NKF GIPLSDS + S K   + R +
Sbjct  245   AAGRDDIKAASVPLLPDPEDIHDDSCKTP--NSARNKFFGIPLSDSAQASPKWPYRPRKL  302

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
               D S    SD N+     T+  ++      I+  LKRQV L+RKSL+ + MELDEER+A
Sbjct  303   GGDKSEFI-SDAND-----TSAADDD-----ILHRLKRQVRLDRKSLMELYMELDEERSA  351

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             SA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ 
Sbjct  352   SAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKV  411

Query  1302  LESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDV------  1460
             LE++L+ YR+K+G I    SE  E++ DD++  LK  S+SSFGE S C S  +V      
Sbjct  412   LEAELETYREKYGHIKKVGSEVCEVDADDDYQELKSHSVSSFGERSDCGSPREVDQDGVN  471

Query  1461  ---LDHHEVY---------LDSDNDRSHHSALLRTIPETTSATPAVQ  1565
                ++    Y         LD +N+RS+   LL  + +     P V+
Sbjct  472   ELHIERPREYGEGIVDQSNLDFENERSYLQGLLTNLEKKIKIPPDVE  518



>ref|XP_009768785.1| PREDICTED: uncharacterized protein LOC104219754 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009768791.1| PREDICTED: uncharacterized protein LOC104219754 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009768800.1| PREDICTED: uncharacterized protein LOC104219754 isoform X1 [Nicotiana 
sylvestris]
Length=596

 Score =   354 bits (908),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 236/527 (45%), Positives = 308/527 (58%), Gaps = 94/527 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ +GR  +F IY++LE+ MI++L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRLVEQKMGRVGVFFIYAILEWAMIIILFIDGFLAFFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYND+ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +KDS     
Sbjct  66    IFIKRNSSFYYNDSICEVHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKDSDCDRY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------RCSCCMEFLGGKGKYTRS  683
                     K ++ F D  + +                     RCSCC E L  + KYTR 
Sbjct  126   KSLVGILHKDIDCFMDGDDQRVSIKSVKNEDEVIKTGTVVVLRCSCCGEPLKLRSKYTRD  185

Query  684   MS------QVAPPPSPRA----WRN---------------------NETDHPDDNENATN  770
             +S        AP PSPR+    WRN                     N++D PDD E   N
Sbjct  186   LSINENIYSQAPAPSPRSPLTTWRNEESRNLELPHVRYTELKFTSDNDSDLPDD-EGHQN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTM  941
               GRDD     ++   + E + D SCKTP      NK  GIPLSDS + S K   + + +
Sbjct  245   AAGRDD-----INAATDPEDIHDESCKTP--NSARNKIFGIPLSDSAQASPKWPYRPKKL  297

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
               D S    SD N+     T+  NE +    I+  LKRQV L+RKSL+ + MELDEER+A
Sbjct  298   GGDKSEFI-SDAND-----TSAANEADDD--ILHRLKRQVRLDRKSLMELYMELDEERSA  349

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             SA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ 
Sbjct  350   SAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKV  409

Query  1302  LESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTD-----VL  1463
             LE++L+ YR+K+G +    SE  E++ DD++  LK  S+SSFGE S C S  D     V 
Sbjct  410   LEAELETYREKYGHVKRVGSEVCEVDADDDYQELKSHSVSSFGERSECGSPRDMDQDGVN  469

Query  1464  DHH-------------EVYLDSDNDRSHHSALLRTIPETTSATPAVQ  1565
             + H             E  LD +N+RS+   LL  + +     P V+
Sbjct  470   EFHIERPGKYGEGTVDESNLDFENERSYLQDLLTNLEKKIKIPPDVE  516



>ref|XP_009631973.1| PREDICTED: uncharacterized protein LOC104121637 isoform X2 [Nicotiana 
tomentosiformis]
Length=597

 Score =   352 bits (902),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 236/527 (45%), Positives = 309/527 (59%), Gaps = 93/527 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ +GR  +F IY++LE+VMI++L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRLVEQKMGRVGVFFIYAILEWVMIIILFIDGFLAFFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYND+ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +KDS     
Sbjct  66    IFIKRNSSFYYNDSICEVHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKDSDCDRY  125

Query  567   dyyaaddvkSVNVFADKPN---------------------FQRCSCCMEFLGGKGKYTRS  683
                     K ++ F D  +                       RCSCC E L  + KY R+
Sbjct  126   KSLVGILHKDIDCFVDGDDQRVSIKSVKNEDEVIKTGAVVILRCSCCGEPLKLRSKYLRN  185

Query  684   MS------QVAPPPSPRA----WRN---------------------NETDHPDDNENATN  770
              S        AP PSPR+    WRN                     N++D PDD E   N
Sbjct  186   SSINENIYSQAPAPSPRSPLTIWRNEESRNLELPHFRYTELKFTSENDSDLPDD-EGHQN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTM  941
               GRDD ++ +V    + E + D SCKTP      NKF GIPLSDS + S K   + R +
Sbjct  245   A-GRDDIKAASVPLLPDPEDIHDDSCKTP--NSARNKFFGIPLSDSAQASPKWPYRPRKL  301

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
               D S    SD N+     T+  ++      I+  LKRQV L+RKSL+ + MELDEER+A
Sbjct  302   GGDKSEFI-SDAND-----TSAADDD-----ILHRLKRQVRLDRKSLMELYMELDEERSA  350

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             SA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ 
Sbjct  351   SAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKV  410

Query  1302  LESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDV------  1460
             LE++L+ YR+K+G I    SE  E++ DD++  LK  S+SSFGE S C S  +V      
Sbjct  411   LEAELETYREKYGHIKKVGSEVCEVDADDDYQELKSHSVSSFGERSDCGSPREVDQDGVN  470

Query  1461  ---LDHHEVY---------LDSDNDRSHHSALLRTIPETTSATPAVQ  1565
                ++    Y         LD +N+RS+   LL  + +     P V+
Sbjct  471   ELHIERPREYGEGIVDQSNLDFENERSYLQGLLTNLEKKIKIPPDVE  517



>ref|XP_006344983.1| PREDICTED: uncharacterized protein LOC102601358 isoform X1 [Solanum 
tuberosum]
 ref|XP_006344984.1| PREDICTED: uncharacterized protein LOC102601358 isoform X2 [Solanum 
tuberosum]
Length=599

 Score =   352 bits (903),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 229/526 (44%), Positives = 303/526 (58%), Gaps = 89/526 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ LGR  +F +Y+VLE+VMI+LL +DGFLA F+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKCLVEQKLGRVGVFCVYAVLEWVMILLLFIDGFLALFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYN++ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +K++     
Sbjct  66    IFIKRNSSFYYNESICEGHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKEADCDKY  125

Query  567   dyyaaddvkSVNVFADKPN--------------------FQRCSCCMEFLGGKGKYTR--  680
                     K ++ F D                        + CSCC E L  + KY R  
Sbjct  126   KSLVGILHKDIDCFVDDDKRMSIKSVKNEEEVIKTGSVVIRNCSCCGEPLKLRTKYARNS  185

Query  681   -------SMSQVAPPPSPRAWRN---------------------NETDHPDDNENATNGD  776
                    S +  + P SP  W+N                     NE+  PDD E   N  
Sbjct  186   SINGNHYSQAPASSPRSPLTWKNEESGNMELPHIQYTKLKFSSDNESILPDD-EGHQNAA  244

Query  777   GRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTMSI  947
             G++D ++       + E + D SCKTP +    NKF GIPL+DS + S K   K R +  
Sbjct  245   GKEDTKAATAPLLPDPEDIHDESCKTPVS--ARNKFFGIPLTDSAQASPKWPNKPRKLGG  302

Query  948   DYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasa  1127
             D S    SD N+     T+  NE +    I+  LKRQV L+RKSL+ + MELDEER+ASA
Sbjct  303   DTSEFI-SDAND-----TSAVNEADDD--ILHSLKRQVRLDRKSLMELYMELDEERSASA  354

Query  1128  iaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALE  1307
             +AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ LE
Sbjct  355   VAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKVLE  414

Query  1308  SDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHH----  1472
             +++D YR+++G I    SE  E++ DD++  L+ QS SSF E S C S  +V DH+    
Sbjct  415   AEMDTYRERYGVIKKVGSEVCEVDADDDYQELRSQSASSFDERSDCSSPREV-DHNGVNE  473

Query  1473  ---------------EVYLDSDNDRSHHSALLRTIPETTSATPAVQ  1565
                            E  LD +N+RS    LL  + +     P V+
Sbjct  474   LHIERPGEYRDENVDESNLDFENERSFLQGLLANLEKKIKIPPDVE  519



>ref|XP_009768805.1| PREDICTED: uncharacterized protein LOC104219754 isoform X2 [Nicotiana 
sylvestris]
Length=595

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 236/527 (45%), Positives = 308/527 (58%), Gaps = 95/527 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ +GR  +F IY++LE+ MI++L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRLVEQKMGRVGVFFIYAILEWAMIIILFIDGFLAFFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYND+ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +KDS     
Sbjct  66    IFIKRNSSFYYNDSICEVHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKDSDCDRY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------RCSCCMEFLGGKGKYTRS  683
                     K ++ F D  + +                     RCSCC E L  + KYTR 
Sbjct  126   KSLVGILHKDIDCFMDGDDQRVSIKSVKNEDEVIKTGTVVVLRCSCCGEPLKLRSKYTRD  185

Query  684   MS------QVAPPPSPRA----WRN---------------------NETDHPDDNENATN  770
             +S        AP PSPR+    WRN                     N++D PDD E   N
Sbjct  186   LSINENIYSQAPAPSPRSPLTTWRNEESRNLELPHVRYTELKFTSDNDSDLPDD-EGHQN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTM  941
               GRDD     ++   + E + D SCKTP      NK  GIPLSDS + S K   + + +
Sbjct  245   A-GRDD-----INAATDPEDIHDESCKTP--NSARNKIFGIPLSDSAQASPKWPYRPKKL  296

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
               D S    SD N+     T+  NE +    I+  LKRQV L+RKSL+ + MELDEER+A
Sbjct  297   GGDKSEFI-SDAND-----TSAANEADDD--ILHRLKRQVRLDRKSLMELYMELDEERSA  348

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             SA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ 
Sbjct  349   SAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKV  408

Query  1302  LESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTD-----VL  1463
             LE++L+ YR+K+G +    SE  E++ DD++  LK  S+SSFGE S C S  D     V 
Sbjct  409   LEAELETYREKYGHVKRVGSEVCEVDADDDYQELKSHSVSSFGERSECGSPRDMDQDGVN  468

Query  1464  DHH-------------EVYLDSDNDRSHHSALLRTIPETTSATPAVQ  1565
             + H             E  LD +N+RS+   LL  + +     P V+
Sbjct  469   EFHIERPGKYGEGTVDESNLDFENERSYLQDLLTNLEKKIKIPPDVE  515



>ref|XP_009595854.1| PREDICTED: uncharacterized protein LOC104092070 [Nicotiana tomentosiformis]
Length=600

 Score =   350 bits (897),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 305/518 (59%), Gaps = 85/518 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C++EQN G+ A F IY+VLE++MI+LL ++GFLAFFS EFAKFF+LK+PC  CTRID 
Sbjct  6     FKCYVEQNTGKFAFFFIYAVLEWMMIILLFIEGFLAFFSNEFAKFFDLKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHRN NFYYN++ICE HK+DISSL+YCHVHKK+SDI+ MC+ CLLSFA +KD+     
Sbjct  66    ILVHRNANFYYNESICEVHKKDISSLAYCHVHKKLSDIRNMCDGCLLSFATEKDADCDRY  125

Query  567   dyyaaddvkSVNVFAD--------------------KPNFQRCSCCMEFLGGKGKYTRSM  686
                     K ++ F +                    K    RCSCC E L  K KY+R+ 
Sbjct  126   KSLVGILHKDIDCFVEDDKKVHTKSGKKEDEVIQIEKGGIVRCSCCGEPLKTKSKYSRNA  185

Query  687   SQV-------APPPSPRA----WRNNETDH---------------------PDDNENATN  770
             S +       AP PSPR+    WRN E  H                     PDD E   N
Sbjct  186   SSMKGNPYSQAPAPSPRSPLTTWRNEEARHLELPHTQYTEVKFISDNDLDLPDD-EGIPN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRT  938
             G GR+D ++  V    + E + D + KTP      NKF GIPLSDS    PR S  + R 
Sbjct  245   G-GREDIKAATVPLIPDSEEINDDALKTP--NFTRNKFFGIPLSDSVHASPRWS-HRPRK  300

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
             +S+D  +   S+ N+      +  NE +    I+  LKRQV L+ KSL+++ MELDEER+
Sbjct  301   LSMDIKSELISETND-----ASAVNESDDD--ILHRLKRQVRLDHKSLMALYMELDEERS  353

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             A+A+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+
Sbjct  354   AAAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLLLKREEEIK  413

Query  1299  ALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-------------  1439
              L+++L+ YR+++G I    SE  E++ D+++      SLSS  E S             
Sbjct  414   VLDAELETYRERYGHIKKVGSEVCEVDADEDYQEWNSHSLSSVSERSACVSPDQNERSFE  473

Query  1440  CRSLTDVLDHHEVYLDSDNDRSHHSALLRTIPETTSAT  1553
             C       +  E +LD +N+RS+   LL  + E    +
Sbjct  474   CSGEYGGENVGESHLDFENERSYLMGLLTNLEEKIKTS  511



>ref|XP_006344985.1| PREDICTED: uncharacterized protein LOC102601358 isoform X3 [Solanum 
tuberosum]
Length=598

 Score =   348 bits (894),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 227/524 (43%), Positives = 304/524 (58%), Gaps = 86/524 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ LGR  +F +Y+VLE+VMI+LL +DGFLA F+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKCLVEQKLGRVGVFCVYAVLEWVMILLLFIDGFLALFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYN++ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +K++     
Sbjct  66    IFIKRNSSFYYNESICEGHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKEADCDKY  125

Query  567   dyyaaddvkSVNVFADKPN--------------------FQRCSCCMEFLGGKGKYTR--  680
                     K ++ F D                        + CSCC E L  + KY R  
Sbjct  126   KSLVGILHKDIDCFVDDDKRMSIKSVKNEEEVIKTGSVVIRNCSCCGEPLKLRTKYARNS  185

Query  681   -------SMSQVAPPPSPRAWRNNETDHPD-------------DNENATNGD------GR  782
                    S +  + P SP  W+N E+ + +             DNE+    D      G+
Sbjct  186   SINGNHYSQAPASSPRSPLTWKNEESGNMELPHIQYTKLKFSSDNESILPDDEGHQNAGK  245

Query  783   DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTMSIDY  953
             +D ++       + E + D SCKTP +    NKF GIPL+DS + S K   K R +  D 
Sbjct  246   EDTKAATAPLLPDPEDIHDESCKTPVS--ARNKFFGIPLTDSAQASPKWPNKPRKLGGDT  303

Query  954   SALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaia  1133
             S    SD N+     T+  NE +    I+  LKRQV L+RKSL+ + MELDEER+ASA+A
Sbjct  304   SEFI-SDAND-----TSAVNEADDD--ILHSLKRQVRLDRKSLMELYMELDEERSASAVA  355

Query  1134  annamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESD  1313
             ANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ LE++
Sbjct  356   ANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKVLEAE  415

Query  1314  LDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHH------  1472
             +D YR+++G I    SE  E++ DD++  L+ QS SSF E S C S  +V DH+      
Sbjct  416   MDTYRERYGVIKKVGSEVCEVDADDDYQELRSQSASSFDERSDCSSPREV-DHNGVNELH  474

Query  1473  -------------EVYLDSDNDRSHHSALLRTIPETTSATPAVQ  1565
                          E  LD +N+RS    LL  + +     P V+
Sbjct  475   IERPGEYRDENVDESNLDFENERSFLQGLLANLEKKIKIPPDVE  518



>ref|XP_009784004.1| PREDICTED: uncharacterized protein LOC104232478 [Nicotiana sylvestris]
Length=604

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 220/476 (46%), Positives = 288/476 (61%), Gaps = 65/476 (14%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C++EQ  G+ A F IY+VLE+VMI+LL ++GFLAFFS EFAKFF+LK+PC  CTRID 
Sbjct  6     FKCYVEQKTGKFAFFFIYAVLEWVMIILLFIEGFLAFFSNEFAKFFDLKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHRN NFYYN++ICE HK+DISSL+YCHVHKK+SDI+ MC+ CLLSFA +KD+     
Sbjct  66    ILVHRNANFYYNESICEVHKKDISSLAYCHVHKKLSDIRNMCDGCLLSFATEKDADCDRY  125

Query  567   dyyaaddvkSVNVFAD--------------------KPNFQRCSCCMEFLGGKGKYTRSM  686
                     K ++ F +                    K    RCSCC E L  K KY+R+ 
Sbjct  126   KSLVGILHKDIDCFVEDDKKVDTKSGKKEDEVIQIEKGGIVRCSCCGEILKTKSKYSRNA  185

Query  687   S------QVAPPPSPRA----WRNNETDHPD-------------DNENATNGD------G  779
             S        AP PSPR+    WRN E  H +             DN+     D      G
Sbjct  186   SMKGNPYSQAPAPSPRSPLTTWRNEEARHLELPHTQYTEVKFISDNDLDLPADEGLPSGG  245

Query  780   RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTMSID  950
             R+D ++  V    + E + D + KTP      NKF GIPLSDS   S +   + R +S+D
Sbjct  246   REDIKAATVPLIPDSEEINDDALKTP--NFTRNKFFGIPLSDSAHASPRWSHRPRKLSMD  303

Query  951   YSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasai  1130
               +   S+ N+   V     NE +    I+  LKRQV L+ KSL+++ MELDEER+A+A+
Sbjct  304   IKSEFISETNDASTV-----NESDDD--ILHRLKRQVRLDHKSLMALYMELDEERSAAAV  356

Query  1131  aannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALES  1310
             AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KDM+LKREEEI+ LE+
Sbjct  357   AANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEAMQVMKDMLLKREEEIKVLEA  416

Query  1311  DLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRSLTDVLDHHEV  1478
             +L+ YR+++G I    SE  E++ D+++      SLSS  E S     D  D H V
Sbjct  417   ELETYRERYGHIKKVGSEVCEVDADEDYQEWNSHSLSSVSERSACVSPDEGDQHGV  472



>gb|AHX26274.1| Rac5-interacting sub-apical pollen tube protein [Nicotiana tabacum]
Length=600

 Score =   347 bits (891),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 304/518 (59%), Gaps = 85/518 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C++EQN G+ A F IY+VLE++MI+LL ++GFLAFFS EFAKFF+LK+PC  CTRID 
Sbjct  6     FKCYVEQNTGKFAFFFIYAVLEWMMIILLFIEGFLAFFSNEFAKFFDLKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHRN NFYYN++ICE HK+DISSL+YCHVHKK+SDI+ MC+ CLLSFA +KD+     
Sbjct  66    ILVHRNANFYYNESICEVHKKDISSLAYCHVHKKLSDIRNMCDGCLLSFATEKDADCDRY  125

Query  567   dyyaaddvkSVNVFAD--------------------KPNFQRCSCCMEFLGGKGKYTRSM  686
                     K ++ F +                    K    RCSCC E L  K KY+R+ 
Sbjct  126   KSLVGILHKDIDCFVEDDKKVHTKSGKKEDEVIQIEKGGIVRCSCCGEPLKTKSKYSRNA  185

Query  687   SQV-------APPPSPRA----WRNNETDH---------------------PDDNENATN  770
             S +       AP PSPR+    WRN E  H                     PDD E   N
Sbjct  186   SSMKGNPYSQAPAPSPRSPLTTWRNEEARHLELPHTQYTEVKFISDNDLDLPDD-EGIPN  244

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRT  938
             G GR+D ++  V    + E + D + KTP       KF GIPLSDS    PR S  + R 
Sbjct  245   G-GREDIKAATVPLIPDSEEINDDALKTP--NFTRKKFFGIPLSDSVHASPRWS-HRPRK  300

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
             +S+D  +   S+ N+      +  NE +    I+  LKRQV L+ KSL+++ MELDEER+
Sbjct  301   LSMDIKSELISETND-----ASAVNESDDD--ILHRLKRQVRLDHKSLMALYMELDEERS  353

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             A+A+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+
Sbjct  354   AAAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLLLKREEEIK  413

Query  1299  ALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-------------  1439
              L+++L+ YR+++G I    SE  E++ D+++      SLSS  E S             
Sbjct  414   VLDAELETYRERYGHIKKVGSEVCEVDADEDYQEWNSHSLSSVSERSACVSPDQNERSFE  473

Query  1440  CRSLTDVLDHHEVYLDSDNDRSHHSALLRTIPETTSAT  1553
             C       +  E +LD +N+RS+   LL  + E    +
Sbjct  474   CSGEYGGENVGESHLDFENERSYLMGLLTNLEEKIKTS  511



>ref|XP_010318953.1| PREDICTED: uncharacterized protein LOC101263101 isoform X1 [Solanum 
lycopersicum]
Length=599

 Score =   344 bits (883),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 228/525 (43%), Positives = 301/525 (57%), Gaps = 89/525 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ LGR  +F +Y+VLE+VMI+LL +DGFLA F+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKCLVEQKLGRVGVFCVYAVLEWVMILLLFIDGFLALFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYN++ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +K++     
Sbjct  66    IFIKRNSSFYYNESICEGHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKEADCDKY  125

Query  567   dyyaaddvkSVNVFADKPN--------------------FQRCSCCMEFLGGKGKYTRSM  686
                     K ++ F D                        + CSCC E L  + KY R+ 
Sbjct  126   KSLVGILHKDIDCFVDDDKRMSIKSVKNEEEVIKTASVVLRNCSCCGEPLKLRTKYARNS  185

Query  687   S------QVAPPPSPRA---WRN---------------------NETDHPDDNENATNGD  776
             S        AP  SPR+   W+N                     NE+  PDD E   N  
Sbjct  186   SINGNHYTQAPASSPRSPLTWKNEESGNMELPRIQYTKLKFSSDNESILPDD-EGHQNAA  244

Query  777   GRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTMSI  947
             GR+D ++       + E + + S KTP +    NKF GIPL+DS + S K   K R +  
Sbjct  245   GREDIKAATAPLLPDPEDIHEESSKTPVS--ARNKFFGIPLTDSAQASPKWPNKPRKLGG  302

Query  948   DYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasa  1127
             D S    SD N+      +  NE +    I+  LKRQV L+RKSL+ + MELDEER+ASA
Sbjct  303   DKSEFI-SDAND-----ASAVNEADDD--IVHSLKRQVRLDRKSLMELYMELDEERSASA  354

Query  1128  iaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALE  1307
             +AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ LE
Sbjct  355   VAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKVLE  414

Query  1308  SDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSF-GEMSCRSLTDVLDHH----  1472
             +++D YR+++G I    SE  E++ DD++  L+ QS SSF G   C S     DH+    
Sbjct  415   AEIDTYRERYGIIKKVGSEVCEVDADDDYQELRSQSASSFDGRSDCSSPRQA-DHNGVNG  473

Query  1473  ---------------EVYLDSDNDRSHHSALLRTIPETTSATPAV  1562
                            E  LD +N+RS+   LL T+ +     P V
Sbjct  474   FHIGCPGEYRDENIDESNLDFENERSYLQGLLTTLEKQIKIPPDV  518



>emb|CDP14909.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   342 bits (877),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 312/529 (59%), Gaps = 92/529 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
              +  IE+ LG+   FLIY++LE+V+I+LL +DGFLAF   E AK F L++PC  CTRID 
Sbjct  5     IKILIEEKLGKFPQFLIYAILEWVVIILLFIDGFLAFICNELAKLFGLRIPCLLCTRIDH  64

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHRN NFYYND+ICE HK+DISSL+YCHVHKK+SDI+++C+ CLLSFA +KDS     
Sbjct  65    VLVHRNPNFYYNDSICEVHKKDISSLAYCHVHKKLSDIRSICDGCLLSFATEKDSDCDRY  124

Query  567   dyyaaddvkSVNVF-------------------ADKPNFQRCSCCMEFLGGK--GKYTRS  683
                     K ++ F                    D     RCSCC + L  +   K+ RS
Sbjct  125   KSLVGILHKDIDCFVEDDQRNLVKSGKKDEGLQGDLTGVPRCSCCGDPLKTRPSSKFIRS  184

Query  684   --MSQVAPPPSPRA----WRNNETDHPD--------------------DNENATNGD---  776
               M+  AP PSPRA    W+N +  +P+                    ++E+A+ GD   
Sbjct  185   SSMNANAPTPSPRAPLLSWKNEDGRNPELPHIRYTELKFMSDNDSEIPEDEDASIGDNQP  244

Query  777   GRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMS  944
             GR+D ++  V    + E + + + KTP    GN KF GIPLSDS    PR    K  +M 
Sbjct  245   GREDTKAATVPLLPDSEDINEDASKTPLFVRGN-KFFGIPLSDSAQASPRYRAGKKFSMD  303

Query  945   IDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnas  1124
                  L  +D N          NE +G + I+  LKRQV L+RKSL+++ MELDEER+AS
Sbjct  304   KPDFVLEPNDIN--------ALNEADGDS-ILTRLKRQVRLDRKSLMALYMELDEERSAS  354

Query  1125  aiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEAL  1304
             A+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++ KR+EEI+ L
Sbjct  355   AVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLLGKRDEEIKVL  414

Query  1305  ESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHH---  1472
             E+DLDVYR+K+GPI    SE  EI+ D+++ +LK QSLSS GE S C S +++LD     
Sbjct  415   EADLDVYREKYGPIKKIGSEVCEIDDDEDYQALKSQSLSSSGEKSECGSPSELLDQSGIG  474

Query  1473  -------------------EVYLDSDNDRSHHSALLRTIPETTSATPAV  1562
                                E  LD +++RS+   LL+ + E   + P+V
Sbjct  475   EKKRSFDRSMEPGAGGTLDESSLDFEHERSYLLGLLKDV-ERNMSVPSV  522



>ref|XP_010318954.1| PREDICTED: uncharacterized protein LOC101263101 isoform X2 [Solanum 
lycopersicum]
Length=598

 Score =   341 bits (874),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 226/523 (43%), Positives = 302/523 (58%), Gaps = 86/523 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ LGR  +F +Y+VLE+VMI+LL +DGFLA F+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKCLVEQKLGRVGVFCVYAVLEWVMILLLFIDGFLALFTNEFAKFFELKVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
               + RN +FYYN++ICE HK+DISSL+YCHVHKK+SDI+ MCE CLLSFA +K++     
Sbjct  66    IFIKRNSSFYYNESICEGHKKDISSLAYCHVHKKLSDIRNMCEGCLLSFATEKEADCDKY  125

Query  567   dyyaaddvkSVNVFADKPN--------------------FQRCSCCMEFLGGKGKYTRSM  686
                     K ++ F D                        + CSCC E L  + KY R+ 
Sbjct  126   KSLVGILHKDIDCFVDDDKRMSIKSVKNEEEVIKTASVVLRNCSCCGEPLKLRTKYARNS  185

Query  687   S------QVAPPPSPRA---WRNNETDHPD-------------DNENATNGD------GR  782
             S        AP  SPR+   W+N E+ + +             DNE+    D      GR
Sbjct  186   SINGNHYTQAPASSPRSPLTWKNEESGNMELPRIQYTKLKFSSDNESILPDDEGHQNAGR  245

Query  783   DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTK---KTRTMSIDY  953
             +D ++       + E + + S KTP +    NKF GIPL+DS + S K   K R +  D 
Sbjct  246   EDIKAATAPLLPDPEDIHEESSKTPVS--ARNKFFGIPLTDSAQASPKWPNKPRKLGGDK  303

Query  954   SALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaia  1133
             S    SD N+      +  NE +    I+  LKRQV L+RKSL+ + MELDEER+ASA+A
Sbjct  304   SEFI-SDAND-----ASAVNEADDD--IVHSLKRQVRLDRKSLMELYMELDEERSASAVA  355

Query  1134  annamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESD  1313
             ANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q++KD++LKREEEI+ LE++
Sbjct  356   ANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQVMKDLVLKREEEIKVLEAE  415

Query  1314  LDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSF-GEMSCRSLTDVLDHH------  1472
             +D YR+++G I    SE  E++ DD++  L+ QS SSF G   C S     DH+      
Sbjct  416   IDTYRERYGIIKKVGSEVCEVDADDDYQELRSQSASSFDGRSDCSSPRQA-DHNGVNGFH  474

Query  1473  -------------EVYLDSDNDRSHHSALLRTIPETTSATPAV  1562
                          E  LD +N+RS+   LL T+ +     P V
Sbjct  475   IGCPGEYRDENIDESNLDFENERSYLQGLLTTLEKQIKIPPDV  517



>ref|XP_009616413.1| PREDICTED: uncharacterized protein LOC104108954 [Nicotiana tomentosiformis]
Length=608

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 231/526 (44%), Positives = 305/526 (58%), Gaps = 92/526 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+CF++Q LG+   F +Y++LE+V+I+ L +DGFLAFF+ EFAKFFEL +PC  CTRID 
Sbjct  6     FKCFVDQKLGKFVHFFLYAILEWVLIITLFIDGFLAFFANEFAKFFELNIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds----s  566
              LVHRN NFYYND+IC+ HK+D+SSL+YC+VHKK+S+IK MCE CLLSFA +KD+     
Sbjct  66    VLVHRNSNFYYNDSICDVHKKDLSSLAYCYVHKKLSEIKNMCEGCLLSFATEKDADCHRY  125

Query  567   dyyaaddvkSVNVFA---------------------DKPNFQRCSCCMEFLGGKGKYTRS  683
                A    K ++ F                      +K    RCSCC E L  + KY R+
Sbjct  126   KSLAGILHKDIDCFVGDDMKVSMKTGKKELDEIIQIEKGIVHRCSCCGEPLKMRSKYARN  185

Query  684   MS------QVAPPPSPRA---------WRN-NETDH--------------PDDNENATNG  773
              S        AP PSPRA         WRN  ET H              PDD E  +N 
Sbjct  186   TSINGRSYSQAPAPSPRASPRAPLLGAWRNIEETRHVESPRIRYTELKFIPDD-EGPSNA  244

Query  774   DGRDDNRSLAVSeeeeeeGLEDSSCKTP-CNRGGNNKFVGIPLSDS----PRMSTKKTRT  938
              G++D ++  +      E   ++ CKTP C R   NKF GIPL+DS    PR+S  + R 
Sbjct  245   -GKEDVKAATMPVLAHSEITHEAPCKTPNCTR---NKFFGIPLTDSAQESPRLSRHRPRK  300

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               +       S+ N+    T++  NE      I+  LK+QV L+RKSLV++ MELDEER+
Sbjct  301   SWLSDKIEVTSEAND----TSSALNELEDD--ILHRLKKQVHLDRKSLVALYMELDEERS  354

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + D +LK+EEE++
Sbjct  355   ASAIAANNAMAMITRLQAEKAAVEMEAFQYQRMMEEQAEYDQEALQFMNDELLKKEEEMK  414

Query  1299  ALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHHE  1475
              LE++L+ YR+K+G I +  SE  E++ D+++  LK Q LSS  E S C SL +V D H 
Sbjct  415   VLEAELETYREKYGHIKIVGSEVCEVDADEDYQELKSQCLSSISERSDCASLDEV-DRHR  473

Query  1476  V-------------------YLDSDNDRSHHSALLRTIPETTSATP  1556
             V                    LD +  RS+   LL  + E    +P
Sbjct  474   VNERPFQCSGEHGGVNVDDSQLDFEKQRSYLMGLLTDVVEKIKTSP  519



>gb|EYU42505.1| hypothetical protein MIMGU_mgv1a003405mg [Erythranthe guttata]
Length=587

 Score =   340 bits (871),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 226/519 (44%), Positives = 316/519 (61%), Gaps = 79/519 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             FR F+E+ LG    FLIY++ E+++I+LL VDGFLAF S E A+FFEL++PC  CTR+D 
Sbjct  6     FRTFVEEKLGTFPHFLIYAIFEWLVIILLFVDGFLAFVSNEIARFFELRIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              L+HR+ NFYYND+ICE+HKRDISSL+YC+VHKK+SDI+TMC+NCLLSFA +KDS     
Sbjct  66    ILIHRDSNFYYNDSICEAHKRDISSLAYCNVHKKLSDIRTMCQNCLLSFATEKDSDFDKY  125

Query  567   dyyaaddvkSVNVFADK------PNFQR----------------CSCCMEFLGGKG--KY  674
                     K  N F ++       +F++                CSCC E L  +   K+
Sbjct  126   KSLVGILHKDANCFVEEERKFLMKSFRKDEMDIALDERSRVLMCCSCCGEPLKSRSALKF  185

Query  675   TRSMSQVAPPPSPRA----WRNNETDHPD--------------------DNENATNGDGR  782
              RS+S  AP PSPRA     RN ET + D                    ++E+ TNG  R
Sbjct  186   NRSLSMSAPAPSPRAPYFPGRNEETGNMDLPHIRYTELKLMSDTDSELHEDEDVTNG-IR  244

Query  783   DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSID  950
             +D ++ AV    + E + + + +TPC   GN +F GI LSDS    PR + + TR +++D
Sbjct  245   EDAKAAAVPLLPDAEDINEDATRTPCFTRGN-RFFGISLSDSGQASPRWAHRGTRKITVD  303

Query  951   YSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasai  1130
                L+ +DP           +E +G   I+  L+RQV L+R+SL+++ MELDEER+ASA+
Sbjct  304   KLDLASADP---------ATDEVDGD--IVTRLRRQVRLDRRSLMALYMELDEERSASAV  352

Query  1131  aannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALES  1310
             AANNAMAMITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q++KD++ KREE+++ALES
Sbjct  353   AANNAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQVMKDLLFKREEDVKALES  412

Query  1311  DLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-C----RSLTDVLDHHE  1475
             +L+ YR+K+G I    SE  E++ D+++  ++ Q+LS   E S C    RS     D   
Sbjct  413   ELESYREKYGHIKKIGSEVCEMDADEDYQDMRSQALSLVSERSDCGGSDRSENTPEDRAN  472

Query  1476  V-----YLDSDNDRSHHSALLRTIPETTSATPAVQLPEK  1577
             V      LD D +RS    LLR + E  ++ P   + E+
Sbjct  473   VPEESSSLDFDGERSFLLGLLRNLEEKINSPPEFLVVEE  511



>ref|XP_009789178.1| PREDICTED: uncharacterized protein LOC104236857 [Nicotiana sylvestris]
Length=604

 Score =   340 bits (871),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 229/521 (44%), Positives = 303/521 (58%), Gaps = 86/521 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+CF +Q LG+   F +Y++LE+V+I+ L +DGFLAFF+ EFAKFFEL +PC  CTRID 
Sbjct  6     FKCFGDQKLGKFVHFFVYAILEWVLIITLFIDGFLAFFANEFAKFFELNIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHRN NFYYND+IC+ HK+D+SSL+YCHVHKK+S+IK MCE CLLSFA +KD+     
Sbjct  66    VLVHRNSNFYYNDSICDVHKKDLSSLAYCHVHKKLSEIKNMCEGCLLSFATEKDADCHRY  125

Query  567   dyyaaddvkSVNVFA-----------------DKPNFQRCSCCMEFLGGKGKYTRSMS--  689
                A    K ++ FA                 +K    RCSCC E L  + KY R+ S  
Sbjct  126   KSLAGILHKDIDCFAGDDMKTGKKELAETIQIEKGIVHRCSCCGEPLKMRSKYARNTSIN  185

Query  690   ----QVAPPPSPRA---------WRN-NETDHPD-------------DNENATNGDGRDD  788
                   AP PSPRA         WRN  E  H +             D+E  +N  G++D
Sbjct  186   GRSYSQAPAPSPRASPRAPLLGAWRNIEEVRHVESPRSRYTDLKFIQDDEGPSNA-GKED  244

Query  789   NRSLAVSeeeeeeGLEDSSCKTP-CNRGGNNKFVGIPLSDS----PRMSTKKTRTMSIDY  953
              ++  +      E   ++ CKTP C R   NKF GIPL+DS    PR+S  + R   +  
Sbjct  245   VKAATMPLLAHSEITHEAPCKTPNCTR---NKFFGIPLTDSAQESPRLSRHRPRKSWLSD  301

Query  954   SALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaia  1133
                  S+ N+    T++  NE      I+  LK+QV L+RKSLV++ MELDEER+ASAIA
Sbjct  302   KIEVTSEGND----TSSALNELEDD--ILHRLKKQVHLDRKSLVALYMELDEERSASAIA  355

Query  1134  annamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESD  1313
             ANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + D +LK+EEE++ LE++
Sbjct  356   ANNAMAMITRLQAEKAAVEMEAFQYQRMMEEQAEYDQEALQFMNDELLKKEEEMKVLEAE  415

Query  1314  LDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHHEV----  1478
             L+ YR+++G I    SE  E++ D+++  LK Q LSS  E S C SL D +D H V    
Sbjct  416   LETYRERYGHIKTVGSEVCEVDADEDYQELKSQCLSSISERSDCASL-DEVDRHRVNERP  474

Query  1479  ---------------YLDSDNDRSHHSALLRTIPETTSATP  1556
                             LD +  RS+   LL  + E    +P
Sbjct  475   FQCSGEHGGVNVDDSQLDFEKQRSYLMGLLTDVVEKIKTSP  515



>ref|XP_011071775.1| PREDICTED: uncharacterized protein LOC105157161 isoform X2 [Sesamum 
indicum]
Length=602

 Score =   330 bits (847),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 212/477 (44%), Positives = 290/477 (61%), Gaps = 71/477 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             FR F+EQ LG    FL+Y V E+V+I+LL +DGFLAF S E A+FFEL++PC  CTRID 
Sbjct  6     FRSFVEQKLGTFPHFLVYVVFEWVVIILLFIDGFLAFVSNEIARFFELRIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHR+ NFYYN++ICE HK+DISSL+YC+VHKK+SDI+ MC+ CLLSFA +K S     
Sbjct  66    VLVHRDSNFYYNESICEIHKKDISSLAYCNVHKKLSDIRCMCQGCLLSFATEKGSDFDKY  125

Query  579   addvkSVNVFAD-------------------------KPNFQRCSCCMEFLGGKG--KYT  677
                V  ++  AD                         K    RCSCC E L  +   KY+
Sbjct  126   KSLVGILHKDADYFVEDDRKLLVKPLKKDDSEIASDEKSEMLRCSCCGEPLKSRSSTKYS  185

Query  678   RSMSQVAPPPSPRAW----RN---------------------NETDHPDDNENATNGDG-  779
             RS+S  AP PSPRA     RN                     NE + P+D E+A N +  
Sbjct  186   RSLSMSAPAPSPRASLFGSRNEEGGNMDLPSVRYTELKLVADNELELPED-EDAANAETQ  244

Query  780   -RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMS  944
              R+D ++  V    + E L + + +TP    GN KF GIPLSD    SPR + + ++ ++
Sbjct  245   VREDVKAARVPLLPDTEDLGEDAARTPSFTRGN-KFFGIPLSDTAQMSPRWANRASKKLT  303

Query  945   IDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnas  1124
             +D             ++      E +G+  I+  LKRQV ++RK+L  + MELDEER+A+
Sbjct  304   VDKLDF---------ILDAHDATEPDGN--ILTRLKRQVRMDRKALTELYMELDEERSAA  352

Query  1125  aiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEAL  1304
             A+AANNAMAMITRLQAEKA+  M+ASQYQRMMEEQAEYD+E  Q++KDM+ KR+E+I+AL
Sbjct  353   AVAANNAMAMITRLQAEKAAVQMEASQYQRMMEEQAEYDQEALQLMKDMLFKRDEDIKAL  412

Query  1305  ESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRSLTDVLDHHE  1475
             E++L++YR+K+G I    SE  EI+ +D++  +K Q+LS F + S  S ++  D  E
Sbjct  413   EAELEMYREKYGHIKKIGSEICEIDAEDDYQDMKSQALSMFSDKSDGSSSNGADRSE  469



>ref|XP_011071774.1| PREDICTED: uncharacterized protein LOC105157161 isoform X1 [Sesamum 
indicum]
Length=603

 Score =   330 bits (846),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 212/478 (44%), Positives = 290/478 (61%), Gaps = 72/478 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             FR F+EQ LG    FL+Y V E+V+I+LL +DGFLAF S E A+FFEL++PC  CTRID 
Sbjct  6     FRSFVEQKLGTFPHFLVYVVFEWVVIILLFIDGFLAFVSNEIARFFELRIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHR+ NFYYN++ICE HK+DISSL+YC+VHKK+SDI+ MC+ CLLSFA +K S     
Sbjct  66    VLVHRDSNFYYNESICEIHKKDISSLAYCNVHKKLSDIRCMCQGCLLSFATEKGSDFDKY  125

Query  579   addvkSVNVFAD-------------------------KPNFQRCSCCMEFLGGKG--KYT  677
                V  ++  AD                         K    RCSCC E L  +   KY+
Sbjct  126   KSLVGILHKDADYFVEDDRKLLVKPLKKDDSEIASDEKSEMLRCSCCGEPLKSRSSTKYS  185

Query  678   RSMSQVAPPPSPRAW----RN---------------------NETDHPDDNENATNGDG-  779
             RS+S  AP PSPRA     RN                     NE + P+D E+A N +  
Sbjct  186   RSLSMSAPAPSPRASLFGSRNEEGGNMDLPSVRYTELKLVADNELELPED-EDAANAETQ  244

Query  780   --RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTM  941
               R+D ++  V    + E L + + +TP    GN KF GIPLSD    SPR + + ++ +
Sbjct  245   AVREDVKAARVPLLPDTEDLGEDAARTPSFTRGN-KFFGIPLSDTAQMSPRWANRASKKL  303

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
             ++D             ++      E +G+  I+  LKRQV ++RK+L  + MELDEER+A
Sbjct  304   TVDKLDF---------ILDAHDATEPDGN--ILTRLKRQVRMDRKALTELYMELDEERSA  352

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             +A+AANNAMAMITRLQAEKA+  M+ASQYQRMMEEQAEYD+E  Q++KDM+ KR+E+I+A
Sbjct  353   AAVAANNAMAMITRLQAEKAAVQMEASQYQRMMEEQAEYDQEALQLMKDMLFKRDEDIKA  412

Query  1302  LESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRSLTDVLDHHE  1475
             LE++L++YR+K+G I    SE  EI+ +D++  +K Q+LS F + S  S ++  D  E
Sbjct  413   LEAELEMYREKYGHIKKIGSEICEIDAEDDYQDMKSQALSMFSDKSDGSSSNGADRSE  470



>ref|XP_006354808.1| PREDICTED: uncharacterized protein LOC102594354 [Solanum tuberosum]
Length=611

 Score =   323 bits (827),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 221/526 (42%), Positives = 301/526 (57%), Gaps = 90/526 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+CF+++ +G+ A F +Y++LE+V+I++L VDGFLAFFS EFAKFFEL +PC  CTRID 
Sbjct  6     FKCFVDKKMGKFAFFFLYAILEWVLIIVLFVDGFLAFFSNEFAKFFELNIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds----s  566
              LV+RN +FYYN++ICE HK+D+S+L+YCHVHKK+S+IK MCE CLLSFA ++D+     
Sbjct  66    VLVNRNSSFYYNESICEVHKKDLSALAYCHVHKKLSEIKNMCEGCLLSFATERDADCERY  125

Query  567   dyyaaddvkSVNVFA---------------------DKPNFQRCSCCMEFLGGKGKYTRS  683
                A    K ++ FA                     ++    RCSCC E L  + K+ R+
Sbjct  126   KSLAGVLKKDIDCFAGDDARLSVRTGKKELDEAIQIERGVVARCSCCGEPLKMRSKFARN  185

Query  684   MS------QVAPPPSPRA---------WRN---------------NETDHPDDNENATNG  773
              S        AP PSPRA         WRN                E     D+E  ++G
Sbjct  186   ASINGRSYSQAPAPSPRASPRAPLLGAWRNIEEVRHLESPRSVRYTELKFTQDDEGPSHG  245

Query  774   DGRDDNRSLAVSeeeeeeGLE-DSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRT  938
              G++D ++  +    + E    DSSCKTP N    N+F GIPLSDS    PR S  + R 
Sbjct  246   -GKEDVKAATMPLLPDSEDTHIDSSCKTPNN--TRNRFFGIPLSDSAQASPRFSHHRPRK  302

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               I       S+ N+ + V +      +    ++  LK+QV L+RKSLV + MELDEER+
Sbjct  303   SWISDKLDFTSEANDMNSVPS------DLEEDVLNRLKKQVRLDRKSLVELYMELDEERS  356

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + D +LK+E+E++
Sbjct  357   ASAIAANNAMAMITRLQAEKAAVEMEAFQYQRMMEEQAEYDQEALQFMNDDLLKKEDEMK  416

Query  1299  ALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHHE  1475
              L+ +L+ YR+K+G I    SE  E++ D+++  LK Q LSS  E S C S  +  DHH 
Sbjct  417   LLQVELETYREKYGLIKTIGSEVCEVDDDEDYQELKSQCLSSISERSDCASPFEA-DHHR  475

Query  1476  V-------------------YLDSDNDRSHHSALLRTIPETTSATP  1556
             V                    LD +  RS+   LL  + E    +P
Sbjct  476   VNERLFECPGENGGVNVEESQLDFEKQRSYLMGLLTDVVEKIQISP  521



>ref|XP_004241555.1| PREDICTED: uncharacterized protein LOC101246638 [Solanum lycopersicum]
Length=610

 Score =   322 bits (825),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 221/526 (42%), Positives = 300/526 (57%), Gaps = 90/526 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+CF++Q LG+ A F +Y++LE+V+I++L VDGFLAFF  E+AKFFEL +PC  CTRID 
Sbjct  6     FKCFVDQKLGKFAFFFLYAILEWVLIIVLFVDGFLAFFCNEYAKFFELNIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LV+RN +FYYN++ICE HK+D+S+L+YCHVHKK+S+IK MCE CLLSFA ++D+     
Sbjct  66    VLVNRNSSFYYNESICEVHKKDLSALAYCHVHKKLSEIKNMCEGCLLSFATERDADCERY  125

Query  567   dyyaaddvkSVNVFA---------------------DKPNFQRCSCCMEFLGGKGKYTRS  683
                A    K ++ FA                     ++    RCSCC E L  + K+ R+
Sbjct  126   KSLAGVLKKDIDCFAGDDARLTVRTGKKELDEAIQIERGVVARCSCCGEPLKMRSKFARN  185

Query  684   MS------QVAPPPSPRA---------WRN---------------NETDHPDDNENATNG  773
              S        AP PSPRA         WRN                E     D+E  ++G
Sbjct  186   ASINGRSYSQAPAPSPRASPRAPLLGAWRNIEEVRHLESPRSVRYTELKFTQDDEGPSHG  245

Query  774   DGRDDNRSLAVSeeeeeeGLE-DSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRT  938
              G++D ++  +    + E    DSSCKTP N    N+F GIPLSDS    PR S  + R 
Sbjct  246   -GKEDMKAATMPLLPDSEDTNIDSSCKTPNN--TRNRFFGIPLSDSAQASPRFSHHRPRK  302

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               I       S+ N+ + V +      +    ++  LK+QV L+RKSLV + MELDEER+
Sbjct  303   SWISDKLDFTSEANDLNSVPS------DLEEDVLNRLKKQVRLDRKSLVELYMELDEERS  356

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + D +LK+E+E++
Sbjct  357   ASAIAANNAMAMITRLQAEKAAVEMEAFQYQRMMEEQAEYDQEALQFMNDDLLKKEDEMK  416

Query  1299  ALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS-CRSLTDVLDHHE  1475
              L+ +L+ YR+K+G I    SE  E++ D+++  LK Q LSS  E S C S  +  DHH 
Sbjct  417   LLQVELETYREKYGLIKTIGSEVCEVDDDEDYQELKSQCLSSISERSDCASPFEA-DHHR  475

Query  1476  V-------------------YLDSDNDRSHHSALLRTIPETTSATP  1556
             V                    LD +  RS+   LL  + E    +P
Sbjct  476   VNERLFECPAENGGVNVEESQLDFEKQRSYLMGLLTDVVEKIQISP  521



>ref|XP_006339978.1| PREDICTED: uncharacterized protein LOC102605908 isoform X1 [Solanum 
tuberosum]
Length=518

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 199/427 (47%), Positives = 263/427 (62%), Gaps = 57/427 (13%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ +G+ A F IY++LE+VMI+LL ++GFLAFFS EFAK F+LK+PC  CTRID 
Sbjct  3     FKCCVEQKMGKFAFFFIYALLEWVMILLLFIEGFLAFFSNEFAKLFDLKIPCLLCTRIDH  62

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds----s  566
              LVHR+ NFYYND+ICE HK+DISSL+YCHVH+K+SDIK MCE CLLSFA +KD+     
Sbjct  63    ILVHRDANFYYNDSICEVHKKDISSLAYCHVHRKLSDIKNMCEGCLLSFATEKDADCDRY  122

Query  567   dyyaaddvkSVNVFADKP----------------NFQRCSCCMEFLGGKGKYTRSMSQVA  698
                     K ++ F +                  +F RCSCC E L  + K T       
Sbjct  123   KSLVGILHKDIDCFVEDALHMKKEDHEVMLQTTTSFVRCSCCGEHLKIRSKST-------  175

Query  699   PPPSPRAWRNNETDHPD--DNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGG  872
              P S   WRN +          +  +G GR+DN   A SEE     + D S KT      
Sbjct  176   -PSSQAPWRNEDYTQLKFIFVNDLDDGAGREDNIKGANSEE-----INDDSLKTA--NFT  227

Query  873   NNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGII  1040
              NKF GIPLSD    SPR S  + R +S++  + S    N  D               I+
Sbjct  228   RNKFFGIPLSDSCQASPRWS-HRPRKLSMELISESNDVVNESD-------------NDIL  273

Query  1041  QHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMM  1220
               LKRQV L+ KS++++ MELDEER+A+A+AANNAMAMITRLQAEKA+  M+A QYQRMM
Sbjct  274   HRLKRQVHLDHKSVIALYMELDEERSAAAVAANNAMAMITRLQAEKAAVQMEALQYQRMM  333

Query  1221  EEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHS  1400
             EEQAEYD+E  Q++KD++LKREE+I+ +E  ++ YR+++G      SE  ++  D+E++S
Sbjct  334   EEQAEYDQEALQVMKDLLLKREEDIKVMEVVVETYRERYGDTKRVGSEVCDV--DEEWNS  391

Query  1401  LKFQSLS  1421
               F SLS
Sbjct  392   HSFSSLS  398



>ref|XP_006339979.1| PREDICTED: uncharacterized protein LOC102605908 isoform X2 [Solanum 
tuberosum]
Length=517

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 200/426 (47%), Positives = 263/426 (62%), Gaps = 56/426 (13%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ +G+ A F IY++LE+VMI+LL ++GFLAFFS EFAK F+LK+PC  CTRID 
Sbjct  3     FKCCVEQKMGKFAFFFIYALLEWVMILLLFIEGFLAFFSNEFAKLFDLKIPCLLCTRIDH  62

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds----s  566
              LVHR+ NFYYND+ICE HK+DISSL+YCHVH+K+SDIK MCE CLLSFA +KD+     
Sbjct  63    ILVHRDANFYYNDSICEVHKKDISSLAYCHVHRKLSDIKNMCEGCLLSFATEKDADCDRY  122

Query  567   dyyaaddvkSVNVFADKP----------------NFQRCSCCMEFLGGKGKYTRSMSQVA  698
                     K ++ F +                  +F RCSCC E L  + K T       
Sbjct  123   KSLVGILHKDIDCFVEDALHMKKEDHEVMLQTTTSFVRCSCCGEHLKIRSKST-------  175

Query  699   PPPSPRAWRNNE-TDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGN  875
              P S   WRN + T       N  +  GR+DN   A SEE     + D S KT       
Sbjct  176   -PSSQAPWRNEDYTQLKFIFVNDLDDGGREDNIKGANSEE-----INDDSLKTA--NFTR  227

Query  876   NKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQ  1043
             NKF GIPLSD    SPR S  + R +S++  + S    N  D               I+ 
Sbjct  228   NKFFGIPLSDSCQASPRWS-HRPRKLSMELISESNDVVNESD-------------NDILH  273

Query  1044  HLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMME  1223
              LKRQV L+ KS++++ MELDEER+A+A+AANNAMAMITRLQAEKA+  M+A QYQRMME
Sbjct  274   RLKRQVHLDHKSVIALYMELDEERSAAAVAANNAMAMITRLQAEKAAVQMEALQYQRMME  333

Query  1224  EQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSL  1403
             EQAEYD+E  Q++KD++LKREE+I+ +E  ++ YR+++G      SE  ++  D+E++S 
Sbjct  334   EQAEYDQEALQVMKDLLLKREEDIKVMEVVVETYRERYGDTKRVGSEVCDV--DEEWNSH  391

Query  1404  KFQSLS  1421
              F SLS
Sbjct  392   SFSSLS  397



>ref|XP_011042659.1| PREDICTED: uncharacterized protein LOC105138308 [Populus euphratica]
Length=576

 Score =   304 bits (778),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 203/443 (46%), Positives = 273/443 (62%), Gaps = 50/443 (11%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG+  LFLIY+VLE+V+I +L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRFVEQELGKLPLFLIYAVLEWVLIAVLFIDGFLAFFANEFAKFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds-----  563
              LVHR+ +FYYN++IC +HK+++S L+YCHVHKK+SDI+ MCE CLLSFA +++S     
Sbjct  66    VLVHRDADFYYNESICGTHKKEVSCLAYCHVHKKLSDIRNMCEGCLLSFATERESDCDLF  125

Query  564   --------------------sdyyaaddvkSVNVFADKPNFQRCSCCMEFLG----GKGK  671
                                 S          + V ADK +  +CSCC E L      KGK
Sbjct  126   KFPAGVLHKDIELSADDDRDSHLRLPALGNDIVVPADKSSPHQCSCCGEPLKVKSYSKGK  185

Query  672   YTRSMSQVAPPPSPRA---WRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDS  842
                 +SQ AP PSPRA      NE     D  +    + ++D ++  V    E E + + 
Sbjct  186   IAGVLSQ-APAPSPRAPFVTLRNEGPRKLDLSHVRYTELKEDVKAAMVPLLTEAENMNEE  244

Query  843   SCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGF  1010
               +TP    G NKF GIPL+D    SPR  T+  R   +D + LS       + +  T  
Sbjct  245   --RTPTFSRG-NKFFGIPLTDSAAASPRAFTRFPRKSLLDKTELSS------ETIEGTSL  295

Query  1011  NEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKH  1190
             +       I+QHLK+QV L+ KSL+++ MELDEER+ASA+AANNAMAMITRLQAEKA+  
Sbjct  296   SNEVDDDSILQHLKKQVRLDCKSLMALYMELDEERSASAVAANNAMAMITRLQAEKAAVQ  355

Query  1191  MQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFF  1370
             M+A QYQRMM+EQAEYD+E  Q  +D++ KREE+I+ LE++L  YR+K+G   L   +F 
Sbjct  356   MEALQYQRMMDEQAEYDQEALQATRDIVSKREEQIKTLEAELVAYREKYGV--LMGEDFM  413

Query  1371  EI--EGDDEFHSLKFQSLSSFGE  1433
             E   E D++ H LK +S SS+ E
Sbjct  414   ESGDEIDEDCHDLKTESHSSYTE  436



>ref|XP_010314142.1| PREDICTED: uncharacterized protein LOC101260615 [Solanum lycopersicum]
Length=518

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 205/475 (43%), Positives = 282/475 (59%), Gaps = 63/475 (13%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+C +EQ +G+ A FLIY++LE+VMI+LL ++GFLAFFS E+AK F+LK+PC  CTRID 
Sbjct  3     FKCCVEQKMGKFAFFLIYALLEWVMILLLFIEGFLAFFSNEYAKLFDLKIPCLLCTRIDH  62

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds----s  566
              LVHR+ +FYYND+ICE HK+DISSL+YCHVHKK+SDIK MCE CLLSFA +KD+     
Sbjct  63    ILVHRDASFYYNDSICEVHKKDISSLAYCHVHKKLSDIKNMCEGCLLSFATEKDADCDRY  122

Query  567   dyyaaddvkSVNVFADKP----------------NFQRCSCCMEFLGGKGKYTRSMSQVA  698
                     K ++ F                    +F  CSCC E L  + K        +
Sbjct  123   KSLVGILHKDIDCFVKDALHTKKEDNEVMLQTTTSFVWCSCCGEPLKMRSK--------S  174

Query  699   PPPSPRAWRNNE-TDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGN  875
              P S   WRN + T     ++N  +  GR+DN   A  E      + D++ KT       
Sbjct  175   NPSSQAPWRNEDYTQLKFISDNDLDDGGREDNIKGASEE------INDNALKTA--NFTR  226

Query  876   NKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQ  1043
             N F GIPLSD    SPR S  + R +S++  + S    N  D               I+ 
Sbjct  227   NMFFGIPLSDSCQASPRWS-HRPRKLSMELISESNDVVNESD-------------NDILH  272

Query  1044  HLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMME  1223
              LKRQV L+ KS++++ MELDEER+A+A+AANNAMAMITRLQAEKA+  M+A QYQRMME
Sbjct  273   RLKRQVHLDHKSVIALYMELDEERSAAAVAANNAMAMITRLQAEKAAVQMEALQYQRMME  332

Query  1224  EQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSL  1403
             EQAEYD+E  Q++KD++LKREE+I+ +E  ++ YR+++G +    SE  E+    E++S 
Sbjct  333   EQAEYDQEALQVMKDLLLKREEDIKVMEVVVETYRERYGDMKGVGSEVCEVGEYQEWNSY  392

Query  1404  KFQSLSSFGEMSCRSLTDVLDHH-----EVYLDSDNDRSHHSALLRTIPETTSAT  1553
              F SLS     +C S  D  D H     E +LD +++R +   LL  + +  + +
Sbjct  393   SFSSLSE--RSTCVS-PDEGDQHRLGPFEPHLDFEHERCYLMGLLTKLEDKITTS  444



>ref|XP_002318621.1| hypothetical protein POPTR_0012s07520g [Populus trichocarpa]
 gb|EEE96841.1| hypothetical protein POPTR_0012s07520g [Populus trichocarpa]
Length=611

 Score =   301 bits (772),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 284/469 (61%), Gaps = 78/469 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG+  LFLIY+VLE+V+I +L +DGFLAFF+ EFAKFFELK+PC  CTRID 
Sbjct  6     FKRFVEQELGKLPLFLIYAVLEWVLIAVLFIDGFLAFFANEFAKFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
              LVHR+ +FYYN++IC +HK+++S L+YCHVHKK+SDI+ MCE CLLSFA +++S     
Sbjct  66    VLVHRDADFYYNESICGTHKKEVSCLAYCHVHKKLSDIRNMCEGCLLSFATERESDCDLF  125

Query  567   dyyaaddvkSVNVFADKPN----------------------FQRCSCCMEFLG----GKG  668
              + A    K + +FAD                          Q CSCC E L      KG
Sbjct  126   KFPAGVLHKDIELFADDDRDIHLRLPALGNDIVVPADKSSPHQYCSCCGEPLKVKSYSKG  185

Query  669   KYTRSMSQVAPPPSPRA------------------------WRNNETDHPDDNE--NATN  770
             K    +SQ AP PSPRA                        +  N+++  DD +  NA++
Sbjct  186   KIAGMLSQ-APAPSPRAPFVTLRNEGPRKLDLSHVRYTELKFSENDSELHDDEDASNASH  244

Query  771   GDG--RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKT  932
              D   R+D ++  V    E E + +   +TP    GN KF GIPL+DS    PR  T+  
Sbjct  245   LDKQFREDVKAAMVPLLTEAENMNEE--RTPTFSRGN-KFFGIPLTDSAAASPRAFTRFP  301

Query  933   RTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEE  1112
             R   +D + LS        L      NE +G + I+QHLK+QV L+RKSL+++ MELDEE
Sbjct  302   R--KLDKTELSSETIEGASLS-----NEVDGES-ILQHLKKQVRLDRKSLMALYMELDEE  353

Query  1113  RnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEE  1292
             R+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q  +D++ KREE+
Sbjct  354   RSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATRDIVSKREEQ  413

Query  1293  IEALESDLDVYRDKFGPINLACSEFFEI--EGDDEFHSLKFQSLSSFGE  1433
             I+ LE++L  YR+K+G   L   +F E   E D++ H LK  S SS+ E
Sbjct  414   IKTLEAELVAYREKYGV--LMGEDFMESGDEIDEDCHDLKTDSHSSYTE  460



>gb|KDO69844.1| hypothetical protein CISIN_1g037589mg [Citrus sinensis]
Length=532

 Score =   298 bits (763),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 274/471 (58%), Gaps = 78/471 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ ++EQ LG+   FLIY+VLE+V+I++L +DGFLA  + EFAKFFELK+PC  CTRID 
Sbjct  6     FKSYVEQELGKFPHFLIYAVLEWVLIIILFIDGFLALAANEFAKFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHRN NFYYN++ICE+HK+D+SSL+YCHVHKK+SDI+ MCE CLLSFA  ++S D   
Sbjct  66    VLVHRNPNFYYNESICEAHKKDVSSLAYCHVHKKLSDIRKMCEPCLLSFATGRESGDCDT  125

Query  579   addvkSV-------------------------NVFADKPNFQRCSCCMEFLG----GKGK  671
                +  +                          V  +K + Q CSCC E L      KGK
Sbjct  126   YKSLVGILQKDMELIVDDDEMQLTLPPNKKDEMVHVEKSSVQCCSCCGEPLKVKSYPKGK  185

Query  672   YTRSMSQVAPPPSPRA---------WRN----------------------NETDHPDDNE  758
              +   SQ AP PSPRA          RN                      NE++ P+D E
Sbjct  186   NSGLTSQ-APAPSPRASFLTSRIEEQRNMDLTRNLELPHIRYTELKFSADNESELPED-E  243

Query  759   NATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTK  926
              ++N      + + A +     +  + +  KTP    G NKF GIPLSD    SPR ST+
Sbjct  244   GSSNALSLIKDETTAAAVPLLTDAEDFNEDKTPTFIRG-NKFFGIPLSDSAQASPRWSTR  302

Query  927   KTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELD  1106
               R   ++ +  +  + +          NE  G + I+ HL RQV L+RKSL+ + MELD
Sbjct  303   ILRKSPLEKTEDAEGNVS----------NEAYGDS-ILHHLNRQVRLDRKSLMDLYMELD  351

Query  1107  EERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKRE  1286
             EER+A+A+AANNAMAMITRLQAEKA+  M A QYQRMMEEQAEYD+E  Q  K+++ KRE
Sbjct  352   EERSAAAVAANNAMAMITRLQAEKAAVQMDALQYQRMMEEQAEYDQEALQSTKELLTKRE  411

Query  1287  EEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS  1439
             EEI+ LE++++ YR+K+G +     +  E E DD++     +S SS  E S
Sbjct  412   EEIKDLEAEIEAYREKYGILREEEIDGQEGEADDDYQDFISKSCSSNNEKS  462



>ref|XP_006439710.1| hypothetical protein CICLE_v10024191mg [Citrus clementina]
 gb|ESR52950.1| hypothetical protein CICLE_v10024191mg [Citrus clementina]
Length=535

 Score =   298 bits (763),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 208/476 (44%), Positives = 277/476 (58%), Gaps = 85/476 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ ++EQ LG+   FLIY+VLE+V+I++L +DGFLAF + EFAKFFELK+PC  CTRID 
Sbjct  6     FKSYVEQELGKFPHFLIYAVLEWVLIIILFIDGFLAFAANEFAKFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHRN NFYYN++ICE+HK+D+SSL+YCHVHKK+SDI+ MCE CLLSFA  ++S D   
Sbjct  66    VLVHRNPNFYYNESICEAHKKDVSSLAYCHVHKKLSDIRKMCEPCLLSFATGRESGDCDT  125

Query  579   addvkSV-------------------------NVFADKPNFQRCSCCMEFLG----GKGK  671
                +  +                          V  +K + Q CSCC E L      KGK
Sbjct  126   YKSLVGILQKDMELIVDDDEMQLTLPPNKKDEMVHVEKSSVQCCSCCGEPLKVKSYPKGK  185

Query  672   YTRSMSQVAPPPSPRA---------WRN----------------------NETDHPDDNE  758
              +   SQ AP PSPRA          RN                      NE++ P+D E
Sbjct  186   NSGLTSQ-APAPSPRASFLTSRIEEQRNMDLTRNLELPHIRYTELKFSADNESELPED-E  243

Query  759   NATNGDG-----RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SP  911
              ++N        +D+  + AV    + E   +   KTP    G NKF GIPLSD    SP
Sbjct  244   GSSNALSLSKPFKDETTAAAVPLLTDAEDFNED--KTPTFIRG-NKFFGIPLSDSAQASP  300

Query  912   RMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSV  1091
             R ST+  R   ++ +  +  + +          NE  G + I+ HL RQV L+RKSL+ +
Sbjct  301   RWSTRILRKSPLEKTEDAEGNVS----------NEAYGDS-ILHHLNRQVRLDRKSLMDL  349

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
              MELDEER+A+A+AANNAMAMITRLQAEKA+  M A QYQRMMEEQAEYD+E  Q  K++
Sbjct  350   YMELDEERSAAAVAANNAMAMITRLQAEKAAVQMDALQYQRMMEEQAEYDQEALQSTKEL  409

Query  1272  ILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS  1439
             + KREEEI+ LE++++ YR+K+G +     +  E E DD++     +S SS  E S
Sbjct  410   LTKREEEIKDLEAEIEAYREKYGILREEEIDGQEGEADDDYQDFISKSCSSNNEKS  465



>ref|XP_006477536.1| PREDICTED: uncharacterized protein LOC102627363 [Citrus sinensis]
Length=527

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 205/465 (44%), Positives = 271/465 (58%), Gaps = 71/465 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ ++EQ LG+   FLIY+VLE+V+I++L +DGFLA  + EFAKFFELK+PC  CTRID 
Sbjct  6     FKSYVEQELGKFPHFLIYAVLEWVLIIILFIDGFLALAANEFAKFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHRN NFYYN++ICE+HK+D+SSL+YCHVHKK+SDI+ MCE CLLSFA  ++S D   
Sbjct  66    VLVHRNPNFYYNESICEAHKKDVSSLAYCHVHKKLSDIRKMCEPCLLSFATGRESGDCDT  125

Query  579   addvkSV-------------------------NVFADKPNFQRCSCCMEFLG----GKGK  671
                +  +                          V  +K + Q CSCC E L      KGK
Sbjct  126   YKSLVGILQKDMELIVDDDEMQLTLPPNKKDEMVHVEKSSVQCCSCCGEPLKVKSYPKGK  185

Query  672   YTRSMSQVAPPPSPRA---------------WRNNETDH--------PDDNENATNGDGR  782
              +   SQ AP PSPRA                RN E  H          DNE+    D  
Sbjct  186   NSGLTSQ-APAPSPRASFLTSRIEEQRNMDLTRNLELPHIRYTELKFSADNESELPEDEG  244

Query  783   DDN--RSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMS  944
               N  ++ A +     +  + +  KTP    G NKF GIPLSD    SPR ST+  R   
Sbjct  245   SSNALKTKAAAVPLLTDAEDFNEDKTPTFIRG-NKFFGIPLSDSAQASPRWSTRILRKSP  303

Query  945   IDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnas  1124
             ++ +  +  + +          NE  G + I+ HL RQV L+RKSL+ + MELDEER+A+
Sbjct  304   LEKTEDAEGNVS----------NEAYGDS-ILHHLNRQVRLDRKSLMDLYMELDEERSAA  352

Query  1125  aiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEAL  1304
             A+AANNAMAMITRLQAEKA+  M A QYQRMMEEQAEYD+E  Q  K+++ KREEEI+ L
Sbjct  353   AVAANNAMAMITRLQAEKAAVQMDALQYQRMMEEQAEYDQEALQSTKELLTKREEEIKDL  412

Query  1305  ESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS  1439
             E++++ YR+K+G +     +  E E DD++     +S SS  E S
Sbjct  413   EAEIEAYREKYGILREEEIDGQEGEADDDYQDFISKSCSSNNEKS  457



>ref|XP_002511483.1| hypothetical protein RCOM_1512920 [Ricinus communis]
 gb|EEF52085.1| hypothetical protein RCOM_1512920 [Ricinus communis]
Length=609

 Score =   296 bits (758),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 204/468 (44%), Positives = 273/468 (58%), Gaps = 75/468 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG+   FLIY+VLE+V+I +L +DGF+AFF+ EFA+FFELK+PC  CTRID 
Sbjct  6     FKHFVEQELGKFPHFLIYAVLEWVLIFVLFIDGFIAFFANEFARFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LV R  +FYYND+ICESHK+D+S L+YCH HKK+SDI  MCE+CLLSFA ++     + 
Sbjct  66    VLVRRAADFYYNDSICESHKKDVSCLAYCHNHKKLSDINKMCESCLLSFATERSSDCHTY  125

Query  567   dyyaaddvkSVNVFAD---------------------KPNFQRCSCCMEFLGGK----GK  671
                     K + +F D                     K +  RC+CC E L  K    G+
Sbjct  126   KSLVGILHKDIELFVDNDQDHRLTLSAGRKDEPVQVEKSSIHRCACCGEPLKAKSQLKGR  185

Query  672   YTRSMSQVAPPPSPRA---------WRNNETDH-----------------PDDNENATNG  773
              T   SQ  P PSPRA          RN +  H                  DD  NA++ 
Sbjct  186   GTGLASQ-GPTPSPRAPFANLRYEEHRNMDLSHIPYTELKYSENESELHEVDDGPNASHL  244

Query  774   DGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTM  941
               R+D ++ ++    E E + +   +TP N G  NKF GIPL+DS    PR + + +R  
Sbjct  245   -AREDVKAASLPLLTEAEDMHED--RTP-NFGRANKFFGIPLTDSANASPRWAARISRKS  300

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAG--IIQHLKRQVLLERKSLVSVCMELDEER  1115
              ++ +  S           +T  N  N S    I+ HLK QV L+RKSL+++ MELDEER
Sbjct  301   PLEKTEFSSE---------STEGNPPNESESELILHHLKGQVRLDRKSLMALYMELDEER  351

Query  1116  nasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEI  1295
             +ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++ KREE+I
Sbjct  352   SASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLLAKREEDI  411

Query  1296  EALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS  1439
              ALE++++ YR+K+G I     E    E D+++  L  QS SS+ E S
Sbjct  412   RALEAEIEQYREKYGIIREEGFEGSGDEVDEDYQDLNSQSFSSYTERS  459



>ref|XP_004489974.1| PREDICTED: uncharacterized protein LOC101494328 [Cicer arietinum]
Length=510

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 267/454 (59%), Gaps = 84/454 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+E+ +G+   F+IY +LE+V+I++L +DGFLAF + EFA+FFELK+PC+ CTR D 
Sbjct  6     FSHFVEEEMGKFPHFVIYMLLEWVLIIILFLDGFLAFIANEFARFFELKIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              +VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    VMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSVN--------------------------VFADKPNFQRCSCCMEFLG-------  659
                V  ++                          VF D  N Q+CSCC + L        
Sbjct  126   KSLVGILHKDLECFVEDGQPIQLSLKDDDGGFMEVF-DTNNTQKCSCCGKPLKVKFSSSS  184

Query  660   --GKGKYTRSMSQVAPPPSPRAW--------------------------RNNETDHPDDN  755
                KGK++RS ++ AP PSPRA+                            N+++ P+++
Sbjct  185   AFAKGKHSRSFAR-APTPSPRAFPFSTSKNEDPHSLELPHIAYTELKFLSRNDSELPEED  243

Query  756   ENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMST  923
              N       +D +S++V      E + D S K        NKF GIPLSDS    PR S 
Sbjct  244   FNVK---LTEDIKSISVPLLAGGEDINDESSKLTPTVTKGNKFFGIPLSDSTNNSPRWSY  300

Query  924   KKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMEL  1103
             +  +   ++ +  + S+ N     T   F++      I+ +LKRQV L+RKSL+++ MEL
Sbjct  301   RFNKKSPLEKTEFA-SESNEVINATQNDFDDI-----IVNNLKRQVRLDRKSLMALYMEL  354

Query  1104  DEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKR  1283
             DEER+ASAIAANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  Q   DM+LKR
Sbjct  355   DEERSASAIAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEALQATNDMLLKR  414

Query  1284  EEEIEALESDLDVYRDKFGPINLACSEFFEIEGD  1385
             EEEI ALE++L+ YR+K+G        F   EGD
Sbjct  415   EEEIRALEAELEFYRNKYG--------FLMAEGD  440



>emb|CAN74948.1| hypothetical protein VITISV_000263 [Vitis vinifera]
Length=605

 Score =   286 bits (731),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 202/474 (43%), Positives = 272/474 (57%), Gaps = 81/474 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ LG    F+IY++LE+V+I+LL +DGF+ F + EFAKFFELK PC  CTRID 
Sbjct  6     FKRIVEQELGYLPQFVIYAILEWVVIILLFLDGFIGFVANEFAKFFELKTPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdk----dss  566
              LVHRN +FYYND+ICE HK+D+SSL+YCH H+K+SDI+ MCE CL+SFA ++    ++ 
Sbjct  66    VLVHRNPSFYYNDSICEDHKKDVSSLAYCHAHRKLSDIRMMCEGCLISFATERGDDCETH  125

Query  567   dyyaaddvkSVNVF---------------ADKPNFQRCSCC-----MEFLGGKGKYTRSM  686
                      +V  F                DK    +CSCC     M     KG   RS 
Sbjct  126   RSLVGILHNTVEPFVDNDHKMQVKLPVGQVDKSGVHQCSCCGGPLKMRASMTKGHVPRSA  185

Query  687   SQ-----VAPPPSPR----AWRNNETDHPD-------------DNENATNGD--------  776
             S       AP PSPR    A RN +  H +             DNE+    D        
Sbjct  186   SHGNLLSQAPTPSPRAPFFATRNEDFRHLELPQIRHMDLKFSSDNESELLEDEYSSYASI  245

Query  777   -GRDDNRSLAVSeeeeeeGLEDSS-CKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRT  938
              GR+D ++  V    E    EDS+  +TP      N+F GI L+D    SPR +T+  R 
Sbjct  246   QGREDVKACTVPLLTES---EDSNEERTPMGFSRGNRFFGISLTDSATSSPRWATRLPRK  302

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               ++ +          + +     NE + S   +Q LKRQ  L+RKSL+++ MELDEER+
Sbjct  303   PVLEKAEFV------LEPLEGNAANEAD-SDSTMQRLKRQARLDRKSLIALYMELDEERS  355

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKAS  M+A QYQRMMEEQAEYD+E+ Q ++D++ KRE+EI+
Sbjct  356   ASAIAANNAMAMITRLQAEKASVQMEALQYQRMMEEQAEYDQEDLQAMRDLLGKREDEIK  415

Query  1299  ALESDLDVYRDKFGPINLACSEF-------FEIEGDDEFHSLKFQSLSSFGEMS  1439
             ALE++L++Y+    P N +  +F        EI+GD++   LK +SLS   E S
Sbjct  416   ALEAELEMYQ----PKNESSKKFTVEGCDSIEIQGDEDDQQLKSESLSEKSECS  465



>ref|XP_002266065.1| PREDICTED: uncharacterized protein LOC100251925 [Vitis vinifera]
Length=621

 Score =   285 bits (729),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 202/474 (43%), Positives = 271/474 (57%), Gaps = 81/474 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ LG    F+IY++LE+V+I+LL +DGF+ F + EFAKFFELK PC  CTRID 
Sbjct  6     FKRIVEQELGYLPQFVIYAILEWVVIILLFLDGFIGFVANEFAKFFELKTPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdk----dss  566
              LVHRN +FYYND+ICE HK+D+SSL+YCH H+K+SDI+ MCE CL+SFA ++    ++ 
Sbjct  66    VLVHRNPSFYYNDSICEDHKKDVSSLAYCHAHRKLSDIRMMCEGCLISFATERGDDCETH  125

Query  567   dyyaaddvkSVNVF---------------ADKPNFQRCSCC-----MEFLGGKGKYTRSM  686
                      +V  F                DK    +CSCC     M     KG   RS 
Sbjct  126   RSLVGILHNTVEPFVDNDHKMQVKLPVGQVDKSGVHQCSCCGGPLKMRASMTKGHVPRSA  185

Query  687   SQ-----VAPPPSPR----AWRNNETDH-------------PDDNENATNGD--------  776
             S       AP PSPR    A RN +  H               DNE+    D        
Sbjct  186   SHGNLLSQAPTPSPRAPFFATRNEDFRHLELPQIRHMDLKFSSDNESELLEDEYSSYASI  245

Query  777   -GRDDNRSLAVSeeeeeeGLEDSS-CKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRT  938
              GR+D ++  V    E    EDS+  +TP      N+F GI L+D    SPR +T+  R 
Sbjct  246   QGREDVKACTVPLLTES---EDSNEERTPMGFSRGNRFFGISLTDSATSSPRWATRLPRK  302

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               ++ +          + +     NE + S   +Q LKRQ  L+RKSL+++ MELDEER+
Sbjct  303   PVLEKAEFV------LEPLEGNAANEAD-SDSTMQRLKRQARLDRKSLIALYMELDEERS  355

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKAS  M+A QYQRMMEEQAEYD+E+ Q ++D++ KRE+EI+
Sbjct  356   ASAIAANNAMAMITRLQAEKASVQMEALQYQRMMEEQAEYDQEDLQAMRDLLGKREDEIK  415

Query  1299  ALESDLDVYRDKFGPINLACSEF-------FEIEGDDEFHSLKFQSLSSFGEMS  1439
             ALE++L++Y+    P N +  +F        EI+GD++   LK +SLS   E S
Sbjct  416   ALEAELEMYQ----PKNESSKKFTVEGCDSIEIQGDEDDQQLKSESLSEKSECS  465



>ref|XP_010533436.1| PREDICTED: uncharacterized protein LOC104809233 [Tarenaya hassleriana]
Length=590

 Score =   283 bits (724),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 189/458 (41%), Positives = 263/458 (57%), Gaps = 87/458 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LGR   F+I++ LE+++I +L +DGFLAF S EFA+FFELK+PC  CTRID 
Sbjct  6     FKNFVEQELGRIPQFVIFAFLEWILIAILFIDGFLAFLSNEFARFFELKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV RN +FYYN +IC+SHK+ +SSL+YCH+HKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRRNPDFYYNSSICDSHKKKVSSLAYCHIHKKLSEIKHMCEGCLLSFATEKESDTDTY  125

Query  579   addvkSVN-----VFADKPNFQ------------------------------------RC  635
                +  ++     +  D+  FQ                                    RC
Sbjct  126   KSLIGILHKDLELLIDDEREFQLTFPVSGPKKEDSIVQQNVDYRTKYDSSGNVFQPQLRC  185

Query  636   SCCMEFLGGKGKYTRSMSQVAPPPSPRA-------------------WRNNETDHPDDNE  758
             SCC E L       +S S +AP PSPR                    + + E + P+D +
Sbjct  186   SCCGELLKASSAKPKS-SFLAPTPSPRVSFNQRTLDMSHVKYTELNKFSDTELELPEDED  244

Query  759   --NATNGDGRDDNRSLAVSeeee-eeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRM  917
               N  N   ++D +  +V    + +E LE+   +TP    G NKF GIPLSD    SPR 
Sbjct  245   SSNTDNPASKEDIKGASVPLLADPDEPLEE---RTPSFVRGGNKFFGIPLSDSAQNSPRW  301

Query  918   STKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCM  1097
             S +  R   +D ++ +  + +          +E      I+Q LKRQV L+RKSL+++ M
Sbjct  302   SVRPVRKSFLDKTSNASENADQ---------SEAMDGDYILQRLKRQVRLDRKSLIALYM  352

Query  1098  ELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMIL  1277
             ELDEER+ASA+AANNAMAMITRLQAEKA+  M A QYQRMMEEQAEYD+E  Q + +M+ 
Sbjct  353   ELDEERSASAVAANNAMAMITRLQAEKAALQMDALQYQRMMEEQAEYDQEALQSMNNMLA  412

Query  1278  KREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDE  1391
             KRE+E++ L+++L+ YR K+  + +       +EGDDE
Sbjct  413   KREDELKDLDAELEAYRQKYRSVPI-------VEGDDE  443



>ref|XP_010028475.1| PREDICTED: uncharacterized protein LOC104418736 [Eucalyptus grandis]
Length=509

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 188/454 (41%), Positives = 266/454 (59%), Gaps = 85/454 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+CF+EQ LG+  LF+IY++LE+++I++L VDG +AF + EFA+FFE+++PC  CTRID 
Sbjct  6     FKCFVEQELGKFPLFVIYAMLEWLLIIMLFVDGLVAFAANEFARFFEMRVPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R  +FYYND++CE+HK+++SSL+YCHVHK++SDI+ MCE CLLSFA +K+S     
Sbjct  66    VLVRRTPDFYYNDSVCEAHKKEVSSLAYCHVHKRLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSV-----NVFADKPNF--------------------QRCSCCMEFLGGK------  665
                V  +     +   D P                      QRC+CC E L  K      
Sbjct  126   KSLVGILHKDLESFVQDDPGVHLALHSGKKDERAEVKKSGDQRCTCCGEPLKMKPSSRSK  185

Query  666   -----GKYTRSMSQVAPPPSPRA----WRNNETD--------------HPDDNENATNGD  776
                  GK T  ++Q AP PSPR      RN E                +PD   +    D
Sbjct  186   NGQKSGKCTSPIAQ-APAPSPRGPFVTLRNEEASNLMLPHIRYTELKFNPDAGSDIPGHD  244

Query  777   GRD-----DNRS---LAVSeeeeeeGLEDS--SCKTPCNRGGNNKFVGIPLSD----SPR  914
                     DN+    + ++        +D+  + +TP    G N+F GIPL+D    SPR
Sbjct  245   ASSNAQLPDNQGTFEMKIASVPLLTESDDTGEAIRTPPFARG-NRFFGIPLTDSANSSPR  303

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
             +  K+ R   +D    + S+P++  + +            I+ HLKRQV L+RKSL+++ 
Sbjct  304   VGLKQLRKSMLDKVDFA-SEPSDGSIASED---------SILSHLKRQVRLDRKSLMAMY  353

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + +++
Sbjct  354   MELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQEISNLL  413

Query  1275  LKREEEIEALESDLDVYRDKFGPINLACSEFFEI  1376
              KREE+I+ LE++L+ YR+K+G     C E FE+
Sbjct  414   AKREEDIKLLETELEAYREKYG-----CLEGFEV  442



>gb|EPS58435.1| hypothetical protein M569_16379, partial [Genlisea aurea]
Length=549

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 264/432 (61%), Gaps = 42/432 (10%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             FR FIE+NLG+   F+IY++LE+++I+LL +DGFLAF S E A FFELK+PC  CTRID 
Sbjct  3     FRKFIEENLGKLPHFVIYALLEWLIIILLFIDGFLAFLSNEIAGFFELKIPCLLCTRIDH  62

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA-------Pdk  557
              LVHRN NFYYND+ICESHKRDISSL++CHVHKK+SDI++MC+ CLLSF+          
Sbjct  63    ILVHRNPNFYYNDSICESHKRDISSLAFCHVHKKLSDIRSMCQGCLLSFSVEKDSEFDKY  122

Query  558   dssdyyaaddvkSVNVFADKPNFQRCSCCMEFLGGKGKYTRSMSQVA----PPPSPRA--  719
              S       D  +  V+ +K    RCSCC E L  +       S       P PSPRA  
Sbjct  123   KSIVGIQHKDDGAEGVYDEKSGILRCSCCGEVLKSRSSSRYKRSFSVNIPTPAPSPRAHF  182

Query  720   -WRNNETDHPDD-----------------NENATNGDGRDDNRSL-AVSeeeeeeGLEDS  842
              +  N+     D                 +E   N D  DD  +  A+    + E L + 
Sbjct  183   LYDGNKGGGNKDLMSQIMYTELKLMSGAESELPENDDHHDDAETTSAIPLSLDSEELTED  242

Query  843   SCKTPCNRGGNNKFVGIPLSDSPRMSTK-KTRTMSIDYSALSRSDPNNYDLVTTTGFNEG  1019
               +TP    G NKF  IPLSDS + S +   RT++  + +++R      D +     N+G
Sbjct  243   VQRTPIFAKG-NKFFRIPLSDSAQASPRFYNRTLANHHLSINR----KLDFICMEA-NDG  296

Query  1020  NGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQA  1199
             +   G    L+ Q+   RKSL+++ MELDEER+ASA+AA NAMAMITRLQAEKA+  M A
Sbjct  297   SDMDG--DSLRSQIHFYRKSLMALYMELDEERSASAVAAKNAMAMITRLQAEKAAVQMDA  354

Query  1200  SQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIE  1379
              QYQRMMEEQAEYD+E  Q++KD++L+REE++ ALES+ +VYR ++G IN+  SE  + +
Sbjct  355   LQYQRMMEEQAEYDQEALQVMKDLVLRREEDLMALESENEVYRHRYGEINVISSEVNDSD  414

Query  1380  GDDEFHSLKFQS  1415
              +D +H LK Q+
Sbjct  415   -EDYYHDLKSQA  425



>ref|XP_006578598.1| PREDICTED: intracellular protein transport protein USO1-like 
[Glycine max]
 gb|KHN16280.1| hypothetical protein glysoja_030255 [Glycine soja]
Length=603

 Score =   281 bits (720),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 189/439 (43%), Positives = 265/439 (60%), Gaps = 73/439 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ +G+   F+IY +LE+V+I +L +DGFLAF + EFA+FFEL +PC+ CTR D 
Sbjct  6     FSQFVEQEMGKFTHFVIYVLLEWVLIFILFLDGFLAFLANEFARFFELHIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              +VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    VMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSVN----------------------VFADKPNFQRCSCCMEFLGGKG--------  668
                V  ++                      +  D+ + Q+CSCC E L  K         
Sbjct  126   KSLVGILHKDLECFVQDDQPIQLSLKDDGVMQVDRSSNQKCSCCGEPLKMKSSSNSNIKV  185

Query  669   KYTRSMSQVAPPPSPRA--WRNNETDHPDD--------------------------NENA  764
             K++ S ++ AP PSPRA  +  ++++ P+                           N N+
Sbjct  186   KHSSSFAR-APTPSPRAFPFSTSKSEEPNGLELHHIRYKELKFMSDPELQEDEFGFNVNS  244

Query  765   TNGDGRDDNRSLAVSeeeeeeGLEDSSCK-TPCNRGGNNKFVGIPLSD----SPRMSTKK  929
                    D +S ++    E E L D S K TP    G NKF GIPL+D    SPR + + 
Sbjct  245   PIVKSSGDTKSTSLPLLGEVEDLNDESSKFTPTFTRG-NKFFGIPLTDSANNSPRWTYRI  303

Query  930   TRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDE  1109
              R   ++ +  S SD N  D+   T F++      I+ +LKRQV L+RKSL+++ MELDE
Sbjct  304   NRKSPLEKTEFS-SDSN--DVNPQTDFDD-----AILNNLKRQVRLDRKSLMALYMELDE  355

Query  1110  ERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREE  1289
             ER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  Q   DM+LKREE
Sbjct  356   ERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEALQASNDMLLKREE  415

Query  1290  EIEALESDLDVYRDKFGPI  1346
             +++ALE++L++YR K+G +
Sbjct  416   DLKALEAELEIYRKKYGSL  434



>gb|KHN19356.1| hypothetical protein glysoja_012276 [Glycine soja]
Length=602

 Score =   279 bits (714),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 191/437 (44%), Positives = 260/437 (59%), Gaps = 70/437 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ +G+   F+IY +LE+V+I +L +DGFLAF + EFA+FFEL +PC+ CTR D 
Sbjct  6     FSHFVEQEMGKFTHFVIYVLLEWVLIFILFLDGFLAFLANEFARFFELHIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              +VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    VMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSVN----------------------VFADKPNFQRCSCCMEFLGGKG-----KYT  677
                V  ++                      +  D+ N Q+CSCC E L  K      K  
Sbjct  126   KSLVGILHKDLECFVQDDQPIQLTLKDDGFMQVDRSNNQKCSCCGEPLKMKSSNSNVKVK  185

Query  678   RSMSQV-APPPSPRAW------------------RNNETDHPDD----------NENATN  770
              S S V AP PSPRA+                  R  E     D          N N+ N
Sbjct  186   HSSSFVRAPTPSPRAFPFSTPISLEPNGPELPHIRYKELKFMADPELQEDEFGFNVNSPN  245

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCK-TPCNRGGNNKFVGIPLSD----SPRMSTKKTR  935
                  D +S ++    E E L D S K TP    G NKF GIPL+D    SPR + +  +
Sbjct  246   VKSSGDTKSTSLPLLGEVEDLNDESSKFTPTFTRG-NKFFGIPLTDSANNSPRWTYRINK  304

Query  936   TMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEER  1115
                ++ +  S SD N  D+   T F++      I+ +LKRQV L+RKSL+++ MELDEER
Sbjct  305   KSPLEKTEFS-SDSN--DVNPQTDFDD-----AILNNLKRQVRLDRKSLMALYMELDEER  356

Query  1116  nasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEI  1295
             +ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  Q   DM++KREE++
Sbjct  357   SASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEALQASNDMLIKREEDL  416

Query  1296  EALESDLDVYRDKFGPI  1346
              ALE++L+++R ++G +
Sbjct  417   RALEAELEIFRKQYGSL  433



>gb|KEH16489.1| zein-binding protein [Medicago truncatula]
Length=520

 Score =   277 bits (708),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 185/435 (43%), Positives = 261/435 (60%), Gaps = 66/435 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+E+ LG+    +IY  LE+V+I +L +DGFLAF + E+A+FFELK+PC+ CTR D 
Sbjct  6     FSHFVEEALGKFPHLVIYIFLEWVLIFILFLDGFLAFIANEYARFFELKIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss----  566
             A+VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    AMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  567   --------------------dyyaaddvkSVNVFADKPNFQRCSCCMEFLGGKGK-----  671
                                    +  D   + +  D+ + Q+CSCC + L  K       
Sbjct  126   KSLVGILHKDLECFVEDGQPIQLSLKDDDGLMMQLDRNSTQKCSCCGKPLKVKSSSPYIA  185

Query  672   YTRSMSQVAPPPSPRA--WRNNETDH------------------PDDNENATNGDG----  779
               R     AP PSPRA  + +++ DH                  P+D+E+    DG    
Sbjct  186   KARHSEARAPTPSPRAFPFSSSKNDHPHSLDLPHIGYTPLKFMSPNDSEHLEEDDGHHNV  245

Query  780   --RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTM  941
               R+D ++      + ++  +DSS  TP    G NKF GIPLSD    SPR S +  +  
Sbjct  246   KMREDIKTTVPLLADGDDIHDDSSKFTPTFTRG-NKFFGIPLSDSTNNSPRWSYRFNKKS  304

Query  942   SIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERna  1121
              ++ +  + SD +         F++      I+ +LKRQV L+RKSL+++ M+LDEER+A
Sbjct  305   PLEKTEFA-SDSHEVMNSVQNDFDD-----AIVNNLKRQVRLDRKSLMALYMDLDEERSA  358

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEA  1301
             SA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  +   DM++KREEEI A
Sbjct  359   SAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEALEATNDMLIKREEEIRA  418

Query  1302  LESDLDVYRDKFGPI  1346
             LE++LD YR+K+G +
Sbjct  419   LEAELDFYRNKYGTL  433



>ref|XP_006581945.1| PREDICTED: uncharacterized protein LOC100793806 [Glycine max]
Length=602

 Score =   278 bits (711),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 190/437 (43%), Positives = 260/437 (59%), Gaps = 70/437 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ +G+   F+IY +LE+V+I +L +DGFLAF + EFA+FFEL +PC+ CTR D 
Sbjct  6     FSHFVEQEMGKFTHFVIYVLLEWVLIFILFLDGFLAFLANEFARFFELHIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              +VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    VMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSVN----------------------VFADKPNFQRCSCCMEFLGGKG-----KYT  677
                V  ++                      +  D+ N Q+CSCC E L  K      K  
Sbjct  126   KSLVGILHKDLECFVQDDQPIQLSLKDDGFMQVDRSNNQKCSCCGEPLKMKSSNSNVKVK  185

Query  678   RSMSQV-APPPSPRAW------------------RNNETDHPDD----------NENATN  770
              S S V AP PSPRA+                  R  E     D          N N+ N
Sbjct  186   HSSSFVRAPTPSPRAFPFSTPISLEPNGPELPHIRYKELKFMADPELQEDEFGFNVNSPN  245

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCK-TPCNRGGNNKFVGIPLSD----SPRMSTKKTR  935
                  D +S ++    E E L D S K TP    G NKF GIPL+D    SPR + +  +
Sbjct  246   VKSSGDTKSTSLPLLGEVEDLNDESSKFTPTFTRG-NKFFGIPLTDSANNSPRWTYRINK  304

Query  936   TMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEER  1115
                ++ +  + SD N  D+   T F++      I+ +LKRQV L+RKSL+++ MELDEER
Sbjct  305   KSPLEKTEFA-SDSN--DVNPQTDFDD-----AILNNLKRQVRLDRKSLMALYMELDEER  356

Query  1116  nasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEI  1295
             +ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  Q   DM++KREE++
Sbjct  357   SASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEALQASNDMLIKREEDL  416

Query  1296  EALESDLDVYRDKFGPI  1346
              ALE++L+++R ++G +
Sbjct  417   RALEAELEIFRKQYGSL  433



>emb|CBI15308.3| unnamed protein product [Vitis vinifera]
Length=600

 Score =   276 bits (706),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 189/432 (44%), Positives = 252/432 (58%), Gaps = 70/432 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+  +EQ LG    F+IY++LE+V+I+LL +DGF+ F + EFAKFFELK PC  CTRID 
Sbjct  6     FKRIVEQELGYLPQFVIYAILEWVVIILLFLDGFIGFVANEFAKFFELKTPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdk----dss  566
              LVHRN +FYYND+ICE HK+D+SSL+YCH H+K+SDI+ MCE CL+SFA ++    ++ 
Sbjct  66    VLVHRNPSFYYNDSICEDHKKDVSSLAYCHAHRKLSDIRMMCEGCLISFATERGDDCETH  125

Query  567   dyyaaddvkSVNVF---------------ADKPNFQRCSCC-----MEFLGGKGKYTRSM  686
                      +V  F                DK    +CSCC     M     KG   RS 
Sbjct  126   RSLVGILHNTVEPFVDNDHKMQVKLPVGQVDKSGVHQCSCCGGPLKMRASMTKGHVPRSA  185

Query  687   SQ-----VAPPPSPR----AWRNNETDH-------------PDDNENATNGD--------  776
             S       AP PSPR    A RN +  H               DNE+    D        
Sbjct  186   SHGNLLSQAPTPSPRAPFFATRNEDFRHLELPQIRHMDLKFSSDNESELLEDEYSSYASI  245

Query  777   -GRDDNRSLAVSeeeeeeGLEDSS-CKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRT  938
              GR+D ++  V    E    EDS+  +TP      N+F GI L+D    SPR +T+  R 
Sbjct  246   QGREDVKACTVPLLTES---EDSNEERTPMGFSRGNRFFGISLTDSATSSPRWATRLPRK  302

Query  939   MSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERn  1118
               ++ +          + +     NE + S   +Q LKRQ  L+RKSL+++ MELDEER+
Sbjct  303   PVLEKAEFV------LEPLEGNAANEAD-SDSTMQRLKRQARLDRKSLIALYMELDEERS  355

Query  1119  asaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIE  1298
             ASAIAANNAMAMITRLQAEKAS  M+A QYQRMMEEQAEYD+E+ Q ++D++ KRE+EI+
Sbjct  356   ASAIAANNAMAMITRLQAEKASVQMEALQYQRMMEEQAEYDQEDLQAMRDLLGKREDEIK  415

Query  1299  ALESDLDVYRDK  1334
             ALE++L++Y+ K
Sbjct  416   ALEAELEMYQPK  427



>ref|XP_010087740.1| hypothetical protein L484_008937 [Morus notabilis]
 gb|EXB29773.1| hypothetical protein L484_008937 [Morus notabilis]
Length=560

 Score =   275 bits (702),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 182/437 (42%), Positives = 257/437 (59%), Gaps = 67/437 (15%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ +G+   FL+Y+VLE+++I+LL +DGFLAF + EFA+FF L+ PC FCTRID 
Sbjct  6     FSRFVEQEVGKFPHFLLYAVLEWILIILLFIDGFLAFIANEFARFFGLQTPCLFCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LVHR+ +FY+ND++CE+HK+++SSL++CH HKKI+DI+ MCE CLLSFA DK  S+   
Sbjct  66    VLVHRSRDFYFNDSVCEAHKKEVSSLAFCHNHKKIADIRRMCEVCLLSFAADKADSECDT  125

Query  579   addvkSV--------------------------NVFADKPNFQRCSCCMEFLG-------  659
                +  +                               K    RCSCC E L        
Sbjct  126   YKSLVGILQKDLEENDDHDDNHDVIRHRIQLGLGFEEIKAGGLRCSCCGEALKTKKAAAL  185

Query  660   -----GKGKYTRSMSQV---APPPSPRAWRN-------------NETDHPDDNENA----  764
                  GKG+     S +   AP PSPRA  +             NE +   + EN     
Sbjct  186   NNNNIGKGRQYYGGSLLFSQAPAPSPRAMFSRLRSSGERKLMPENEAELLPEFENGSSQA  245

Query  765   -TNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKK  929
              T+   R+D ++  V    E + L D + KTP    G NKF GIPL+D    SPR+  + 
Sbjct  246   VTSEKLREDVKAAMVPLLTEADELNDEANKTPSFVRG-NKFFGIPLTDSASNSPRLGMRV  304

Query  930   TRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDE  1109
             +R   ++ +  +       ++ T+T   + +    I+  LKRQV  +RKSL+++ MELDE
Sbjct  305   SRKSPLEKTEFASESMEGINVQTSTNDTDTD---SILHGLKRQVRFDRKSLMALYMELDE  361

Query  1110  ERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREE  1289
             ER+ASA+AANNAMAMITRLQA+KA+  M+A QYQRMMEEQ EYD+E  Q   ++++KREE
Sbjct  362   ERSASAVAANNAMAMITRLQADKAAVQMEALQYQRMMEEQLEYDQEALQETNELLMKREE  421

Query  1290  EIEALESDLDVYRDKFG  1340
             +I+ALE++L+ YR+K+G
Sbjct  422   DIKALEAELEAYREKYG  438



>ref|XP_008393130.1| PREDICTED: uncharacterized protein LOC103455326 [Malus domestica]
Length=618

 Score =   275 bits (702),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 188/459 (41%), Positives = 264/459 (58%), Gaps = 81/459 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LGR   F++Y++LE+ +I+LL VDGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  18    FSRYVEQELGRLPHFMVYALLEWTLIILLFVDGFLAFAANEFAKFFELQIPCWLCTRIDH  77

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+ +FYYND+ICE+H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  78    ILVHRDQDFYYNDSICEAHRKDVSYLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  137

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +  + Q                            CSCC   L   
Sbjct  138   KSLVGILHKDLECFVEDDHHQIQLSVPAARTWEEGAGQVEKSNSIVCISCSCCGVPLKMS  197

Query  660   ------GKGKYTRSMSQVAPPPSPRA---------------------WRNNETDHPDDN-  755
                    KGK    ++Q AP PSPRA                       +NE++ P+D  
Sbjct  198   STSNSYPKGKNDSVLAQ-APAPSPRAPLRSDDRSLDLPHIRYTELKLMSDNESELPEDEY  256

Query  756   ----ENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SP  911
                  N  +   ++D ++  V    E E L D + +TP   G  N+F GIPL+D    SP
Sbjct  257   ESQPPNRVSQSVKEDPKAATVPLLTEGEDLADDANRTPL-FGKGNRFFGIPLTDSATNSP  315

Query  912   RMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSV  1091
             R++ + +R      S L ++     + V  +  NE    + I+  LKRQV L+RKSL+++
Sbjct  316   RVAMRISRK-----SPLEKTGEYALESVEXSTXNEAECDS-ILHRLKRQVRLDRKSLMAL  369

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
              MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D+
Sbjct  370   YMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYDL  429

Query  1272  ILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDD  1388
             + KREEE+  +E++++ YR+K+G +     EF    GD+
Sbjct  430   LAKREEELRLVEAEVEAYREKYGLLK----EFAYESGDE  464



>ref|XP_008239683.1| PREDICTED: uncharacterized protein LOC103338270 isoform X2 [Prunus 
mume]
Length=605

 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 184/444 (41%), Positives = 261/444 (59%), Gaps = 79/444 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LG+   F+IY++LE+++I+LL +DGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  6     FTRYVEQELGKLPHFVIYALLEWMLIILLFIDGFLAFAANEFAKFFELRIPCWLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+ +FYYND+ICE+H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  66    ILVHRDQDFYYNDSICEAHRKDVSYLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +    Q                            CSCC   L   
Sbjct  126   KSLVGILHKDLECFVEDDYHQIQLSVPAARTWEEAAGQVENSGSIVQVSCSCCGVPLKMS  185

Query  660   ------GKGKYTRSMSQVAPPPSPRA-WRNNE-----------------TDH----PDD-  752
                    KGK   +++  AP PSPRA  RN+E                 +DH    P+D 
Sbjct  186   STSSAYPKGKNGSALAH-APAPSPRAPLRNDENRGLELPHIRYTELKLMSDHESELPEDE  244

Query  753   -NENATNGDG--RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SP  911
                +  N D   ++D ++ AV    E + L D + +TP   G  N+F GIPL+D    SP
Sbjct  245   YGSHPPNRDSQFKEDPKASAVPSLTEGDDLTDDANRTPV-FGKGNRFFGIPLTDSATNSP  303

Query  912   RMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQH-LKRQVLLERKSLVS  1088
             R++ + +R   ++  +       ++ L +  G    +     I H LKRQV L+RKSL++
Sbjct  304   RVAMRISRKSPLEKGS-------DFVLESADGSTPNDADCDSILHRLKRQVRLDRKSLMA  356

Query  1089  VCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKD  1268
             + MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D
Sbjct  357   LYMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYD  416

Query  1269  MILKREEEIEALESDLDVYRDKFG  1340
             ++ KREEE+  +E++++ YR+K+G
Sbjct  417   LLAKREEELRIIETEVEAYREKYG  440



>ref|XP_008374499.1| PREDICTED: uncharacterized protein LOC103437776 [Malus domestica]
Length=590

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 192/471 (41%), Positives = 271/471 (58%), Gaps = 80/471 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LGR   F+IY++LE+ +I+LL  DGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  6     FTRYVEQELGRVPHFVIYALLEWTLIILLFADGFLAFVANEFAKFFELQIPCWLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+  FYYND+ICE H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  66    ILVHRDQGFYYNDSICEGHRKDVSHLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +  + Q                            CSCC   L   
Sbjct  126   KSLVGILHKDLECFVEDDHHQIQLSVQAARTWEETTGQVEKSNSIVRVSCSCCGVPLKMS  185

Query  660   ------GKGKYTRSMSQVAPPPSPRA---------------------WRNNETDHPDDNE  758
                    KGK   +++Q AP PSPRA                       ++E++ P+D E
Sbjct  186   SSSNSYPKGKNGSALAQ-APTPSPRAPLRSDDRSLDLPHIRCTELKLMSDHESELPED-E  243

Query  759   NATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTK  926
               +    R D++S     + E E L D + +TP   G  N+F GIPL+D    SPR++ +
Sbjct  244   YGSQLPNR-DSQSXKEDPKAEGEDLADDANRTPLF-GKGNRFFGIPLTDSATNSPRVAMR  301

Query  927   KTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELD  1106
              +R      S L ++     + V  +  NE    + I+  LKRQV L+RKSL+++ MELD
Sbjct  302   ISRK-----SPLEKTGEYALESVEESTPNEAECDS-ILHRLKRQVRLDRKSLMALYMELD  355

Query  1107  EERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKRE  1286
             EER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D++ +RE
Sbjct  356   EERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYDLLAQRE  415

Query  1287  EEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMS  1439
             EE+  +E++++ YR+K+G +     + F  E  DE    K +S +S GE++
Sbjct  416   EELRLIEAEVEAYREKYGLL-----KEFAYESGDEGKG-KNESGTSAGELN  460



>ref|XP_008239682.1| PREDICTED: uncharacterized protein LOC103338270 isoform X1 [Prunus 
mume]
Length=606

 Score =   269 bits (688),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 261/445 (59%), Gaps = 80/445 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LG+   F+IY++LE+++I+LL +DGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  6     FTRYVEQELGKLPHFVIYALLEWMLIILLFIDGFLAFAANEFAKFFELRIPCWLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+ +FYYND+ICE+H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  66    ILVHRDQDFYYNDSICEAHRKDVSYLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +    Q                            CSCC   L   
Sbjct  126   KSLVGILHKDLECFVEDDYHQIQLSVPAARTWEEAAGQVENSGSIVQVSCSCCGVPLKMS  185

Query  660   ------GKGKYTRSMSQVAPPPSPRA-WRNNE-----------------TDH----PDD-  752
                    KGK   +++  AP PSPRA  RN+E                 +DH    P+D 
Sbjct  186   STSSAYPKGKNGSALAH-APAPSPRAPLRNDENRGLELPHIRYTELKLMSDHESELPEDE  244

Query  753   -NENATNGDG---RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----S  908
                +  N D    ++D ++ AV    E + L D + +TP   G  N+F GIPL+D    S
Sbjct  245   YGSHPPNRDSQSVKEDPKASAVPSLTEGDDLTDDANRTPV-FGKGNRFFGIPLTDSATNS  303

Query  909   PRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQH-LKRQVLLERKSLV  1085
             PR++ + +R   ++  +       ++ L +  G    +     I H LKRQV L+RKSL+
Sbjct  304   PRVAMRISRKSPLEKGS-------DFVLESADGSTPNDADCDSILHRLKRQVRLDRKSLM  356

Query  1086  SVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILK  1265
             ++ MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   
Sbjct  357   ALYMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATY  416

Query  1266  DMILKREEEIEALESDLDVYRDKFG  1340
             D++ KREEE+  +E++++ YR+K+G
Sbjct  417   DLLAKREEELRIIETEVEAYREKYG  441



>ref|XP_007138138.1| hypothetical protein PHAVU_009G183400g [Phaseolus vulgaris]
 gb|ESW10132.1| hypothetical protein PHAVU_009G183400g [Phaseolus vulgaris]
Length=564

 Score =   268 bits (685),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 181/435 (42%), Positives = 258/435 (59%), Gaps = 73/435 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ +G+   F+IY +LE+V+I +L +DGFLAF + E+A+FFEL +PC+ CTR D 
Sbjct  6     FSNFVEQEMGKFTHFVIYVLLEWVLIFILFLDGFLAFAANEYARFFELHIPCWLCTRFDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              +VHRN +FYYN+++CE+HK+D+SSL++CH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  66    VMVHRNPDFYYNESVCEAHKKDMSSLAFCHNHKKLSDIRKMCEGCLLSFATEKESDCDTY  125

Query  579   addvkSVN----------------------VFADKPNFQRCSCCMEFLGGKGKYTR----  680
                V  ++                      +  ++ N QRCSCC E L  K  Y +    
Sbjct  126   KSLVGILHKDLECFVQDGQPIQLSLKDEGFMQIERNNNQRCSCCGEPLKMKTSYAKVKHS  185

Query  681   SMSQVAPPPSPRAW------------------RNNETDHPDDNENATNGD----------  776
             S    AP PSPRA+                  R  E     D+++    D          
Sbjct  186   SSFARAPAPSPRAFPFSSSKSEDHHSLELPHMRYKELKFTSDHDSELQEDEYGYHTNSPI  245

Query  777   --GRDDNRSLAVSeeeeeeGLEDSSCK-TPCNRGGNNKFVGIPLSD----SPRMSTKKTR  935
                R++++S  V      + L D + K TP    G NKF GIPL+D    SPR + +  R
Sbjct  246   VKAREEHKSTTVP--PLFDDLNDEASKFTPTFTKG-NKFFGIPLTDSANNSPRWTYRVNR  302

Query  936   TMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEER  1115
                ++ +  + S+ N    VT T F++      ++ +LKRQV L+RKSL+++ MELDEER
Sbjct  303   KSPLEKTEFA-SESNE---VTQTDFDD-----AVLSNLKRQVRLDRKSLMALYMELDEER  353

Query  1116  nasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEI  1295
             +ASA+AANNAMAMITRLQA+KA+  M+A QYQRMMEEQAEYD E  Q   D++LK+++E+
Sbjct  354   SASAVAANNAMAMITRLQADKAAVQMEALQYQRMMEEQAEYDEEALQATNDLLLKKDQEM  413

Query  1296  EALESDLDVYRDKFG  1340
             +AL+++L+ YR K G
Sbjct  414   KALQAELESYRKKHG  428



>ref|XP_007210877.1| hypothetical protein PRUPE_ppa003082mg [Prunus persica]
 gb|EMJ12076.1| hypothetical protein PRUPE_ppa003082mg [Prunus persica]
Length=606

 Score =   269 bits (687),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 259/445 (58%), Gaps = 80/445 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LG+   F+IY++LE+ +I+LL +DGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  6     FTRYVEQELGKLPHFVIYALLEWTLIILLFIDGFLAFAANEFAKFFELRIPCWLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+ +FYYND+ICE+H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  66    ILVHRDQDFYYNDSICEAHRKDVSYLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +    Q                            CSCC   L   
Sbjct  126   KSLVGILHKDLECFVEDDYHQIQLSVPAARTWEEAAGQVENSGSIVQVSCSCCGVPLKMS  185

Query  660   ------GKGKYTRSMSQVAPPPSPRA-WRNNE-----------------TDH----PDDN  755
                    KGK   +++  AP PSPRA  RN+E                 +DH    P+D 
Sbjct  186   STSSAYPKGKNGSALAH-APAPSPRAPLRNDENRGLELPHIRYTELKLMSDHESELPEDE  244

Query  756   -----ENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----S  908
                   N  +   ++D ++ AV    E + L D + +TP   G  N+F GIPL+D    S
Sbjct  245   YGSHPPNRDSQSVKEDPKASAVPSLTEGDDLTDDANRTPV-FGKGNRFFGIPLTDSATNS  303

Query  909   PRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQH-LKRQVLLERKSLV  1085
             PR++ + +R   ++  +       ++ L +  G    +     I H LKRQV L+RKSL+
Sbjct  304   PRVAMRISRKSPLEKGS-------DFVLESADGSTPNDADCDSILHRLKRQVRLDRKSLM  356

Query  1086  SVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILK  1265
             ++ MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   
Sbjct  357   ALYMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATY  416

Query  1266  DMILKREEEIEALESDLDVYRDKFG  1340
             D++ KREEE+  +E++++ YR+K+G
Sbjct  417   DLLAKREEELRIIEAEVEAYREKYG  441



>gb|EYU24446.1| hypothetical protein MIMGU_mgv1a003615mg [Erythranthe guttata]
Length=574

 Score =   267 bits (682),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 263/458 (57%), Gaps = 69/458 (15%)
 Frame = +3

Query  219   FRCFIEQ-NLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRID  395
             F+ F++Q NLG+   F+I++VLE+ MI+LL  DG +AF S EFAKFF L+ PC  CTRID
Sbjct  5     FKNFLDQLNLGKFPQFVIFAVLEWTMILLLFADGLIAFVSNEFAKFFGLETPCLLCTRID  64

Query  396   QALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdss---  566
               LV RN +FYYND+IC +HK+D+SSL+YC +H K+SDI+ MC+ CLLSFA +KD+    
Sbjct  65    HILVKRNSSFYYNDSICGAHKKDVSSLAYCRIHDKLSDIRNMCQGCLLSFATEKDADCDK  124

Query  567   -dyyaaddvkSVNVFADKPNFQ---------------------RCSCCMEFLGGK--GKY  674
                      K  + F D  + +                     RCSCC E +  K   KY
Sbjct  125   YKSLVGILHKDFDCFVDDEDRKKSSASKKVDGGGGGGDDEDDPRCSCCGEIVKLKLSSKY  184

Query  675   TRSMSQVAPPPSPRA-W----RNN-------------------ETDHPDDNENATNGDGR  782
              RS+S  AP  SPRA W    RNN                   +    D + NA N  G+
Sbjct  185   IRSLSMKAPVSSPRASWLANGRNNVESPRTRYAELKFMSETGRDVSEVDASSNAYN-HGK  243

Query  783   DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD---SPRMS-TKKTRTMSID  950
             +  +SL        + + + +C+TP      NKF  +PL+    SPR+      R +S++
Sbjct  244   EAIKSLNAPSLPYSKDINEDACRTPI-FARRNKFFPMPLNSAPVSPRVWLNNGLRKLSVE  302

Query  951   YSALSR---SDP--NNY---DLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELD  1106
                 +     DP  NN    D+  +   NE +    I+  LK+QV L+ KSL+++ MELD
Sbjct  303   RGGTAGDMIGDPTTNNNEDDDVANSNPLNEVDFE--ILNRLKKQVRLDNKSLMALYMELD  360

Query  1107  EERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKRE  1286
             EER+AS +AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD E  Q+++D + +R+
Sbjct  361   EERSASNVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDEEAIQVMRDELSRRD  420

Query  1287  EEIEALESDLDVYRDKFG-PINLACSEFFEIEGDDEFH  1397
             +++ ALE +L+VYR+K+G  +N    E  E+  +D ++
Sbjct  421   DDVAALEYELEVYREKYGVVVNKIGGEICEVADEDNYY  458



>ref|XP_008437815.1| PREDICTED: uncharacterized protein LOC103483117 isoform X3 [Cucumis 
melo]
Length=578

 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 200/476 (42%), Positives = 275/476 (58%), Gaps = 86/476 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG +AF + EFAKFFEL++PC FCTRID 
Sbjct  7     FTSFVEQELGKFPHFVVCAVLEWVLIILLFIDGIVAFLANEFAKFFELRVPCLFCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA  K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATQKESDCNTY  126

Query  579   addvkSV-----------NVFADKP-----------------NFQRCSCCMEFL-----G  659
                V  +           N     P                 N+  CSCC E L      
Sbjct  127   KSLVGILHKDLECFVEDDNRHVSLPPMGKKDDVLHMEKGIGVNYSCCSCCGEPLKVKSSN  186

Query  660   GKGKYTRSMSQVAPPPSPRA-----WRNN---------------------ETDHPDDNE-  758
              KGK   + SQ AP PSPRA     +RN+                     E+D+ +D++ 
Sbjct  187   SKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESDYVEDDDG  245

Query  759   -NATNGDG---RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPR  914
              +  N D    ++D +++ V    E E + +SS +TP   G  NKF GIPL+D    SPR
Sbjct  246   LHGRNLDAHPFKEDVKAVKVPLLPEPEDMHESS-RTPV-FGKGNKFFGIPLTDSANNSPR  303

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
              + + +R   ++ + L+ ++    D++   G N+      I+  LKRQV ++RKSL+ + 
Sbjct  304   WAIRISRKSPLERTELA-AETYEADMM-GPGDND-----SILNCLKRQVRIDRKSLMELY  356

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++
Sbjct  357   MELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLL  416

Query  1275  LKREEEIEALESDLDVYRDKFGPINLACSEFFEIE-GDDEFHSLKFQSLSSFGEMS  1439
              KRE E       LDVYR+K+G +   C +  + E  D+++   K QS  S  E S
Sbjct  417   AKREAE-------LDVYREKYGYLGEDCFKMSDDEISDEDYQEFKSQSCLSSDEKS  465



>ref|XP_004301292.1| PREDICTED: uncharacterized protein LOC101306928 [Fragaria vesca 
subsp. vesca]
Length=675

 Score =   269 bits (688),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 177/443 (40%), Positives = 252/443 (57%), Gaps = 97/443 (22%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQN+G+   F++Y+VLE+V+I+LL +DGF+AF + EFAK FEL  PC+ CT+ID 
Sbjct  6     FTLFVEQNMGQLPRFMVYAVLEWVLIILLFLDGFVAFLANEFAKLFELTTPCWLCTKIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkds-----  563
              LV+R  +FYYND+ICESHK+D+S L+YCH HK++SDI+ MCE CLLSFA +K+S     
Sbjct  66    ILVNRGRDFYYNDSICESHKKDVSYLAYCHNHKRLSDIRKMCEACLLSFATEKESDFDTY  125

Query  564   -----------------sdyyaaddvkSVNVFADKPNFQR--------CSCCMEFLG---  659
                                +     V +   + D    ++        CSCC   L    
Sbjct  126   KSLVGILHKDLECFVEDDQHQIQLSVPAARTWEDAGTIEKSRDSMTIGCSCCGAPLKLSQ  185

Query  660   ----GKGKYTRSMSQVAPPPSPRA-----------------------WRNNETDHPDDNE  758
                  KGK   +++Q AP PSPRA                          NE++ P+D  
Sbjct  186   SPSYPKGKNVTALAQ-APTPSPRAPLGKNDDAPGLDLPPIRYSELKFMSENESELPEDEY  244

Query  759   NATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTK  926
              A + +  D+              L D + +TP   G  NKF GIPL+D    SPR++ +
Sbjct  245   GAHSKNQGDE--------------LTDDANRTPL-FGRGNKFFGIPLTDSAQNSPRVAMR  289

Query  927   KTRTMSIDYS--ALSRSD---PNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSV  1091
              ++   ++ S   L   D   PN+ D  +            I+Q LKRQV L++KSL+++
Sbjct  290   ISKKSPLEKSEFVLESVDGNLPNDTDCDS------------ILQRLKRQVRLDKKSLMAL  337

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
              MELDEER+ASA+AA+ AMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D+
Sbjct  338   YMELDEERSASAVAADEAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYDL  397

Query  1272  ILKREEEIEALESDLDVYRDKFG  1340
             + KRE+++  LE++++ YR+K+G
Sbjct  398   LAKREDDMRVLEAEIEAYREKYG  420



>ref|XP_008437805.1| PREDICTED: uncharacterized protein LOC103483117 isoform X2 [Cucumis 
melo]
Length=587

 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 200/476 (42%), Positives = 275/476 (58%), Gaps = 86/476 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG +AF + EFAKFFEL++PC FCTRID 
Sbjct  7     FTSFVEQELGKFPHFVVCAVLEWVLIILLFIDGIVAFLANEFAKFFELRVPCLFCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA  K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATQKESDCNTY  126

Query  579   addvkSV-----------NVFADKP-----------------NFQRCSCCMEFL-----G  659
                V  +           N     P                 N+  CSCC E L      
Sbjct  127   KSLVGILHKDLECFVEDDNRHVSLPPMGKKDDVLHMEKGIGVNYSCCSCCGEPLKVKSSN  186

Query  660   GKGKYTRSMSQVAPPPSPRA-----WRNN---------------------ETDHPDDNE-  758
              KGK   + SQ AP PSPRA     +RN+                     E+D+ +D++ 
Sbjct  187   SKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESDYVEDDDG  245

Query  759   -NATNGDG---RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPR  914
              +  N D    ++D +++ V    E E + +SS +TP   G  NKF GIPL+D    SPR
Sbjct  246   LHGRNLDAHPFKEDVKAVKVPLLPEPEDMHESS-RTPV-FGKGNKFFGIPLTDSANNSPR  303

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
              + + +R   ++ + L+ ++    D++   G N+      I+  LKRQV ++RKSL+ + 
Sbjct  304   WAIRISRKSPLERTELA-AETYEADMM-GPGDND-----SILNCLKRQVRIDRKSLMELY  356

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++
Sbjct  357   MELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLL  416

Query  1275  LKREEEIEALESDLDVYRDKFGPINLACSEFFEIE-GDDEFHSLKFQSLSSFGEMS  1439
              KRE E       LDVYR+K+G +   C +  + E  D+++   K QS  S  E S
Sbjct  417   AKREAE-------LDVYREKYGYLGEDCFKMSDDEISDEDYQEFKSQSCLSSDEKS  465



>ref|XP_008437788.1| PREDICTED: uncharacterized protein LOC103483117 isoform X1 [Cucumis 
melo]
 ref|XP_008437796.1| PREDICTED: uncharacterized protein LOC103483117 isoform X1 [Cucumis 
melo]
Length=631

 Score =   268 bits (684),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 200/476 (42%), Positives = 275/476 (58%), Gaps = 86/476 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG +AF + EFAKFFEL++PC FCTRID 
Sbjct  7     FTSFVEQELGKFPHFVVCAVLEWVLIILLFIDGIVAFLANEFAKFFELRVPCLFCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA  K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATQKESDCNTY  126

Query  579   addvkSV-----------NVFADKP-----------------NFQRCSCCMEFL-----G  659
                V  +           N     P                 N+  CSCC E L      
Sbjct  127   KSLVGILHKDLECFVEDDNRHVSLPPMGKKDDVLHMEKGIGVNYSCCSCCGEPLKVKSSN  186

Query  660   GKGKYTRSMSQVAPPPSPRA-----WRNN---------------------ETDHPDDNE-  758
              KGK   + SQ AP PSPRA     +RN+                     E+D+ +D++ 
Sbjct  187   SKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESDYVEDDDG  245

Query  759   -NATNGDG---RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPR  914
              +  N D    ++D +++ V    E E + +SS +TP   G  NKF GIPL+D    SPR
Sbjct  246   LHGRNLDAHPFKEDVKAVKVPLLPEPEDMHESS-RTPV-FGKGNKFFGIPLTDSANNSPR  303

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
              + + +R   ++ + L+ ++    D++   G N+      I+  LKRQV ++RKSL+ + 
Sbjct  304   WAIRISRKSPLERTELA-AETYEADMM-GPGDND-----SILNCLKRQVRIDRKSLMELY  356

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++
Sbjct  357   MELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLL  416

Query  1275  LKREEEIEALESDLDVYRDKFGPINLACSEFFEIE-GDDEFHSLKFQSLSSFGEMS  1439
              KRE E       LDVYR+K+G +   C +  + E  D+++   K QS  S  E S
Sbjct  417   AKREAE-------LDVYREKYGYLGEDCFKMSDDEISDEDYQEFKSQSCLSSDEKS  465



>ref|XP_010428475.1| PREDICTED: uncharacterized protein LOC104713121 [Camelina sativa]
Length=544

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 244/435 (56%), Gaps = 83/435 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG   LF+IY+VLE+ +IV+L +DG +AFFS +FAKFFEL +PC  CTRID 
Sbjct  25    FKKFVEQELGSLPLFVIYTVLEWSLIVILFIDGLIAFFSNQFAKFFELNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              L+ R+   YYN++ICESHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +KDS     
Sbjct  85    ILIPRDPISYYNESICESHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  579   addvkSVN---------------VFADKPNF-----------------------QRCSCC  644
                +  ++                F    NF                       + CSCC
Sbjct  145   KSLIGILHKDLELLIDDERELPLAFKKDDNFVQTTKNLVDYKINNNNLKSDSLKEHCSCC  204

Query  645   MEFLGGKG-KYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeee  821
              E L  K  K  ++ S +AP PSPR        +   +EN       D +R         
Sbjct  205   GELLKLKSEKLPKNNSFLAPAPSPR------VSYSKQSENEPEFKDIDMDR---------  249

Query  822   eeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYD  989
                       TP    G NKF G+PLSD    SPR S +  +   +D        P N  
Sbjct  250   ----------TPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLKKPLLD-------KPEN--  290

Query  990   LVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQ  1169
                ++   + NG + I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQ
Sbjct  291   --ASSDAADQNGES-ILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQ  347

Query  1170  AEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPI-  1346
             AEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KRE+E++ LE++ + YR+K+G + 
Sbjct  348   AEKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREDEMKELEAEFEAYREKYGCLS  407

Query  1347  --NLACSEFFEIEGD  1385
               + A  EF E  GD
Sbjct  408   DEDDAREEFLEQNGD  422



>ref|XP_009369392.1| PREDICTED: uncharacterized protein LOC103958796 [Pyrus x bretschneideri]
 ref|XP_009346730.1| PREDICTED: uncharacterized protein LOC103938448 [Pyrus x bretschneideri]
Length=578

 Score =   263 bits (672),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 181/454 (40%), Positives = 255/454 (56%), Gaps = 90/454 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  ++EQ LGR   F++Y++LE+ +I+LL  DGFLAF + EFAKFFEL++PC+ CTRID 
Sbjct  6     FTRYVEQELGRVPHFVLYALLEWTLIILLFADGFLAFVANEFAKFFELQIPCWLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LVHR+  FYYND+ICE H++D+S L+YCH HKK+SDI+ MCE CLLSFA +K+    + 
Sbjct  66    ILVHRDQGFYYNDSICEGHRKDVSHLAYCHNHKKLSDIRKMCEACLLSFATEKESDCDTY  125

Query  567   dyyaaddvkSVNVFADKPNFQ---------------------------RCSCCMEFLG--  659
                     K +  F +  + Q                            CSCC   L   
Sbjct  126   KSLVGILHKDLECFVEDDHHQIQLSVQAARTWEETTGQVEKSNSIVRVSCSCCGVPLKMS  185

Query  660   ------GKGKYTRSMSQVAPPPSPRA---------------------WRNNETDHPDDNE  758
                    KGK   +++Q AP PSPRA                        +E++ P+D  
Sbjct  186   SSSNSYPKGKNGSALAQ-APTPSPRAPLRSDDRSLDLPHIRCTELKLMSGHESELPEDEY  244

Query  759   NATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTK  926
              +   +  +D              L D + +TP   G  N+F GIPL+D    SPR++ +
Sbjct  245   GSQPPNQGED--------------LADDANRTPLF-GKGNRFFGIPLTDSATSSPRVAMR  289

Query  927   KTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELD  1106
              +R      S L ++     + V  +  NE    + I+  LKRQV L+RKSL+++ MELD
Sbjct  290   ISRK-----SPLEKTGEYALESVEESTPNEAECDS-ILHRLKRQVRLDRKSLMALYMELD  343

Query  1107  EERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKRE  1286
             EER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D++ +RE
Sbjct  344   EERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYDLLAQRE  403

Query  1287  EEIEALESDLDVYRDKFGPINLACSEFFEIEGDD  1388
             EE+  +E++++ YR+K+G +     EF    GD+
Sbjct  404   EELRLIEAEVEAYREKYGLLK----EFAYESGDE  433



>ref|XP_004152544.1| PREDICTED: uncharacterized protein LOC101220477 [Cucumis sativus]
Length=604

 Score =   262 bits (670),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 264/456 (58%), Gaps = 76/456 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG + F + EFAKFFEL++PC +CTRID 
Sbjct  7     FTSFVEQELGQFPHFVVCAVLEWVLIILLFIDGIVTFLANEFAKFFELRVPCLYCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATEKESDCNTY  126

Query  579   addvkSVN-------------VFADKP----------------NFQRCSCCMEFL-----  656
                V  ++             V +  P                N+  CSCC E L     
Sbjct  127   KSLVGILHKDLECFVEDDNRQVVSLPPVGKKDDGLPMDKGFGVNYSCCSCCGEPLKVKSS  186

Query  657   GGKGKYTRSMSQVAPPPSPRA-----WRNNE-TDHPDDNENATNGDGRDDNRSLAVSeee  818
               KGK   + SQ AP PSPRA     +RN++ T     +   T      D+ S  V ++E
Sbjct  187   NSKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESEFVEDDE  245

Query  819   eeeG--LEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPN  980
                G  L+   CKTP   G  NKF GIPL+D    SPR + + +R   +D + ++ ++  
Sbjct  246   GIHGRNLDAHPCKTPV-FGKGNKFFGIPLTDSANNSPRWAIRISRKSPLDRTEVA-AETY  303

Query  981   NYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
               D++   G N+      I+  LKRQV ++RKSL+ + MELDEER+ASA+AANNAMAMIT
Sbjct  304   EADMM-GPGDND-----SILNCLKRQVRIDRKSLMELYMELDEERSASAVAANNAMAMIT  357

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             RLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++ KRE E       LDVYR+K+G
Sbjct  358   RLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLLAKREAE-------LDVYREKYG  410

Query  1341  PINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRS  1448
              +           G+DE     +Q    F   SC S
Sbjct  411   YL-----------GEDEISDEDYQ---EFKSQSCLS  432



>ref|XP_010471574.1| PREDICTED: uncharacterized protein LOC104751351 [Camelina sativa]
Length=549

 Score =   260 bits (664),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 173/419 (41%), Positives = 236/419 (56%), Gaps = 83/419 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    F+IY+VLE+ +IV+L +DG +AFFS +FAKFFEL +PC  CTRID 
Sbjct  25    FKKFVEQELGSLPHFVIYTVLEWSLIVILFIDGLIAFFSNQFAKFFELNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  +   YYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +KDS     
Sbjct  85    ILVPGDPQSYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  579   addvkSVN---------------VFADKPNF-------------------------QRCS  638
                +  ++                F    NF                         + CS
Sbjct  145   KSLIGILHKDLELLIDDERELPLAFKKDDNFVQTTKNLVDYKINNNNNNLKSDSLKEHCS  204

Query  639   CCMEFLGGKG-KYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSee  815
             CC E L  K  K+ ++ S +AP PSPR   N ++      EN +     D +R       
Sbjct  205   CCGELLKMKSEKFPKNNSFLAPAPSPRVSYNKQS------ENESEFKDLDMDR-------  251

Query  816   eeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNN  983
                         TP    G NKF G+PLSD    SPR S +  +   +D        P N
Sbjct  252   ------------TPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLKKPLLD-------KPEN  292

Query  984   YDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTR  1163
                   +   + NG + I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITR
Sbjct  293   -----ASDTADQNGES-ILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITR  346

Query  1164  LQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             LQAEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KRE+E++ LE++ + YR+K+G
Sbjct  347   LQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREDEMKDLEAEFEAYREKYG  405



>ref|NP_173333.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79302.1|AC068602_25 F14D16.14 [Arabidopsis thaliana]
 gb|AAO22746.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29787.1| uncharacterized protein AT1G18990 [Arabidopsis thaliana]
Length=524

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 181/418 (43%), Positives = 247/418 (59%), Gaps = 66/418 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTR+D 
Sbjct  6     FKNFIEEELGTFPQFLIYALLEWILIIILFIDGFLAFFSNQIAKFFDLKIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV RN +FYYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K++     
Sbjct  66    VLVSRNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKETDVDTY  125

Query  579   addvkSVN------------------VFADKPN----------------FQR---CSCCM  647
                +  ++                  V   K +                FQR   CSCC 
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPVAGSKKDENFYQVENRTNNSNDRFQRQQRCSCCG  185

Query  648   EFLGGKGKYTRSMSQV---APPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeee  818
             + +  K    +S +Q    AP PSPR   N  T    D  N    D  +D+ +L      
Sbjct  186   QIMKLKSDKPKSNNQSFFGAPSPSPRVSFNQRT---LDLSNIKYTDLPEDDDALNTK---  239

Query  819   eeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNY  986
                 L+    +TP    G NKF GIPLSD    SPR S +  +   +D + L        
Sbjct  240   -GASLDAVDDRTPSFVKGGNKFFGIPLSDSAQNSPRWSVRSMKKSFVDQNGLE-------  291

Query  987   DLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRL  1166
                     +E      I+QHL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITRL
Sbjct  292   --------SEVLDGDSILQHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITRL  343

Query  1167  QAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             QAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE+ ++VYR ++G
Sbjct  344   QAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAGIEVYRLRYG  401



>ref|XP_004157842.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224988 
[Cucumis sativus]
Length=604

 Score =   259 bits (663),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 195/456 (43%), Positives = 263/456 (58%), Gaps = 76/456 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG + F + EFAKFFEL++PC +CTRID 
Sbjct  7     FTSFVEQELGQFPHFVVCAVLEWVLIILLFIDGIVTFLANEFAKFFELRVPCLYCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATEKESDCNTY  126

Query  579   addvkSVN-------------VFADKP----------------NFQRCSCCMEFL-----  656
                V  ++             V +  P                N+  CSCC E L     
Sbjct  127   KSLVGILHKDLECFVEDDNRQVVSLPPVGKKDDGLPMDKGFGVNYSCCSCCGEPLKVKSS  186

Query  657   GGKGKYTRSMSQVAPPPSPRA-----WRNNE-TDHPDDNENATNGDGRDDNRSLAVSeee  818
               KGK   + SQ AP PSPRA     +RN++ T     +   T      D+ S  V ++E
Sbjct  187   NSKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESEFVEDDE  245

Query  819   eeeG--LEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPN  980
                G  L+   CKTP    GN  F GIPL+D    SPR + + +R   +D + ++ ++  
Sbjct  246   GIHGRNLDAHPCKTPVFGKGNKXF-GIPLTDSANNSPRWAIRISRKSPLDRTEVA-AETY  303

Query  981   NYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
               D++   G N+      I+  LKRQV ++RKSL+ + MELDEER+ASA+AANNAMAMIT
Sbjct  304   EADMM-GPGDND-----SILNCLKRQVRIDRKSLMELYMELDEERSASAVAANNAMAMIT  357

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             RLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D++ KRE E       LDVYR+K+G
Sbjct  358   RLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDLLAKREAE-------LDVYREKYG  410

Query  1341  PINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRS  1448
              +           G+DE     +Q    F   SC S
Sbjct  411   YL-----------GEDEISDEDYQ---EFKSQSCLS  432



>gb|KGN64272.1| hypothetical protein Csa_1G045700 [Cucumis sativus]
Length=626

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 272/479 (57%), Gaps = 100/479 (21%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F+EQ LG+   F++ +VLE+V+I+LL +DG + F + EFAKFFEL++PC +CTRID 
Sbjct  7     FTSFVEQELGQFPHFVVCAVLEWVLIILLFIDGIVTFLANEFAKFFELRVPCLYCTRIDH  66

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV++N +FYYN++ICE HK+DISSL+YCH HKK+SDI+ MCE CLLSFA +K+S     
Sbjct  67    VLVNKNTDFYYNNSICEGHKKDISSLAYCHNHKKLSDIRKMCEVCLLSFATEKESDCNTY  126

Query  579   addvkSVN-------------VFADKP----------------NFQRCSCCMEFL-----  656
                V  ++             V +  P                N+  CSCC E L     
Sbjct  127   KSLVGILHKDLECFVEDDNRQVVSLPPVGKKDDGLPMDKGFGVNYSCCSCCGEPLKVKSS  186

Query  657   GGKGKYTRSMSQVAPPPSPRA-----WRNN---------------------ETDHPDDNE  758
               KGK   + SQ AP PSPRA     +RN+                     E++  +D+E
Sbjct  187   NSKGKNGSTFSQ-APAPSPRASFTPSFRNDDKTGLELPHIRYTELKLLSDSESEFVEDDE  245

Query  759   --NATNGDG---RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SP  911
               +  N D    ++D +++ V    E E + +SS +TP   G  NKF GIPL+D    SP
Sbjct  246   GIHGRNLDAHPFKEDAKAVKVPLLPEPEDMHESS-RTPV-FGKGNKFFGIPLTDSANNSP  303

Query  912   RMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSV  1091
             R + + +R   +D + ++ ++    D++   G N+      I+  LKRQV ++RKSL+ +
Sbjct  304   RWAIRISRKSPLDRTEVA-AETYEADMM-GPGDND-----SILNCLKRQVRIDRKSLMEL  356

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
              MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q   D+
Sbjct  357   YMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQATNDL  416

Query  1272  ILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRS  1448
             + KRE E       LDVYR+K+G +           G+DE     +Q    F   SC S
Sbjct  417   LAKREAE-------LDVYREKYGYL-----------GEDEISDEDYQ---EFKSQSCLS  454



>ref|XP_010471575.1| PREDICTED: uncharacterized protein LOC104751352, partial [Camelina 
sativa]
Length=513

 Score =   255 bits (651),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 174/423 (41%), Positives = 237/423 (56%), Gaps = 86/423 (20%)
 Frame = +3

Query  261   FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             F+IY+VLE+ +IV+L +DG +AFFS +FAKFFEL +PC  CTRID  LV R+   YYN++
Sbjct  7     FVIYTVLEWSLIVILFIDGLIAFFSNQFAKFFELNIPCLLCTRIDHILVPRDPQSYYNES  66

Query  441   ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVN------  602
             IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +KDS        +  ++      
Sbjct  67    ICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTYKSLIGILHKDLELL  126

Query  603   ---------VFADKPNF-------------------------QRCSCCMEFLGGKG-KYT  677
                       F    NF                         + CSCC E L  K  K+ 
Sbjct  127   IDDERELPLAFKKDDNFVQTTKNLVDYKINNNNNNLKSDSLKEHCSCCGELLKMKSEKFP  186

Query  678   RSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTP  857
             ++ S +AP PSPR   N ++      EN +     D +R                   TP
Sbjct  187   KNNSFLAPAPSPRVSYNKQS------ENESEFKDLDMDR-------------------TP  221

Query  858   CNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNG  1025
                 G NKF G+PLSD    SPR S +  +   +D        P N      +   + NG
Sbjct  222   SFVRGGNKFFGVPLSDSAQNSPRWSVRSLKKPLLD-------KPEN-----ASDTADQNG  269

Query  1026  SAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQ  1205
              + I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQAEKA+  M+A Q
Sbjct  270   ES-ILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQAEKAAVQMEALQ  328

Query  1206  YQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPI---NLACSEFFEI  1376
             YQRMM+EQAEYD+E  Q +   + KRE+E++ LE++ + YR+K+G +   + A  EF E 
Sbjct  329   YQRMMDEQAEYDQEALQSMSSELAKREDEMKELEAEFEAYREKYGCLSDEDDAREEFLEQ  388

Query  1377  EGD  1385
              GD
Sbjct  389   NGD  391



>ref|XP_002322137.1| hypothetical protein POPTR_0015s07970g [Populus trichocarpa]
 gb|EEF06264.1| hypothetical protein POPTR_0015s07970g [Populus trichocarpa]
Length=466

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 266/470 (57%), Gaps = 77/470 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFA-------KFFELKMPCF  377
             F+CF+EQ+LG+  LFLIY+VLE+V+I ++ +DG LAFF+ EF        KFFELK+PC 
Sbjct  6     FKCFVEQDLGKLPLFLIYAVLEWVLIAVVFIDGLLAFFANEFTFFANEFTKFFELKIPCL  65

Query  378   FCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdk  557
              CTRID A+V R+ + YYN +ICE+HK+++SSL+YC VHKK+SDI+ M E CLLSFA  K
Sbjct  66    LCTRIDLAVVRRDADLYYNQSICETHKKEVSSLAYCRVHKKLSDIRKMREGCLLSFATKK  125

Query  558   d----ssdyyaaddvkSVNVFAD---------------------KPNFQRCSCCMEFLG-  659
             +    +         K++ +F D                     K N  + SCC   L  
Sbjct  126   ESDCDTYKSPVRVLHKNIELFVDDDRDIHLRLPTGGKDNMVPAEKSNLHQGSCCGNPLKV  185

Query  660   ---GKGKYTRSMSQVAPPPSPR----AWRN--------------------NETDHPDDNE  758
                 KGK   ++SQ AP PSP     + RN                    N+++  DD +
Sbjct  186   KAYTKGKIAGTLSQ-APTPSPWVPLVSLRNEDPRKLDLSQVRYTELNFSENDSELQDDED  244

Query  759   --NATNGDGR--DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PR  914
               NA + D +  DD ++  V    E E   +    T  +RG  NKF+GI L+DS    PR
Sbjct  245   VSNAAHLDKQFTDDVKAAMVPLLTEAENTNEDWTPT-FSRG--NKFLGILLTDSATASPR  301

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
               T+  R   +D +     D + +   T    NE      I+ HLK+QV L+RK L+++ 
Sbjct  302   AFTRFPRKSFLDET----EDASEFTEGTCLS-NELVDDDSILHHLKKQVHLDRKLLMALY  356

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             MELDEER+ASA+AANNAMAMIT LQAE+A+  M+A QYQRMMEEQAEYD+E  Q  +D++
Sbjct  357   MELDEERSASAVAANNAMAMITWLQAERAAVQMEAIQYQRMMEEQAEYDQEALQATRDIL  416

Query  1275  LKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSS  1424
              KRE++I+ LE +L  YR+ +G +          E D++ H LK  S SS
Sbjct  417   SKREKQIKGLEFELMAYRENYGALFGQGFMGSGDEIDEDCHELKPHSHSS  466



>ref|XP_006416545.1| hypothetical protein EUTSA_v10007355mg [Eutrema salsugineum]
 gb|ESQ34898.1| hypothetical protein EUTSA_v10007355mg [Eutrema salsugineum]
Length=527

 Score =   253 bits (645),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 254/424 (60%), Gaps = 84/424 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTRID 
Sbjct  6     FKNFIEEELGSFPQFLIYAILEWIIIIILFIDGFLAFFSNQLAKFFDLKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssd---  569
              LV RN +FYYND+IC+SHK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRRNPDFYYNDSICDSHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  570   ---------------------------yyaaddvkSVNVFADKPN-----FQ---RCSCC  644
                                           +   ++ N    + N     FQ   RCSCC
Sbjct  126   KSLIGILHKDLELLIDDERELHQLAFPVSGSKKDENFNQIQHRANNSNDRFQQQQRCSCC  185

Query  645   MEFLGGKGKYTRSMSQVAPPPSPRAWRNNET---DH---PDDNENATNGDGRDDNRSLAV  806
              E L  K K  +  +  AP PSPR   N  T    H   P++ E++ N  G         
Sbjct  186   GELL--KIKSEKPKNNTAPSPSPRVSFNQRTLDLSHMKLPEE-EDSVNMKG---------  233

Query  807   SeeeeeeGLEDS-SCKTPCN-RGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSR  968
                     L DS   +TP + +GGNN+F GIPLSD    SPR S + T+         S 
Sbjct  234   -------ALADSVDDRTPSSVKGGNNRFFGIPLSDSAQNSPRWSVRSTKK--------SV  278

Query  969   SDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannam  1148
             +D N  +     G         I+ HLKRQV L+RKSL+ + MELDEER+A+A+AANNAM
Sbjct  279   NDQNGQESEVLDG-------DSILHHLKRQVRLDRKSLMDLYMELDEERSATAVAANNAM  331

Query  1149  amiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYR  1328
             AMITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++VYR
Sbjct  332   AMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIEVYR  391

Query  1329  DKFG  1340
              ++G
Sbjct  392   LRYG  395



>ref|XP_006390385.1| hypothetical protein EUTSA_v10019533mg [Eutrema salsugineum]
 gb|ESQ27671.1| hypothetical protein EUTSA_v10019533mg [Eutrema salsugineum]
Length=561

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 183/438 (42%), Positives = 246/438 (56%), Gaps = 83/438 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+V++ +L +DG LAF S +FA+FF+LK PC  CTRID 
Sbjct  25    FKNFVEQELGSFPQFLIYTVLEWVLLTVLFIDGVLAFLSNQFARFFDLKTPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R+  FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  85    VLVPRDPKFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  144

Query  579   addvkSVN---------------VFADKPNF------------------------QRCSC  641
                +  ++                F    NF                        Q CSC
Sbjct  145   KSLIGILHKDLELLIDDERELPLAFKKDDNFVQTTTNLVDYKTNNNNNTKKDSLKQHCSC  204

Query  642   CMEFLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSee  815
             C E L  K +     + S +AP PSPR   N  +            +   + R L V   
Sbjct  205   CGELLKMKSEKLPKTNNSFLAPAPSPRVPYNKLS------------ESESEFRDLDVD--  250

Query  816   eeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSID----YSALSRS  971
                        KTP    G NKF GIPLSD    SPR S +  +  S+D     S+L ++
Sbjct  251   -----------KTPSFARGGNKFFGIPLSDTAQNSPRWSVRSLKKSSLDKTENASSLDKT  299

Query  972   DPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannama  1151
             + N  D+    G         I+  LK++V L++KSL+ + MELDEER+ASA+AANNAMA
Sbjct  300   E-NASDMADPNG-------ESILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANNAMA  351

Query  1152  miTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRD  1331
             MITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++++ YR+
Sbjct  352   MITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEIEAYRE  411

Query  1332  KFGPINLACSEFFEIEGD  1385
             K+G +     EF E  G+
Sbjct  412   KYGCLT-DDEEFLEENGN  428



>ref|XP_011028725.1| PREDICTED: uncharacterized protein LOC105128660 [Populus euphratica]
Length=467

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 193/472 (41%), Positives = 268/472 (57%), Gaps = 79/472 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFA-------KFFELKMPCF  377
             F+CF+EQ+LG+  LFLIY+VLE+V+I ++ +DG LAFF+ EF        KFFELK+PC 
Sbjct  6     FKCFVEQDLGKLPLFLIYAVLEWVLIAVVFIDGLLAFFANEFTFFANEFTKFFELKIPCL  65

Query  378   FCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdk  557
              CTRID A+V R+ + YYN +ICE+HK+++SSL+YC VHKK++DI+ M E CLLSFA  K
Sbjct  66    LCTRIDLAVVRRDADLYYNQSICENHKKEVSSLAYCRVHKKLTDIRKMREGCLLSFATKK  125

Query  558   dssdyyaaddvkSVN-------------------------VFADKPNFQRCSCCMEFLG-  659
             +S        V++++                         V A+K N  + SCC   L  
Sbjct  126   ESDCDTYKSPVRALHKNIELFVDDDRDIHLRLPTGGKDNTVPAEKSNLHQGSCCGSPLKV  185

Query  660   ---GKGKYTRSMSQVAPPPSPR----AWRN---------------------NETDHPDDN  755
                 KGK + ++SQ AP PSP     + RN                     N+T+  DD 
Sbjct  186   EAYTKGKTSCTLSQ-APTPSPWVPLVSLRNEDPRKLDLSHVRCTELNLFSENDTELQDDE  244

Query  756   E--NATNGDGR--DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----P  911
             +  +A + D +  DD ++  V    E E   +    T  +RG  NKF+GI L+DS    P
Sbjct  245   DVSHAAHLDKQFADDVKAAMVPLLTEAENTNEDWTST-FSRG--NKFLGILLTDSATTSP  301

Query  912   RMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSV  1091
             R  T+  R      S L  ++  +     T   NE +  + I+  LK+QV L+RK LV++
Sbjct  302   RAFTRFPRK-----SFLDETEDASESTEGTCLSNEVDDDS-ILHQLKKQVRLDRKLLVAL  355

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
              MELDEER+ASA+AA NAMAMIT LQAE+A+  M+A QYQRMMEEQAEYD E  Q  +D+
Sbjct  356   YMELDEERSASAVAATNAMAMITWLQAERAAVQMEAIQYQRMMEEQAEYDHEALQATRDI  415

Query  1272  ILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSF  1427
             + KREE+I+ LE +L  +R+K+G            E D++ H LK  S SS+
Sbjct  416   LSKREEQIKGLEFELMAFREKYGVFFGQGFMGSGDEIDEDCHELKPHSHSSY  467



>ref|XP_007099756.1| Uncharacterized protein TCM_045761 [Theobroma cacao]
 gb|EOY20301.1| Uncharacterized protein TCM_045761 [Theobroma cacao]
Length=643

 Score =   253 bits (645),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 202/464 (44%), Positives = 266/464 (57%), Gaps = 61/464 (13%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG+   F IY+VLE++MI +L +DGFLAFF+ EFA FFEL +PC  CTRID 
Sbjct  27    FKQFVEQELGQVLKFFIYAVLEWIMIFVLFIDGFLAFFANEFANFFELPIPCLLCTRIDH  86

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkd----ss  566
              LV RN +FYYND+ICE HK+++S+L++CH HKK+SDI+ MCE+CLLSFA  K+    + 
Sbjct  87    VLVRRNSDFYYNDSICEHHKKNVSTLAFCHAHKKLSDIRNMCESCLLSFATGKESDCDTY  146

Query  567   dyyaaddvkSVNVFAD---------------------KPNFQRCSCCMEFLGGKGKYTR-  680
                     K + +F D                     K +   CSCC E L  K  Y + 
Sbjct  147   KSLLGILHKDIELFVDEDHEVHLSLPAGKKENEGAIEKSHDHLCSCCGEPLKVKSSYIKG  206

Query  681   --SMSQVAPPPSPRAWRNNETDHPDDNENATNGD----GRDDNRSLAVSeeeeeeGLE--  836
               S    AP P   A  N +  H +  E   N D      D++RS  +S E+  E  +  
Sbjct  207   KHSSLAPAPSPRAPANPNLDLSHINYTELKLNSDESEVHEDNDRSRGISLEKPFEDAKAA  266

Query  837   --------DSSCKTPCNRGGNNKFVGIPLSD----SPRMS--TKKTRTMSIDYSALSRSD  974
                     D   KTP N    NKF GIPLSD    SPR +  T+K+     ++++ S   
Sbjct  267   TVPLLMDADDEDKTP-NFIRGNKFFGIPLSDSATNSPRWTRITRKSLLEKTEFASESGDG  325

Query  975   PNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamam  1154
             P           NE  G   I+ HLKRQV ++RKSL+++ MELDEER+AS +AANNAMAM
Sbjct  326   PVP---------NEAEGD--ILHHLKRQVRMDRKSLMALYMELDEERSASTVAANNAMAM  374

Query  1155  iTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             ITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q + +++ KREEEI+ LE++L+VYR  
Sbjct  375   ITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQEMSNLLAKREEEIKDLEAELEVYRQN  434

Query  1335  FGPINLACSEFFEIEGDDEFHSLKFQSLSSF-GEMSCRSLTDVL  1463
             +G +     E    E D  +  LK  S SS+ G   C S T  L
Sbjct  435   YGCLKEVDFEGQGEESDGGYRVLKPPSNSSYNGRTECTSPTRSL  478



>ref|XP_002888993.1| hypothetical protein ARALYDRAFT_316417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65252.1| hypothetical protein ARALYDRAFT_316417 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   249 bits (635),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 177/435 (41%), Positives = 240/435 (55%), Gaps = 86/435 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+ +IV+L +DG +AF S ++AKFF+L +PC  CTRID 
Sbjct  25    FKKFVEQELGSRPHFLIYTVLEWSLIVILFIDGIIAFLSNQYAKFFDLNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R+  FYYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  85    ILVPRDPRFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  144

Query  579   addvkSVN---------------VFADKPNF--------------------QRCSCCMEF  653
                +  ++                F    NF                    Q CSCC E 
Sbjct  145   KSLIGILHKDLELLIDDERELPLAFKKDDNFIQTTKNLVDHKNNIKNDSLKQHCSCCGEL  204

Query  654   LGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeee  827
             L  K +     + S +AP PSPR   N  ++               + + L V       
Sbjct  205   LKIKSEKLPNNNNSFLAPAPSPRVSNNKLSER------------ESEFKDLDVD------  246

Query  828   GLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYS--ALSRSDPNNYD  989
                    +TP    G NKF GIPLSD    SPR S +  +   +D +  A   +DPN   
Sbjct  247   -------RTPSFVRGGNKFFGIPLSDSVQNSPRWSVRSLKKSLLDKTENASDTADPN---  296

Query  990   LVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQ  1169
                            I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQ
Sbjct  297   ------------GESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQ  344

Query  1170  AEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPIN  1349
             AEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ + YR+K+G + 
Sbjct  345   AEKAAVQMEALQYQRMMDEQAEYDQEALQSMSTELAKREEEMKELEAEFEAYREKYGSLT  404

Query  1350  ---LACSEFFEIEGD  1385
                 A  EF E  G+
Sbjct  405   DEEDAREEFHEQNGN  419



>gb|AAD55293.1|AC008263_24 F25A4.20 [Arabidopsis thaliana]
 gb|AAG51939.1|AC013258_33 hypothetical protein; 88230-89897 [Arabidopsis thaliana]
Length=523

 Score =   248 bits (633),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 229/416 (55%), Gaps = 80/416 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+ +IV L +DG +AF S +FAKFF+L +PC  CTRID 
Sbjct  6     FKKFVEQELGSLPHFLIYTVLEWSLIVFLFIDGVIAFLSNQFAKFFDLNIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS------------  542
              LV R+  FYYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLS            
Sbjct  66    ILVPRDPQFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  125

Query  543   ------------------------FAPdkdssdyyaaddvkSVNVFADKPNFQRCSCCME  650
                                     F  D +             N   +    Q CSCC E
Sbjct  126   KSLIGILHKDLELLIDDERDLPLAFKKDDNLVQTTKNLVDYKTNNIKNDSLKQHCSCCGE  185

Query  651   FLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeee  824
              L  K +     + S +AP PSPR   N  +      EN +     D +R          
Sbjct  186   LLKIKSEKLPKNNNSFLAPAPSPRVSHNKLS------ENESEFKDMDVDR----------  229

Query  825   eGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSIDYSALSRSDPNNYDL  992
                      TP    G NKF GIPLSDS    PR S +     S+  S L++++ N  D 
Sbjct  230   ---------TPSFVRGGNKFFGIPLSDSAQNSPRWSVR-----SLKKSVLNKTE-NASDT  274

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
                TG         I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQA
Sbjct  275   TDPTG-------ESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQA  327

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             EKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ +VYR+K+G
Sbjct  328   EKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEVYREKYG  383



>ref|NP_177621.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35636.1| uncharacterized protein AT1G74830 [Arabidopsis thaliana]
Length=542

 Score =   248 bits (634),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 229/416 (55%), Gaps = 80/416 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+ +IV L +DG +AF S +FAKFF+L +PC  CTRID 
Sbjct  25    FKKFVEQELGSLPHFLIYTVLEWSLIVFLFIDGVIAFLSNQFAKFFDLNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS------------  542
              LV R+  FYYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLS            
Sbjct  85    ILVPRDPQFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  543   ------------------------FAPdkdssdyyaaddvkSVNVFADKPNFQRCSCCME  650
                                     F  D +             N   +    Q CSCC E
Sbjct  145   KSLIGILHKDLELLIDDERDLPLAFKKDDNLVQTTKNLVDYKTNNIKNDSLKQHCSCCGE  204

Query  651   FLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeee  824
              L  K +     + S +AP PSPR   N  +      EN +     D +R          
Sbjct  205   LLKIKSEKLPKNNNSFLAPAPSPRVSHNKLS------ENESEFKDMDVDR----------  248

Query  825   eGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSIDYSALSRSDPNNYDL  992
                      TP    G NKF GIPLSDS    PR S +     S+  S L++++ N  D 
Sbjct  249   ---------TPSFVRGGNKFFGIPLSDSAQNSPRWSVR-----SLKKSVLNKTE-NASDT  293

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
                TG         I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQA
Sbjct  294   TDPTG-------ESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQA  346

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             EKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ +VYR+K+G
Sbjct  347   EKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEVYREKYG  402



>ref|XP_006301094.1| hypothetical protein CARUB_v10021488mg [Capsella rubella]
 gb|EOA33992.1| hypothetical protein CARUB_v10021488mg [Capsella rubella]
Length=554

 Score =   247 bits (631),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 178/434 (41%), Positives = 241/434 (56%), Gaps = 79/434 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+ +I++L +DG +AF S +FAKFF+L +PC  CTR+D 
Sbjct  25    FKKFVEQELGSLPHFLIYTVLEWSLIIILFIDGLIAFLSNQFAKFFDLNIPCLLCTRVDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R+   YYN++IC+SHK+ ISSL+YCHVHKK+S+IK MCE CLLSFA +KDS     
Sbjct  85    ILVPRDPQSYYNESICDSHKKKISSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  579   addvkSVN---------------VFADKPNF-------------------------QRCS  638
                +  ++                F    NF                         Q CS
Sbjct  145   KSLIGILHKDLELLIDDERDLPLAFKKDDNFVQSTKNLVDHKTNNNNNNIKNDSLKQHCS  204

Query  639   CCMEFLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSe  812
             CC E L  K +     + S +AP PSPR   N ++      EN +     D +R      
Sbjct  205   CCGELLKMKSEKLPKNNNSFLAPAPSPRVSNNKQS------ENESEFKDLDMDR------  252

Query  813   eeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDL  992
                          TP    G NKF GIPLSDS + S +        +S  S   P     
Sbjct  253   -------------TPSFVRGGNKFFGIPLSDSAQNSPR--------WSVRSLKKPLLEKT  291

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
               T+   + NG + I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQA
Sbjct  292   ENTSDTADPNGDS-ILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQA  350

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPI--  1346
             EKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ + YR+K+G +  
Sbjct  351   EKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEAYREKYGCLTD  410

Query  1347  -NLACSEFFEIEGD  1385
              + A  EF E  G+
Sbjct  411   EDDAREEFLERNGN  424



>dbj|BAC42795.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 173/416 (42%), Positives = 228/416 (55%), Gaps = 80/416 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+ +IV L +DG +AF S +FAKFF+L +PC  CTRID 
Sbjct  25    FKKFVEQELGSLPHFLIYTVLEWSLIVFLFIDGVIAFLSNQFAKFFDLNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS------------  542
              LV R+  FYYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLS            
Sbjct  85    ILVPRDPQFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  543   ------------------------FAPdkdssdyyaaddvkSVNVFADKPNFQRCSCCME  650
                                     F  D +             N   +    Q CSCC E
Sbjct  145   KSLIGILHKDLELLIDDERDLPLAFKKDDNLVQTTKNLVDYKTNNIKNDSLKQHCSCCGE  204

Query  651   FLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeee  824
              L  K +     + S +AP PSPR   N  +      EN +     D +R          
Sbjct  205   LLKIKSEKLPKNNNSFLAPAPSPRVSHNKLS------ENESEFKDMDVDR----------  248

Query  825   eGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSIDYSALSRSDPNNYDL  992
                      TP    G NKF GIPLSDS    PR S +     S+  S L++++ N  D 
Sbjct  249   ---------TPSFVRGGNKFFGIPLSDSAQNSPRWSVR-----SLKKSVLNKTE-NASDT  293

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
                 G         I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITRLQA
Sbjct  294   TDPAG-------ESILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITRLQA  346

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             EKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ +VYR+K+G
Sbjct  347   EKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEVYREKYG  402



>ref|XP_010416341.1| PREDICTED: uncharacterized protein LOC104702212 [Camelina sativa]
Length=547

 Score =   246 bits (628),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 174/419 (42%), Positives = 234/419 (56%), Gaps = 85/419 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    F+IY+VLE+ +IV+L +DG +AFFS +FAKFFEL +PC  CTRID 
Sbjct  25    FKKFVEQELGSLPHFVIYTVLEWSLIVILFIDGLIAFFSNQFAKFFELNIPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  +   YYN++IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +KDS     
Sbjct  85    ILVPGDPQSYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKDSDCDTY  144

Query  579   addvkSVN---------------VFADKPNF-----------------------QRCSCC  644
                +  ++                F    NF                       + CSCC
Sbjct  145   KSLIGILHKDLELLIDDERELPLAFKKDDNFVQTTKNLVDYKINNNNLKSDSLKEHCSCC  204

Query  645   MEFLGGKG-KYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeee  821
              E L  K  K  ++ S +AP PSPR   N ++      EN +     D +R         
Sbjct  205   GELLKMKSEKLPKNNSFLAPAPSPRVSYNKQS------ENESEFKYLDMDR---------  249

Query  822   eeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDY--SALSRSDPNN  983
                       TP    G NKF G+PLSD    SPR S +  +   +D   +A  R+D N 
Sbjct  250   ----------TPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLKKPLLDKPENASDRADQN-  298

Query  984   YDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTR  1163
                              I+  LK++V L++KSL+ + MELDEER+ASA+AAN AMAMITR
Sbjct  299   --------------GESILHQLKKEVRLDKKSLIDLYMELDEERSASAVAANEAMAMITR  344

Query  1164  LQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             LQAEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ + YR+K+G
Sbjct  345   LQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSSELAKREEEMKELEAEFEAYREKYG  403



>ref|XP_002893026.1| hypothetical protein ARALYDRAFT_472122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69285.1| hypothetical protein ARALYDRAFT_472122 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   244 bits (622),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 180/427 (42%), Positives = 245/427 (57%), Gaps = 84/427 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTR+D 
Sbjct  6     FKNFIEEELGTFPQFLIYALLEWILIIILFIDGFLAFFSNQIAKFFDLKIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCL--------------  536
              LV RN +FYYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CL              
Sbjct  66    VLVRRNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  537   ----------------------LSFAPdkdssdyyaaddvkSVNVFADK-PNFQRCSCCM  647
                                   L+F       D       +  N   D+    QRCSCC 
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPAAGSKKDENFYQVDQRTNNSNDRFHKQQRCSCCG  185

Query  648   EFLGGKGKYTRSMSQ---VAPPPSPRAWRNNET---------DHPDDNENATNGDGRDDN  791
             + L  K +  ++ +Q    AP PSPR   N  T         D P+D+ +A N  G    
Sbjct  186   QLLKLKSEKPKNNNQSFFAAPSPSPRVSFNQRTLDLSNIKYTDSPEDD-DAVNTKG----  240

Query  792   RSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSIDYSA  959
                          ++    +TP    G NKF GIPLSDS    PR S +  +   ID + 
Sbjct  241   -----------ASVDSVDDRTPSFVKGGNKFFGIPLSDSAQNSPRWSVRSMKKSLIDQNG  289

Query  960   LSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaan  1139
              S S+  + D               I+QHL RQV L+RKSL+ + MELDEER+ASA+AAN
Sbjct  290   -SESEVLDGD--------------SILQHLNRQVRLDRKSLMDLYMELDEERSASAVAAN  334

Query  1140  namamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLD  1319
             NAMAMITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++
Sbjct  335   NAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIE  394

Query  1320  VYRDKFG  1340
             VYR ++G
Sbjct  395   VYRLRYG  401



>ref|XP_010477102.1| PREDICTED: uncharacterized protein LOC104756242 [Camelina sativa]
Length=530

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 198/506 (39%), Positives = 278/506 (55%), Gaps = 80/506 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+E+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTR+D 
Sbjct  6     FKSFVEKELGTYPHFLIYALLEWILIIILFIDGFLAFFSNQMAKFFDLKIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRTNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  579   addvkSVN-----VFADKPNFQ--------------------------------RCSCCM  647
                +  ++     +  D+   Q                                RCSCC 
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPVTGSKRDDNFYQIDYRTNNGNDRFQQHQRCSCCG  185

Query  648   EFLGGKGKYTRSMSQV---APPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeee  818
             E L  K +  ++ +Q    AP PSPR   N  T    D  N    +  +D  +L      
Sbjct  186   ELLKVKSEKPKNGNQSFFGAPSPSPRVSFNQRT---LDVSNIKYTELTEDEDALNTK---  239

Query  819   eeeGLEDS-SCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNN  983
                 L DS   +TP    G NKF GIPLSD    SPR S +  +         S +D N 
Sbjct  240   --GALVDSVDDRTPSFVKGGNKFFGIPLSDSVQNSPRWSVRSMKK--------SLTDQNG  289

Query  984   YDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTR  1163
              +       NE      I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITR
Sbjct  290   SE-------NEVLDGDSILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITR  342

Query  1164  LQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGP  1343
             LQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++ YR ++G 
Sbjct  343   LQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIEAYRLRYGL  402

Query  1344  I-------NLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRSLTDVLDHHE----VYLDS  1490
             +         A  EF + E D+          SS  E     + D ++  +    V L+ 
Sbjct  403   LGEEDEERGEAAEEFLDEEKDETKPVSDLPVCSSNHEDDLEQMKDSVEESKPTNGVILEE  462

Query  1491  DN-DRSHHSALLRTIPETTSATPAVQ  1565
             +N + S    L++ I E T    A++
Sbjct  463   ENANGSRKDMLVKEISEITERLNAIE  488



>ref|XP_010459554.1| PREDICTED: uncharacterized protein LOC104740600 [Camelina sativa]
 ref|XP_010459555.1| PREDICTED: uncharacterized protein LOC104740600 [Camelina sativa]
Length=530

 Score =   240 bits (613),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 197/506 (39%), Positives = 277/506 (55%), Gaps = 80/506 (16%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+E+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTR+D 
Sbjct  6     FKSFVEKELGTYPHFLIYALLEWILIIILFIDGFLAFFSNQMAKFFDLKIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRTNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  579   addvkSVN-----VFADKPNFQ--------------------------------RCSCCM  647
                +  ++     +  D+   Q                                RCSCC 
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPVTGSKREDNFYQIDYRTNNGNDRFQQQQRCSCCG  185

Query  648   EFLGGKGKYTRSMSQV---APPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeee  818
             E L  K    ++ +Q    AP PSPR   N  T    D  N    +  +D  +L      
Sbjct  186   ELLKVKSDKPKTSNQSFFGAPSPSPRVSFNQRT---LDVSNIKYTELTEDEYALNTK---  239

Query  819   eeeGLEDS-SCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNN  983
                 L DS   +TP    G NKF GIPLSD    SPR S +  +         S +D N 
Sbjct  240   --GALVDSVDDRTPSFVKGGNKFFGIPLSDSVQNSPRWSVRSMKK--------SLTDQNG  289

Query  984   YDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTR  1163
              +       NE      I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITR
Sbjct  290   SE-------NEVLDGDSILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITR  342

Query  1164  LQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGP  1343
             LQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++ YR ++G 
Sbjct  343   LQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIEAYRLRYGL  402

Query  1344  I-------NLACSEFFEIEGDDEFHSLKFQSLSSFGEMSCRSLTDVLDH----HEVYLDS  1490
             +         A  EF + E D+          SS  E     + D ++     + V ++ 
Sbjct  403   LGEEDEERGEAAEEFLDEEKDETKPVSDLPVCSSNHEDDLEQMKDSVEESITTNGVIIEE  462

Query  1491  DN-DRSHHSALLRTIPETTSATPAVQ  1565
             +N + S    L++ I E T    A++
Sbjct  463   ENANASRKDMLVKEISEITERLNAIE  488



>ref|XP_004508804.1| PREDICTED: uncharacterized protein LOC101500585 [Cicer arietinum]
Length=504

 Score =   239 bits (610),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 172/435 (40%), Positives = 240/435 (55%), Gaps = 77/435 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F  F++Q +G    F++  VLE+V+I+ L +DGF+AFF+ EFA++FEL +PC+ C R++ 
Sbjct  6     FTRFVKQKMGNFPHFVLCMVLEWVLIISLFLDGFIAFFTTEFARYFELDIPCWLCARMNH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              L  +   FYYN++IC++HK+D+SS+++CH H K+SD++ MCE CLLSFA  K+S     
Sbjct  66    VLAQKTPGFYYNNSICDAHKKDVSSMAFCHNHNKLSDLRKMCEGCLLSFATQKESDCDTY  125

Query  579   addvkSVN-----------------------VFAD-KPNFQRCSCCMEFLG-----GKGK  671
                V  +N                       V  D K + QRCSCC   L       KGK
Sbjct  126   KSLVGVLNKNLECFVEDGEDNIQLSLKDEEVVSQDEKSSIQRCSCCGAPLKLKSSISKGK  185

Query  672   YTRSMSQVAPPPSPRAWRNNETDHP---------------------DDNENATNGDG---  779
              + S  + AP  SPRA       HP                      D+E   N DG   
Sbjct  186   NSGSFLK-APAASPRA-------HPFVTSKYEESRGLESPRTPYAKKDSELTQNEDGNNL  237

Query  780   RDDNRSL--AVSeeeeeeGLEDSSCKTPCNR--GGNNKFVGIPLSDSPRMSTKKTRTMSI  947
             +  N  L   +       G ED + ++P       +N+F G+PL+DSP  S K +  + +
Sbjct  238   KKQNSKLKEVLKGTSLLTGSEDINVESPKTPPFPWSNRFSGVPLTDSPINSPKWSSGL-M  296

Query  948   DYSALSR----SDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEER  1115
               S L +    SD N +         +      ++ +LKRQV L+RKSL+++ MELDEER
Sbjct  297   KKSPLEKTEYASDSNEWSC-------QNEEDDAVLNNLKRQVRLDRKSLMALYMELDEER  349

Query  1116  nasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEI  1295
             +ASA+AANNAMAMITRLQ EKA+  M ASQYQRMMEEQ EYD E  Q   D++LK EEE+
Sbjct  350   SASAVAANNAMAMITRLQEEKAALQMDASQYQRMMEEQIEYDEEVLQETNDLLLKLEEEV  409

Query  1296  EALESDLDVYRDKFG  1340
               L ++L++YRDK G
Sbjct  410   RTLYTELEIYRDKHG  424



>emb|CDY19266.1| BnaC05g14670D [Brassica napus]
Length=521

 Score =   239 bits (609),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 176/411 (43%), Positives = 240/411 (58%), Gaps = 57/411 (14%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG      IY++LE+++I+LL +DG LAFFS +FA+FF L  PC  CTR+D 
Sbjct  6     FKNFIEEELGTFPHLFIYAILEWIIIILLFIDGLLAFFSNQFARFFNLITPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             ALV  N +FYYND+IC+SHKR+ISSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    ALVKTNPDFYYNDSICDSHKRNISSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDVDTY  125

Query  579   addv----kSVNVFADK---------------PNFQR----------CSCCMEFLGGKGK  671
                +    K + +  D+                NF R          CSCC EFL  K +
Sbjct  126   KSLIGILHKDLELLIDERELQLAFPVAGSKKDENFHRTNNRLQKQQNCSCCGEFLKIKTE  185

Query  672   YTRSMSQ----VAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLED  839
               ++ +       P PSPR   N  T      + +   +G D     +V+ +       D
Sbjct  186   KPKNNNNQSFFAGPSPSPRVSFNQRTLDLSQIKYSELPEGED-----SVNNKGALGDTVD  240

Query  840   SSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTG  1007
                 +    G NN+F GIPLSD    SPR S +  +   ID +                 
Sbjct  241   DRTPSFVKGGNNNRFFGIPLSDSALNSPRWSVRSMKKSLIDQNGAE--------------  286

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              +E      I+ HLKRQV L+RKSL+ + MELDEER+ASA+AANNAMAMITRLQAEKA+ 
Sbjct  287   -SEVLDGDSILHHLKRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITRLQAEKAAV  345

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
              M+A QYQRMM+EQAEYD+E  Q +  +++KREE+++ LE++++ YR ++G
Sbjct  346   QMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEDMKELEAEIEAYRLRYG  396



>ref|XP_010498305.1| PREDICTED: uncharacterized protein LOC104776015 [Camelina sativa]
 ref|XP_010498306.1| PREDICTED: uncharacterized protein LOC104776015 [Camelina sativa]
Length=530

 Score =   237 bits (605),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 252/442 (57%), Gaps = 75/442 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+E+ LG    FLIY++LE+++I++L +DGFLAFFS + AKFF+LK+PC  CTR+D 
Sbjct  6     FKSFVEKELGTFPQFLIYALLEWILIIILFIDGFLAFFSNQMAKFFDLKIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N + YYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRTNPDIYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  579   addvkSVN-----VFADKPNFQ--------------------------------RCSCCM  647
                +  ++     +  D+   Q                                RCSCC 
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPVTGSKREDNFYQIDYRTNNGNDRFQQQQRCSCCG  185

Query  648   EFLGGKGKYTRSMSQV---APPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeee  818
             E L  K    ++ +Q    AP PSPR   N  T    D  N    +  +D  +L      
Sbjct  186   ELLKVKSDKPKNNNQSFFGAPSPSPRVSFNQRT---LDVSNIKYTELTEDEDALNTK---  239

Query  819   eeeGLEDS-SCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNN  983
                 L DS   +TP    G NKF GIPLSD    SPR S +  +         S +D N 
Sbjct  240   --GALVDSVDDRTPSFVKGGNKFFGIPLSDSVQNSPRWSVRSMKK--------SLTDQNG  289

Query  984   YDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTR  1163
              +       NE      I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITR
Sbjct  290   SE-------NEVLDGDSILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITR  342

Query  1164  LQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGP  1343
             LQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++ YR ++G 
Sbjct  343   LQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIEAYRLRYGL  402

Query  1344  I-------NLACSEFFEIEGDD  1388
             +         A  EF + E D+
Sbjct  403   LGEEDEERGEAAEEFLDEEKDE  424



>emb|CDX73116.1| BnaC06g35640D [Brassica napus]
Length=551

 Score =   238 bits (606),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 173/437 (40%), Positives = 234/437 (54%), Gaps = 92/437 (21%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+++I  L VDG LAF S ++A+FF+L  PC  CTRID 
Sbjct  26    FKTFVEQELGSFPKFLIYTVLEWILITALFVDGVLAFLSNQYARFFDLNAPCLLCTRIDH  85

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA----------  548
              LV R+ +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA          
Sbjct  86    VLVPRDPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  145

Query  549   ---------------------PdkdssdyyaaddvkSVNVFADKPNFQRCSCCMEFLGGK  665
                                  P               +  +      Q CSCC E L  K
Sbjct  146   KSLIGILHKDLEVLIDDERDLPLGLKKQDDLVQTTTHLIDYKTDSLKQHCSCCGELLKTK  205

Query  666   GK--YTRSMSQVAPPPSPRAWRN-----NETDHPDDNENATNGDGRDDNRSLAVSeeeee  824
              +    ++ S +AP PSPR   N     NE++  D                         
Sbjct  206   SEKFLKKNNSFLAPAPSPRVSYNKLSEINESEFKD-------------------------  240

Query  825   eGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYDL  992
                 D   +TP    G NKF G+PLSD    SPR S +  R  S+D   +  S       
Sbjct  241   ---FDVEERTPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLRKPSLDKIEIPDS-------  290

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
                      NG + I+  LK++V L++KSL+ + MELDEER+ASA+AA NAMAMIT+LQA
Sbjct  291   ---------NGES-ILNQLKKEVRLDKKSLIDLYMELDEERSASAVAAYNAMAMITKLQA  340

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPIN-  1349
             EK++  M+A QYQRMM+EQAEYD+E  Q +   + K+EEE + LE++ + YR+++G +  
Sbjct  341   EKSAIQMEALQYQRMMDEQAEYDQEALQSMSSDLAKKEEEFKELEAEFEAYRERYGCLTD  400

Query  1350  --LACSEFFEIEGDDEF  1394
                +  EF  +E  DEF
Sbjct  401   DEASGDEF--LEEQDEF  415



>gb|KFK41919.1| hypothetical protein AALP_AA2G189100 [Arabis alpina]
Length=711

 Score =   240 bits (613),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 177/436 (41%), Positives = 238/436 (55%), Gaps = 85/436 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    F IY++LE+ +I +L +DG LAF S +FAKFF+L  PC  CTRID 
Sbjct  6     FKNFVEQELGSLPQFFIYTILEWSLITILFIDGVLAFLSNQFAKFFDLNTPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA----------  548
              LV ++  FYYND+IC+SHK+ ISSL+YCHVH+K+S+IK MCE CLLSFA          
Sbjct  66    VLVPQDPEFYYNDSICDSHKKKISSLAYCHVHRKLSEIKHMCEGCLLSFATEKESDCDTY  125

Query  549   ---------------------PdkdssdyyaaddvkSVNVFADKPNF-------QRCSCC  644
                                  P     D        + N+   K N        + CSCC
Sbjct  126   KSLIGILHKDLELLIDDERELPLAFKKDDNFVQTTTTTNLVDHKSNNIKNESLKEHCSCC  185

Query  645   MEFLGGKGKY--TRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeee  818
              E L  K +     + + +AP PSPR   N  +++              + + L V    
Sbjct  186   GELLKIKSEKLPKNNNAFIAPAPSPRVSYNKLSEN------------ESEFKDLDVD---  230

Query  819   eeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNY  986
                       KTP    G NKF GIPLSD    SPR S +  R      S L +++ N  
Sbjct  231   ----------KTPSFVRGGNKFFGIPLSDSAQNSPRWSVRPLRK-----SLLEKTE-NAS  274

Query  987   DLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRL  1166
             ++    G         I+  LK++V L++KSL+ + MELDEER+ASAIAANNAMAMITRL
Sbjct  275   EMANQNG-------DSILNQLKKEVRLDKKSLIDLYMELDEERSASAIAANNAMAMITRL  327

Query  1167  QAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPI  1346
             QAEKA+  M+A QYQRMM+EQAEYD+E  Q +   + KREEE++ LE++ + YR+K+G +
Sbjct  328   QAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSTELAKREEEVKELEAEFEAYREKYGCL  387

Query  1347  ---NLACSEFFEIEGD  1385
                + A  EF E  G+
Sbjct  388   TDEDNAREEFLEEHGN  403



>emb|CDY26705.1| BnaA06g13170D [Brassica napus]
Length=518

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 177/423 (42%), Positives = 240/423 (57%), Gaps = 84/423 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    F IY++LE+++I+LL +DG LAFFS +FA+FF L+ PC  CTR+D 
Sbjct  6     FKNFIEEELGTFPHFFIYAILEWIIIILLFIDGLLAFFSNQFARFFNLRTPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC+SHKR+ISSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVKTNPDFYYNDSICDSHKRNISSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDVDTY  125

Query  579   ad----dvkSVNVFADK---------------PNFQR----------CSCCMEFLGGKGK  671
                     K + +  D+                NF R          CSCC E L  K +
Sbjct  126   KSLIGILHKDLELLIDERELQLAFPVAGSKKDENFHRTNNRFQQQQHCSCCGELLKIKTE  185

Query  672   YTRSMSQ----VAPPPSPRAWRNNET---------DHPDDNEN-ATNGDGRDDNRSLAVS  809
               ++ +       P PSPR   N  T         + P++ +     GD  DD       
Sbjct  186   KPKNNNNQSFFAGPSPSPRVSFNQRTLDLSQIKYSELPEEEDTKGALGDTVDD-------  238

Query  810   eeeeeeGLEDSSCKTP--CNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRS  971
                          +TP     G NN+F G+PLSD    SPR S +  +   ID +     
Sbjct  239   -------------RTPSFVKGGNNNRFFGLPLSDSALNSPRWSVRSMKKSLIDQNGAE--  283

Query  972   DPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannama  1151
                          +E      I+ HLKRQV L+RKSL+ + MELDEER+ASA+AANNAMA
Sbjct  284   -------------SEVLDGDSILHHLKRQVRLDRKSLMDLYMELDEERSASAVAANNAMA  330

Query  1152  miTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRD  1331
             MITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREE+++ LE++++ YR 
Sbjct  331   MITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEDMKELEAEIEAYRL  390

Query  1332  KFG  1340
             ++G
Sbjct  391   RYG  393



>gb|KFK44044.1| hypothetical protein AALP_AA1G208200 [Arabis alpina]
Length=533

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 184/432 (43%), Positives = 245/432 (57%), Gaps = 90/432 (21%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    FL Y++LE+++I++L +DGFLAFFS + A+FF+LK+PC  CTRID 
Sbjct  6     FKNFIEEELGTFPHFLFYAILEWILIIILFIDGFLAFFSNQIARFFDLKIPCLLCTRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV RN +FYYND+IC++HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRRNPDFYYNDSICDAHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  579   addv--------------------------------------kSVNVFADK-PNFQRCSC  641
                +                                      +S N  +DK    Q CSC
Sbjct  126   KSLIGILHKDLELLIDDERELQLAFPVTAGSKKDENYYQIDHRSTNNSSDKFQQQQHCSC  185

Query  642   CMEFL---GGKGKYTRSMSQV-APPPSPRAWRNNE---------TDHPDDNENATNGDGR  782
             C E L     K K   S S   AP PSPR   N           TD P+D E+  N  G 
Sbjct  186   CGELLKIKSEKPKINNSQSFFGAPSPSPRVSFNQRTLDLSNVKYTDFPED-EDPVNTKG-  243

Query  783   DDNRSLAVSeeeeeeGLEDS-SCKTPC-NRGGNNKFVGIPLSD----SPRMSTKKTRTMS  944
                             L DS   +TP   +G +N+F GIPL+D    SPR S +  +   
Sbjct  244   ---------------ALMDSVDERTPSFVKGSSNRFFGIPLTDSAQNSPRWSVRSMKKSL  288

Query  945   IDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnas  1124
             ID +                  NE      I+ HL RQV L+RKSL+ + MELDEER+AS
Sbjct  289   IDQNG---------------SENEVLDGDSILHHLNRQVRLDRKSLMDLYMELDEERSAS  333

Query  1125  aiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEAL  1304
             A+AANNAMAMITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ L
Sbjct  334   AVAANNAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKEL  393

Query  1305  ESDLDVYRDKFG  1340
             E++++ YR ++G
Sbjct  394   EAEIEAYRLRYG  405



>ref|XP_006306072.1| hypothetical protein CARUB_v10011395mg [Capsella rubella]
 gb|EOA38970.1| hypothetical protein CARUB_v10011395mg [Capsella rubella]
Length=529

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 177/421 (42%), Positives = 243/421 (58%), Gaps = 72/421 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE  LG    FL+Y++LE+++I++L +DGFLAFFS + AKFF+L++PC  CTR+D 
Sbjct  6     FKNFIEDELGTFPQFLVYALLEWILIIILFIDGFLAFFSNQIAKFFDLQIPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV RN +FY ND+IC+ HK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVRRNPDFYINDSICDVHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKESDVDTY  125

Query  579   addvkSVN-----VFADKPNF--------------------------------QRCSCCM  647
                +  ++     +  D+  F                                Q CSCC 
Sbjct  126   KSLIGILHKDLELLIDDEREFQLAFPVTGSKKDDNLCQIDHRANNGNNRFQQQQHCSCCG  185

Query  648   EFLGGKGKYTRSMSQV---APPPSPRAWRNNET---DHPDDNENATNGDGRDDNRSLAVS  809
             E L  K +  ++ +Q    AP PSPR   N  T    H    E+  + D  +    L  S
Sbjct  186   ELLKVKSEKPKNTNQSFFGAPSPSPRVSFNQRTVDMSHMKYAESPEDEDALNTKSELVDS  245

Query  810   eeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDP  977
              +E          +TP    G NKF GIPLSD    SPR S +  +         S +D 
Sbjct  246   FDE----------RTPSFVKGGNKFFGIPLSDSVQNSPRWSVRSMKK--------SLTDQ  287

Query  978   NNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamami  1157
             N  +     G         I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMI
Sbjct  288   NGLESEVLDG-------DSILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMI  340

Query  1158  TRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             TRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREEE++ LE++++ YR ++
Sbjct  341   TRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEEMKELEAEIEAYRLRY  400

Query  1338  G  1340
             G
Sbjct  401   G  401



>ref|XP_009149381.1| PREDICTED: uncharacterized protein LOC103872703 [Brassica rapa]
Length=518

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 176/423 (42%), Positives = 240/423 (57%), Gaps = 84/423 (20%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE+ LG    F IY++LE+++I+LL +DG LAFFS +FA+FF L+ PC  CTR+D 
Sbjct  6     FKNFIEEELGTFPHFFIYAILEWIIIILLFIDGLLAFFSNQFARFFNLRTPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC+SHKR+ISSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  66    VLVKTNPDFYYNDSICDSHKRNISSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDVDTY  125

Query  579   ad----dvkSVNVFADK---------------PNFQR----------CSCCMEFLGGKGK  671
                     K + +  D+                NF R          CSCC E L  K +
Sbjct  126   KSLIGILHKDLELLIDERELQLAFPVAGSKKDENFHRTNNRFQQQQHCSCCGELLKIKTE  185

Query  672   YTRSMSQ----VAPPPSPRAWRNNET---------DHPDDNEN-ATNGDGRDDNRSLAVS  809
               ++ +       P PSPR   N  T         + P++ +     GD  DD       
Sbjct  186   KPKNNNNQSFFAGPSPSPRVSFNQRTLDLSQIKYSELPEEEDTKGALGDTVDD-------  238

Query  810   eeeeeeGLEDSSCKTP--CNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRS  971
                          +TP     G NN+F G+PLSD    SPR S +  +   ID +     
Sbjct  239   -------------RTPSFVKGGNNNRFFGLPLSDSALNSPRWSVRSMKKSLIDQNGAE--  283

Query  972   DPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannama  1151
                          +E      I+ HLKRQV L+RKSL+ + M+LDEER+ASA+AANNAMA
Sbjct  284   -------------SEVLDGDSILHHLKRQVRLDRKSLMDLYMDLDEERSASAVAANNAMA  330

Query  1152  miTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRD  1331
             MITRLQAEKA+  M+A QYQRMM+EQAEYD+E  Q +  +++KREE+++ LE++++ YR 
Sbjct  331   MITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMNGLLVKREEDMKELEAEIEAYRL  390

Query  1332  KFG  1340
             ++G
Sbjct  391   RYG  393



>ref|XP_009106137.1| PREDICTED: uncharacterized protein LOC103831941 [Brassica rapa]
Length=562

 Score =   234 bits (596),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 172/431 (40%), Positives = 243/431 (56%), Gaps = 82/431 (19%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+++I  L VDG LAF S ++A+FF+L  PC  CTRID 
Sbjct  26    FKNFVEQELGSFPKFLIYTVLEWILITALFVDGVLAFLSNQYARFFDLDAPCLLCTRIDH  85

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R+ +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  86    VLVPRDPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  145

Query  579   addvkSVN-----VFADKPNF---------------------------QRCSCCMEFLGG  662
                +  ++     +  D+ +                            Q CSCC E L  
Sbjct  146   KSLIGILHKDLEVLIEDERDLPLGLKKQDDLVQTTTTHLIDYKTDSLKQHCSCCGELLKT  205

Query  663   KGK--YTRSMSQVAPPPSPRAWRN-----NETDHPDDNENATNGDGRDDNRSLAVSeeee  821
             K +    ++ S +AP PSPR   N     NE++  D                        
Sbjct  206   KSEKFLKKNNSFLAPAPSPRVSYNKLSEINESEFKD------------------------  241

Query  822   eeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTT  1001
                  D   +TP    G NKF G+PLSDS + S +        +S  S   P + D +  
Sbjct  242   ----FDVEERTPSFVRGGNKFFGVPLSDSAQNSPR--------WSVRSLRKPPSLDKIEI  289

Query  1002  TGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKA  1181
                 + NG + I+  LK++V L++KSL+ + MELDEER+ASA+AANNAMAMIT+LQAEK+
Sbjct  290   P---DSNGES-ILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANNAMAMITKLQAEKS  345

Query  1182  SKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPIN---L  1352
             +  M+A QYQRMM+EQAEYD+E  Q +   + K+EEE + LE++ + YR+++G +     
Sbjct  346   AIQMEALQYQRMMDEQAEYDQEALQSMSSDLAKKEEEFKELEAEFEAYRERYGCLTDDEA  405

Query  1353  ACSEFFEIEGD  1385
             +  EF E +G+
Sbjct  406   SGDEFLEEQGN  416



>emb|CDY45396.1| BnaA07g31760D [Brassica napus]
Length=542

 Score =   233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 175/438 (40%), Positives = 243/438 (55%), Gaps = 93/438 (21%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY+VLE+++I  L +DG LAF S ++A+FF+L  PC  CTRID 
Sbjct  26    FKNFVEQELGSFPRFLIYTVLEWILITALFIDGVLAFLSNQYARFFDLDAPCLLCTRIDH  85

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV R+ +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +K+S     
Sbjct  86    VLVPRDPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  145

Query  579   addvkSVN-----VFADKPNF---------------------------QRCSCCMEFLGG  662
                +  ++     +  D+ +                            Q CSCC E L  
Sbjct  146   KSLIGILHKDLEVLIEDERDLPLGLKKQDDLVQTTTTHLIDYKTDSLKQHCSCCGELLKT  205

Query  663   KGK--YTRSMSQVAPPPSPRAWRN-----NETDHPDDNENATNGDGRDDNRSLAVSeeee  821
             K +    ++ S +AP PSPR   N     NE++  D                        
Sbjct  206   KSEKFLKKNNSFLAPAPSPRVSYNKLSEINESEFKD------------------------  241

Query  822   eeGLEDSSCKTPCNRGGNNKFVGIPLSD----SPRMSTKKTRTMSIDYSALSRSDPNNYD  989
                  D   +TP    G NKF G+PLSD    SPR S +  R  S+D   +  S      
Sbjct  242   ----FDVEERTPSFVRGGNKFFGVPLSDSAQNSPRWSVRSLRKPSLDKLEIPDS------  291

Query  990   LVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQ  1169
                       NG + I+  LK++V L++KSL+ + MELDEER+ASA+AANNAMAMIT+LQ
Sbjct  292   ----------NGES-ILNQLKKEVRLDKKSLIDLYMELDEERSASAVAANNAMAMITKLQ  340

Query  1170  AEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPIN  1349
             AEK++  M+A QYQRMM+EQAEYD+E  Q +   + K+EEE + LE++ + YR+++G + 
Sbjct  341   AEKSAIQMEALQYQRMMDEQAEYDQEALQSMSSDLAKKEEEFKELEAEFEAYRERYGCLT  400

Query  1350  ---LACSEFFEIEGDDEF  1394
                 +  EF  +E  DEF
Sbjct  401   DDEASGDEF--LEEQDEF  416



>ref|XP_003622396.1| hypothetical protein MTR_7g036980 [Medicago truncatula]
 gb|KEH31882.1| zein-binding protein [Medicago truncatula]
Length=505

 Score =   229 bits (583),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 172/429 (40%), Positives = 249/429 (58%), Gaps = 66/429 (15%)
 Frame = +3

Query  228   FIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALV  407
             F+E+N+G+   FL+  +LE+V+I+ L +DG LAFF  EFA+FF+L++PC+ C +++  L 
Sbjct  9     FVERNIGKFPHFLLCMMLEWVLIISLFIDGLLAFFITEFARFFDLEIPCWLCAKMNHFLT  68

Query  408   HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaadd  587
             H+  NFYYN ++CE+HK+D+SSL++C+ HKK+SD + MCE CLLSFA  K+S+       
Sbjct  69    HKTPNFYYNSSMCEAHKKDVSSLAFCYNHKKLSDTRKMCEGCLLSFATQKESNCDTYKSL  128

Query  588   vkSVN----------------------VFADKPNFQRCSCCMEFLGGKGKYTRSMSQV--  695
             V  +N                      +  +K   Q+CSCC   L  K   ++  + V  
Sbjct  129   VGILNKNLDCFVEDSGNIQLSLKDEGVIQVEKNGTQKCSCCGAPLKLKSSISKRKNLVSN  188

Query  696   --APPPSPRAW--------RNNETDHP------DDNENATNGDGRDDN---RSLAVSeee  818
               AP  SPRA          +  T+ P       D E   N D  D+N   +SL + E  
Sbjct  189   LQAPTASPRAHPFIASKCEESRGTESPRILNAKKDYELQQNEDDNDNNLKNQSLELKEVN  248

Query  819   e------eeGLED---SSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSID--YSALS  965
             +        G +D    S KTP    G+ +F G+P +DSP  S + +   S+    S L 
Sbjct  249   KGAFWPLLTGSDDINVESPKTPSFPWGS-RFFGVPPTDSPNNSPRWSSLSSVSGKKSPLE  307

Query  966   RSDPNNYDLVTTTGFNEGNGSA----GIIQHLKRQVLLERKSLVSVCMELDEERnasaia  1133
             +       + +T+   EGN        ++ +LKRQV L+RKSL+++ MELDEER+ASA+A
Sbjct  308   K-------MESTSDSTEGNCQDEEVDAVLNNLKRQVRLDRKSLMALYMELDEERSASAVA  360

Query  1134  annamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESD  1313
             ANNAMAMITRLQ EKA+ HM  SQYQRMMEEQ EYD E  Q   +++LK EEE++ L+++
Sbjct  361   ANNAMAMITRLQEEKATLHMDTSQYQRMMEEQIEYDEEVLQETNELLLKLEEEVKTLDAE  420

Query  1314  LDVYRDKFG  1340
             L++YRDK+G
Sbjct  421   LEIYRDKYG  429



>ref|XP_009117572.1| PREDICTED: uncharacterized protein LOC103842670 [Brassica rapa]
 emb|CDY21687.1| BnaA09g44380D [Brassica napus]
Length=511

 Score =   228 bits (580),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 233/408 (57%), Gaps = 69/408 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE  LG    FLIY++LE+++I+LL +DG LAF S + +K F+LK PC  CTR+D 
Sbjct  6     FKNFIEDELGTFPHFLIYAILEWIIIILLFLDGLLAFSSNQLSKLFDLKTPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC+SHK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K++     
Sbjct  66    VLVPTNPDFYYNDSICDSHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKETDVDTY  125

Query  579   add----------------vkSVNVFADKPNF---------QRCSCCMEFLGGKGKYTRS  683
                                 K+  V   K +          Q CSCC E L  K +   +
Sbjct  126   KSLIGILHKDLELLIDDEHQKAFPVTGSKLDLRANNRFQEQQCCSCCGELLKIKTEKQPN  185

Query  684   MSQ-----VAPPPSPRAWRNNET----DHPDDNENATNGDGRDDNRSLAVSeeeeeeGLE  836
              +       AP PSPR   N  T    + P++ E A N D  D   S             
Sbjct  186   SNGNRSFFAAPSPSPRVSFNQRTMDFSNLPEEEEAANNKDTLDRTPSFV-----------  234

Query  837   DSSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNE  1016
                      RGGNN+F      +SPR S +  +   ID +      P    L        
Sbjct  235   ---------RGGNNRFFSDSAQNSPRWSVRSMKKSLIDQTG-----PEAEVL--------  272

Query  1017  GNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQ  1196
              +G + I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITRLQAEKA+  M+
Sbjct  273   -DGDS-ILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITRLQAEKAAVQME  330

Query  1197  ASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             A QYQRMM+EQAEYD+E  Q L  +++KREE+++ LE++++ YR ++G
Sbjct  331   ALQYQRMMDEQAEYDQEAVQSLSGLLVKREEDMKELEAEVEAYRLRYG  378



>emb|CDX68162.1| BnaA07g22020D [Brassica napus]
Length=493

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 164/407 (40%), Positives = 220/407 (54%), Gaps = 88/407 (22%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY++LE  +I +L +DG LAF S ++A+FFEL  PC  CTRID 
Sbjct  25    FKNFVEQELGSLPQFLIYTLLELTLITILFIDGALAFISNQYARFFELNTPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPd--------  554
              LV RN +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +        
Sbjct  85    VLVPRNPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  144

Query  555   --------------------kdssdyyaaddvkSVNVFADKPNF-----QRCSCCMEFLG  659
                                   +          + N+   K N      Q CSCC + L 
Sbjct  145   KSLIGILHKDLELLIDEQVLALALKKEDDLVQTTTNLVDYKTNNNISLKQHCSCCGDLLK  204

Query  660   GKGKYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLED  839
                 +      +AP PSPR   N  +      EN +     D +R+L+        G+  
Sbjct  205   NNSSF------LAPAPSPRVPYNKLS------ENESEFRVLDVDRTLS--------GV--  242

Query  840   SSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEG  1019
                     RGG NKF G PL   P   T+    M+                       + 
Sbjct  243   --------RGG-NKFFGTPLRKLPLDKTENISDMA-----------------------DS  270

Query  1020  NGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQA  1199
             NG + I+  LK++  LE+KSL+ + MELDEER+ASA+AANNAMAMIT+LQAEKA+  M+A
Sbjct  271   NGES-ILNQLKKEDCLEKKSLMDLYMELDEERSASAVAANNAMAMITKLQAEKATVQMEA  329

Query  1200  SQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
              Q QRMM+EQAEYD+E  Q L   + KREE+++ LE +L+ YR+ +G
Sbjct  330   LQCQRMMDEQAEYDQEALQSLSSELAKREEDMKELEDELEAYRETYG  376



>emb|CDX81908.1| BnaC08g36930D [Brassica napus]
Length=499

 Score =   223 bits (567),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 230/403 (57%), Gaps = 70/403 (17%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ FIE  LG     LIY++LE+++I+LL +DG LAF S +F+K F+LK PC  CTR+D 
Sbjct  6     FKNFIEDELGTFPHLLIYAILEWIIIILLFLDGLLAFSSNQFSKLFDLKTPCLLCTRLDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              LV  N +FYYND+IC+SHK+++SSL+YCHVHKK+S+IK MCE CLLSFA +K++     
Sbjct  66    VLVPTNPDFYYNDSICDSHKKNVSSLAYCHVHKKLSEIKRMCEGCLLSFATEKETDVDTY  125

Query  579   ad----------------dvkSVNVFADKPNF----------QRCSCCMEFLGGKGKYTR  680
                                 K+  V   K +           QRCSCC E L  K +   
Sbjct  126   KSLIGILHKDLELLIDDEHQKAFPVTGSKLDLRANNRLQEQQQRCSCCGELLKIKTEKQP  185

Query  681   SMSQ-----VAPPPSPRAWRNNET----DHPDDNENATNGDGRDDNRSLAVSeeeeeeGL  833
             + +       AP PSPR   N  T    + P++ E A N D  D   S            
Sbjct  186   NSNGNRSFFAAPSPSPRVSFNQRTMDFSNLPEEEEAANNKDTLDRTPSFV----------  235

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFN  1013
                       RGG+N+F      +SPR S +  +   ID +      P+   L       
Sbjct  236   ----------RGGHNRFFSDSAQNSPRWSVRSMKRTLIDQTG-----PDAEVL-------  273

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             +G+    I+ HL RQV L+RKSL+ + MELDEER+ASA+AANNAMAMITRLQAEKA+  M
Sbjct  274   DGD---SILHHLNRQVRLDRKSLMDLYMELDEERSASAVAANNAMAMITRLQAEKAAVQM  330

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDV  1322
             +A QYQRMM+EQAEYD+E  Q L  +++KREE+++ LE++++ 
Sbjct  331   EALQYQRMMDEQAEYDQEAVQSLSGLLVKREEDMKELEAEVEA  373



>ref|XP_010272236.1| PREDICTED: uncharacterized protein LOC104608071 [Nelumbo nucifera]
Length=552

 Score =   223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 174/434 (40%), Positives = 240/434 (55%), Gaps = 79/434 (18%)
 Frame = +3

Query  228   FIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALV  407
              IEQNLG+  LF I +VLE ++I++L++DG +AF + EFA+FFE+++PC FCTRID+ LV
Sbjct  9     LIEQNLGKIPLFFINAVLELILIIILIMDGLIAFAANEFARFFEMRIPCLFCTRIDRHLV  68

Query  408   HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaadd  587
              R+ NFYYND+ICE+H++D+SSL+YCHVH+K+SD + MCE CL SFA    S        
Sbjct  69    SRDPNFYYNDSICEAHRKDVSSLAYCHVHQKLSDTRRMCEGCLFSFATGNKSDCEKYRSL  128

Query  588   vkSV-----------NVF---------------ADKPNFQRCSCCMEFLGGKGKYTRSMS  689
             V  +           N+                 DK N   CSCC E L       + + 
Sbjct  129   VGILGKDLECSIEDDNIIHLRLSPREKMDALHQVDKSNIHWCSCCGEPLRIMSSL-QGLV  187

Query  690   QVAPP-----------PSPRA-----WRNNETDHPD-----------DNENATNGDGRDD  788
             Q  PP           P+PR+      +N ET   D           + E   + +G   
Sbjct  188   QSLPPNVTTAFPQTPDPTPRSPLLIKTKNEETRGSDHLRQVSFKLNTELEIPVHEEGSSA  247

Query  789   NRSLAVSeeeeeeGLED---SSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSI  947
                     E  + G ED    +CKTP    GN  F G+PL+DS    PR   +  R + I
Sbjct  248   LTPYNQCREYVKIGTEDLNEDACKTPAFIRGNRLF-GVPLTDSAAATPRWIHRLQRRLPI  306

Query  948   DYSALSRSDPNNYDLVTTTGFNEGNG-----SAGIIQHLKRQVLLERKSLVSVCMELDEE  1112
             +             L +     EGN      S  I+ +LK++  L+R SL+++ MELDEE
Sbjct  307   E------------KLESGAESMEGNTINDADSEAILNYLKKEAHLDRNSLIALYMELDEE  354

Query  1113  RnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEE  1292
             RNASA+AAN AMAMITRLQ EKA+  M+A QYQR+M+EQAEYD++  Q +KD++ KRE E
Sbjct  355   RNASAVAANQAMAMITRLQEEKAAVRMEAFQYQRIMDEQAEYDQKALQAMKDLLNKREME  414

Query  1293  IEALESDLDVYRDK  1334
             I AL++ L++YR+K
Sbjct  415   IRALKAQLELYREK  428



>ref|XP_009104742.1| PREDICTED: uncharacterized protein LOC103830682 [Brassica rapa]
Length=493

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 163/407 (40%), Positives = 218/407 (54%), Gaps = 88/407 (22%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG    FLIY++LE  +I +L +DG LAF S ++A+FFEL  PC  CTRID 
Sbjct  25    FKNFVEQELGSFPQFLIYTLLELTLITILFIDGVLAFLSNQYARFFELNTPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPd--------  554
              LV RN +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA +        
Sbjct  85    VLVPRNPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTY  144

Query  555   --------------------kdssdyyaaddvkSVNVFADKPNF-----QRCSCCMEFLG  659
                                   +          + N+   K N      Q CSCC + L 
Sbjct  145   KSLIGILHKDLELLIDEQVLALALKKDDDLVQTTTNLVDYKTNNNISLKQHCSCCGDLLK  204

Query  660   GKGKYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLED  839
                 +      +AP  SPR   N  +      EN +     D  R+L+        G+  
Sbjct  205   NNSSF------LAPALSPRVPYNKLS------ENESEFRVLDVGRTLS--------GV--  242

Query  840   SSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEG  1019
                     RGG NKF G PL   P   T+ T  M+                       + 
Sbjct  243   --------RGG-NKFFGTPLRKLPLDKTENTSDMA-----------------------DS  270

Query  1020  NGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQA  1199
             NG   I+  LK++  L++KSL+ + MELDEER+ASA+AANNAMAMIT+LQAEKA+  M+A
Sbjct  271   NGEY-ILNQLKKEACLDKKSLMDLYMELDEERSASAVAANNAMAMITKLQAEKATVQMEA  329

Query  1200  SQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
              Q QRMM+EQAEYD+E  Q L   + KREE+++ LE +L+ YR+ +G
Sbjct  330   LQCQRMMDEQAEYDQEALQSLSSELAKREEDMKELEDELEAYRETYG  376



>emb|CDX85859.1| BnaC06g22750D [Brassica napus]
Length=493

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 162/407 (40%), Positives = 215/407 (53%), Gaps = 88/407 (22%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F+EQ LG     LIY++LE  +I +L +DG LAF S ++A+FFEL  PC  CTRID 
Sbjct  25    FKNFVEQELGSFPQLLIYTLLELTLITILFIDGALAFLSNQYARFFELNTPCLLCTRIDH  84

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPd--------  554
              LV RN +FYYND+IC+SHK+ +SSL+YCHVHKK+S+IK MCE CLLSFA          
Sbjct  85    VLVPRNPHFYYNDSICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATQKESDCDTF  144

Query  555   ---------------------kdssdyyaaddvkSVNVFADKPN----FQRCSCCMEFLG  659
                                    +          S N+   K N     Q CSCC + L 
Sbjct  145   KSLIGILHKDLELLINDQRELALALKKDDNLVQTSTNLVDYKTNNISLKQHCSCCGDLLK  204

Query  660   GKGKYTRSMSQVAPPPSPRAWRNNETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLED  839
                 +      +AP PSPR   N  +    +NE+        + R L V           
Sbjct  205   NNSSF------LAPAPSPRVPYNKLS----ENES--------EFRVLDVDI---------  237

Query  840   SSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEG  1019
                 TP    G +KF G PL   P   T+                 N  DL  + G    
Sbjct  238   ----TPSVVRGGSKFFGTPLRKLPLDKTE-----------------NTSDLADSDG----  272

Query  1020  NGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQA  1199
                  I+  LK++  L++KSL+ + MELDEER+ASA+AANNAMAMIT+LQAEKA+  M+A
Sbjct  273   ---ESILNQLKKEARLDKKSLMDLYMELDEERSASAVAANNAMAMITKLQAEKAAVQMEA  329

Query  1200  SQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
              Q QRMM+EQAEYD+E  Q L   + KREE+++ LE +L+ YR+++G
Sbjct  330   LQCQRMMDEQAEYDQEALQSLSSELAKREEDMKELEDELEAYRERYG  376



>ref|XP_010264937.1| PREDICTED: uncharacterized protein LOC104602809 [Nelumbo nucifera]
Length=660

 Score =   209 bits (531),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 160/438 (37%), Positives = 235/438 (54%), Gaps = 77/438 (18%)
 Frame = +3

Query  219   FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             F+ F EQ L +   F IY++ E+++I+LL++DG +AF + EFA+FF +K+PC FC+RID 
Sbjct  6     FKQFEEQKLRKFPYFFIYALFEWILIILLIIDGLIAFAANEFARFFGMKIPCLFCSRIDH  65

Query  399   ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
              L  R+  FYYND+ICE+H++ +SSL YCHVH+K+SDI+ MCE CLLSF  +  S     
Sbjct  66    VLASRDPYFYYNDSICEAHRKHVSSLVYCHVHRKLSDIRQMCEGCLLSFGSENKSDYETC  125

Query  579   addvkSVNVFA----------------------------DKPNFQRCSCCMEFLGGKGKY  674
                   V +                              +K +  RCSCC E L  K  +
Sbjct  126   KSL---VGILGRDIRCSVEDGRRIHLRLPCRGNMDTSQVEKSSMHRCSCCGEPLRIKPSF  182

Query  675   TRSMSQVAP---------PPS---------PRAW----------------RNNETDHPDD  752
              R      P         P S         PR +                 + E++ P+D
Sbjct  183   RRGFLPCLPSNECDFPQAPASSPIKANDEEPRGFDQVQIPLIRYTEAKLVSDTESEIPED  242

Query  753   NENAT----NGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMS  920
             +E+ +    +   R+D +   V    E E L +  CKTP N    NK +G+ ++DS    
Sbjct  243   DESLSTITEDNQCREDVKGAIVPFITENEDLNEDPCKTP-NLIRGNKLLGVTVADSAIWL  301

Query  921   TKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCME  1100
              K  R +  +      S   +++ +      EG+  A  +   KRQV ++RK L+++  E
Sbjct  302   AKLPRKLQTEK---IESGAESWEGI---AIGEGDDEA-TLDCQKRQVRVDRKFLIALYTE  354

Query  1101  LDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILK  1280
             LD+ER+ASA+AAN AMAMITRLQAEKA+  M+A QYQRMMEEQ EY+++  Q++KD++  
Sbjct  355   LDKERSASAVAANQAMAMITRLQAEKAAVQMEALQYQRMMEEQTEYEQKALQVVKDLLKM  414

Query  1281  REEEIEALESDLDVYRDK  1334
             RE EI AL+++L  YR+K
Sbjct  415   REGEIRALKAELQAYREK  432



>ref|XP_010678645.1| PREDICTED: uncharacterized protein LOC104894167 [Beta vulgaris 
subsp. vulgaris]
Length=577

 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
             R +IEQ LG    F+IY+VLE+ +I LL +DGFLAF S EFA FF+L+ PC  CTRID 
Sbjct  8    LRHYIEQELGTLPHFIIYAVLEWTLIGLLFLDGFLAFISSEFADFFDLQAPCVLCTRIDH  67

Query  399  ALV-HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             L  +++  + YN+TIC+ HK ++SSL+YCHVH+K+SDI+TMCE CLLSFA
Sbjct  68   ILARNKSWRYCYNETICDGHKNELSSLAYCHVHRKLSDIRTMCEGCLLSFA  118


 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 160/278 (58%), Gaps = 47/278 (17%)
 Frame = +3

Query  684   MSQVAPPPSPRA----WR-------------------NNETDHPDDNENA---TNGDGRD  785
             +SQ AP PSPRA    WR                   ++ET  PD+   +   T    +D
Sbjct  216   LSQQAPTPSPRAPFASWRPDESRATLELSHIRCKELKSSETTTPDEEVTSSVTTPTASKD  275

Query  786   DNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIP--LSDSPRMSTKKTRTMSIDYSA  959
             +N+ +     E ++ +ED   +TP   G  N+F G+    + SPR + +  R   ++   
Sbjct  276   ENKPMTPRPTEIDDSVEDF-VRTP-TFGRGNRFYGLSDSAAASPRFANRAPRKSLLEKVE  333

Query  960   LSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaan  1139
             L+ SDP     V     NE + S  I+  LK+QV  ++KSL+++ MELDEER+ASA+AAN
Sbjct  334   LA-SDP-----VEAITGNETD-SELIMSRLKKQVRSDKKSLIALYMELDEERSASAVAAN  386

Query  1140  namamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLD  1319
             NAMAMITRLQAEKAS  M+A QYQRMMEEQAEYD+E+ Q+LKD + K+E+EI  LE++LD
Sbjct  387   NAMAMITRLQAEKASVQMEALQYQRMMEEQAEYDKEDIQMLKDFLNKKEDEIRDLEAELD  446

Query  1320  VYRDKFGPINLACSEFFEIEGDDEFHSLKFQSLSSFGE  1433
             +YRD++G  ++   +  E          K QS SS  E
Sbjct  447   LYRDRYGLPHVTRGDVLE----------KSQSFSSITE  474



>ref|XP_006843144.1| hypothetical protein AMTR_s00146p00025270 [Amborella trichopoda]
 gb|ERN04819.1| hypothetical protein AMTR_s00146p00025270 [Amborella trichopoda]
Length=869

 Score =   137 bits (346),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +  G+ A  LIY+ LE+V+IVLL + G   F + EFA+ FEL++PC FC+RID 
Sbjct  6    FAFILHKRFGKFAGSLIYAFLEWVLIVLLFLGGLFNFIASEFARLFELQIPCLFCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             L  ++ NFYYN+ IC +H  ++SSL+YCH+H+K+SD++ MCE CLLSFA
Sbjct  66   LLSKKDPNFYYNELICHAHGVELSSLAYCHIHRKLSDVRAMCEGCLLSFA  115


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 87/119 (73%), Gaps = 7/119 (6%)
 Frame = +3

Query  1002  TGFNEGNGS-------AGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
             +GF   +GS         +I HLKRQ+  +RKSL+++  EL+EER+AS +AAN AMAMIT
Sbjct  508   SGFESLDGSIVSEIEGESVIDHLKRQIQADRKSLMALYKELEEERSASTVAANEAMAMIT  567

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RLQ EKA+  M+A QYQRMMEEQAEYD+E  Q+  +++ KRE+EI+ LE +L+ YR +F
Sbjct  568   RLQEEKAAMQMEAHQYQRMMEEQAEYDQEALQVTNELLAKREKEIKDLEEELETYRKRF  626



>ref|XP_008351834.1| PREDICTED: uncharacterized protein LOC103415268 [Malus domestica]
Length=390

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 128/191 (67%), Gaps = 11/191 (6%)
 Frame = +3

Query  780   RDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS----PRMSTKKTRTMSI  947
             ++D ++  V    E E L D + +TP   G  N+F GIPL+DS    PR++ + +R    
Sbjct  41    KEDPKAATVPLLTEGEDLADDANRTPLF-GKGNRFFGIPLTDSATNSPRVAMRISRK---  96

Query  948   DYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasa  1127
               S L ++     + V  +  NE    + I+  LKRQV L+RKSL+++ MELDEER+ASA
Sbjct  97    --SPLEKTGEYALESVEGSTSNEAECDS-ILHRLKRQVRLDRKSLMALYMELDEERSASA  153

Query  1128  iaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALE  1307
             +AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  +   D++ KREEE+  +E
Sbjct  154   VAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALEATYDLLAKREEELRLVE  213

Query  1308  SDLDVYRDKFG  1340
             ++++ YR+K+G
Sbjct  214   AEVEAYREKYG  224



>ref|XP_010670133.1| PREDICTED: uncharacterized protein LOC104887238 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=611

 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 123/381 (32%), Positives = 186/381 (49%), Gaps = 42/381 (11%)
 Frame = +3

Query  243   LGRSA-----LFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALV  407
             LGR++     + L Y+ LE+ +I+LLL++   ++   +FA +F LK PC  C+RID  L 
Sbjct  10    LGRNSGKKIFVVLAYAFLEWFLILLLLINSIFSYMIRKFAGYFHLKQPCILCSRIDHLLE  69

Query  408   HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaadd  587
                    Y   +CE+H  +IS L YC  H K S ++ MCE C   F P            
Sbjct  70    PLTTTDSYKSLVCENHATEISKLGYCSNHHKFSVLQQMCEEC-FDFKPTN----------  118

Query  588   vkSVNVFADKP----NFQRCSCCMEFLGGKGK----YTRSMSQVAPPPSPRAWRNNETDH  743
                 NV  DK        RCSCC +    K        R + + A         N+ +  
Sbjct  119   ----NVPFDKSKCTEKTSRCSCCEKISSKKHPPLHFPLREIQEEADGEETEFIANDIS--  172

Query  744   PDDNENATNGDGR--DDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRM  917
                N++ +  D +   D  SL + E  E +  ED       +   ++   G+      R 
Sbjct  173   ---NQSGSECDPQILSDVGSLYLREAAENDSNEDD------HEVQDHAESGMENIKHLRH  223

Query  918   STKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCM  1097
               +    +  D+  LS +D  N  L+     +  +  +  I+ LK  +  E+K+   +  
Sbjct  224   EDRILPIVEADHLLLS-ADERNSSLLDEKIMDGNHDISCEIKQLKSDLEAEQKARNVLYG  282

Query  1098  ELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMIL  1277
             EL+ ERNA+AIAAN  MAMITRLQ EKA+  M+  QYQR+MEEQAEYD+E  Q+L +++ 
Sbjct  283   ELEAERNAAAIAANQTMAMITRLQEEKAAMQMEGLQYQRVMEEQAEYDQEALQLLNELVA  342

Query  1278  KREEEIEALESDLDVYRDKFG  1340
             KRE + + LE +LD+YR++  
Sbjct  343   KRERQQQELEKELDIYRERVS  363



>ref|XP_010670134.1| PREDICTED: uncharacterized protein LOC104887238 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=609

 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 122/382 (32%), Positives = 180/382 (47%), Gaps = 46/382 (12%)
 Frame = +3

Query  243   LGRSA-----LFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALV  407
             LGR++     + L Y+ LE+ +I+LLL++   ++   +FA +F LK PC  C+RID  L 
Sbjct  10    LGRNSGKKIFVVLAYAFLEWFLILLLLINSIFSYMIRKFAGYFHLKQPCILCSRIDHLLE  69

Query  408   HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaadd  587
                    Y   +CE+H  +IS L YC  H K S ++ MCE C   F P            
Sbjct  70    PLTTTDSYKSLVCENHATEISKLGYCSNHHKFSVLQQMCEEC-FDFKPTN----------  118

Query  588   vkSVNVFADKP----NFQRCSCCMEFLGGKGKYTRSMSQVAPPPSPRAWR-------NNE  734
                 NV  DK        RCSCC             +S    PP     R         E
Sbjct  119   ----NVPFDKSKCTEKTSRCSCC-----------EKISSKKHPPLHFPLREIQEEADGEE  163

Query  735   TDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPR  914
             T+   ++ +  +G   D      V      E  E+ S +   +        G+      R
Sbjct  164   TEFIANDISNQSGSECDPQILSDVGSLYLREAAENDSNE---DDHEVQDHAGMENIKHLR  220

Query  915   MSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVC  1094
                +    +  D+  LS +D  N  L+     +  +  +  I+ LK  +  E+K+   + 
Sbjct  221   HEDRILPIVEADHLLLS-ADERNSSLLDEKIMDGNHDISCEIKQLKSDLEAEQKARNVLY  279

Query  1095  MELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
              EL+ ERNA+AIAAN  MAMITRLQ EKA+  M+  QYQR+MEEQAEYD+E  Q+L +++
Sbjct  280   GELEAERNAAAIAANQTMAMITRLQEEKAAMQMEGLQYQRVMEEQAEYDQEALQLLNELV  339

Query  1275  LKREEEIEALESDLDVYRDKFG  1340
              KRE + + LE +LD+YR++  
Sbjct  340   AKRERQQQELEKELDIYRERVS  361



>ref|XP_006828397.1| hypothetical protein AMTR_s00060p00048940 [Amborella trichopoda]
 gb|ERM95813.1| hypothetical protein AMTR_s00060p00048940 [Amborella trichopoda]
Length=982

 Score =   107 bits (266),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y+VLE+V+I LLLVDG  ++   +FA FF LK PC +C+R+D 
Sbjct  6    FASMVHRNSSKLTLILVYAVLEWVLIALLLVDGLFSYLIRKFAAFFGLKPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             L       YY + +C++H ++IS L YC  H K+++   MCE C LS
Sbjct  66   VLEPNKDKHYYRELVCDNHAKEISRLGYCLNHAKLAEACEMCEECSLS  113


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 115/203 (57%), Gaps = 28/203 (14%)
 Frame = +3

Query  729   NETDHPDDNENATNGDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDS  908
             NETD P +         R+  + L+V   E  EG ED + +TPC+  G +      L   
Sbjct  559   NETDKPTEKP-------RERMKQLSV-YVEFNEGEEDKAPETPCSIEGIHS-----LHKR  605

Query  909   PRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVS  1088
                  K++ T S+D S +S  +                G   +I+  K  +  ER++L +
Sbjct  606   LLFERKESGTESLDGSIISEIE---------------GGEGSVIERFKSALKSERRALSA  650

Query  1089  VCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKD  1268
             +  EL+EER+ASAIAAN  MAMITRLQ EKA   M+A QYQRMMEEQ+EYD+E  Q+L +
Sbjct  651   LYTELEEERSASAIAANQTMAMITRLQEEKAQMQMEALQYQRMMEEQSEYDQEALQLLNE  710

Query  1269  MILKREEEIEALESDLDVYRDKF  1337
             +++KRE+E + LE +L+VYR K 
Sbjct  711   LMVKREKEKQELERELEVYRKKV  733



>ref|XP_003616291.1| hypothetical protein MTR_5g078300 [Medicago truncatula]
 gb|AES99249.1| zein-binding protein [Medicago truncatula]
Length=986

 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (53%), Gaps = 16/169 (9%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + L+Y+ LE+++I+ LL++   ++   +FAK F LK PC FC+R+D 
Sbjct  6    FATILHRNTNKIVVILVYAFLEWILIIFLLLNSLFSYLITKFAKGFGLKPPCLFCSRLDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L   N  F+ +D +CE+H  +IS+L YC  H+++++  +MCENCL S     ++ + + 
Sbjct  66   VLHQENSKFFQSDLVCETHAAEISNLGYCSNHQRLAETHSMCENCLASRPNHHETENSFG  125

Query  579  addvkSVNVF-------ADKPNFQRCSCCMEFLGGKGKYTRSMSQVAPP  704
                     +        ++ +  RCSCC E L           Q+ PP
Sbjct  126  MRHRIGFIPWLGHEKHDENEESLNRCSCCNESLNN---------QIYPP  165


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  E+++L ++  EL+EER+ASAIA N  MAMITRLQ EKA+  M+A QYQRM
Sbjct  617   IDRLKTSLKAEQRALSAIYQELEEERSASAIATNQTMAMITRLQEEKAAMQMEALQYQRM  676

Query  1218  MEEQAEYDREEKQILKDMI  1274
             MEEQAEYD+E  Q+L D++
Sbjct  677   MEEQAEYDQEALQLLNDLM  695



>gb|ABM68547.1| IFA binding protein [Lilium longiflorum]
Length=807

 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 115/191 (60%), Gaps = 6/191 (3%)
 Frame = +3

Query  879   KFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQ  1058
             +F+   LS SPR+S   + T S   S   R + N   L +  G          +  LKRQ
Sbjct  438   EFLSSELSPSPRLSNASSTTGSQSNS--KRYEGNESSLESLYGIVSEVEGESPVDRLKRQ  495

Query  1059  VLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEY  1238
             +  +RKSL S+  EL+EER+ASAIAAN AMAMI RLQ EKA+  M+A QYQRMMEEQAEY
Sbjct  496   IEFDRKSLTSLFKELEEERSASAIAANQAMAMINRLQEEKAAMQMEAWQYQRMMEEQAEY  555

Query  1239  DREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHSLKFQSL  1418
             D+E  + L D++ +RE++I+ LE+++D YR +FG   L       IE D   +S    + 
Sbjct  556   DQEALEKLNDILAEREKDIQDLEAEIDNYRKRFGEEALGDL----IERDLSRNSTPRATR  611

Query  1419  SSFGEMSCRSL  1451
             SS  + SCR++
Sbjct  612   SSSRQNSCRTM  622


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 80/163 (49%), Gaps = 25/163 (15%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R    L  +  E+++I+LL +   L++ +   A+F +L+ PC  C+R+D    +    FY
Sbjct  15   RLTTLLSSAFFEWLLIILLFIAAILSYLATRLARFCKLQTPCLLCSRLDHIWGNEKAGFY  74

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVF  608
              D +C +HK +++SL YCH+H+K+ D+  MCE+CL SFA  K   +   A     V + 
Sbjct  75   -KDLLCHTHKLEMASLGYCHIHRKLGDVHKMCESCLRSFAKKKTIDEGENARTKLPVTLI  133

Query  609  AD---------------------KP---NFQRCSCCMEFLGGK  665
            AD                     +P   + + CSCC E   GK
Sbjct  134  ADGLRNKYYGEDMVKVPLLKNDLEPRSLSTRYCSCCSEAFRGK  176



>ref|XP_010675058.1| PREDICTED: uncharacterized protein LOC104891107 [Beta vulgaris 
subsp. vulgaris]
Length=869

 Score =   104 bits (260),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  ++LE+++IVLLLV G   +   +FA++ EL +PC  C+RID+      + FY  D +
Sbjct  22   LASALLEWILIVLLLVYGLFGYLITKFARYCELPLPCLLCSRIDRIFGSEKVGFY-RDMM  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C SHK +ISSL YCH H+K+ D++ MCE CL SFA
Sbjct  81   CRSHKLEISSLVYCHFHEKLVDVRGMCETCLFSFA  115


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG    G    L+RQ+  +RK L+++  EL+EERNASAIA N AMAMITRLQ EKA+  M
Sbjct  548   EGESELG---RLRRQLEHDRKFLIALLKELEEERNASAIAINEAMAMITRLQEEKAAFQM  604

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +ASQ  RMMEEQAEYD E    L D+++++E+EI+ LE++L+ YR K+
Sbjct  605   EASQDLRMMEEQAEYDMEALDKLNDLMMEKEKEIQDLEAELEYYRTKY  652



>ref|XP_008788172.1| PREDICTED: uncharacterized protein LOC103706017 [Phoenix dactylifera]
Length=906

 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +++N  R A+ L+Y++LE+++I LLL++G  A+   +FA+FF LK PC FC+R+D 
Sbjct  6    FATMLQRNTHRMAVILVYTLLEWIIIALLLLNGLFAYLIAKFAEFFGLKPPCLFCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                      Y+D +C++H  ++S L YC  H++++ +  MCE+C
Sbjct  66   LFEPGRGRSAYSDLLCDAHAAEVSRLGYCSKHRRLAQVSDMCEDC  110


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  535   IDRLKAALKAERKALSALYAELEEERSASAIAANQTMAMITRLQEEKAAMQMEALQYQRM  594

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+EQ+EYD+E  Q+L ++++KRE+E + LE +L++YR K 
Sbjct  595   MDEQSEYDQEALQLLNELMMKREKEKQDLEKELEIYRKKV  634



>gb|KDP31175.1| hypothetical protein JCGZ_11551 [Jatropha curcas]
Length=282

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = +3

Query  1083  VSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQIL  1262
             +++ MELDEER+ASA+AANNAMAMITRLQAEKA+  M+A QYQRMMEEQAEYD+E  Q  
Sbjct  1     MALYMELDEERSASAVAANNAMAMITRLQAEKAAVQMEALQYQRMMEEQAEYDQEALQAT  60

Query  1263  KDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEG---DDEFHSLKFQSLSSFGE  1433
              D++ KREE+I+ LE++LD YR+++G   L   E FE  G   D+++H +   S SS+ +
Sbjct  61    NDLLAKREEDIKVLEAELDEYRERYG---LLREEGFEGSGDEVDEDYHDMSSHSFSSYTD  117

Query  1434  MS  1439
              S
Sbjct  118   RS  119



>ref|XP_010043260.1| PREDICTED: uncharacterized protein LOC104432519 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043261.1| PREDICTED: uncharacterized protein LOC104432519 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043262.1| PREDICTED: uncharacterized protein LOC104432519 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043263.1| PREDICTED: uncharacterized protein LOC104432519 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010043264.1| PREDICTED: uncharacterized protein LOC104432519 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85280.1| hypothetical protein EUGRSUZ_B02126 [Eucalyptus grandis]
Length=875

 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 79/147 (54%), Gaps = 16/147 (11%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
            A+ L  +VLE+++I +L ++   ++   +FA +  L+ PC  C+R+D  L  + + FY+ 
Sbjct  19   AVALSSAVLEWLLIFVLFINALFSYLITKFAGYCGLQTPCLLCSRLDHVLGGKRVGFYW-  77

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV-----  599
            D IC +HK +ISSL  CH H K++D+  MCENCL SFA    S+       V  +     
Sbjct  78   DMICGNHKSEISSLVLCHAHNKLADVHRMCENCLFSFATINKSNAETYRLLVGKLGEDSN  137

Query  600  -----NVFADKPNF-----QRCSCCME  650
                 N+F++  N        CSCC E
Sbjct  138  IELEENIFSEDHNLCSSSRTHCSCCNE  164


 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
             G+I  LKRQV  +RKS+ ++  EL+EERNASAIAAN AMAMITRLQ EKA+ HM+A QY 
Sbjct  530   GLIDRLKRQVEHDRKSMSALYKELEEERNASAIAANQAMAMITRLQEEKATLHMEALQYL  589

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RMMEEQAEYD E  Q   D++  RE++I+ L+++L+ YR+K+
Sbjct  590   RMMEEQAEYDMEALQKSNDLLADREKDIQDLDAELEFYRNKY  631



>ref|XP_011007254.1| PREDICTED: uncharacterized protein LOC105112992 [Populus euphratica]
 ref|XP_011007255.1| PREDICTED: uncharacterized protein LOC105112992 [Populus euphratica]
 ref|XP_011007256.1| PREDICTED: uncharacterized protein LOC105112992 [Populus euphratica]
 ref|XP_011007257.1| PREDICTED: uncharacterized protein LOC105112992 [Populus euphratica]
Length=965

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 88/166 (53%), Gaps = 13/166 (8%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +++N  +  + L+Y+VLE+V+I+LLL++   A+   +FAK+F L+ PC +C+RID 
Sbjct  6    FATMLQRNTHKLTVILVYAVLEWVLIILLLLNSLFAYLITKFAKYFGLQKPCPWCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L        Y D +CESH  +IS LSYC  H+K+++ + MC +CL S     D S    
Sbjct  66   MLEPGKNTNSYRDLVCESHATEISKLSYCSNHQKLAEAQKMCMDCLASRPNHSDQSGGMT  125

Query  579  addv----kSVNVFADKPNFQRCSCCMEFLGGKGKYTRSMSQVAPP  704
                     S N  A+  N  RCSCC E L          S V PP
Sbjct  126  RRIALFSWVSKNDIANGENIVRCSCCNESLN---------SNVYPP  162


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  1026  SAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQ  1205
             S   ++ LK  +  ERK+  ++  EL+EER+ASAIAAN  MAMI RLQ EKA+  M+A Q
Sbjct  577   SVLTVERLKTALKAERKAFGALYTELEEERSASAIAANQTMAMINRLQEEKAAMQMEALQ  636

Query  1206  YQRMMEEQAEYDREEKQILKDMIL  1277
             YQRMMEEQ+EYD+E  Q+L ++++
Sbjct  637   YQRMMEEQSEYDQEALQLLNELMI  660



>gb|KDO41531.1| hypothetical protein CISIN_1g001327mg [Citrus sinensis]
Length=1099

 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 78/165 (47%), Gaps = 25/165 (15%)
 Frame = +3

Query  273  SVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICES  452
            + LE+++I LL +D   ++    FA + EL+ PC  C+R+D  L +  LN  Y D IC  
Sbjct  25   AALEWLLIFLLFIDAIFSYLITRFAHYCELQRPCLLCSRLDHVLGNEKLN-PYRDLICGK  83

Query  453  HKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFADKPNF--  626
            H+ +ISSL  CH H K+ D++ MC+NCL SFA    S     +     V    D  NF  
Sbjct  84   HRLEISSLVLCHAHNKLVDVRGMCQNCLFSFAKVNRSITETYSLL---VGKVGDDSNFGS  140

Query  627  ----------------QRCSCCMEFLGGKG---KYTRSMSQVAPP  704
                            + CSCC E    +G   K   S S V+ P
Sbjct  141  DEDPLHEGHKNSQSSIRHCSCCNEPWTARGNVQKMIHSKSSVSEP  185


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = +3

Query  1002  TGFNEGNGSA-------GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
             +GF   +GS          +  LKRQ+  ++K L +V  EL+EERNAS  A N AMAMIT
Sbjct  732   SGFESLDGSTVSEIEGESAVDRLKRQIEHDKKLLNAVYKELEEERNASTDAINQAMAMIT  791

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RLQ EKAS HM+A Q  RMMEEQAEYD E  Q   D++ ++E+EI+ LE  L+ YR K+
Sbjct  792   RLQEEKASLHMEALQSLRMMEEQAEYDMETLQKTNDLLAEKEKEIQDLEEQLEYYRKKY  850



>ref|XP_006423971.1| hypothetical protein CICLE_v10027718mg [Citrus clementina]
 gb|ESR37211.1| hypothetical protein CICLE_v10027718mg [Citrus clementina]
Length=1099

 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 78/165 (47%), Gaps = 25/165 (15%)
 Frame = +3

Query  273  SVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICES  452
            + LE+++I LL +D   ++    FA + EL+ PC  C+R+D  L +  LN  Y D IC  
Sbjct  25   AALEWLLIFLLFIDAIFSYLITRFAHYCELQRPCLLCSRLDHVLGNEKLN-PYRDLICGK  83

Query  453  HKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFADKPNF--  626
            H+ +ISSL  CH H K+ D++ MC+NCL SFA    S     +     V    D  NF  
Sbjct  84   HRLEISSLVLCHAHNKLVDVRGMCQNCLFSFAKVNRSITETYSLL---VGKVGDDSNFGS  140

Query  627  ----------------QRCSCCMEFLGGKG---KYTRSMSQVAPP  704
                            + CSCC E    +G   K   S S V+ P
Sbjct  141  DEDPLPEGHKNSQSSIRHCSCCNEPWTARGNVQKMIHSKSSVSEP  185


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = +3

Query  1002  TGFNEGNGSA-------GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
             +GF   +GS          +  LKRQ+  ++K L +V  EL+EERNAS  A N AMAMIT
Sbjct  732   SGFESLDGSTVSEIEGESAVDRLKRQIEHDKKLLNAVYKELEEERNASTDAINQAMAMIT  791

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RLQ EKAS HM+A Q  RMMEEQAEYD E  Q   D++ ++E+EI+ LE  L+ YR K+
Sbjct  792   RLQEEKASLHMEALQSLRMMEEQAEYDMETLQKTNDLLAEKEKEIQDLEEQLEYYRKKY  850



>ref|XP_010278089.1| PREDICTED: uncharacterized protein LOC104612396 [Nelumbo nucifera]
 ref|XP_010278090.1| PREDICTED: uncharacterized protein LOC104612396 [Nelumbo nucifera]
 ref|XP_010278091.1| PREDICTED: uncharacterized protein LOC104612396 [Nelumbo nucifera]
 ref|XP_010278092.1| PREDICTED: uncharacterized protein LOC104612396 [Nelumbo nucifera]
Length=960

 Score = 97.8 bits (242),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +VLE+++I LL ++   ++   +FA++FEL++PC  C+R+D    +    FY  D 
Sbjct  20   VLASAVLEWLLIFLLFINAAFSYLLTKFARYFELQVPCVLCSRLDHVFGNEQPGFY-KDL  78

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            IC  HK +ISSL  CH+H K++D+  MCE CL S A
Sbjct  79   ICSKHKSEISSLVLCHIHGKLADVHEMCEGCLFSLA  114


 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             I+  LKRQV  +RKS+ ++  EL+EERNASAIAAN AMAMITRLQ EKA+ HM+A QY R
Sbjct  607   IVDRLKRQVEYDRKSMSALYKELEEERNASAIAANQAMAMITRLQEEKAALHMEALQYLR  666

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFE  1373
             MMEEQ+EYD E  Q    ++ +RE+ I+ LE++L+ Y+ KF P +    E  E
Sbjct  667   MMEEQSEYDMEALQKANSLLAEREKMIQDLETELEFYKKKF-PTDSVVEEIQE  718



>ref|XP_009386128.1| PREDICTED: uncharacterized protein LOC103973323 [Musa acuminata 
subsp. malaccensis]
Length=781

 Score = 97.4 bits (241),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  258  LFLIYS-VLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
            LF+++S V E+ +I++LLV+  LA+ +   A+F  L  PC  C+R+D  L +    FY N
Sbjct  17   LFVLWSAVSEWSLIIILLVNAVLAYVATRIARFCMLPAPCLLCSRLDPILGNERREFYRN  76

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
               C  HK DISSL YCH H+K++D + MCE CLLS A
Sbjct  77   -LFCHEHKVDISSLVYCHGHRKLADFREMCEACLLSSA  113


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = +3

Query  993   VTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQA  1172
             V   G  EG  S   +  LK+Q+ L+RKSL ++  EL+EERNASA+AAN AMAMI RLQ 
Sbjct  478   VNLLGDIEGETS---VDRLKQQIELDRKSLSALYKELEEERNASAVAANEAMAMINRLQE  534

Query  1173  EKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             EKA+  M+A QY RMMEEQ+EYD+E  Q L D++ +RE+E+  LE++++ YR + G
Sbjct  535   EKAAMQMEALQYLRMMEEQSEYDQEAIQKLNDLLTEREKELLDLEAEIESYRKRLG  590



>ref|XP_007032995.1| Uncharacterized protein TCM_019131 [Theobroma cacao]
 gb|EOY03921.1| Uncharacterized protein TCM_019131 [Theobroma cacao]
Length=975

 Score = 97.4 bits (241),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F  F+ +N  +  + L+Y++LE+ +I+LLL++    +   +FA +F LK PC +CTR+D 
Sbjct  6    FATFLHKNTSKITVILVYALLEWTLIILLLLNSVFTYLITKFANYFGLKPPCPWCTRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             L   N    + D +C+ H  +IS LSYC  H K+++   MCE CL S
Sbjct  66   VLEPGNDANCHRDLVCDKHATEISKLSYCSRHGKLAESHLMCEECLAS  113


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  597   IERLKTSLKAERKALSALYAELEEERSASAIAANQTMAMITRLQEEKAAMQMEALQYQRM  656

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L ++++KRE+E E LE +L+VYR K 
Sbjct  657   MEEQSEYDQEALQLLNELMIKREKEKEELEKELEVYRKKV  696



>ref|XP_006838814.1| hypothetical protein AMTR_s00002p00262300 [Amborella trichopoda]
 gb|ERN01383.1| hypothetical protein AMTR_s00002p00262300 [Amborella trichopoda]
Length=731

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L+Y++LE+ +I+LL ++  L++   EFA FF L+ PC  C+RID  +      FY    
Sbjct  18   LLVYAILEWFLILLLFLNAVLSYVVTEFADFFGLQTPCLLCSRIDHKIGSHEPGFYRK-L  76

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCL  536
            IC  H  +ISSL+YCHVH+K+++++ +C NCL
Sbjct  77   ICHFHGLEISSLAYCHVHEKLANVQKICGNCL  108


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              +E  G +G+   LKRQV  +RKS+ ++  EL+EER+ASAI+ N AMAMITRLQ EKA  
Sbjct  504   LSEIEGESGV-DRLKRQVEFDRKSMRALYRELEEERSASAISVNQAMAMITRLQEEKAMM  562

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYR  1328
              M++ QYQRMMEEQAEYD+E  Q L D++ KRE+E++ LE ++ +YR
Sbjct  563   QMESQQYQRMMEEQAEYDQEALQKLNDLLDKREKEMKDLEEEVKMYR  609



>ref|XP_002521947.1| hypothetical protein RCOM_0607680 [Ricinus communis]
 gb|EEF40351.1| hypothetical protein RCOM_0607680 [Ricinus communis]
Length=1162

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++I LL ++   ++   +FA ++EL+ PC  C+R+D  L ++ L  YY D I
Sbjct  22   LASAFLEWLLICLLFIEAIFSYLITKFACYYELQTPCLLCSRLDHILGNKRLK-YYRDLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C  HK +ISSL  CH H K+ D+  MCE+CL SFA
Sbjct  81   CGKHKLEISSLVLCHAHNKLVDVHGMCESCLFSFA  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQ+  ++K L ++  ELDEERN+SAI+AN AMAMITRLQ EKA+  M+A QY RM
Sbjct  816   VDRLKRQIEHDKKLLSALYKELDEERNSSAISANQAMAMITRLQEEKATLQMEALQYLRM  875

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             MEEQAEYD E  Q   D++ +RE+EI+ LE++L+ YR   G
Sbjct  876   MEEQAEYDMEALQKTNDLLSEREKEIQDLEAELEFYRINPG  916



>ref|XP_006487767.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Citrus sinensis]
 ref|XP_006487768.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Citrus sinensis]
Length=1099

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 79/162 (49%), Gaps = 19/162 (12%)
 Frame = +3

Query  273  SVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICES  452
            + LE+++I LL +D   ++    FA + EL+ PC  C+R+D  L +  LN  Y D IC  
Sbjct  25   AALEWLLIFLLFIDAIFSYLITRFAHYCELQRPCLLCSRLDHVLGNEKLN-PYRDLICGK  83

Query  453  HKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA----  611
            H+ +ISSL  CH H K+ D++ MC+NCL SFA    S        V  V   + F     
Sbjct  84   HRLEISSLVLCHAHNKLVDVRGMCQNCLFSFATVNRSITETYRLLVGKVGDDSSFGSDED  143

Query  612  --------DKPNFQRCSCCMEFLGGKG---KYTRSMSQVAPP  704
                     + + + CSCC E    +G   K   S S V+ P
Sbjct  144  PLHEGHKNSQSSIRHCSCCNEPWTARGNVQKMIHSKSSVSEP  185


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = +3

Query  1002  TGFNEGNGSA-------GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiT  1160
             +GF   +GS          +  LKRQ+  ++K L +V  EL+EERNAS  A N AMAMIT
Sbjct  732   SGFESLDGSTVSEIEGESAVDRLKRQIEHDKKLLNAVYKELEEERNASTDAINQAMAMIT  791

Query  1161  RLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RLQ EKAS HM+A Q  RMMEEQAEYD E  Q   D++ ++E+EI+ LE  L+ YR K+
Sbjct  792   RLQEEKASLHMEALQSLRMMEEQAEYDMETLQKTNDLLAEKEKEIQDLEEQLEYYRKKY  850



>ref|XP_010265637.1| PREDICTED: uncharacterized protein LOC104603303 [Nelumbo nucifera]
 ref|XP_010265710.1| PREDICTED: uncharacterized protein LOC104603303 [Nelumbo nucifera]
Length=1006

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + L+Y+VLE+++I LLL +   ++   +FA +F LK PC +C+R+D 
Sbjct  6    FATMLSRNTHKITVILVYAVLEWILIFLLLANSLFSYLIAKFANYFGLKPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                     +Y D +CESH  +IS L YC  H+K+++ + MCE C
Sbjct  66   VFEPGKRCSFYRDLVCESHASEISKLGYCSNHRKLAEAQQMCEEC  110


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +3

Query  978   NNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamami  1157
             ++ D    + F  G G    ++ LK  +  ER+ L ++  EL+EER+ASAIAAN  MAMI
Sbjct  603   DSLDGSVNSDFEIGEGVL-TVERLKTALKAERRVLKTLYAELEEERSASAIAANQTMAMI  661

Query  1158  TRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             TRLQ EKA+  M+A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  662   TRLQEEKAAMQMEALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQDLEKELEVYRKKV  721



>emb|CBI35190.3| unnamed protein product [Vitis vinifera]
Length=604

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  +RK+++++  ELDEERNASAI+AN AMAMITRLQ EKA+ HM+A QY R
Sbjct  343   MVDRLKRQVEHDRKTIIALYKELDEERNASAISANQAMAMITRLQEEKAALHMEALQYLR  402

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIE  1379
             MMEEQ+EYD E  Q   D++ ++E+E++ LE++L+ YR KF    +  +   EIE
Sbjct  403   MMEEQSEYDMEALQKTNDLLTEKEKEMQDLEAELEFYRKKFPDETINVNSLLEIE  457



>ref|XP_004236946.1| PREDICTED: cingulin isoform X1 [Solanum lycopersicum]
Length=832

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + LIY+VLE+ +I LLL++ F ++   +FA +F LK PC  C+RID 
Sbjct  6    FATMLHKNTNKITMILIYAVLEWTLISLLLLNSFFSYMIIKFANYFGLKPPCPLCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
               H     +  D +CE+H ++IS L +C  H+K+ + + MCE+CL S
Sbjct  66   LFEHEKTKAFCKDLLCEAHAKEISQLGFCLNHQKLVESQDMCEDCLSS  113


 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG  +   I+HLK  +  ERK+L ++  EL+EER+ASA+AAN  MAMI +LQ EK++  M
Sbjct  461   EGGDAVSSIEHLKSALKAERKALHALYTELEEERSASAVAANQTMAMINKLQEEKSAMQM  520

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR +  
Sbjct  521   EALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQELEKELEVYRKRLS  569



>ref|XP_010319389.1| PREDICTED: cingulin isoform X2 [Solanum lycopersicum]
Length=829

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + LIY+VLE+ +I LLL++ F ++   +FA +F LK PC  C+RID 
Sbjct  6    FATMLHKNTNKITMILIYAVLEWTLISLLLLNSFFSYMIIKFANYFGLKPPCPLCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
               H     +  D +CE+H ++IS L +C  H+K+ + + MCE+CL S
Sbjct  66   LFEHEKTKAFCKDLLCEAHAKEISQLGFCLNHQKLVESQDMCEDCLSS  113


 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG  +   I+HLK  +  ERK+L ++  EL+EER+ASA+AAN  MAMI +LQ EK++  M
Sbjct  458   EGGDAVSSIEHLKSALKAERKALHALYTELEEERSASAVAANQTMAMINKLQEEKSAMQM  517

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR +  
Sbjct  518   EALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQELEKELEVYRKRLS  566



>ref|XP_010660132.1| PREDICTED: uncharacterized protein LOC100258654 isoform X2 [Vitis 
vinifera]
Length=800

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +  E++++ +L +DG  ++   +FA+  EL+ PC  C+R+D+ L    L FY+ D 
Sbjct  21   VLTSAFFEWLLMFMLFIDGIFSYLVTKFARSCELQAPCLLCSRLDRVLGKEKLGFYW-DL  79

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            IC +HK +ISSL  C+ HKK+ + + MCENCL SFA
Sbjct  80   ICHNHKLEISSLVLCYTHKKLVNGRGMCENCLFSFA  115


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  +RK+++++  ELDEERNASAI+AN AMAMITRLQ EKA+ HM+A QY R
Sbjct  454   MVDRLKRQVEHDRKTIIALYKELDEERNASAISANQAMAMITRLQEEKAALHMEALQYLR  513

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQ+EYD E  Q   D++ ++E+E++ LE++L+ YR KF
Sbjct  514   MMEEQSEYDMEALQKTNDLLTEKEKEMQDLEAELEFYRKKF  554



>ref|XP_011038542.1| PREDICTED: myosin-9-like [Populus euphratica]
Length=948

 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  +VLE++++ +L  +   ++    FA  +EL+ PC  C+R+D  L  R L +Y+ D I
Sbjct  22   LASAVLEWLLMCMLFTNAIFSYLITRFACHWELQTPCLLCSRLDHILGSRKLRYYW-DLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK ++SSL +CH H  + D+  MCENCL SFA
Sbjct  81   CGNHKLEVSSLVFCHAHNNLVDVHGMCENCLFSFA  115


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  ++K L ++  EL+EERNAS IAAN AMAMITRLQ EKA+ HM+A QY RM
Sbjct  603   VDRLKRQVEHDKKLLSALYKELEEERNASTIAANQAMAMITRLQEEKATLHMEALQYLRM  662

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q   D++ ++E+E++ LE +L+ YR KF
Sbjct  663   MEEQSEYDKEALQKKNDLLTEKEKEVQDLEEELEFYRSKF  702



>ref|XP_002263011.2| PREDICTED: uncharacterized protein LOC100258654 isoform X1 [Vitis 
vinifera]
 ref|XP_010660130.1| PREDICTED: uncharacterized protein LOC100258654 isoform X1 [Vitis 
vinifera]
 ref|XP_010660131.1| PREDICTED: uncharacterized protein LOC100258654 isoform X1 [Vitis 
vinifera]
Length=880

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +  E++++ +L +DG  ++   +FA+  EL+ PC  C+R+D+ L    L FY+ D 
Sbjct  21   VLTSAFFEWLLMFMLFIDGIFSYLVTKFARSCELQAPCLLCSRLDRVLGKEKLGFYW-DL  79

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            IC +HK +ISSL  C+ HKK+ + + MCENCL SFA
Sbjct  80   ICHNHKLEISSLVLCYTHKKLVNGRGMCENCLFSFA  115


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  +RK+++++  ELDEERNASAI+AN AMAMITRLQ EKA+ HM+A QY R
Sbjct  534   MVDRLKRQVEHDRKTIIALYKELDEERNASAISANQAMAMITRLQEEKAALHMEALQYLR  593

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQ+EYD E  Q   D++ ++E+E++ LE++L+ YR KF
Sbjct  594   MMEEQSEYDMEALQKTNDLLTEKEKEMQDLEAELEFYRKKF  634



>ref|XP_010032708.1| PREDICTED: uncharacterized protein LOC104422160 isoform X2 [Eucalyptus 
grandis]
 gb|KCW52154.1| hypothetical protein EUGRSUZ_J01598 [Eucalyptus grandis]
Length=979

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 83/153 (54%), Gaps = 5/153 (3%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R    L+Y+ LE+V+I +LL++    +   +FA FF LK PC +C RID+
Sbjct  6    FATVLHRNTNRLIAILVYAALEWVLISMLLLNSLFGYLISKFAGFFGLKPPCPWCCRIDR  65

Query  399  ALVH-RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyy  575
             L   +  +  + + +CE+H  +IS LSYC  H K+++ + MC +C  S  P  D+S+  
Sbjct  66   VLERGKRADHSFVNEVCETHAAEISKLSYCSNHHKLAESQGMCNDCFAS-RPVTDASNGM  124

Query  576  aaddvkSV---NVFADKPNFQRCSCCMEFLGGK  665
                  S+   +   +  +  RCSCC E L GK
Sbjct  125  TRTPFVSMMREDTCQNGDDILRCSCCKENLTGK  157


 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = +3

Query  1017  GNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQ  1196
             G+G+  + + LK  +  ERK+L ++  EL+EER+ASA+A N  MAMITRLQ EKA+  M+
Sbjct  596   GDGAISV-ERLKAALKAERKALSALYAELEEERSASAVATNQTMAMITRLQEEKAAMQME  654

Query  1197  ASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             A QYQRMMEEQ+EYD+E  Q+L ++++KRE E E LE +L +YR K  
Sbjct  655   ALQYQRMMEEQSEYDQEALQLLNELMIKREREKEELEKELAIYRQKVS  702



>ref|XP_010032706.1| PREDICTED: uncharacterized protein LOC104422160 isoform X1 [Eucalyptus 
grandis]
Length=983

 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 83/153 (54%), Gaps = 5/153 (3%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R    L+Y+ LE+V+I +LL++    +   +FA FF LK PC +C RID+
Sbjct  6    FATVLHRNTNRLIAILVYAALEWVLISMLLLNSLFGYLISKFAGFFGLKPPCPWCCRIDR  65

Query  399  ALVH-RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyy  575
             L   +  +  + + +CE+H  +IS LSYC  H K+++ + MC +C  S  P  D+S+  
Sbjct  66   VLERGKRADHSFVNEVCETHAAEISKLSYCSNHHKLAESQGMCNDCFAS-RPVTDASNGM  124

Query  576  aaddvkSV---NVFADKPNFQRCSCCMEFLGGK  665
                  S+   +   +  +  RCSCC E L GK
Sbjct  125  TRTPFVSMMREDTCQNGDDILRCSCCKENLTGK  157


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = +3

Query  1017  GNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQ  1196
             G+G+  + + LK  +  ERK+L ++  EL+EER+ASA+A N  MAMITRLQ EKA+  M+
Sbjct  600   GDGAISV-ERLKAALKAERKALSALYAELEEERSASAVATNQTMAMITRLQEEKAAMQME  658

Query  1197  ASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             A QYQRMMEEQ+EYD+E  Q+L ++++KRE E E LE +L +YR K  
Sbjct  659   ALQYQRMMEEQSEYDQEALQLLNELMIKREREKEELEKELAIYRQKVS  706



>ref|XP_002319088.1| hypothetical protein POPTR_0013s04060g [Populus trichocarpa]
 gb|EEE95011.1| hypothetical protein POPTR_0013s04060g [Populus trichocarpa]
Length=954

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  +VLE++++ +L  +   ++    FA  +EL+ PC  C+R+D  L  R L +Y+ D I
Sbjct  22   LASAVLEWLLMCMLFTNAIFSYLITRFACQWELQTPCLLCSRLDHILGSRKLRYYW-DLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK ++SSL +CH H  + D+  MCENCL SFA
Sbjct  81   CGNHKLEVSSLVFCHAHNNLVDVHGMCENCLFSFA  115


 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  ++K L ++  EL+EERNAS IAAN AMAMITRLQ EKA+ HM+A QY RM
Sbjct  609   VDRLKRQVEHDKKLLSALYKELEEERNASTIAANQAMAMITRLQEEKATLHMEALQYLRM  668

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD E  Q   D++ ++E+E++ LE +L+ YR KF
Sbjct  669   MEEQSEYDTEALQKKNDLLTEKEKEVQDLEEELEFYRSKF  708



>ref|XP_006355075.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Solanum tuberosum]
Length=858

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + LIY++LE+ +I LLL++ F ++   +FA +F LK PC  C+RID 
Sbjct  6    FATMLHKNTNKITMILIYAILEWTLISLLLLNSFFSYMIIKFADYFGLKPPCPLCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
               H     +  D +CE+H  +IS L +C  H+K+ + K MCE+CL S
Sbjct  66   LFEHEKTKAFCKDLLCEAHAVEISKLGFCLNHQKLVESKDMCEDCLSS  113


 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG  +   I+HLK  +  ERK+L ++  EL+EER+ASA+AAN  MAMI +LQ EK++  M
Sbjct  487   EGGDAVSSIEHLKSALKAERKALHALYTELEEERSASAVAANQTMAMINKLQEEKSAMQM  546

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR +  
Sbjct  547   EALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQELEKELEVYRKRLS  595



>ref|XP_006355076.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X2 [Solanum tuberosum]
Length=856

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + LIY++LE+ +I LLL++ F ++   +FA +F LK PC  C+RID 
Sbjct  6    FATMLHKNTNKITMILIYAILEWTLISLLLLNSFFSYMIIKFADYFGLKPPCPLCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
               H     +  D +CE+H  +IS L +C  H+K+ + K MCE+CL S
Sbjct  66   LFEHEKTKAFCKDLLCEAHAVEISKLGFCLNHQKLVESKDMCEDCLSS  113


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG  +   I+HLK  +  ERK+L ++  EL+EER+ASA+AAN  MAMI +LQ EK++  M
Sbjct  485   EGGDAVSSIEHLKSALKAERKALHALYTELEEERSASAVAANQTMAMINKLQEEKSAMQM  544

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR +  
Sbjct  545   EALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQELEKELEVYRKRLS  593



>ref|XP_010274148.1| PREDICTED: uncharacterized protein LOC104609520 isoform X1 [Nelumbo 
nucifera]
Length=989

 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +V E+++I LL ++G +++ S +FA+++EL  PC  C+RID  + + N    Y D 
Sbjct  23   VLASAVQEWLLIFLLFINGAISYLSTKFARYYELPTPCLLCSRIDHVIGNEN-PASYKDL  81

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             C  HK +ISSL  CH+H K+ D+  +CE+CLLS A
Sbjct  82   FCGKHKLEISSLILCHIHDKLVDVHGICESCLLSLA  117


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +3

Query  849   KTPCNRGGNNKFVGIPLSD-SPRM----STKKTRTMSIDYSALSRSDPNNYDLVTTTGFN  1013
             K P ++  N + + + L+D SPR        K    S+    L +      +   T  ++
Sbjct  510   KVPLSQVSNARGLELALNDVSPRAYGFGDELKISDASVVPQLLPKKSLTEKNECGTDSWD  569

Query  1014  EGNGSA----GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKA  1181
             E   S      I+  LKRQ    RK + ++  EL+EERNASA+AAN+++AMITRLQ EKA
Sbjct  570   ESTASETEVESIVDRLKRQSECYRKCMAALYKELEEERNASAVAANHSLAMITRLQEEKA  629

Query  1182  SKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             S HM+A QY RMMEEQ+EYD E  Q   D++ +RE++I+ LE++L+ Y++K+
Sbjct  630   SLHMEALQYLRMMEEQSEYDMEALQKANDLLAEREKDIQDLEAELEYYKEKY  681



>gb|KHG18859.1| Eukaryotic translation initiation factor 3 subunit E [Gossypium 
arboreum]
Length=851

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F  F+ ++  +  + L+Y+VLE+++I LLL++ F  +   +FA +F LK PC +C+R+D 
Sbjct  7    FARFLHKHTSKITVILVYAVLEWILIFLLLLNSFFTYLITKFANYFGLKPPCPWCSRVDH  66

Query  399  AL--VHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             L   + N +  Y D +C+ H  +IS LSYC  H K+++   MCE CL S
Sbjct  67   VLEPNNNNSSNSYRDLVCDKHGSEISKLSYCSSHGKLAETHLMCEECLAS  116


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  482   IERLKTSLKAERKALSALYAELEEERSASAIAANQTMAMITRLQEEKAAMQMEALQYQRM  541

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L ++++KRE+E E LE +L+VYR K 
Sbjct  542   MEEQSEYDQEALQLLNELMIKREKEKEELEKELEVYRKKV  581



>ref|XP_009790074.1| PREDICTED: uncharacterized protein LOC104237594 isoform X3 [Nicotiana 
sylvestris]
Length=841

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ D I
Sbjct  22   LTTAFLEWLLMIFLFMDGAFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKEKAGFYW-DLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKLKISSLVLCHSHNNLVDVHGMCESCLFSFA  115


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ +M+A Q  R
Sbjct  510   VSDRLKRQVEYDRKLMAALYKELEEERNASSVAANQAMAMITRLQEEKAALNMEALQCLR  569

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             ++EEQAEYD E  Q   D++ ++E+EI+ LE++L++Y+ K G + L
Sbjct  570   VLEEQAEYDNEALQKANDLLAQKEKEIQDLEAELELYKKKLGNMAL  615



>ref|XP_004247345.1| PREDICTED: uncharacterized protein LOC101245695 [Solanum lycopersicum]
Length=1195

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (47%), Gaps = 28/173 (16%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L Y+V E+ ++ +L +D  LA F  +FA ++EL+ PC  C+R +  L  +  +  Y   
Sbjct  15   VLSYAVCEWFLMFMLFIDAALAQFIAKFASYYELQTPCMLCSRFNHILGDKK-SGCYGSH  73

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFADK-  617
            +C +HK D+S   +CH+H  ++D++ MCE CL+SFA              +S N+  DK 
Sbjct  74   LCRNHKEDVSFQVFCHIHGNLADVRAMCEECLVSFA-------TENILIKESDNLMIDKL  126

Query  618  ---------PNFQRCSCCMEFLGGKGKYTRSMSQVA----------PPPSPRA  719
                     P    CSCC +    +    R +   +           PP PRA
Sbjct  127  GNKSFIPTSPGPWNCSCCQKTWRARSSAQRLLQLTSVGFGASKANVKPPLPRA  179


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             I+  LKRQ+  +++ + S+  EL+EER+ASAIA N AMAMITRLQ EKAS HM+A QY R
Sbjct  856   IVDRLKRQIEHDQRYINSLYKELEEERSASAIATNQAMAMITRLQEEKASLHMEALQYLR  915

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  +   D + +RE+E++ +E +L  YR+  
Sbjct  916   MMEEQAEYDMEALERANDQLAEREKELQDMEEELLEYRNNI  956



>ref|XP_009630715.1| PREDICTED: uncharacterized protein LOC104120616 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009630716.1| PREDICTED: uncharacterized protein LOC104120616 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009630717.1| PREDICTED: uncharacterized protein LOC104120616 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ D I
Sbjct  22   LTTAFLEWLLLIFLFMDGAFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKEKAGFYW-DLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKLKISSLVLCHSHDNLVDVHGMCESCLFSFA  115


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
              +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITR+Q EKA+ +M+A Q  
Sbjct  509   SVSDRLKRQVEYDRKLMAALYKELEEERNASSVAANQAMAMITRVQEEKAALNMEALQCL  568

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             R++EEQAEYD E  Q   D+++++E+EI+ LE++L++Y+ K G + L
Sbjct  569   RVLEEQAEYDNEALQKANDLLVQKEKEIQDLEAELELYKKKLGNMAL  615



>ref|XP_009630718.1| PREDICTED: uncharacterized protein LOC104120616 isoform X2 [Nicotiana 
tomentosiformis]
Length=840

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ D I
Sbjct  22   LTTAFLEWLLLIFLFMDGAFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKEKAGFYW-DLI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKLKISSLVLCHSHDNLVDVHGMCESCLFSFA  115


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
              +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITR+Q EKA+ +M+A Q  
Sbjct  508   SVSDRLKRQVEYDRKLMAALYKELEEERNASSVAANQAMAMITRVQEEKAALNMEALQCL  567

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             R++EEQAEYD E  Q   D+++++E+EI+ LE++L++Y+ K G + L
Sbjct  568   RVLEEQAEYDNEALQKANDLLVQKEKEIQDLEAELELYKKKLGNMAL  614



>ref|XP_009790072.1| PREDICTED: uncharacterized protein LOC104237594 isoform X1 [Nicotiana 
sylvestris]
Length=860

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ D I
Sbjct  41   LTTAFLEWLLMIFLFMDGAFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKEKAGFYW-DLI  99

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  100  CPNHKLKISSLVLCHSHNNLVDVHGMCESCLFSFA  134


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
              +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ +M+A Q  
Sbjct  528   SVSDRLKRQVEYDRKLMAALYKELEEERNASSVAANQAMAMITRLQEEKAALNMEALQCL  587

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             R++EEQAEYD E  Q   D++ ++E+EI+ LE++L++Y+ K G + L
Sbjct  588   RVLEEQAEYDNEALQKANDLLAQKEKEIQDLEAELELYKKKLGNMAL  634



>ref|XP_009790073.1| PREDICTED: uncharacterized protein LOC104237594 isoform X2 [Nicotiana 
sylvestris]
Length=859

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ D I
Sbjct  41   LTTAFLEWLLMIFLFMDGAFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKEKAGFYW-DLI  99

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  100  CPNHKLKISSLVLCHSHNNLVDVHGMCESCLFSFA  134


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
              +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ +M+A Q  
Sbjct  527   SVSDRLKRQVEYDRKLMAALYKELEEERNASSVAANQAMAMITRLQEEKAALNMEALQCL  586

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             R++EEQAEYD E  Q   D++ ++E+EI+ LE++L++Y+ K G + L
Sbjct  587   RVLEEQAEYDNEALQKANDLLAQKEKEIQDLEAELELYKKKLGNMAL  633



>ref|XP_006587251.1| PREDICTED: uncharacterized protein LOC100794710 isoform X2 [Glycine 
max]
Length=823

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +  N  +  L L+Y++LE+++I LLL++ F ++   +F  +F LK PC +CTRID+
Sbjct  6    FATMLLTNTNKITLVLVYAILEWILIFLLLLNSFFSYLIMKFVIYFGLKRPCIWCTRIDR  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +   N      D +CE+H  +IS L +C  H+K+++ +TMCE+C
Sbjct  66   IIEPENNKGSCRDLVCEAHAFEISKLDFCLNHRKLAESETMCEDC  110


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  +  ER++L  V  EL+EER+ASAIAAN  MA+I RLQ EKA+  M+A QY+RM
Sbjct  482   IEKLKSALKAEREALNVVYAELEEERSASAIAANQTMAVINRLQEEKAAMQMEALQYERM  541

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L D+++KRE+E   LE ++++YR K 
Sbjct  542   MEEQSEYDQEALQLLNDLMVKREKEKLELEKEVEIYRKKV  581



>ref|XP_003533115.1| PREDICTED: uncharacterized protein LOC100794710 isoform X1 [Glycine 
max]
 gb|KHN03157.1| hypothetical protein glysoja_038926 [Glycine soja]
Length=871

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +  N  +  L L+Y++LE+++I LLL++ F ++   +F  +F LK PC +CTRID+
Sbjct  6    FATMLLTNTNKITLVLVYAILEWILIFLLLLNSFFSYLIMKFVIYFGLKRPCIWCTRIDR  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +   N      D +CE+H  +IS L +C  H+K+++ +TMCE+C
Sbjct  66   IIEPENNKGSCRDLVCEAHAFEISKLDFCLNHRKLAESETMCEDC  110


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  +  ER++L  V  EL+EER+ASAIAAN  MA+I RLQ EKA+  M+A QY+RM
Sbjct  530   IEKLKSALKAEREALNVVYAELEEERSASAIAANQTMAVINRLQEEKAAMQMEALQYERM  589

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQ+EYD+E  Q+L D+++KRE+E   LE ++++YR K
Sbjct  590   MEEQSEYDQEALQLLNDLMVKREKEKLELEKEVEIYRKK  628



>gb|KDP23688.1| hypothetical protein JCGZ_23521 [Jatropha curcas]
Length=971

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  +VLE+++I +L VD  L+    +FA + +L+ PC  C+R+D  L ++ L +Y+ D I
Sbjct  21   LASAVLEWLLICMLFVDAILSCLITKFACYCQLQTPCLLCSRLDHILGNKKLKYYW-DLI  79

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C  HK +ISSL  CH H  + D+  +CE CL SFA
Sbjct  80   CGVHKSEISSLVLCHAHNNLVDVHGICERCLFSFA  114


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  L RQ+  ++K L+++  EL+EERNASAIAAN AMAMITRLQ EKA+  M+A Q  R
Sbjct  633   VVDRLNRQIEHDKKLLIALYKELEEERNASAIAANQAMAMITRLQEEKATLQMEALQCLR  692

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  Q   D++ +RE+EI+ LE+DL+ YR+ +
Sbjct  693   MMEEQAEYDMETLQKTNDLLAEREKEIQDLEADLEFYRNNY  733



>ref|XP_010043265.1| PREDICTED: uncharacterized protein LOC104432519 isoform X2 [Eucalyptus 
grandis]
Length=752

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
             G+I  LKRQV  +RKS+ ++  EL+EERNASAIAAN AMAMITRLQ EKA+ HM+A QY 
Sbjct  407   GLIDRLKRQVEHDRKSMSALYKELEEERNASAIAANQAMAMITRLQEEKATLHMEALQYL  466

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RMMEEQAEYD E  Q   D++  RE++I+ L+++L+ YR+K+
Sbjct  467   RMMEEQAEYDMEALQKSNDLLADREKDIQDLDAELEFYRNKY  508



>ref|XP_008218509.1| PREDICTED: uncharacterized protein LOC103318854 [Prunus mume]
Length=745

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L+ ++ E+++I +L VD   ++   +FA +  L+ PC  C+R+D  L    L  YY D 
Sbjct  21   VLVTAIFEWLLISMLFVDAIFSYIITKFAYYCGLRTPCLLCSRLDHVLGKEKLG-YYLDL  79

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             C +HK +ISSL  CH H K+ D+  MCE+CL SFA
Sbjct  80   FCGNHKSEISSLVLCHAHHKLVDVHGMCESCLFSFA  115


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K + ++  EL+EERNASA+A++ AMAMITRLQ EKA+ HM+A Q+ R
Sbjct  522   VVDRLKRQVEHDKKLMSALYKELEEERNASAVASDQAMAMITRLQEEKAALHMEALQHLR  581

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  Q + D+++++E+EI+ LE++L+ YR KF
Sbjct  582   MMEEQAEYDNEALQKIDDLLVEKEKEIQDLEAELEFYRRKF  622



>ref|XP_006482093.1| PREDICTED: intracellular protein transport protein USO1-like 
[Citrus sinensis]
Length=949

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 78/155 (50%), Gaps = 6/155 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + ++  +    L+Y+VLE+++I+ LL++    +   ++A +F LK PC +C+R+D 
Sbjct  6    FATMLHKSTNKITAILVYAVLEWILIIFLLLNSLFTYLITKYANYFGLKPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L        Y D +C +H  +IS LSYC  H+++++ + MC  CL S     + S    
Sbjct  66   ILEPGKNTKSYRDLVCHTHATEISKLSYCSSHQRLAETENMCMECLASREQQNEESIGMT  125

Query  579  addvkSVNVFADKP-----NFQRCSCCMEFLGGKG  668
                    V + KP     +F RC CC E L  + 
Sbjct  126  RRIAFISWVSSHKPEKGDQDF-RCYCCNESLNSEA  159


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ +K  +  ERK+  ++  EL+EER+ASA+AAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  569   IEKMKSALRAERKAFSALYSELEEERSASAVAANQTMAMITRLQEEKAAMQMEALQYQRM  628

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQAEYD+E  Q+L ++++KRE+E + LE +L++YR K 
Sbjct  629   MEEQAEYDQEALQLLNELMVKREKEKQELEKELEIYRMKV  668



>ref|XP_010531814.1| PREDICTED: uncharacterized protein LOC104808028 [Tarenaya hassleriana]
Length=953

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
            AL L +S  E++++ +L + G  ++   +FA + EL+ PC  C+R+D  L  +    Y+ 
Sbjct  21   ALALAFS--EWILLFMLFLHGIFSYLITKFADYSELQSPCVLCSRLDHILGKKPFKHYW-  77

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            D IC  HK +ISSL YCH H K+ D+  MCE CL SFA
Sbjct  78   DLICSKHKSEISSLVYCHAHDKLVDVHGMCETCLFSFA  115


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EERNAS +AAN AMAMITRLQ +KAS  M+A Q  R MEE
Sbjct  714   LKRQVDHDRKLLTGLYKELEEERNASTVAANQAMAMITRLQEDKASFQMEALQNLREMEE  773

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L +++ +RE+ I+ LE++L+ YR+K
Sbjct  774   QAEYDMEAVQKLNELLSEREKVIQDLEAELEFYREK  809



>gb|KDO50780.1| hypothetical protein CISIN_1g002237mg [Citrus sinensis]
Length=949

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 78/155 (50%), Gaps = 6/155 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + ++  +    L+Y+VLE+++I+ LL++    +   ++A +F LK PC +C+R+D 
Sbjct  6    FATMLHKSTNKITAILVYAVLEWILIIFLLLNSLFTYLITKYANYFGLKPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L        Y D +C +H  +IS LSYC  H+++++ + MC  CL S     + S    
Sbjct  66   ILEPGKNTKSYRDLVCHTHATEISELSYCSSHQRLAETENMCMECLASREQQNEESIGMT  125

Query  579  addvkSVNVFADKP-----NFQRCSCCMEFLGGKG  668
                    V + KP     +F RC CC E L  + 
Sbjct  126  RRIAFISWVSSHKPEKGDQDF-RCYCCNESLNSEA  159


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ +K  +  ERK+  ++  EL+EER+ASA+AAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  569   IEKMKSALRAERKAFSALYSELEEERSASAVAANQTMAMITRLQEEKAAMQMEALQYQRM  628

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQAEYD+E  Q+L ++++KRE+E + LE +L++YR K 
Sbjct  629   MEEQAEYDQEALQLLNELMVKREKEKQELEKELEIYRMKV  668



>ref|XP_010274744.1| PREDICTED: golgin subfamily A member 4 [Nelumbo nucifera]
Length=1010

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y VLE+ +I  LL++   ++   +FA +F LK PC +C+RID 
Sbjct  6    FATMLSRNTHKITLILVYVVLEWFLIFFLLLNSLFSYLIVKFANYFGLKTPCLWCSRIDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                   +  Y D +CE+H  +IS L YC  H+K+ + + MCE C
Sbjct  66   VFEPGKEHASYRDLVCENHASEISKLGYCSNHRKLVEAQDMCEEC  110


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +3

Query  987   DLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRL  1166
             D    + F  G G    +  +K  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRL
Sbjct  620   DGSVISDFEAGEGVL-TVDRMKSVLKAERKALNALYAELEEERSASAIAANQTMAMITRL  678

Query  1167  QAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             Q EKA+  M+A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  679   QEEKAAMQMEALQYQRMMEEQSEYDQEALQLLNELMVKREKEKQDLEKELEVYRKKV  735



>ref|XP_010528817.1| PREDICTED: uncharacterized protein LOC104805830 [Tarenaya hassleriana]
Length=1036

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+++I +L V+   ++   +FA + EL+ PC  C+R+D  L  + L  ++ D IC  HK 
Sbjct  40   EWLLIFMLFVNAIFSYLITKFADYSELQQPCLLCSRLDHILGKKRLKHHW-DLICSKHKS  98

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSFA  548
            +ISSL YCH H K+ D+  MCE CL SFA
Sbjct  99   EISSLVYCHAHDKLVDVHGMCETCLFSFA  127


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+AAN AMAMITRLQ +KAS  M+A Q  RMMEE
Sbjct  748   LKRQVDHDRKMLTGLYKELEEERSASAVAANQAMAMITRLQEDKASFQMEALQNLRMMEE  807

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++ +RE+ I+ LE++L+ YR +
Sbjct  808   QAEYDMEALQKLSDLLAEREKVIQDLEAELEFYRSQ  843



>ref|XP_006351687.1| PREDICTED: intracellular protein transport protein USO1-like 
[Solanum tuberosum]
Length=1151

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (47%), Gaps = 28/173 (16%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +V E+ ++ LL +D  LA+F  +FA ++EL+ PC  C+R +  L  +  +  Y   
Sbjct  20   VLSSAVCEWFLMFLLFLDAALAYFIAKFASYYELQTPCMLCSRFNHILGDKK-SGCYGSH  78

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFADK-  617
            +C +HK D+S   +CH+H  ++D++ MCE CL+SFA              +S N+  DK 
Sbjct  79   LCRNHKEDVSFQVFCHIHGNLADVRAMCEECLVSFA-------TENILIKESDNLMIDKL  131

Query  618  ---------PNFQRCSCCMEFLGGKGKYTRSMSQVA----------PPPSPRA  719
                     P    CSCC +    +    R +   +           PP PRA
Sbjct  132  GNKSFKPSSPGPWNCSCCQKTWRARSSAQRLLQLTSVGFGASKANVKPPLPRA  184


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 18/124 (15%)
 Frame = +3

Query  966   RSDPNNYDLV------TTTGFNE-GNGSA-----------GIIQHLKRQVLLERKSLVSV  1091
             RSD ++ D V      T TG ++ GN SA            I+  LKRQ+  +++ + S+
Sbjct  771   RSDASSSDGVHVIQTSTITGRDDSGNESADGFSVSDIEDESIVDRLKRQIEHDQRYINSL  830

Query  1092  CMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDM  1271
               EL+EER+ASAIA N AMAMITRLQ EKAS HM+A QY RMMEEQAEYD E  +   D 
Sbjct  831   YKELEEERSASAIATNQAMAMITRLQEEKASLHMEALQYLRMMEEQAEYDMEALERANDQ  890

Query  1272  ILKR  1283
             +  R
Sbjct  891   LADR  894



>ref|XP_007208094.1| hypothetical protein PRUPE_ppa001296mg [Prunus persica]
 gb|EMJ09293.1| hypothetical protein PRUPE_ppa001296mg [Prunus persica]
Length=861

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L+ ++ E+++I LL VD   ++   +FA +  L+ PC  C+R+D  L    L +Y+ D 
Sbjct  21   VLVTAIFEWLLISLLFVDAIFSYIITKFAYYCGLQTPCLLCSRLDHVLGKEKLGYYW-DL  79

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             C +HK +ISSL  C+ H K+ D+  MCE+CL SFA
Sbjct  80   FCGNHKSEISSLVLCYAHHKLVDVHGMCESCLFSFA  115


 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K + ++  EL+EERNASA+A++ AMAMITRLQ EKA+ HM+A Q+ R
Sbjct  519   VVDRLKRQVEHDKKLMSALYKELEEERNASAVASDQAMAMITRLQEEKAAIHMEALQHLR  578

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  Q + D+++++E+EI+ LE++L+ YR KF
Sbjct  579   MMEEQAEYDNEALQKIDDLLVEKEKEIQDLEAELEFYRRKF  619



>ref|XP_009404792.1| PREDICTED: uncharacterized protein LOC103988027 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404793.1| PREDICTED: uncharacterized protein LOC103988027 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1162

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L Y++LE+ +I+LLL++GF A+    FA +F LK PC FC+R+D 
Sbjct  76   FATVLHRNSHRMAVILAYAILEWALIILLLLNGFFAYLIARFADYFGLKPPCIFCSRVDH  135

Query  399  ALV--HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdy  572
                          D IC+ H  +++ L YC  H+++++   MCE+C  S  P + +   
Sbjct  136  LFQSDEGRRRCALRDLICDEHAAEVAKLGYCAHHRRLAEAGEMCEDCSSSSRPVEVAVLS  195

Query  573  yaaddvkSVNVFADKPNFQRCSCC  644
            +       +    +     RCSCC
Sbjct  196  W-------MKRIEEGEKDLRCSCC  212


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LK  +  ERK+L ++  EL+EER+A+AIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  787   VDQLKAALKAERKALSALYAELEEERSAAAIAANQTMAMITRLQEEKAAMQMEALQYQRM  846

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+EQ+EYD+E  ++L ++++KRE E + LE +L+VYR+K 
Sbjct  847   MDEQSEYDQEALELLNELMIKREREKQDLEKELEVYRNKV  886



>ref|XP_009404794.1| PREDICTED: uncharacterized protein LOC103988027 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1149

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L Y++LE+ +I+LLL++GF A+    FA +F LK PC FC+R+D 
Sbjct  76   FATVLHRNSHRMAVILAYAILEWALIILLLLNGFFAYLIARFADYFGLKPPCIFCSRVDH  135

Query  399  ALV--HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdy  572
                          D IC+ H  +++ L YC  H+++++   MCE+C  S  P + +   
Sbjct  136  LFQSDEGRRRCALRDLICDEHAAEVAKLGYCAHHRRLAEAGEMCEDCSSSSRPVEVAVLS  195

Query  573  yaaddvkSVNVFADKPNFQRCSCC  644
            +       +    +     RCSCC
Sbjct  196  W-------MKRIEEGEKDLRCSCC  212


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LK  +  ERK+L ++  EL+EER+A+AIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  774   VDQLKAALKAERKALSALYAELEEERSAAAIAANQTMAMITRLQEEKAAMQMEALQYQRM  833

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+EQ+EYD+E  ++L ++++KRE E + LE +L+VYR+K 
Sbjct  834   MDEQSEYDQEALELLNELMIKREREKQDLEKELEVYRNKV  873



>ref|XP_006347726.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X3 [Solanum tuberosum]
Length=860

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ + I
Sbjct  22   LTSAFLEWLLMIFLFIDGGFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKERAGFYW-ELI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKYRISSLVLCHNHNNLVDVHGMCESCLFSFA  115


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ HM+A Q  RMMEE
Sbjct  521   LKRQVEYDRKLMAALYRELEEERNASSVAANQAMAMITRLQEEKAALHMEALQCLRMMEE  580

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             QAEYD E  Q   D++ ++E+EI+  E+ L++Y+ K G + L
Sbjct  581   QAEYDNEALQNSNDLLAQKEKEIQDFETKLELYKKKLGNMAL  622



>ref|XP_006347724.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347725.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Solanum tuberosum]
Length=861

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ + I
Sbjct  22   LTSAFLEWLLMIFLFIDGGFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKERAGFYW-ELI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKYRISSLVLCHNHNNLVDVHGMCESCLFSFA  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ HM+A Q  RMMEE
Sbjct  522   LKRQVEYDRKLMAALYRELEEERNASSVAANQAMAMITRLQEEKAALHMEALQCLRMMEE  581

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             QAEYD E  Q   D++ ++E+EI+  E+ L++Y+ K G + L
Sbjct  582   QAEYDNEALQNSNDLLAQKEKEIQDFETKLELYKKKLGNMAL  623



>ref|XP_010327558.1| PREDICTED: uncharacterized protein LOC101255631 isoform X2 [Solanum 
lycopersicum]
Length=909

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ + I
Sbjct  22   LTSAFLEWLLMIFLFIDGGFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKERAGFYW-ELI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKYRISSLVLCHNHNNLVDVHGMCESCLFSFA  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ HM+A Q  R
Sbjct  566   VSDRLKRQVEYDRKLMAALYRELEEERNASSVAANQAMAMITRLQEEKAALHMEALQCLR  625

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             MMEEQAEYD E  Q   D++ ++E+EI+  E+ L++Y+ K G + L
Sbjct  626   MMEEQAEYDSEALQNANDLLAQKEKEIQDFETKLELYKKKLGNMAL  671



>ref|XP_004230077.1| PREDICTED: uncharacterized protein LOC101255631 isoform X1 [Solanum 
lycopersicum]
Length=910

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++++ L +DG  A+   +FA++ +L++PC  C+R+D  L      FY+ + I
Sbjct  22   LTSAFLEWLLMIFLFIDGGFAYLVTKFAQYCQLQVPCLLCSRLDHVLGKERAGFYW-ELI  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK  ISSL  CH H  + D+  MCE+CL SFA
Sbjct  81   CPNHKYRISSLVLCHNHNNLVDVHGMCESCLFSFA  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             +   LKRQV  +RK + ++  EL+EERNAS++AAN AMAMITRLQ EKA+ HM+A Q  R
Sbjct  567   VSDRLKRQVEYDRKLMAALYRELEEERNASSVAANQAMAMITRLQEEKAALHMEALQCLR  626

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             MMEEQAEYD E  Q   D++ ++E+EI+  E+ L++Y+ K G + L
Sbjct  627   MMEEQAEYDSEALQNANDLLAQKEKEIQDFETKLELYKKKLGNMAL  672



>ref|XP_006430570.1| hypothetical protein CICLE_v10011001mg [Citrus clementina]
 gb|ESR43810.1| hypothetical protein CICLE_v10011001mg [Citrus clementina]
Length=949

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   ++++  +    L+Y+VLE+++I+ LL++    +   ++A +F LK PC +C+R+D 
Sbjct  6    FATMLQKSTNKITAILVYAVLEWILIIFLLLNSLFTYLITKYANYFGLKPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             L        Y D +C +H  +IS LSYC  H+++++ + MC  CL S
Sbjct  66   ILEPGKNTKSYRDLVCHTHATEISELSYCSSHQRLAETENMCMECLAS  113


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ +K  +  ERK+  ++  EL+EER+ASA+AAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  569   IEKMKSALRAERKAFSALYSELEEERSASAVAANQTMAMITRLQEEKAAMQMEALQYQRM  628

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQAEYD+E  Q+L ++++KRE+E + LE +L++YR K 
Sbjct  629   MEEQAEYDQEALQLLNELMVKREKEKQELEKELEIYRMKV  668



>ref|XP_010102267.1| hypothetical protein L484_024549 [Morus notabilis]
 gb|EXB93210.1| hypothetical protein L484_024549 [Morus notabilis]
Length=938

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+ ++LE+++I  L  D   ++    FA+  +L+ PC  C+R+D  L    + +Y+ D +
Sbjct  23   LVSALLEWLLIFFLFFDAVFSYVITRFARGCKLQTPCLLCSRLDHVLGKEKVGYYW-DLM  81

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C++HK +ISSL  CH H K+ D+  MCE+CL SFA
Sbjct  82   CKNHKSEISSLVLCHAHNKLVDVHKMCESCLFSFA  116


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K + ++  EL+EERNASA+A N AMAMITRLQ EKA+  M+A QY R
Sbjct  606   MVDRLKRQVEHDKKLMNALYRELEEERNASAVATNQAMAMITRLQEEKAALQMEALQYLR  665

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD +E Q   D++ ++E+EI+ LE++L+ YR KF
Sbjct  666   MMEEQAEYDDDELQKSNDLLSEKEKEIQDLEAELEYYRKKF  706



>ref|XP_011087390.1| PREDICTED: uncharacterized protein LOC105168894 [Sesamum indicum]
 ref|XP_011087391.1| PREDICTED: uncharacterized protein LOC105168894 [Sesamum indicum]
Length=891

 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
            A  L+ +VLE+++I LL +D   ++    FA++ +L++PC  C+R+D  L      FY+ 
Sbjct  20   ASLLVSAVLEWMLIFLLFIDANFSYLVTRFARYCQLQIPCLLCSRLDHVLGSERSGFYW-  78

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            D IC  HK  ISSL  C +H  + D+   CE+CL SFA
Sbjct  79   DLICHRHKLKISSLVLCKLHDNLVDVHGTCESCLFSFA  116


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 107/173 (62%), Gaps = 16/173 (9%)
 Frame = +3

Query  873   NNKFVGIPLSD-SPRMSTKKTRTMSIDYS------------ALSRSDPNNYDLVTTTGFN  1013
             +++ + +PL+D SPR+S       ++D S            +L R+D       +T    
Sbjct  485   SSRGIEVPLNDMSPRVSANSEDFKAMDASIATGIQIIQRRISLERNDSTLSLDGSTISEI  544

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG     +   L+RQV  ++K + ++  EL+EERNASAIAAN +MAMITRLQ EKA+ HM
Sbjct  545   EGES---VEDRLRRQVEHDKKIMSTLYKELEEERNASAIAANQSMAMITRLQEEKAALHM  601

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINL  1352
             +A Q  RMM+EQAE+D E  Q   D++  +E++I+ LE +L++Y+++FG I+L
Sbjct  602   EALQCLRMMDEQAEHDDEALQQANDLLTDKEKQIQDLEYELELYKNQFGDISL  654



>ref|XP_007030504.1| Intracellular protein transport protein USO1, putative [Theobroma 
cacao]
 gb|EOY11006.1| Intracellular protein transport protein USO1, putative [Theobroma 
cacao]
Length=846

 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query  279  LEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHK  458
            LE+++I +L +D  +++   +FA   +L+ PC  C+R+D  L      FY+ D +C  HK
Sbjct  65   LEWLLIFMLFIDAIVSYLITKFAHKCKLQTPCLLCSRLDHVLGKEKQKFYW-DLVCGDHK  123

Query  459  RDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             +ISSL YCH H K+ D+  MCE+CL SFA
Sbjct  124  LEISSLVYCHSHNKLVDVHGMCESCLFSFA  153


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  +RK L ++  EL+EERNAS IA N AMAMITRLQ EKA+ HM+A Q  R
Sbjct  671   LVDRLKRQVEHDRKLLNALYKELEEERNASTIAVNQAMAMITRLQEEKATLHMEALQSLR  730

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  Q   D++ ++++EI+ +E++L+ YR KF
Sbjct  731   MMEEQAEYDMEALQKTNDLLAEKDKEIQYIEAELEFYRMKF  771



>ref|XP_009397014.1| PREDICTED: uncharacterized protein LOC103981960 [Musa acuminata 
subsp. malaccensis]
Length=890

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +3

Query  252  SALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYY  431
            SAL L  ++LE+++++LLL D + ++   +F++  +L+ PC FC+R+D       L+FY 
Sbjct  15   SALSL--AILEWILMLLLLFDAWFSYMVTKFSRICKLQTPCIFCSRLDHIFGSEKLDFYL  72

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAP  551
             D ICE+H+ +ISSL+ CH H K++D+ TMC+ CLLS  P
Sbjct  73   -DLICETHRSEISSLALCHAHGKLADVHTMCKACLLSLKP  111


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +3

Query  1041  QHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMM  1220
             + LKRQV L+RKS+  +  EL+EER+ASAIAAN AMAMITRLQ EKA+  M+A  YQRMM
Sbjct  541   ERLKRQVELDRKSINLLYKELEEERSASAIAANQAMAMITRLQEEKAAMQMEALHYQRMM  600

Query  1221  EEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFHS  1400
             EEQAEYD E  Q   +++ +RE+E++ LE+++++YR  F    L+  +  E+ G+  FH 
Sbjct  601   EEQAEYDHEALQKCNELLTQREKEMQDLEAEMEIYRKSFTD-KLSNDQAVELNGN--FHD  657

Query  1401  LKFQS  1415
              + +S
Sbjct  658   KELES  662



>ref|XP_006469212.1| PREDICTED: myosin-2 heavy chain, non muscle-like [Citrus sinensis]
Length=1037

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y+ LE+++I  LL++   ++   ++A++F LK PC +C R+D 
Sbjct  6    FATMLHRNTNKITLILVYAFLEWILIFFLLLNSLFSYLIIKYAEYFGLKKPCLWCCRLDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +  +     Y D +C++H ++IS L +C  H+K+S+ + MCE+C
Sbjct  66   LIDSKKNKKSYRDLVCDAHAKEISKLGFCPNHQKLSESQDMCEDC  110


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             + +  A  +  LK  +  +RK+L  +  EL+EER+ASAIAAN  MAMI RLQ EKA+  M
Sbjct  668   DADDGALTVDKLKSALKAQRKALNVLYAELEEERSASAIAANQTMAMINRLQEEKAAMQM  727

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMM+EQ+EYD+E  Q+L ++++KRE+E   +E +L++YR K 
Sbjct  728   EALQYQRMMDEQSEYDQEALQLLNEIMVKREKEKAEVEKELEIYRKKV  775



>ref|XP_008388693.1| PREDICTED: LOW QUALITY PROTEIN: probable GPI-anchored adhesin-like 
protein PGA55 [Malus domestica]
Length=878

 Score = 91.3 bits (225),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+Y+  E+++I +L VD   ++   +FA +  L+ PC  C+RID  L      +Y+ D  
Sbjct  22   LVYAFFEWLLIFVLFVDAIFSYIITKFAYYCGLRAPCLLCSRIDHVLGKEKRGYYW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRAHNKLVDVHGMCESCLFSFA  115


 Score = 85.1 bits (209),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  ++K + ++  EL+EERNASAIA++ AMAMITRLQ EKA+ HM+A Q  RM+EE
Sbjct  547   LKRQVEHDKKIMSALYKELEEERNASAIASDQAMAMITRLQEEKAALHMEALQQLRMIEE  606

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGD  1385
             QAEYD E  Q  +D+++++E+EI+ LE +L++YR+K+ P     +   E  GD
Sbjct  607   QAEYDNEALQKTEDLLVEKEKEIQDLEXELELYRNKY-PNESMLANIAETTGD  658



>gb|KDO64582.1| hypothetical protein CISIN_1g001651mg [Citrus sinensis]
 gb|KDO64583.1| hypothetical protein CISIN_1g001651mg [Citrus sinensis]
 gb|KDO64584.1| hypothetical protein CISIN_1g001651mg [Citrus sinensis]
Length=1037

 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y+ LE+++I  LL++   ++   ++A++F LK PC +C R+D 
Sbjct  6    FATMLHRNTNKITLILVYAFLEWILIFFLLLNSLFSYLIIKYAEYFGLKKPCLWCCRLDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +  +     Y D +C++H ++IS L +C  H+K+S+ + MCE+C
Sbjct  66   LIDSKKNKKSYRDLVCDAHAKEISKLGFCPNHQKLSESQDMCEDC  110


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             + +  A  +  LK  +  +RK+L  +  EL+EER+ASAIAAN  MAMI RLQ EKA+  M
Sbjct  668   DADDGALTVDKLKSALKAQRKALNVLYAELEEERSASAIAANQTMAMINRLQEEKAAMQM  727

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMM+EQ+EYD+E  Q+L ++++KRE+E   +E +L++YR K 
Sbjct  728   EALQYQRMMDEQSEYDQEALQLLNEIMVKREKEKAEVEKELEIYRKKV  775



>ref|XP_009364471.1| PREDICTED: uncharacterized protein LOC103954380 [Pyrus x bretschneideri]
Length=880

 Score = 90.9 bits (224),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+Y+  E+++I +L VD   ++   +FA +  L+ PC  C+RID  L    L +++ D  
Sbjct  22   LVYAFFEWLLIFVLFVDAIFSYIITKFAYYCGLQAPCLLCSRIDHVLGKEKLGYHW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRSHNKLVDVHGMCESCLFSFA  115


 Score = 85.1 bits (209),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             I   LKRQV  ++K + ++  EL+EERNASAIA++ AMAMITRLQ EKA+ HM+A Q  R
Sbjct  545   IADRLKRQVEHDKKIMSALYKELEEERNASAIASDQAMAMITRLQEEKAALHMEALQQLR  604

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGD  1385
             M+EEQAEYD E  Q  +D+++++E+EI+ LE++L++YR K+ P     +   E  GD
Sbjct  605   MIEEQAEYDNEALQKTEDLLVEKEKEIQDLEAELELYRIKY-PNESMLANLAETTGD  660



>ref|XP_004302068.1| PREDICTED: uncharacterized protein LOC101309555 [Fragaria vesca 
subsp. vesca]
Length=901

 Score = 90.9 bits (224),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
            A  L+ + LE+++I +L++D   ++   +FA +  L+ PC  C+R+D    +     YY 
Sbjct  17   AQALVSASLEWLLIFMLVIDAIFSYVITKFAHYCGLQTPCLMCSRLDHVFGNEKPG-YYR  75

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            D IC SHK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  76   DLICGSHKSEISSLVLCRAHNKLVDVNGMCESCLFSFA  113


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K L S+  EL+EER+ASAIA++ AMAMITRLQ EKA+ HM+A Q  R
Sbjct  576   VLDRLKRQVEYDKKILASLYKELEEERSASAIASDQAMAMITRLQEEKAALHMEALQCVR  635

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E    + D++ ++E+E++ LE++L+ YR K+
Sbjct  636   MMEEQAEYDNEALSKIDDLLAEKEKEVQDLEAELEFYRIKY  676



>ref|XP_006383693.1| hypothetical protein POPTR_0005s24190g [Populus trichocarpa]
 gb|ERP61490.1| hypothetical protein POPTR_0005s24190g [Populus trichocarpa]
Length=873

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +3

Query  231  IEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH  410
            +++NL R    L  +V E+ +I LLL+D  L++   +FA +  L++PC FC+R+D  L +
Sbjct  11   VQRNLQRFMTVLQSAVSEWFLIFLLLIDAALSYLLTKFASYCRLQIPCMFCSRLDHFLGN  70

Query  411  RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLL  539
                F Y   IC +H+ +IS+L  CH+H K++D   MCE CLL
Sbjct  71   EKPGF-YKKVICSNHRSEISTLISCHIHGKLADGYGMCEECLL  112


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 3/172 (2%)
 Frame = +3

Query  873   NNKFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLK  1052
             +N   GI   D         R+  +       +  +  + +  + F E  G +  I  LK
Sbjct  476   HNAITGIEGHDDELQMNNAVRSNGVQMLKTESTGSSGLESLDGSFFTEIEGES-TIDRLK  534

Query  1053  RQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQA  1232
             RQV  +R+ + ++  EL+EER+ASAI+AN AMAMITRLQ EKA+ HM+A QY RMMEEQA
Sbjct  535   RQVESDRRHISALYKELEEERSASAISANQAMAMITRLQEEKAALHMEALQYLRMMEEQA  594

Query  1233  EYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDD  1388
             EYD E  +   D++ ++E+EI+ LE+++D  +      N + +E   +E DD
Sbjct  595   EYDVEALEKANDLLAEKEKEIQDLEAEIDSLQLNLS--NESTAETIHVESDD  644



>ref|XP_006448212.1| hypothetical protein CICLE_v10014119mg [Citrus clementina]
 ref|XP_006448213.1| hypothetical protein CICLE_v10014119mg [Citrus clementina]
 gb|ESR61452.1| hypothetical protein CICLE_v10014119mg [Citrus clementina]
 gb|ESR61453.1| hypothetical protein CICLE_v10014119mg [Citrus clementina]
Length=1037

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y+ LE+++I  LL++   ++   ++A++F LK PC +C R+D 
Sbjct  6    FATMLHRNTNKITLILVYAFLEWILIFSLLLNSLFSYLIIKYAEYFGLKKPCLWCCRLDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +  +     Y D +C++H ++IS L +C  H+K+S+ + MCE+C
Sbjct  66   LIDSKKNKKSYRDLVCDAHAKEISKLGFCPNHQKLSESQDMCEDC  110


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             + +  A  +  LK  +  +RK+L  +  EL+EER+ASAIAAN  MAMI RLQ EKA+  M
Sbjct  668   DADDGALTVDKLKSALKAQRKALNVLYAELEEERSASAIAANQTMAMINRLQEEKAAMQM  727

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMM+EQ+EYD+E  Q+L ++++KRE+E   +E +L++YR K 
Sbjct  728   EALQYQRMMDEQSEYDQEALQLLNEIMVKREKEKAEVEKELEIYRKKV  775



>gb|KDO68502.1| hypothetical protein CISIN_1g002931mg [Citrus sinensis]
Length=863

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+ +I LLL+D   +F   +FA + EL++PC  C+R+D  L +    FY N  +C SH+ 
Sbjct  28   EWFLIFLLLIDAVFSFLVTKFAHYCELQIPCILCSRLDHVLGNEKPEFYRN-LLCSSHRS  86

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSFA  548
            +ISSL  CH+H K++    MC++CLLSF+
Sbjct  87   EISSLISCHIHGKLAAAHGMCDDCLLSFS  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  +R+ + ++  ELDEER+A+A+AAN AMAMITRLQ EK++ HM A QY RM
Sbjct  523   IDRLKRQVEYDRRCMNALYKELDEERSAAAVAANEAMAMITRLQEEKSALHMDALQYLRM  582

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD EE +   D+I ++E++I+ LE +L+ YR K
Sbjct  583   MEEQAEYDMEELEKANDLIAEKEKQIQDLEEELEYYRLK  621



>ref|XP_006443890.1| hypothetical protein CICLE_v10018827mg [Citrus clementina]
 ref|XP_006479570.1| PREDICTED: uncharacterized protein LOC102624412 isoform X1 [Citrus 
sinensis]
 ref|XP_006479571.1| PREDICTED: uncharacterized protein LOC102624412 isoform X2 [Citrus 
sinensis]
 gb|ESR57130.1| hypothetical protein CICLE_v10018827mg [Citrus clementina]
Length=862

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+ +I LLL+D   +F   +FA + EL++PC  C+R+D  L +    FY N  +C SH+ 
Sbjct  28   EWFLIFLLLIDAVFSFLVTKFAHYCELQIPCILCSRLDHVLGNEKPEFYRN-LLCSSHRS  86

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSFA  548
            +ISSL  CH+H K++    MC++CLLSF+
Sbjct  87   EISSLISCHIHGKLAAAHGMCDDCLLSFS  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  +R+ + ++  ELDEER+A+A+AAN AMAMITRLQ EK++ HM A QY RM
Sbjct  522   IDRLKRQVEYDRRCMNALYKELDEERSAAAVAANEAMAMITRLQEEKSALHMDALQYLRM  581

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD EE +   D+I ++E++I+ LE +L+ YR K
Sbjct  582   MEEQAEYDMEELEKANDLIAEKEKQIQDLEEELEYYRLK  620



>ref|XP_002531180.1| hypothetical protein RCOM_0012650 [Ricinus communis]
 gb|EEF31195.1| hypothetical protein RCOM_0012650 [Ricinus communis]
Length=520

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +++N  +  + L+Y+VLE+++I+LLL++ F A+   +FA +F LK PC +C+R+D 
Sbjct  6    FATMLQRNTHKLTVILVYAVLEWILIILLLLNSFFAYLITKFANYFGLKPPCLWCSRVDH  65

Query  399  ALV--HRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             L   + N N  Y D +CE+H  +IS L YC  H+++++ + MC +CL S
Sbjct  66   VLEPGNSNTNNSYRDLVCETHATEISKLGYCSNHRRLAETQNMCNDCLAS  115



>gb|KDO68503.1| hypothetical protein CISIN_1g002931mg [Citrus sinensis]
Length=864

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+ +I LLL+D   +F   +FA + EL++PC  C+R+D  L +    FY N  +C SH+ 
Sbjct  28   EWFLIFLLLIDAVFSFLVTKFAHYCELQIPCILCSRLDHVLGNEKPEFYRN-LLCSSHRS  86

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSFA  548
            +ISSL  CH+H K++    MC++CLLSF+
Sbjct  87   EISSLISCHIHGKLAAAHGMCDDCLLSFS  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  +R+ + ++  ELDEER+A+A+AAN AMAMITRLQ EK++ HM A QY RM
Sbjct  524   IDRLKRQVEYDRRCMNALYKELDEERSAAAVAANEAMAMITRLQEEKSALHMDALQYLRM  583

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD EE +   D+I ++E++I+ LE +L+ YR K
Sbjct  584   MEEQAEYDMEELEKANDLIAEKEKQIQDLEEELEYYRLK  622



>emb|CDP03712.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 87/187 (47%), Gaps = 29/187 (16%)
 Frame = +3

Query  237  QNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRN  416
            +N  R    L  +  E+ +I +L VD  L++   +FA +  L+ PC  C+RI+  +   N
Sbjct  12   RNHRRFMTLLTSAACEWFLIFMLFVDATLSYLLTKFAHYCNLQTPCLLCSRIEH-VFGIN  70

Query  417  LNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkS  596
             + YY   +C +H+ +ISSL YCH H K++D+ T CE+CL+S A    S+       V  
Sbjct  71   KHGYYRSLLCCNHREEISSLVYCHNHCKLADVDTTCEDCLMSLARRSKSNSESCRFLVAK  130

Query  597  VNVFADKPNFQR----------------CSCCMEFLGGKGKYTRSMSQVAP---------  701
            + V  D+   +                 CSCC + L  K    R + +VAP         
Sbjct  131  LGVDTDESGLKSLLLNKSVISDSSGPRTCSCCNKILRVKSNAQR-LLEVAPVGYGASKAN  189

Query  702  --PPSPR  716
              PP PR
Sbjct  190  VKPPLPR  196


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 97/140 (69%), Gaps = 5/140 (4%)
 Frame = +3

Query  954   SALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaia  1133
             +AL R D ++++ +      E  G   +++ LKRQ   +R+ + ++  EL+EERNA+AIA
Sbjct  520   AALERHD-SDHESLDGISVKEIEGET-LLERLKRQGDYDRRCMKAMFKELEEERNAAAIA  577

Query  1134  annamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESD  1313
             AN AMAMITRLQ EKA+ HM+A QY RMMEEQAEYD E  +   D++ +RE+E++ LE++
Sbjct  578   ANQAMAMITRLQEEKAALHMEALQYLRMMEEQAEYDMEALEKANDLLAEREKEVQDLEAE  637

Query  1314  LDVYRDKF--GP-INLACSE  1364
             +++YR+    GP I+  C+E
Sbjct  638   VEIYRNNILEGPEIDYHCNE  657



>ref|XP_010932511.1| PREDICTED: uncharacterized protein LOC105053151 [Elaeis guineensis]
Length=906

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQ+ L+RKS+  +  EL+EERNASAIAAN AMAMITRLQ EKA+  M+A QYQRM
Sbjct  546   VDRLKRQIELDRKSISLLYKELEEERNASAIAANQAMAMITRLQEEKAAMQMEALQYQRM  605

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLA  1355
             MEEQAEYD+E  Q   +++ +RE+EI+ LE + ++Y+ +F   +LA
Sbjct  606   MEEQAEYDQEALQKSNEVLAQREKEIQDLEEEFEIYKKRFRDGSLA  651


 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  324  AFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKI  503
            ++   +FA+  +L+ PC  C+R+D  L +   +FY+ D IC++HK +ISSL++CHVH+K+
Sbjct  39   SYLVTKFARLCKLQTPCLLCSRLDHILGNEKPDFYW-DLICKAHKSEISSLAFCHVHQKL  97

Query  504  SDIKTMCENCLLSFA  548
            +++  MCE CLL+ A
Sbjct  98   ANLHDMCEGCLLTSA  112



>ref|XP_004172706.1| PREDICTED: uncharacterized protein LOC101230686 [Cucumis sativus]
 gb|KGN51484.1| hypothetical protein Csa_5G568820 [Cucumis sativus]
Length=995

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y++LE+V+I LLL+ G  ++   +FA++F LK PC +C+R+D 
Sbjct  6    FATILHRNSNKITLILVYALLEWVLIFLLLLHGLFSYLIVKFAEWFGLKRPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
                +     Y D +CE H  +IS+L YC  H+K+S+ + +CE+C  S      S     
Sbjct  66   VFEPQRKQ-SYRDLLCEGHAMEISNLGYCSNHRKLSEFRDLCEDCSSS------SKSNEF  118

Query  579  addvkSVNVFAD-KPNFQRCSCCMEFLGGK  665
                KS   F D K +F+ CSCC E L G+
Sbjct  119  YQISKSFPFFDDEKEDFRTCSCCGETLKGR  148


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG      ++ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMI RLQ EKAS  M
Sbjct  618   EGGDGVLTLEKLKSALRTERKALNALYAELEEERSASAIAANQTMAMINRLQEEKASMQM  677

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE ++++YR K 
Sbjct  678   EALQYQRMMEEQSEYDQEALQLLNELVVKREKEKQELEKEIEIYRKKL  725



>ref|XP_010232416.1| PREDICTED: uncharacterized protein LOC100821308 isoform X3 [Brachypodium 
distachyon]
Length=796

 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  L+RQ+ L+RKS+  +C EL+EERNA+AIAA+ A+AMITRLQ EKA+  M+AS YQRM
Sbjct  537   IDRLRRQIDLDRKSIHLLCRELEEERNAAAIAASQALAMITRLQDEKAAMQMEASHYQRM  596

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             M+EQAEYD +      +++ +RE+++E LE++L+ YR KFG
Sbjct  597   MDEQAEYDSQALVEANELLAQREQQVEELEAELENYRTKFG  637


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R  + L  + LE+++++LL +D   +F   +FA+  +L +PC FC+R+D  L +    FY
Sbjct  10   RLPVALSSAFLEWILMLLLFIDAVYSFLVTKFARLCKLPVPCPFCSRLDHVLGNEEPCFY  69

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
              + IC++HK +ISSL++C +H+K++ +++MCE C
Sbjct  70   -RELICKTHKSEISSLAFCRLHQKLAGVESMCEGC  103



>ref|XP_004150123.1| PREDICTED: uncharacterized protein LOC101220314 [Cucumis sativus]
Length=977

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y++LE+V+I LLL+ G  ++   +FA++F LK PC +C+R+D 
Sbjct  6    FATILHRNSNKITLILVYALLEWVLIFLLLLHGLFSYLIVKFAEWFGLKRPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
                +     Y D +CE H  +IS+L YC  H+K+S+ + +CE+C  S      S     
Sbjct  66   VFEPQRKQ-SYRDLLCEGHAMEISNLGYCSNHRKLSEFRDLCEDCSSS------SKSNEF  118

Query  579  addvkSVNVFAD-KPNFQRCSCCMEFLGGK  665
                KS   F D K +F+ CSCC E L G+
Sbjct  119  YQISKSFPFFDDEKEDFRTCSCCGETLKGR  148


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG      ++ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMI RLQ EKAS  M
Sbjct  600   EGGDGVLTLEKLKSALRTERKALNALYAELEEERSASAIAANQTMAMINRLQEEKASMQM  659

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE ++++YR K 
Sbjct  660   EALQYQRMMEEQSEYDQEALQLLNELVVKREKEKQELEKEIEIYRKKL  707



>ref|XP_003569935.1| PREDICTED: uncharacterized protein LOC100821308 isoform X2 [Brachypodium 
distachyon]
Length=852

 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  L+RQ+ L+RKS+  +C EL+EERNA+AIAA+ A+AMITRLQ EKA+  M+AS YQRM
Sbjct  593   IDRLRRQIDLDRKSIHLLCRELEEERNAAAIAASQALAMITRLQDEKAAMQMEASHYQRM  652

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             M+EQAEYD +      +++ +RE+++E LE++L+ YR KFG
Sbjct  653   MDEQAEYDSQALVEANELLAQREQQVEELEAELENYRTKFG  693


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R  + L  + LE+++++LL +D   +F   +FA+  +L +PC FC+R+D  L +    FY
Sbjct  10   RLPVALSSAFLEWILMLLLFIDAVYSFLVTKFARLCKLPVPCPFCSRLDHVLGNEEPCFY  69

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
              + IC++HK +ISSL++C +H+K++ +++MCE C
Sbjct  70   -RELICKTHKSEISSLAFCRLHQKLAGVESMCEGC  103



>ref|XP_010232415.1| PREDICTED: uncharacterized protein LOC100821308 isoform X1 [Brachypodium 
distachyon]
Length=902

 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  L+RQ+ L+RKS+  +C EL+EERNA+AIAA+ A+AMITRLQ EKA+  M+AS YQRM
Sbjct  643   IDRLRRQIDLDRKSIHLLCRELEEERNAAAIAASQALAMITRLQDEKAAMQMEASHYQRM  702

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             M+EQAEYD +      +++ +RE+++E LE++L+ YR KFG
Sbjct  703   MDEQAEYDSQALVEANELLAQREQQVEELEAELENYRTKFG  743


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R  + L  + LE+++++LL +D   +F   +FA+  +L +PC FC+R+D  L +    FY
Sbjct  10   RLPVALSSAFLEWILMLLLFIDAVYSFLVTKFARLCKLPVPCPFCSRLDHVLGNEEPCFY  69

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
              + IC++HK +ISSL++C +H+K++ +++MCE C
Sbjct  70   -RELICKTHKSEISSLAFCRLHQKLAGVESMCEGC  103



>gb|KHG12682.1| Golgin subfamily A member 5 [Gossypium arboreum]
Length=802

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R +  L  +  E++++ +L +D  +++   +FA   EL+ PC  C+R+D         FY
Sbjct  17   RFSTALSSAFFEWLLLFMLFIDAIVSYLIKKFAHKCELRTPCMLCSRLDHVFGKEKQKFY  76

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
              D +C  HK +ISSL YCH H K+ D+  MCE+CL SFA
Sbjct  77   I-DLVCNDHKLEISSLVYCHAHNKLVDVHGMCESCLFSFA  115


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  1032  GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQ  1211
              ++  LKRQV  +RK L  +  EL+EERNASA+A N AMAMITRLQ EKA+  M+A Q+ 
Sbjct  617   SVVDRLKRQVEHDRKLLSVLYKELEEERNASAVATNQAMAMITRLQEEKATLQMEALQHL  676

Query  1212  RMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             RMMEEQAEYD E  Q   D++ ++E+EI+ LE++L+ YR KF
Sbjct  677   RMMEEQAEYDMEALQNTNDLLAEKEKEIQDLEAELEFYRMKF  718



>ref|XP_009408477.1| PREDICTED: uncharacterized protein LOC103990908 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=954

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             ++ LKRQV L+RKS+  +  EL+EER+ASAIAAN AMAMITRLQ EKA+ HM+A QYQRM
Sbjct  606   VERLKRQVELDRKSISLLFKELEEERSASAIAANQAMAMITRLQEEKAAMHMEALQYQRM  665

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFH  1397
             MEEQAEYD E  Q    ++ +RE+ I+ LE++++  R  F       S    +E  D FH
Sbjct  666   MEEQAEYDHEALQKCNKLLTQREKMIQGLEAEVESLRICFVE---GLSTDNSVEQSDNFH  722

Query  1398  SLKFQSLSSFGE  1433
               +  S +  GE
Sbjct  723   DKEIASWNKSGE  734


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+++++LL  D    +    F++   L+ PC FC+R+D    +   +FY  D ICE+H+ 
Sbjct  29   EWMLMLLLFFDALFVYLVTRFSRLCMLQKPCMFCSRLDHVFGNEKRSFYL-DLICETHRS  87

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSF  545
            +IS L   + H+K++D+ T+C+ C  SF
Sbjct  88   EISLLGCSNGHEKLADVHTVCQGCFRSF  115



>ref|XP_009408476.1| PREDICTED: uncharacterized protein LOC103990908 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1008

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             ++ LKRQV L+RKS+  +  EL+EER+ASAIAAN AMAMITRLQ EKA+ HM+A QYQRM
Sbjct  660   VERLKRQVELDRKSISLLFKELEEERSASAIAANQAMAMITRLQEEKAAMHMEALQYQRM  719

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGDDEFH  1397
             MEEQAEYD E  Q    ++ +RE+ I+ LE++++  R  F       S    +E  D FH
Sbjct  720   MEEQAEYDHEALQKCNKLLTQREKMIQGLEAEVESLRICFVE---GLSTDNSVEQSDNFH  776

Query  1398  SLKFQSLSSFGE  1433
               +  S +  GE
Sbjct  777   DKEIASWNKSGE  788


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+++++LL  D    +    F++   L+ PC FC+R+D    +   +FY  D ICE+H+ 
Sbjct  29   EWMLMLLLFFDALFVYLVTRFSRLCMLQKPCMFCSRLDHVFGNEKRSFYL-DLICETHRS  87

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSF  545
            +IS L   + H+K++D+ T+C+ C  SF
Sbjct  88   EISLLGCSNGHEKLADVHTVCQGCFRSF  115



>ref|XP_009391340.1| PREDICTED: uncharacterized protein LOC103977516 [Musa acuminata 
subsp. malaccensis]
Length=787

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +V E+ +I+ LL++  LA+ +  FA+   L  PC  C+R+D  L      FY N  
Sbjct  19   VLSAAVCEWYLIIFLLINAVLAYVATRFARLCNLPTPCLLCSRLDHILGSERRGFYRN-L  77

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             C +HK +ISSL YCH H K++D + MC+ CLLS
Sbjct  78   FCHAHKVEISSLVYCHGHGKLADFRDMCKACLLS  111


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQ+ L+RK + ++  EL+EER+AS IAAN AMAMI RLQ EKA+  M+A QY RM
Sbjct  463   VDRLKRQIELDRKCMSALYKELEEERSASTIAANEAMAMINRLQEEKAAMQMEAFQYLRM  522

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E    L D+I +R++E+  LE++ + YR +
Sbjct  523   MEEQAEYDQEAIHKLNDVINERDKELLDLETEFERYRRR  561



>ref|XP_007141904.1| hypothetical protein PHAVU_008G235700g [Phaseolus vulgaris]
 gb|ESW13898.1| hypothetical protein PHAVU_008G235700g [Phaseolus vulgaris]
Length=1055

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (53%), Gaps = 17/169 (10%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + L+Y+VLE+V+I LLL++   ++   +FAK+  L+ PC +C+R+D 
Sbjct  6    FATMLHRNTNKMVVILVYAVLEWVLIALLLLNSLFSYLITKFAKWVGLQPPCVWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L   N    + D +CE+H  +IS L YC  H+++++  +MCE+CL S  P+   + +  
Sbjct  66   VLQQENDAHVHKDLVCEAHAAEISKLGYCSNHQRLAETHSMCEDCLAS-RPNHHENSFGM  124

Query  579  addvkSVNVFADKPN-------FQRCSCCMEFLGGKGKYTRSMSQVAPP  704
               +  ++  +            +RCSCC E L          SQ+ PP
Sbjct  125  RHRIAFISWVSSHGKHESGDSLIRRCSCCNESLS---------SQLYPP  164


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             E       I  LK  +  ER +L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M
Sbjct  677   ESGDPVSTIDRLKTVIKSERMALTAIYQELEEERSASAIAANQTMAMITRLQEEKAAMQM  736

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+ YR K 
Sbjct  737   EALQYQRMMEEQSEYDQEALQLLNELMMKREKEKQGLEKELEEYRQKV  784



>ref|XP_008370719.1| PREDICTED: uncharacterized protein LOC103434185 isoform X1 [Malus 
domestica]
Length=876

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L++++ E+++I +L V    ++   +FA +  L+ PC  C+RID  L    L +Y+ D  
Sbjct  22   LVHALFEWLLISMLFVYAIFSYVITKFAYYCGLQAPCLLCSRIDDVLGKEKLGYYW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRTHNKLVDVHGMCESCLFSFA  115


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K + ++  EL+EERNAS+IA++ AMAMITRLQ EKA+  M+A Q  R
Sbjct  547   MVDRLKRQVEHDKKIMSALYKELEEERNASSIASDQAMAMITRLQEEKAALRMEALQQLR  606

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGD  1385
             MMEEQAEYD E  Q   D+++++E+E++ LE++L+ YR+K+ P         E  GD
Sbjct  607   MMEEQAEYDNEALQKTDDLLVEKEKEVQDLEAELEFYRNKY-PNESMLDNLAETTGD  662



>ref|XP_008370720.1| PREDICTED: uncharacterized protein LOC103434185 isoform X2 [Malus 
domestica]
Length=845

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L++++ E+++I +L V    ++   +FA +  L+ PC  C+RID  L    L +Y+ D  
Sbjct  22   LVHALFEWLLISMLFVYAIFSYVITKFAYYCGLQAPCLLCSRIDDVLGKEKLGYYW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRTHNKLVDVHGMCESCLFSFA  115


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  ++K + ++  EL+EERNAS+IA++ AMAMITRLQ EKA+  M+A Q  R
Sbjct  516   MVDRLKRQVEHDKKIMSALYKELEEERNASSIASDQAMAMITRLQEEKAALRMEALQQLR  575

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEGD  1385
             MMEEQAEYD E  Q   D+++++E+E++ LE++L+ YR+K+ P         E  GD
Sbjct  576   MMEEQAEYDNEALQKTDDLLVEKEKEVQDLEAELEFYRNKY-PNESMLDNLAETTGD  631



>ref|XP_011026020.1| PREDICTED: uncharacterized protein LOC105126756 isoform X1 [Populus 
euphratica]
 ref|XP_011026021.1| PREDICTED: uncharacterized protein LOC105126756 isoform X1 [Populus 
euphratica]
 ref|XP_011026022.1| PREDICTED: uncharacterized protein LOC105126756 isoform X1 [Populus 
euphratica]
Length=876

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +3

Query  231  IEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH  410
            +++NL R    L  +  E+ +I LLL+D  L++   +FA +  L++PC FC+R+   L +
Sbjct  14   VQRNLQRFMTVLQSAASEWFLIFLLLIDAALSYLLTKFASYCRLQIPCMFCSRLGHFLGN  73

Query  411  RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLL  539
                FY N  IC +H+ +IS+L  CH+H K++D   MCE CLL
Sbjct  74   EKPGFYKN-VICSNHRSEISTLISCHIHGKLADGYGMCEECLL  115


 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
             F E  G + II  LKRQV  +R+ + ++  EL+EER+ASAI+AN AMAMITRLQ EKA+ 
Sbjct  524   FTEIEGES-IIDRLKRQVESDRRHISALYKELEEERSASAISANQAMAMITRLQEEKAAL  582

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEF  1367
             HM+A QY RMMEEQAEYD E  +   D++ ++E+EI+ LE+++D  +      N + +E 
Sbjct  583   HMEALQYLRMMEEQAEYDVEALEKANDLLAEKEKEIQDLEAEIDSLQLNLS--NESTAET  640

Query  1368  FEIEGDD  1388
               +E DD
Sbjct  641   IHVESDD  647



>ref|XP_011026023.1| PREDICTED: uncharacterized protein LOC105126756 isoform X2 [Populus 
euphratica]
Length=875

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +3

Query  231  IEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH  410
            +++NL R    L  +  E+ +I LLL+D  L++   +FA +  L++PC FC+R+   L +
Sbjct  14   VQRNLQRFMTVLQSAASEWFLIFLLLIDAALSYLLTKFASYCRLQIPCMFCSRLGHFLGN  73

Query  411  RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLL  539
                FY N  IC +H+ +IS+L  CH+H K++D   MCE CLL
Sbjct  74   EKPGFYKN-VICSNHRSEISTLISCHIHGKLADGYGMCEECLL  115


 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
             F E  G + II  LKRQV  +R+ + ++  EL+EER+ASAI+AN AMAMITRLQ EKA+ 
Sbjct  523   FTEIEGES-IIDRLKRQVESDRRHISALYKELEEERSASAISANQAMAMITRLQEEKAAL  581

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEF  1367
             HM+A QY RMMEEQAEYD E  +   D++ ++E+EI+ LE+++D  +      N + +E 
Sbjct  582   HMEALQYLRMMEEQAEYDVEALEKANDLLAEKEKEIQDLEAEIDSLQLNLS--NESTAET  639

Query  1368  FEIEGDD  1388
               +E DD
Sbjct  640   IHVESDD  646



>ref|XP_007141905.1| hypothetical protein PHAVU_008G235700g [Phaseolus vulgaris]
 gb|ESW13899.1| hypothetical protein PHAVU_008G235700g [Phaseolus vulgaris]
Length=1060

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 89/169 (53%), Gaps = 17/169 (10%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  + L+Y+VLE+V+I LLL++   ++   +FAK+  L+ PC +C+R+D 
Sbjct  6    FATMLHRNTNKMVVILVYAVLEWVLIALLLLNSLFSYLITKFAKWVGLQPPCVWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L   N    + D +CE+H  +IS L YC  H+++++  +MCE+CL S  P+   + +  
Sbjct  66   VLQQENDAHVHKDLVCEAHAAEISKLGYCSNHQRLAETHSMCEDCLAS-RPNHHENSFGM  124

Query  579  addvkSVNVFADKPN-------FQRCSCCMEFLGGKGKYTRSMSQVAPP  704
               +  ++  +            +RCSCC E L          SQ+ PP
Sbjct  125  RHRIAFISWVSSHGKHESGDSLIRRCSCCNESLS---------SQLYPP  164


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             E       I  LK  +  ER +L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M
Sbjct  682   ESGDPVSTIDRLKTVIKSERMALTAIYQELEEERSASAIAANQTMAMITRLQEEKAAMQM  741

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE +L+ YR K 
Sbjct  742   EALQYQRMMEEQSEYDQEALQLLNELMMKREKEKQGLEKELEEYRQKV  789



>ref|XP_004972196.1| PREDICTED: uncharacterized protein LOC101782733 [Setaria italica]
Length=903

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  L+RQV L+RKS+  +C EL+EERNASAIAA+ A+AMIT+LQ EKA+  M+AS YQRM
Sbjct  611   IDRLRRQVDLDRKSIHLLCRELEEERNASAIAASQALAMITKLQDEKAAMQMEASHYQRM  670

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             MEEQAEYD +      +++ +RE++IE LE +L+ YR ++G
Sbjct  671   MEEQAEYDSDALAKANELLAEREQQIEELEVELENYRRQYG  711


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  306  LVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYC  485
             +D   +F    FA+F  L  PC FC+R+D  L +    FY  + IC++HK +ISSL++C
Sbjct  29   FIDAVYSFLVTRFARFCRLPAPCPFCSRLDHVLGNEKPCFY-RELICKTHKSEISSLAFC  87

Query  486  HVHKKISDIKTMCENC  533
            H+H+K++  +++CE C
Sbjct  88   HLHQKLASAQSLCEGC  103



>ref|XP_009372159.1| PREDICTED: uncharacterized protein LOC103961341 isoform X2 [Pyrus 
x bretschneideri]
Length=812

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L++++ E+++I +L V    ++   +FA +  L+ PC  C+RID  L    L +Y+ D  
Sbjct  22   LVHALFEWLLISMLFVYAIFSYVITKFAYYCGLQAPCLLCSRIDDVLGKEKLGYYW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRAHNKLVDVHGMCESCLFSFA  115


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 102/181 (56%), Gaps = 22/181 (12%)
 Frame = +3

Query  906   SPRMSTKKTRTMSIDYSA----LSRSDPNNY------DLVTTTGFNEGNGSA--------  1031
             SPR+S      MS   SA    L  SD +NY      +   +   NE   S         
Sbjct  430   SPRLSANSGSVMSPRLSANSGDLKASDTSNYFGMQIHNKRISLERNESGLSVDGSIVSEI  489

Query  1032  ---GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQAS  1202
                 ++  LKRQV  ++K + ++  EL+EERNAS+IA++ AMAMITRLQ +KA+  M+A 
Sbjct  490   EGESMVDRLKRQVEHDKKIMNALYKELEEERNASSIASDQAMAMITRLQEDKAALRMEAL  549

Query  1203  QYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEG  1382
             Q  RMMEEQAEYD E  Q   D+++++E+E++ LE++L+ YR+K+ P         E  G
Sbjct  550   QQLRMMEEQAEYDNEALQKTDDLLVEKEKEVQDLEAELEFYRNKY-PNESMLDNLAETTG  608

Query  1383  D  1385
             D
Sbjct  609   D  609



>gb|KHN31479.1| hypothetical protein glysoja_035586 [Glycine soja]
Length=864

 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 10/144 (7%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++I+ L +D   ++   +FA + +L++PC  C+R+D  L      +Y+ D I
Sbjct  23   LASAFLEWLLILFLFIDAVFSYVITKFAGYCKLQIPCLLCSRLDHVLGKEKGGYYW-DLI  81

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyy-----aaddvkSVNVF  608
            C  HK +ISSL  C  H K+ +++ MCE+CL SFA    S+              S   F
Sbjct  82   CSGHKTEISSLVLCCAHDKLVNVQGMCESCLFSFATINKSNAETYRLLVGKLGEGSETRF  141

Query  609  ADKP----NFQRCSCCMEFLGGKG  668
               P    N + CSCC E L  KG
Sbjct  142  DQDPLLGENSKCCSCCNEQLVLKG  165


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  +RK + ++  EL+EERNASA+AAN A+AMITRLQ EKA+ HM+A QY RM
Sbjct  529   VDRLKRQVDHDRKLMNALYKELEEERNASAVAANQALAMITRLQEEKATLHMEALQYLRM  588

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+E++EY+ E  Q   D+++++E+EIE LE+ L+ YR KF
Sbjct  589   MDEESEYETEALQKANDLLVEKEKEIEELEAKLEFYRKKF  628



>ref|XP_009372158.1| PREDICTED: uncharacterized protein LOC103961341 isoform X1 [Pyrus 
x bretschneideri]
Length=853

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L++++ E+++I +L V    ++   +FA +  L+ PC  C+RID  L    L +Y+ D  
Sbjct  22   LVHALFEWLLISMLFVYAIFSYVITKFAYYCGLQAPCLLCSRIDDVLGKEKLGYYW-DLF  80

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+  MCE+CL SFA
Sbjct  81   CGNHKSEISSLVLCRAHNKLVDVHGMCESCLFSFA  115


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 102/181 (56%), Gaps = 22/181 (12%)
 Frame = +3

Query  906   SPRMSTKKTRTMSIDYSA----LSRSDPNNY------DLVTTTGFNEGNGSA--------  1031
             SPR+S      MS   SA    L  SD +NY      +   +   NE   S         
Sbjct  471   SPRLSANSGSVMSPRLSANSGDLKASDTSNYFGMQIHNKRISLERNESGLSVDGSIVSEI  530

Query  1032  ---GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQAS  1202
                 ++  LKRQV  ++K + ++  EL+EERNAS+IA++ AMAMITRLQ +KA+  M+A 
Sbjct  531   EGESMVDRLKRQVEHDKKIMNALYKELEEERNASSIASDQAMAMITRLQEDKAALRMEAL  590

Query  1203  QYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSEFFEIEG  1382
             Q  RMMEEQAEYD E  Q   D+++++E+E++ LE++L+ YR+K+ P         E  G
Sbjct  591   QQLRMMEEQAEYDNEALQKTDDLLVEKEKEVQDLEAELEFYRNKY-PNESMLDNLAETTG  649

Query  1383  D  1385
             D
Sbjct  650   D  650



>ref|XP_004139387.1| PREDICTED: uncharacterized protein LOC101220667 [Cucumis sativus]
 ref|XP_004166523.1| PREDICTED: uncharacterized protein LOC101225941 [Cucumis sativus]
 gb|KGN60783.1| hypothetical protein Csa_2G010190 [Cucumis sativus]
Length=904

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+ +V E+++I +L VD   +FF  + A F++L  PC  C+R+D         + +N  I
Sbjct  18   LLSAVSEWLLICMLFVDSIFSFFITKCAHFWKLHTPCLLCSRLDHIFGSEKRGYVWN-LI  76

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C  HK ++SSL  CH H K+ ++  MCENCL SFA
Sbjct  77   CSKHKVELSSLVLCHAHNKLVNVHEMCENCLFSFA  111


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 95/155 (61%), Gaps = 12/155 (8%)
 Frame = +3

Query  906   SPRMSTKKTRTMSIDYSA------LSRS---DPNNYDLVTTTG--FNEGNGSAGIIQHLK  1052
             SPR+S       + DYS+      L R    + N   L +  G   +E +G   +   LK
Sbjct  523   SPRLSVNGDEVRNFDYSSAVGMQMLQRRISLERNESGLESLDGSIISEIDGE-NVADRLK  581

Query  1053  RQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQA  1232
             RQV  ++K + S+  EL+EERNASAIA N AMAMITRLQ EKA+ HM+A Q  RMMEEQ+
Sbjct  582   RQVEYDKKVMSSLYKELEEERNASAIATNQAMAMITRLQEEKANLHMEALQCLRMMEEQS  641

Query  1233  EYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             EYD +  Q   D+I ++++EI+ LE++L+ YR  F
Sbjct  642   EYDDDALQKANDLITEKDKEIQDLEAELEFYRINF  676



>ref|XP_006370993.1| hypothetical protein POPTR_0019s02440g [Populus trichocarpa]
 gb|ERP48790.1| hypothetical protein POPTR_0019s02440g [Populus trichocarpa]
Length=891

 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +3

Query  300  LLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKRDISSLS  479
            +L ++   ++   +FA  +EL+ PC  C+R+D  L  +NL +Y+ D IC +HK +ISSL 
Sbjct  34   MLFINAIFSYLITKFACQWELQTPCLLCSRLDHILGSKNLKYYW-DLICGNHKLEISSLV  92

Query  480  YCHVHKKISDIKTMCENCLLSFA  548
            +CH H  + ++  MCENCL SFA
Sbjct  93   FCHAHNNLVNVHGMCENCLFSFA  115


 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  ++K L ++  EL+EERNAS IA N AMAMITR+Q EKA+ HM+A Q  RM
Sbjct  605   IDRLKRQVEHDKKLLSALYKELEEERNASTIAVNQAMAMITRIQEEKATLHMEALQSLRM  664

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD E  Q   D++ ++E+E++ LE +L+ YR +
Sbjct  665   MEEQAEYDMEALQKTNDLLTEKEKEVQDLEEELEFYRKR  703



>ref|XP_010679046.1| PREDICTED: trichohyalin [Beta vulgaris subsp. vulgaris]
Length=1033

 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +   +    LIY++LE+ +I LLL++   ++F  +FA +F LK PCF C+R+D 
Sbjct  6    FSAMLHKRTNKITRVLIYAILEWTLIFLLLINSLFSYFILKFALYFGLKPPCFLCSRLDH  65

Query  399  AL----VHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             L      +     Y D ICE H  +IS + YC  H+K+ +++ MC +C
Sbjct  66   FLDSHKKEKQNKSPYTDIICEQHAAEISKIGYCSHHRKLVELQHMCNDC  114


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  1026  SAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQ  1205
             S   ++ LK  +L ERK+L ++  EL+EERNASAIAAN  MAMITRLQ EKA+  M+A Q
Sbjct  672   STETMEKLKVDLLSERKTLRALYKELEEERNASAIAANQTMAMITRLQEEKATMQMEALQ  731

Query  1206  YQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             YQRMMEEQ+EYD+E  Q++ ++++KRE+E + LE +L+ YR K
Sbjct  732   YQRMMEEQSEYDQEALQMMNELVIKREKEKQELEKELEAYRKK  774



>ref|XP_010458143.1| PREDICTED: uncharacterized protein LOC104739474 [Camelina sativa]
 ref|XP_010458144.1| PREDICTED: uncharacterized protein LOC104739474 [Camelina sativa]
Length=1069

 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 16/158 (10%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYYNDT  440
            L ++  E++++++L V+   ++    FA + EL+ PC  C+ +D  L   ++L   + D 
Sbjct  22   LAFAFNEWLLMLMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILGRTKHLKKPHWDM  81

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA  611
            IC  HK +ISSL YCH H K+ D++ MCE CL SFA    S+       V  +   + F 
Sbjct  82   ICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFATTNKSNAETYRLLVGKLGDNSYFG  141

Query  612  DK------PNFQR---CSCCMEFLGGKGKYTRSMSQVA  698
             K      PN  +   C+CC +  G +   T + +QVA
Sbjct  142  SKTDRSTNPNCSKLTDCTCCNQLWGTQ---TAAATQVA  176


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  849   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  908

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD+
Sbjct  909   QAEYDMEAIQRLNDLLVEREKVIQDLEAEIEYFRDQ  944



>ref|XP_010420374.1| PREDICTED: caldesmon-like [Camelina sativa]
Length=694

 Score = 87.8 bits (216),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = +3

Query  960   LSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaan  1139
             L+R++    + V  +  ++G G    I+ L+  +  E+++L  +  EL+EER+ASAI+AN
Sbjct  339   LARNEYAGDESVLVSEMDDG-GPLKTIERLRETMRAEQEALRDLYAELEEERSASAISAN  397

Query  1140  namamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLD  1319
               MAMITRLQ EKA   M+A QYQRMMEEQAEYD+E  Q+L  +++KRE+E E L+ +LD
Sbjct  398   QTMAMITRLQEEKAKVQMEALQYQRMMEEQAEYDQEALQLLNHLMVKREKEKEQLQRELD  457

Query  1320  VYRDK  1334
             VYR+K
Sbjct  458   VYREK  462


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++    +F   FA FF LK  C  C  +D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTYFIVRFASFFGLKQVCLLCPNLDR  65

Query  399  ALVHRNLN--FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             L   + N   YY + +CE+H  ++++LS+C  H K S+   +C +C
Sbjct  66   LLERNSANRFTYYREVLCENHVAELATLSFCRTHGKTSESANLCSDC  112



>ref|XP_008781005.1| PREDICTED: uncharacterized protein LOC103700876 isoform X2 [Phoenix 
dactylifera]
Length=902

 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ E+A+  M+A QYQRM
Sbjct  527   IDRLKSALKAERKALSALYAELEEERSASAIAANQTMAMITRLQGERAAMQMEALQYQRM  586

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  587   MEEQSEYDQEALQLLNELMMKREKEKQDLEKELEVYRKKV  626


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 78/142 (55%), Gaps = 4/142 (3%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L+Y++LE+++I LLL++G  ++   +FA FF LK PC FC+R+D 
Sbjct  6    FATMLHKNTNRMAVILVYTLLEWILIALLLLNGLFSYLIGKFADFFGLKAPCLFCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
                      Y+  +CE+H  ++S L YC  H+++++   MCE+CL +   + D +    
Sbjct  66   LFEPGRGRSAYDGLLCEAHAAEVSRLGYCSNHRRLAEASDMCEDCLSARPAEADQAVALL  125

Query  579  addvkSVNVFADKPNFQRCSCC  644
                +S     D     RCSCC
Sbjct  126  TWMKRSDEGEKD----LRCSCC  143



>ref|XP_008780997.1| PREDICTED: uncharacterized protein LOC103700876 isoform X1 [Phoenix 
dactylifera]
Length=906

 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ E+A+  M+A QYQRM
Sbjct  531   IDRLKSALKAERKALSALYAELEEERSASAIAANQTMAMITRLQGERAAMQMEALQYQRM  590

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  591   MEEQSEYDQEALQLLNELMMKREKEKQDLEKELEVYRKKV  630


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 78/142 (55%), Gaps = 4/142 (3%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L+Y++LE+++I LLL++G  ++   +FA FF LK PC FC+R+D 
Sbjct  6    FATMLHKNTNRMAVILVYTLLEWILIALLLLNGLFSYLIGKFADFFGLKAPCLFCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
                      Y+  +CE+H  ++S L YC  H+++++   MCE+CL +   + D +    
Sbjct  66   LFEPGRGRSAYDGLLCEAHAAEVSRLGYCSNHRRLAEASDMCEDCLSARPAEADQAVALL  125

Query  579  addvkSVNVFADKPNFQRCSCC  644
                +S     D     RCSCC
Sbjct  126  TWMKRSDEGEKD----LRCSCC  143



>ref|XP_006644792.1| PREDICTED: uncharacterized protein LOC102717474 [Oryza brachyantha]
Length=891

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ L+RQ+ L+RKS+  +C EL+EERNASAIAAN A+AMITRLQ EKA+  M+A  YQRM
Sbjct  614   IERLRRQIDLDRKSIQLLCKELEEERNASAIAANQALAMITRLQDEKAAMQMEALHYQRM  673

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYR  1328
             MEEQAEYD +      +++ +RE++IE LE++LD YR
Sbjct  674   MEEQAEYDSDALAKANELLAQREQQIEELEAELDNYR  710


 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 89/160 (56%), Gaps = 8/160 (5%)
 Frame = +3

Query  243  LGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLN  422
            L R +  L   +LE++++++L +D    FF   FA+   L  PC FC+R+D  L +    
Sbjct  8    LRRLSATLSSVLLEWILMMMLFIDAVYCFFVTRFARLCRLPAPCPFCSRLDHILGNEEPC  67

Query  423  FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaadd----v  590
            FY  + IC++HK +ISSL++C +H+K++  ++MCE C  S A  ++S+    +D+     
Sbjct  68   FY-RELICKTHKSEISSLAFCRLHQKLAGARSMCERCSDSLAETQESNTDDRSDEPMMDS  126

Query  591  kSVNVFADKPNFQR-CSCCMEFLGGK--GKYTRSMSQVAP  701
               N      + +R CSCC +    +    +TR+++++ P
Sbjct  127  NQGNSAVLHHDVKRICSCCAQHYTQQRPAMFTRAITELEP  166



>ref|XP_002468151.1| hypothetical protein SORBIDRAFT_01g040510 [Sorghum bicolor]
 gb|EER95149.1| hypothetical protein SORBIDRAFT_01g040510 [Sorghum bicolor]
Length=871

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 96/171 (56%), Gaps = 26/171 (15%)
 Frame = +3

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRM---STKKTRTMSIDYSALSRSDPNNYDLVTTT  1004
             ED + +TP N     +        S RM     K++ ++S+D S  S  +          
Sbjct  452   EDKAPETPTNSAATQR--------SDRMFLLERKRSLSLSLDGSVASEME----------  493

Query  1005  GFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
                   G    +  LK  +  ERK+L ++  EL+EERNA+AIA N  MAMI RLQ EKA+
Sbjct  494   -----GGEPSTVDQLKSALQAERKALGALYAELEEERNAAAIATNQTMAMINRLQEEKAA  548

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L +++ KRE E + LE +L++YR K 
Sbjct  549   MQMEALQYQRMMEEQSEYDQEALQLLNELVTKREREKQELERELELYRQKV  599


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-------RNLN  422
            L Y+ LE+V+I LLL++G LA+    FA +F L  PC  C+R+D+  +            
Sbjct  23   LAYAALEWVLIALLLINGVLAYAIARFADYFGLSPPCLLCSRVDRLFLQAEGGDAEAGAA  82

Query  423  FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             +  D +C  H  +IS+L YC  H ++++   MC+ C
Sbjct  83   RWLRDALCGDHAAEISALGYCLRHHRLAEAGEMCDGC  119



>ref|XP_004490812.1| PREDICTED: cingulin-like isoform X1 [Cicer arietinum]
 ref|XP_004490813.1| PREDICTED: cingulin-like isoform X2 [Cicer arietinum]
Length=959

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 81/149 (54%), Gaps = 7/149 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + ++  +    L+Y+ LE+++I+LLL++   ++F  +FA FF LK PC +C+R+D 
Sbjct  6    FATMLHRSTNKIVAILVYAFLEWILIILLLLNSLFSYFITKFANFFGLKPPCLYCSRVDN  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
                 N   + +D +CE+H  +IS++SYC  H++++   +MCE+C  S            
Sbjct  66   VFHQENETIFQSDLVCETHATEISNISYCSNHQRLAQTHSMCEDCFSS-------RPNLH  118

Query  579  addvkSVNVFADKPNFQRCSCCMEFLGGK  665
             +   S  +  D+    RCSCC E L  +
Sbjct  119  HEKYFSFGMRHDENVTNRCSCCNERLKNQ  147


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  E+K+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  588   IDRLKTALKSEQKALSAIYQELEEERSASAIAANQTMAMITRLQEEKAAMQMEALQYQRM  647

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L D++ KRE E + LE +L+ YR K
Sbjct  648   MEEQAEYDQEALQLLNDLMTKREREKQELEMELEEYRQK  686



>gb|KEH42589.1| zein-binding protein [Medicago truncatula]
Length=866

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 83/187 (44%), Gaps = 25/187 (13%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L +   E+ +I LLLVD  L++   +FA + +L++PC  C+R+D  L      FY++  +
Sbjct  24   LTFVACEWFLIFLLLVDSLLSYLVKKFASYCKLQLPCLLCSRLDHILDGEKPEFYHS-LL  82

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFADKPN  623
            C  HK +ISS+  CH H K++D   MC++CLLS   +   +            V      
Sbjct  83   CSDHKSEISSMMLCHTHGKLADGHRMCDDCLLSLTKNGKRNTKTHRLLSGKFGVVIGGSG  142

Query  624  FQR----------------CSCCMEFLGGKGKYTRSMS------QVAPP--PSPRAWRNN  731
            +Q                 CSCC +    +    RS+        V  P  P P A R +
Sbjct  143  YQNTPLSRDLFSRPKGSRPCSCCGKLWKLEQNGFRSIQLKSHGRSVVKPYIPLPHAARQS  202

Query  732  ETDHPDD  752
              +H D+
Sbjct  203  RLNHRDN  209


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = +3

Query  1002  TGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKA  1181
             T   E  G + I+  LKRQ+  +++ +  +  EL+EERNASAIAAN AM+MITRLQ EKA
Sbjct  519   TNMTEIEGES-IVDQLKRQIEYDKRYMDDLQKELEEERNASAIAANEAMSMITRLQEEKA  577

Query  1182  SKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             S  M+A QY RMMEEQAEYD EE   + D++ ++E+EI+ LE++LD YR  F
Sbjct  578   SLQMEAHQYLRMMEEQAEYDNEELDKVNDLLTEKEKEIQDLEAELDYYRINF  629



>ref|XP_010926157.1| PREDICTED: enolase-phosphatase E1-like [Elaeis guineensis]
Length=894

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LK  +  ER++L ++  EL+EER+ASAIAAN  MAMITRLQ E+A+  M+A QYQRM
Sbjct  519   IDRLKSALKAEREALSALYAELEEERSASAIAANQTMAMITRLQGERAAMQMEALQYQRM  578

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQ+EYD+E  Q+L +M++KRE+E + LE +L+VYR K
Sbjct  579   MEEQSEYDQEALQLLNEMMMKREKEKQDLEKELEVYRKK  617


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L+Y+ LE+++I LLL++G  ++   +FA FF LK PC FC+R+D 
Sbjct  6    FATMLHKNTNRMAVILVYTFLEWILIALLLLNGLFSYLIGKFADFFGLKPPCLFCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                      Y+D  CE+H  ++S L YC  H+++++   MCE+C
Sbjct  66   LFESGRGRSAYHDLFCEAHAAEVSRLGYCSNHRRLAEASDMCEDC  110



>ref|XP_008456276.1| PREDICTED: uncharacterized protein LOC103496267 [Cucumis melo]
 ref|XP_008456282.1| PREDICTED: uncharacterized protein LOC103496267 [Cucumis melo]
Length=905

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+ +V E+++I +L  D   +FF  + A F++L  PC  C+R+D         + +N  I
Sbjct  18   LVSAVFEWLLICMLFADSIFSFFITKCAHFWKLCTPCLLCSRLDHIFGSEKRGYIWN-LI  76

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C  HK ++SSL  CH H K+ ++  MCENCL SFA
Sbjct  77   CSKHKLELSSLVLCHAHNKLVNVHEMCENCLFSFA  111


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQ+  ++K + S+  EL+EERNASAIAAN AMAMITRLQ EKA+ HM+A    RMMEE
Sbjct  581   LKRQIEYDKKVMSSLYKELEEERNASAIAANQAMAMITRLQEEKANLHMEALHCLRMMEE  640

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             Q+EYD +  Q   D+I ++++EI+ LE++L+ YR  F
Sbjct  641   QSEYDDDALQKANDLITEKDKEIQDLEAELEFYRINF  677



>ref|XP_008467120.1| PREDICTED: protein SGM1 isoform X2 [Cucumis melo]
Length=982

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y++LE+V+I LLL+ G  ++   +FA++F LK PC +C+R+D 
Sbjct  6    FATILHRNSNKITLILVYALLEWVLIFLLLLHGLFSYLIVKFAEWFGLKRPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             +        Y D +CE H  +IS+L YC  H+K+S+ + +CE+C  S      S     
Sbjct  66   -VFEPERKHSYRDLLCEGHAMEISNLGYCSNHRKLSEFRDLCEDCSSS------SKSNEF  118

Query  579  addvkSVNVFAD-KPNFQRCSCCMEFLGGK  665
                KS   F D K +F+ CSCC E L  +
Sbjct  119  YQISKSFPFFDDEKEDFKSCSCCGETLKSR  148


 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG      ++ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMI RLQ EKAS  M
Sbjct  605   EGGDGVLTLEKLKSALRTERKALNALYAELEEERSASAIAANQTMAMINRLQEEKASMQM  664

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE ++++YR K 
Sbjct  665   EALQYQRMMEEQSEYDQEALQLLNELVVKREKEKQELEKEIEIYRKKL  712



>ref|XP_008467119.1| PREDICTED: intracellular protein transport protein USO1 isoform 
X1 [Cucumis melo]
 ref|XP_008467121.1| PREDICTED: intracellular protein transport protein USO1 isoform 
X1 [Cucumis melo]
Length=983

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 8/150 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L+Y++LE+V+I LLL+ G  ++   +FA++F LK PC +C+R+D 
Sbjct  6    FATILHRNSNKITLILVYALLEWVLIFLLLLHGLFSYLIVKFAEWFGLKRPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             +        Y D +CE H  +IS+L YC  H+K+S+ + +CE+C  S      S     
Sbjct  66   -VFEPERKHSYRDLLCEGHAMEISNLGYCSNHRKLSEFRDLCEDCSSS------SKSNEF  118

Query  579  addvkSVNVFAD-KPNFQRCSCCMEFLGGK  665
                KS   F D K +F+ CSCC E L  +
Sbjct  119  YQISKSFPFFDDEKEDFKSCSCCGETLKSR  148


 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG      ++ LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMI RLQ EKAS  M
Sbjct  606   EGGDGVLTLEKLKSALRTERKALNALYAELEEERSASAIAANQTMAMINRLQEEKASMQM  665

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE+E + LE ++++YR K 
Sbjct  666   EALQYQRMMEEQSEYDQEALQLLNELVVKREKEKQELEKEIEIYRKKL  713



>ref|XP_009791148.1| PREDICTED: uncharacterized protein LOC104238487 isoform X1 [Nicotiana 
sylvestris]
Length=959

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (46%), Gaps = 14/166 (8%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +  E+ +I +L +D  L++   +FA ++EL+ PC  C+R D    ++    Y    
Sbjct  20   VLSSAACEWFLIFMLFLDTALSYLITKFASYYELQTPCMLCSRFDHVFGNKKTGCYRR-L  78

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA  611
            +C +HK +IS   +CHVH  ++D++ MCE CL+SFA +           +  +   +   
Sbjct  79   LCRNHKEEISFQVFCHVHGNLADVRAMCEECLVSFATENVLVKESDNLMMAKLGNKSFIP  138

Query  612  DKPNFQRCSCCMEFLGGKGKYTRSMSQVA----------PPPSPRA  719
              P    CSCC +    +    R +   +           PP PRA
Sbjct  139  SSPGPWSCSCCHKTWRARSSAQRLLQLTSVGFGASKANVKPPLPRA  184


 Score = 84.7 bits (208),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              NE  G + I+  LKRQV  +++ + ++  EL+EER+ASAIAAN AMAMITRLQ EKAS 
Sbjct  615   INEIEGES-IVDRLKRQVEHDQRCINALYKELEEERSASAIAANQAMAMITRLQEEKASL  673

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             HM+A QY RMMEEQAEYD E  +   D++ +RE+E++ LE++L+++R+ +
Sbjct  674   HMEALQYLRMMEEQAEYDMEALERANDLLAEREKELQDLEAELELFRNNY  723



>ref|XP_010916145.1| PREDICTED: uncharacterized protein LOC105041051 [Elaeis guineensis]
Length=904

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LK  +  ERK+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQRM
Sbjct  533   MDRLKSALKAERKALSALYAELEEERSASAIAANQTMAMITRLQEEKAAMQMEALQYQRM  592

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ+EYD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  593   MEEQSEYDQEALQLLNELMMKREKEKQDLEKELEVYRKKI  632


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L+Y++LE+++I LLL++G  ++   +FA  F LK PC FC+R+D 
Sbjct  6    FATMLHRNTHRMAVILVYTLLEWILIALLLLNGLFSYLIAKFADLFGLKPPCLFCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                      Y D +C++H  ++S L YC  H++++++  MCE+C
Sbjct  66   LFEPGRGRSAYRDLLCDAHAAEVSRLGYCSKHRRLAEVSDMCEDC  110



>ref|XP_009791149.1| PREDICTED: myosin-4 isoform X2 [Nicotiana sylvestris]
 ref|XP_009791150.1| PREDICTED: myosin-4 isoform X3 [Nicotiana sylvestris]
Length=916

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (46%), Gaps = 14/166 (8%)
 Frame = +3

Query  261  FLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDT  440
             L  +  E+ +I +L +D  L++   +FA ++EL+ PC  C+R D    ++    Y    
Sbjct  20   VLSSAACEWFLIFMLFLDTALSYLITKFASYYELQTPCMLCSRFDHVFGNKKTGCYRR-L  78

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA  611
            +C +HK +IS   +CHVH  ++D++ MCE CL+SFA +           +  +   +   
Sbjct  79   LCRNHKEEISFQVFCHVHGNLADVRAMCEECLVSFATENVLVKESDNLMMAKLGNKSFIP  138

Query  612  DKPNFQRCSCCMEFLGGKGKYTRSMSQVA----------PPPSPRA  719
              P    CSCC +    +    R +   +           PP PRA
Sbjct  139  SSPGPWSCSCCHKTWRARSSAQRLLQLTSVGFGASKANVKPPLPRA  184


 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              NE  G + I+  LKRQV  +++ + ++  EL+EER+ASAIAAN AMAMITRLQ EKAS 
Sbjct  572   INEIEGES-IVDRLKRQVEHDQRCINALYKELEEERSASAIAANQAMAMITRLQEEKASL  630

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             HM+A QY RMMEEQAEYD E  +   D++ +RE+E++ LE++L+++R+ +
Sbjct  631   HMEALQYLRMMEEQAEYDMEALERANDLLAEREKELQDLEAELELFRNNY  680



>ref|XP_004984946.1| PREDICTED: nuclear autoantigenic sperm protein-like isoform X3 
[Setaria italica]
Length=899

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 26/171 (15%)
 Frame = +3

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRM---STKKTRTMSIDYSALSRSDPNNYDLVTTT  1004
             ED + +TP N        G+    S RM     K++ ++S+D S  S  +          
Sbjct  480   EDKAPETPTN--------GVAAQLSDRMFLLERKRSLSLSLDGSVASEME----------  521

Query  1005  GFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
                   G    +  LK  +  ERK+L ++  EL+EER+A+AIAA+  MAMI RLQ EKA+
Sbjct  522   -----GGEPSTVDQLKSALQAERKALGALYAELEEERSAAAIAASQTMAMINRLQEEKAA  576

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L +++ KRE E + LE +L+++R K 
Sbjct  577   MQMEALQYQRMMEEQSEYDQEALQLLNELVTKREREKQELERELELFRQKV  627


 Score = 81.6 bits (200),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNF----YY  431
            L ++ LE+V+I LLL++G LA+    FA +F L  PC  C+R+D+             + 
Sbjct  27   LAHAALEWVLIALLLINGLLAYAIDRFADYFGLAPPCLLCSRVDRLFQADGGEAGGARWL  86

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             D +C  H  +IS+L YC  H+++++ + MCE+CL S
Sbjct  87   RDALCGDHAAEISALGYCLRHRRLAEGREMCEDCLSS  123



>ref|XP_007147191.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 ref|XP_007147192.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 ref|XP_007147193.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 ref|XP_007147194.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 gb|ESW19185.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 gb|ESW19186.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 gb|ESW19187.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
 gb|ESW19188.1| hypothetical protein PHAVU_006G103500g [Phaseolus vulgaris]
Length=852

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYN  434
             + L  + LE+++I  L +D   ++   + A + +L+ PC FC+R+D  L  +  + YY 
Sbjct  20   TMALASAFLEWLLIFFLFIDAAFSYLITKLAGYCKLQTPCLFCSRLDHVL-GKERDGYYW  78

Query  435  DTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            D IC  HK +ISSL  C  H K+ +++ MCE+CL SFA
Sbjct  79   DLICSGHKTEISSLVLCRAHDKLVNVQGMCESCLFSFA  116


 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  +RK + ++  EL+EERNASA+AAN A+AMITRLQ EKA+ HM+A QY RM
Sbjct  532   VDRLKRQVDHDRKLMNALYKELEEERNASAVAANQALAMITRLQEEKATLHMEALQYLRM  591

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDV  1322
             M+EQ+EY+ E  Q   D+++++E+EI  LE+ L+V
Sbjct  592   MDEQSEYETEALQKANDLLVEKEKEIVELEAKLEV  626



>gb|EYU45803.1| hypothetical protein MIMGU_mgv1a018076mg, partial [Erythranthe 
guttata]
Length=485

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 98/351 (28%), Positives = 164/351 (47%), Gaps = 52/351 (15%)
 Frame = +3

Query  264   LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNF--YYND  437
             LI++ LE+++I+LLL++  L+    +FAK+F LK  C +CTR +     + ++   + N 
Sbjct  2     LIHAALEWILILLLLLNSLLSHLIQKFAKYFALKPICTWCTRFNHIFDSKKIHAQPHRNY  61

Query  438   TICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVF---  608
              +CE H  +I+ LSYC  H+++++ K +C +C  SF P    +          ++ F   
Sbjct  62    HVCEVHGIEIARLSYCMNHQRLAESKNLCGDCS-SFRPSHRGNANEIEISPL-IDFFMNE  119

Query  609   ------ADKPNFQRCSCCMEFLGGKGKYTRSMSQVAPPPSPRAWRNNETDHPDDNENATN  770
                    ++ N   CSCC + +        S + + PP  P     +   H    E   +
Sbjct  120   GIIVQEKNEGNDLVCSCCDQII-------LSRNDLYPPLKPSYDVLDYKRHDKKYEETRS  172

Query  771   GDGRDDNRSLAVSeeeeeeGLEDSSCKTPCNRGGNNKFVGIPLSDSPRMSTKKTRTMSID  950
              + + +  +L            D   +       ++ F+ I L DS      K     ID
Sbjct  173   DEKKTEYCNLG-----------DLFLQNEEEYLESDGFICIELIDS------KAEVEVID  215

Query  951   YSALSRSDPNNYDLVTTTGFNEGNGSAGII---QHLKRQVLLERKSLVSVCMELDEERna  1121
                              +   EG+   G+I   +HLK  +  + K++  +  EL+EER +
Sbjct  216   ------------SFQVESKQKEGSLDGGVITETEHLKASLKAQEKAMSELYKELEEERKS  263

Query  1122  saiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMI  1274
             +AI+A   MAMI +LQ EK+   M+A  YQRMMEEQ+EYD+E  Q L D++
Sbjct  264   AAISAIQTMAMINKLQQEKSDMQMEALHYQRMMEEQSEYDQEALQHLNDLV  314



>ref|XP_004984945.1| PREDICTED: nuclear autoantigenic sperm protein-like isoform X2 
[Setaria italica]
Length=900

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 26/171 (15%)
 Frame = +3

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRM---STKKTRTMSIDYSALSRSDPNNYDLVTTT  1004
             ED + +TP N        G+    S RM     K++ ++S+D S  S  +          
Sbjct  481   EDKAPETPTN--------GVAAQLSDRMFLLERKRSLSLSLDGSVASEME----------  522

Query  1005  GFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
                   G    +  LK  +  ERK+L ++  EL+EER+A+AIAA+  MAMI RLQ EKA+
Sbjct  523   -----GGEPSTVDQLKSALQAERKALGALYAELEEERSAAAIAASQTMAMINRLQEEKAA  577

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L +++ KRE E + LE +L+++R K 
Sbjct  578   MQMEALQYQRMMEEQSEYDQEALQLLNELVTKREREKQELERELELFRQKV  628


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNF----YY  431
            L ++ LE+V+I LLL++G LA+    FA +F L  PC  C+R+D+             + 
Sbjct  27   LAHAALEWVLIALLLINGLLAYAIDRFADYFGLAPPCLLCSRVDRLFQADGGEAGGARWL  86

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             D +C  H  +IS+L YC  H+++++ + MCE+CL S
Sbjct  87   RDALCGDHAAEISALGYCLRHRRLAEGREMCEDCLSS  123



>ref|XP_004984944.1| PREDICTED: nuclear autoantigenic sperm protein-like isoform X1 
[Setaria italica]
Length=901

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 26/171 (15%)
 Frame = +3

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRM---STKKTRTMSIDYSALSRSDPNNYDLVTTT  1004
             ED + +TP N        G+    S RM     K++ ++S+D S  S  +          
Sbjct  482   EDKAPETPTN--------GVAAQLSDRMFLLERKRSLSLSLDGSVASEME----------  523

Query  1005  GFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
                   G    +  LK  +  ERK+L ++  EL+EER+A+AIAA+  MAMI RLQ EKA+
Sbjct  524   -----GGEPSTVDQLKSALQAERKALGALYAELEEERSAAAIAASQTMAMINRLQEEKAA  578

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L +++ KRE E + LE +L+++R K 
Sbjct  579   MQMEALQYQRMMEEQSEYDQEALQLLNELVTKREREKQELERELELFRQKV  629


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNF----YY  431
            L ++ LE+V+I LLL++G LA+    FA +F L  PC  C+R+D+             + 
Sbjct  27   LAHAALEWVLIALLLINGLLAYAIDRFADYFGLAPPCLLCSRVDRLFQADGGEAGGARWL  86

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             D +C  H  +IS+L YC  H+++++ + MCE+CL S
Sbjct  87   RDALCGDHAAEISALGYCLRHRRLAEGREMCEDCLSS  123



>emb|CDX69426.1| BnaA10g17750D [Brassica napus]
Length=684

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = +3

Query  879   KFVGIPLSDSPRMSTKKTRTMSIDYSALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQ  1058
             +F   P S+S  +  K       DY+A      +  D+       +G+     I+ LK  
Sbjct  326   EFPETPTSESSLLHKKLLFLSKNDYAAA----EDARDVSIPVSDTDGDDPIRTIERLKET  381

Query  1059  VLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEY  1238
             V  E+++L  +  EL+EER+ASAIAAN  MAMITRLQ EKA   M+A QYQRMMEEQAEY
Sbjct  382   VRSEQEALRGLYAELEEERSASAIAANQTMAMITRLQEEKAKVQMEALQYQRMMEEQAEY  441

Query  1239  DREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             D+E  Q+L  +++KRE+E E L+ +LDV++ K
Sbjct  442   DQEALQLLNHLMVKREKEKEELQRELDVFKAK  473


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++     F  +FA FF LK  C  C ++D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTCFLVKFASFFGLKQICLLCPKLDR  65

Query  399  ALVHRNLN-FYYNDTICESHKRDISSLSYCHVHKK-ISDIKTMCENC  533
                 + N F Y + +C +H  +++SLS+C  H K +S+  ++C  C
Sbjct  66   IFDQNSENRFTYRELLCPNHVAELASLSFCKAHGKLLSESVSLCSEC  112



>gb|EYU30090.1| hypothetical protein MIMGU_mgv1a001097mg [Erythranthe guttata]
Length=890

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +3

Query  1011  NEGNGSAGII--QHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
             +E  GS G++  + LK  +  ERK+L ++  EL+EER+ASA+AAN  MAMI RLQ EKA+
Sbjct  548   SELEGSEGVVTVEGLKSALRSERKALQALYSELEEERSASAVAANQTMAMINRLQEEKAA  607

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L ++++KRE E + LE ++++YR K 
Sbjct  608   MQMEALQYQRMMEEQSEYDQEALQLLNELMVKREREKQELEKEMEIYRKKL  658


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  +  L L Y+VLE+++I LLL++   ++   +FA+FF LK PC +CTR+D 
Sbjct  6    FATMLHRNTNKITLVLTYAVLEWILISLLLLNSLFSYLIVKFAEFFGLKPPCPWCTRVDH  65

Query  399  AL--VHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             +     N N  + D +CE H ++IS L YC  H+ + D + +CE+CL S
Sbjct  66   IIDPAKGNKNM-HRDLLCEVHSKEISRLGYCSNHQNLVDSQNLCEDCLSS  114



>ref|XP_004984947.1| PREDICTED: nuclear autoantigenic sperm protein-like isoform X4 
[Setaria italica]
Length=875

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 26/171 (15%)
 Frame = +3

Query  834   EDSSCKTPCNRGGNNKFVGIPLSDSPRM---STKKTRTMSIDYSALSRSDPNNYDLVTTT  1004
             ED + +TP N        G+    S RM     K++ ++S+D S  S  +          
Sbjct  456   EDKAPETPTN--------GVAAQLSDRMFLLERKRSLSLSLDGSVASEME----------  497

Query  1005  GFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKAS  1184
                   G    +  LK  +  ERK+L ++  EL+EER+A+AIAA+  MAMI RLQ EKA+
Sbjct  498   -----GGEPSTVDQLKSALQAERKALGALYAELEEERSAAAIAASQTMAMINRLQEEKAA  552

Query  1185  KHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
               M+A QYQRMMEEQ+EYD+E  Q+L +++ KRE E + LE +L+++R K 
Sbjct  553   MQMEALQYQRMMEEQSEYDQEALQLLNELVTKREREKQELERELELFRQKV  603


 Score = 82.0 bits (201),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNF----YY  431
            L ++ LE+V+I LLL++G LA+    FA +F L  PC  C+R+D+             + 
Sbjct  27   LAHAALEWVLIALLLINGLLAYAIDRFADYFGLAPPCLLCSRVDRLFQADGGEAGGARWL  86

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             D +C  H  +IS+L YC  H+++++ + MCE+CL S
Sbjct  87   RDALCGDHAAEISALGYCLRHRRLAEGREMCEDCLSS  123



>ref|XP_008813559.1| PREDICTED: uncharacterized protein LOC103724165 [Phoenix dactylifera]
Length=904

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQ+ L+RKS+  +  EL+EERNASAIAAN AMAMITRLQ EKA+  M+A QYQRM
Sbjct  544   VDRLKRQIELDRKSISLLYKELEEERNASAIAANQAMAMITRLQEEKAAMQMEALQYQRM  603

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKFGPINLACSE  1364
             MEE+ EYD+E  Q   + + +R++EI+ LE+ L++Y  +FG   LA S+
Sbjct  604   MEEETEYDQEALQKSNEALAQRDKEIQDLEAVLEIYIKQFGDGALADSK  652


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = +3

Query  237  QNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRN  416
            +N  R +  L  +V E+++++LL +    ++   +FA+  +L+ PC  C+R+D  L +  
Sbjct  11   RNSRRFSSVLSSAVFEWLLMLLLFLGALYSYLVTKFARLCKLQRPCLLCSRLDHVLGNEK  70

Query  417  LNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             +FY+ D IC +HK +ISSL +CHVH+K++++  MCE CLL+F+
Sbjct  71   PSFYW-DLICRAHKSEISSLVFCHVHQKLANVYDMCEGCLLTFS  113



>gb|EEC71569.1| hypothetical protein OsI_03934 [Oryza sativa Indica Group]
Length=833

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = +3

Query  1041  QHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMM  1220
             + L+RQ+ L+RKS+  +C EL+EERNASAIAA+ A+AMITRLQ +KA+  M+A  YQRMM
Sbjct  549   ERLRRQIDLDRKSIHLLCKELEEERNASAIAASQALAMITRLQDDKAAMQMEALHYQRMM  608

Query  1221  EEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF--GP  1343
             EEQAEYD +      +++ +RE++IE LE++L+ YR +F  GP
Sbjct  609   EEQAEYDSDALAKANELLAQREQQIEELEAELENYRMQFAGGP  651



>ref|XP_010274150.1| PREDICTED: uncharacterized protein LOC104609520 isoform X3 [Nelumbo 
nucifera]
Length=860

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +3

Query  849   KTPCNRGGNNKFVGIPLSD-SPRM----STKKTRTMSIDYSALSRSDPNNYDLVTTTGFN  1013
             K P ++  N + + + L+D SPR        K    S+    L +      +   T  ++
Sbjct  381   KVPLSQVSNARGLELALNDVSPRAYGFGDELKISDASVVPQLLPKKSLTEKNECGTDSWD  440

Query  1014  EGNGSA----GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKA  1181
             E   S      I+  LKRQ    RK + ++  EL+EERNASA+AAN+++AMITRLQ EKA
Sbjct  441   ESTASETEVESIVDRLKRQSECYRKCMAALYKELEEERNASAVAANHSLAMITRLQEEKA  500

Query  1182  SKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             S HM+A QY RMMEEQ+EYD E  Q   D++ +RE++I+ LE++L+ Y++K+
Sbjct  501   SLHMEALQYLRMMEEQSEYDMEALQKANDLLAEREKDIQDLEAELEYYKEKY  552



>ref|XP_010489401.1| PREDICTED: uncharacterized protein LOC104767058 isoform X3 [Camelina 
sativa]
Length=1066

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 78/152 (51%), Gaps = 13/152 (9%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYYNDT  440
            L ++  E++++++L V+   ++    FA + EL+ PC  C+ +D  L   ++L   + D 
Sbjct  22   LAFAFNEWLLMLMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILGRTKHLKKPHWDM  81

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA  611
            IC  HK +ISSL YCH H K+ D++ MCE CL SFA    S+       V  +   + F 
Sbjct  82   ICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFATTNKSNAETYRLLVGKLGDNSYFG  141

Query  612  DK------PNFQR---CSCCMEFLGGKGKYTR  680
             K      PN  +   C+CC +  G +   T+
Sbjct  142  SKTGRSTNPNCSKLTDCTCCNQLWGTQTAPTQ  173


 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 5/127 (4%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  846   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  905

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRD----KFGPINLACSEFFEIEGDDEF  1394
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD    K   +++A  +  EI+   E 
Sbjct  906   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQTPQKKDKVDVA-EQVTEIDSPSEG  964

Query  1395  HSLKFQS  1415
              S K QS
Sbjct  965   MSNKIQS  971



>ref|XP_010274149.1| PREDICTED: uncharacterized protein LOC104609520 isoform X2 [Nelumbo 
nucifera]
Length=865

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +3

Query  849   KTPCNRGGNNKFVGIPLSD-SPRM----STKKTRTMSIDYSALSRSDPNNYDLVTTTGFN  1013
             K P ++  N + + + L+D SPR        K    S+    L +      +   T  ++
Sbjct  386   KVPLSQVSNARGLELALNDVSPRAYGFGDELKISDASVVPQLLPKKSLTEKNECGTDSWD  445

Query  1014  EGNGSA----GIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKA  1181
             E   S      I+  LKRQ    RK + ++  EL+EERNASA+AAN+++AMITRLQ EKA
Sbjct  446   ESTASETEVESIVDRLKRQSECYRKCMAALYKELEEERNASAVAANHSLAMITRLQEEKA  505

Query  1182  SKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             S HM+A QY RMMEEQ+EYD E  Q   D++ +RE++I+ LE++L+ Y++K+
Sbjct  506   SLHMEALQYLRMMEEQSEYDMEALQKANDLLAEREKDIQDLEAELEYYKEKY  557



>ref|XP_010905452.1| PREDICTED: uncharacterized protein LOC105032650 [Elaeis guineensis]
Length=870

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +3

Query  252  SALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYY  431
            SALF  +S  E+ +I +L ++  L+F + +FA+F +L  PC  C+R+D  L   +L FY 
Sbjct  15   SALFSAFS--EWCLIFVLYINALLSFVATKFARFCKLPAPCLLCSRLDHILGDDDLGFY-  71

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
             D  C  HK +ISSL+YC  H K++    MCENCL S
Sbjct  72   RDLFCHGHKVEISSLAYCCGHLKLASFHEMCENCLNS  108


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = +3

Query  897   LSDSPRMSTKKTRTMSIDYSALSRSDPNN-----YDLVTTTGFNEGNGSAGIIQHLKRQV  1061
             ++ SPR+S   +     + +     + NN     YD+   +   EG  S    + LKRQV
Sbjct  471   INSSPRVSDASSSAGLQNIAKRISIERNNSWLEPYDITLVSEI-EGETST---ERLKRQV  526

Query  1062  LLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEYD  1241
              ++RKS+  +  EL+EER+ASAIAA  AMAMI RLQ EKA+  M+A QY R MEEQAEYD
Sbjct  527   EMDRKSMSLLYKELEEERSASAIAAQEAMAMINRLQEEKATMQMEALQYLREMEEQAEYD  586

Query  1242  REEKQILKDMILKREEEIEALESDLDVYRDKFG  1340
             +E  Q L +++ +RE+EI  LE++++ YR +FG
Sbjct  587   QEAIQRLNELLTEREKEILDLEAEIESYRKQFG  619



>ref|XP_006287176.1| hypothetical protein CARUB_v10000344mg, partial [Capsella rubella]
 gb|EOA20074.1| hypothetical protein CARUB_v10000344mg, partial [Capsella rubella]
Length=706

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M+A QYQRM
Sbjct  380   IERLKETVKAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQMEALQYQRM  439

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L  +++KRE+E E L+ +L++YR+K
Sbjct  440   MEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEIYREK  478


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 4/108 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++    +F  +FA FF LK  C  C ++D+
Sbjct  27   FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTYFVVKFASFFGLKQVCLLCPKLDR  86

Query  399  ALVHRNLN---FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             L  RN      YY + +C++H  +++SLS+C  H KIS+   +C +C
Sbjct  87   -LFERNPENRFTYYRELLCQNHVAELASLSFCKTHGKISESANLCSDC  133



>ref|XP_006287177.1| hypothetical protein CARUB_v10000344mg, partial [Capsella rubella]
 gb|EOA20075.1| hypothetical protein CARUB_v10000344mg, partial [Capsella rubella]
Length=706

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ LK  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M+A QYQRM
Sbjct  380   IERLKETVKAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQMEALQYQRM  439

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L  +++KRE+E E L+ +L++YR+K
Sbjct  440   MEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEIYREK  478


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 4/108 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++    +F  +FA FF LK  C  C ++D+
Sbjct  27   FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTYFVVKFASFFGLKQVCLLCPKLDR  86

Query  399  ALVHRNLN---FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             L  RN      YY + +C++H  +++SLS+C  H KIS+   +C +C
Sbjct  87   -LFERNPENRFTYYRELLCQNHVAELASLSFCKTHGKISESANLCSDC  133



>ref|XP_010453837.1| PREDICTED: probable serine/threonine-protein kinase kinX [Camelina 
sativa]
Length=687

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             +G      I+ L+  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M
Sbjct  354   DGGDPLKTIERLRETVRAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQM  413

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             +A QYQRMMEEQAEYD+E  Q+L  +++KRE+E E L+ +L+VYR+K
Sbjct  414   EALQYQRMMEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEVYREK  460


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++    +F   FA FF LK  C  C ++D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTYFIVRFASFFGLKQVCLLCPKLDR  65

Query  399  ALVHRNLN--FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                 + N   YY + +CE+H  +++SLS+C  H K S+   +C +C
Sbjct  66   IFERNSENRFTYYRELLCENHVAELASLSFCKTHGKTSESANLCSDC  112



>ref|XP_010489386.1| PREDICTED: uncharacterized protein LOC104767058 isoform X1 [Camelina 
sativa]
 ref|XP_010489392.1| PREDICTED: uncharacterized protein LOC104767058 isoform X2 [Camelina 
sativa]
Length=1064

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 78/152 (51%), Gaps = 13/152 (9%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYYNDT  440
            L ++  E++++++L V+   ++    FA + EL+ PC  C+ +D  L   ++L   + D 
Sbjct  22   LAFAFNEWLLMLMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILGRTKHLKKPHWDM  81

Query  441  ICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVFA  611
            IC  HK +ISSL YCH H K+ D++ MCE CL SFA    S+       V  +   + F 
Sbjct  82   ICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFATTNKSNAETYRLLVGKLGDNSYFG  141

Query  612  DK------PNFQR---CSCCMEFLGGKGKYTR  680
             K      PN  +   C+CC +  G +   T+
Sbjct  142  SKTGRSTNPNCSKLTDCTCCNQLWGTQTAPTQ  173


 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 5/127 (4%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  844   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  903

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRD----KFGPINLACSEFFEIEGDDEF  1394
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD    K   +++A  +  EI+   E 
Sbjct  904   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQTPQKKDKVDVA-EQVTEIDSPSEG  962

Query  1395  HSLKFQS  1415
              S K QS
Sbjct  963   MSNKIQS  969



>ref|XP_010492592.1| PREDICTED: caldesmon-like [Camelina sativa]
 ref|XP_010492593.1| PREDICTED: caldesmon-like [Camelina sativa]
Length=684

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             +G      I+ L+  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M
Sbjct  348   DGGDPLKTIERLRETVRAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQM  407

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQAEYD+E  Q+L  +++KRE+E E L+ +L+VYR+K 
Sbjct  408   EALQYQRMMEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEVYREKL  455


 Score = 78.6 bits (192),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++    +F   FA FF LK  C  C ++D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSLFTYFIVRFASFFGLKQVCLLCPKLDR  65

Query  399  ALVHRNLN---FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
             L  RN      YY + +C+SH  +++SLS+C  H K S+   +C +C
Sbjct  66   -LFERNSENRFTYYRELLCQSHVAELASLSFCKTHGKTSESGNLCSDC  112



>gb|KDP33181.1| hypothetical protein JCGZ_13446 [Jatropha curcas]
Length=877

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 84/160 (53%), Gaps = 11/160 (7%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   +++N  +  + L+Y+ LE+++I+LLL++ F  +   +FA +F L  PC +C+R+D 
Sbjct  6    FATMLQRNTHKLTVILVYAFLEWILIILLLLNSFFTYLITKFANYFGLTPPCLWCSRVDH  65

Query  399  ALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyya  578
             L  +N    Y + ICE+H  +IS L YC  H+K+++ ++MC +CL +  P++       
Sbjct  66   VLEPQNNTNSYRNLICETHANEISKLGYCKSHQKLAEKQSMCMDCLANSRPNQSEDTTIN  125

Query  579  addv--------kSVNVFADKPNFQRCSCCMEFLGGKGKY  674
                         S N   +      CSCC E L  K +Y
Sbjct  126  GLITRRIAFLSWVSTNTLENGEKL--CSCCNENL-NKNRY  162


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  1014  EGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHM  1193
             EG      ++ LK  +  ERK L ++  EL+EER+ASAIAAN  MAMI RLQ EKA+  M
Sbjct  490   EGGDPVLTVEKLKTALKAERKVLNALYSELEEERSASAIAANQTMAMINRLQEEKAAMQM  549

Query  1194  QASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             +A QYQRMMEEQ+EYD+E  Q+L ++++KRE E + LE +L+VYR K 
Sbjct  550   EALQYQRMMEEQSEYDQEALQLLNELMMKREREKQELEKELEVYRKKV  597



>ref|XP_006577299.1| PREDICTED: uncharacterized protein LOC100800595 isoform X2 [Glycine 
max]
 ref|XP_006577300.1| PREDICTED: uncharacterized protein LOC100800595 isoform X3 [Glycine 
max]
 ref|XP_003521761.2| PREDICTED: uncharacterized protein LOC100800595 isoform X1 [Glycine 
max]
 ref|XP_006577301.1| PREDICTED: uncharacterized protein LOC100800595 isoform X4 [Glycine 
max]
Length=864

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 73/144 (51%), Gaps = 10/144 (7%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L  + LE+++I+ L +D   ++   +FA + +L++PC  C+R+D  L      +Y+ D I
Sbjct  23   LASAFLEWLLILFLFIDAVFSYVITKFAGYCKLQIPCLLCSRLDHVLGKEKGGYYW-DLI  81

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyy-----aaddvkSVNVF  608
            C  HK +IS L  C  H K+ +++ MCE+CL SFA    S+              S   F
Sbjct  82   CSGHKTEISYLVLCCAHDKLVNVQGMCESCLFSFATINKSNAETYRLLVGKLGEGSETRF  141

Query  609  ADKP----NFQRCSCCMEFLGGKG  668
               P    N + CSCC E L  KG
Sbjct  142  DQDPLLGENSKCCSCCNEQLVLKG  165


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  +RK + ++  EL+EERNASA+AAN A+AMITRLQ EKA+ HM+A QY RM
Sbjct  529   VDRLKRQVDHDRKLMNALYKELEEERNASAVAANQALAMITRLQEEKATLHMEALQYLRM  588

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+E++EY+ E  Q   D+++++E+EIE LE+ L+ YR KF
Sbjct  589   MDEESEYETEALQKANDLLVEKEKEIEELEAKLEFYRKKF  628



>ref|XP_009110874.1| PREDICTED: uncharacterized protein LOC103836375 [Brassica rapa]
Length=1152

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 73/142 (51%), Gaps = 11/142 (8%)
 Frame = +3

Query  237  QNLGRS---ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALV  407
            Q   RS   AL L ++  E++++V+L  +    +    FA + +L+ PC  C+R+D  L 
Sbjct  9    QTTSRSFTRALALAFN--EWLLMVMLFANSIFTYVITRFADYSQLQSPCLICSRLDHILG  66

Query  408  H-RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaad  584
               +L   + D  C  HK +ISSL YCH H K+ D++ MCE CLLSF     S+      
Sbjct  67   RTEHLKTSHWDMFCSKHKSEISSLVYCHAHGKLVDVRGMCETCLLSFDKTSKSNAESYKL  126

Query  585  dvkSVNVFADKPNF--QRCSCC  644
                V    D+P+   + C+CC
Sbjct  127  L---VGKLDDQPSTSPRHCTCC  145


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 12/152 (8%)
 Frame = +3

Query  906   SPRMSTKKTRTMSIDYSALS-----RSDPNNYDLVTTTGFN----EGNGSAGIIQHLKRQ  1058
             SPR+S     T ++DY  +      R    N   ++  G +    EG      ++ LKRQ
Sbjct  896   SPRISIVDQETKNLDYEDMQLLIQKRMLERNESTLSLEGVSVSEIEGESE---VERLKRQ  952

Query  1059  VLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQAEY  1238
             V  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKA+  M+A Q  RMMEEQAEY
Sbjct  953   VDHDRKFLTGLYKELEEERSASAVATNQAMAMITRLQEEKATFQMEALQNLRMMEEQAEY  1012

Query  1239  DREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             D E  Q L +++++RE+ I+ LE+++D +R K
Sbjct  1013  DLEAIQKLNELLVEREKVIQDLEAEIDYFRSK  1044



>ref|XP_009421192.1| PREDICTED: uncharacterized protein LOC104000786 [Musa acuminata 
subsp. malaccensis]
Length=1078

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  1044  HLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMME  1223
              LK  +  ERK+L ++  EL+EER+A+AIAAN  MAMITRLQ EKA+  M+A QYQRMME
Sbjct  705   QLKAALKAERKTLSALYAELEEERSAAAIAANQTMAMITRLQEEKAAMQMEALQYQRMME  764

Query  1224  EQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             EQ+EYD+E  Q+L +++ KRE+E + LE +L+VYR K 
Sbjct  765   EQSEYDQEALQLLNELMTKREKEKQDLEKELEVYRKKV  802


 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 75/145 (52%), Gaps = 11/145 (8%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R A+ L+Y++LE+ +I+ LL++G   +    FA FF LK PC FC+R+D 
Sbjct  6    FATVLHRNSHRMAVILVYAILEWALILFLLLNGLFGYLIARFAAFFGLKAPCIFCSRVDH  65

Query  399  ALVHRNLN---FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssd  569
             L  ++       Y D +C+ H  +++ L YC  H+++++   MCE+C  S  P + +  
Sbjct  66   -LFEKDEGRRRHAYRDLLCDEHAAEVTKLGYCAYHRRLAEAGEMCEDCCFSTRPVEAAVL  124

Query  570  yyaaddvkSVNVFADKPNFQRCSCC  644
             +     +            RCSCC
Sbjct  125  SWMKRSEEGEKDL-------RCSCC  142



>ref|XP_009148133.1| PREDICTED: uncharacterized protein LOC103871621 [Brassica rapa]
Length=958

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHR--NLNFY  428
            AL L ++  E+++I++L ++   ++   +FA + +L+ PC  C+ +D  L  R  +L   
Sbjct  16   ALSLAFN--EWLLILMLFINSIFSYLITKFADYSDLQSPCLMCSSLDHILGRRTKHLKKS  73

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            + D +C  HK +ISSL YCH H K+ D++ MCE CL SFA
Sbjct  74   HWDMVCSKHKTEISSLVYCHAHGKLVDVRGMCEACLFSFA  113


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 10/154 (6%)
 Frame = +3

Query  894   PLSDSPRMST-KKTRTMSIDYS------ALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLK  1052
             P   SP++ST ++T+ + +D         L R++ N      +    EG   +     LK
Sbjct  683   PRGISPKISTDQETKDLDLDMQLLIQKRMLERNESNLSLEEVSVSEIEGESES---DRLK  739

Query  1053  RQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQA  1232
             RQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKA   M+A Q  RMMEEQA
Sbjct  740   RQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKALFQMEALQNLRMMEEQA  799

Query  1233  EYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             EYD E  Q L D+++ +E+ I+ LE++++ +RD+
Sbjct  800   EYDMEAIQKLNDLLVDKEKLIQDLEAEIEYFRDQ  833



>emb|CAC01836.1| putative protein [Arabidopsis thaliana]
Length=600

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ L+  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M+A QYQRM
Sbjct  282   IERLRETVRAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQMEALQYQRM  341

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L  +++KRE+E E L+ +L+VYR K
Sbjct  342   MEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEVYRAK  380



>emb|CDY31126.1| BnaA08g26760D [Brassica napus]
Length=198

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYY  431
            AL L ++  E++++V+L  +    +    FA + +L+ PC  C+R+D  L    +L   +
Sbjct  18   ALALAFN--EWLLMVMLFANSIFTYVITRFADYSQLQSPCLICSRLDHILGRTEHLKTSH  75

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSVNVFA  611
             D  C  HK +ISSL YCH H K+ D++ MCE CLLSF     S+          V    
Sbjct  76   WDMFCSKHKSEISSLVYCHAHGKLVDVRGMCETCLLSFDKTSKSNAETYKLL---VGKLD  132

Query  612  DKPNF--QRCSCCMEF  653
            D+P+   + C+CC + 
Sbjct  133  DQPSTSPRHCTCCNQL  148



>gb|AAF99773.1|AC003981_23 F22O13.29 [Arabidopsis thaliana]
Length=1079

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYY  431
            AL L ++  E++++ +L V+   ++    FA + EL+ PC  C+ +D  L   ++L   +
Sbjct  9    ALALAFN--EWLLMFMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILRRTKDLKKTH  66

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             D IC  HK +ISSL YCH H K+ D++ MCE CL SFA
Sbjct  67   WDIICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFA  105


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  859   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  918

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD+
Sbjct  919   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQ  954



>ref|XP_007050382.1| Uncharacterized protein TCM_004165 [Theobroma cacao]
 gb|EOX94539.1| Uncharacterized protein TCM_004165 [Theobroma cacao]
Length=888

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = +3

Query  960   LSRSDPNNYDLVTTTGFNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaan  1139
             + RS+    +    +  NE  G   ++  LKRQV  +RK + ++  EL+EER+ASAIAAN
Sbjct  520   MERSESAGLESFDGSSVNEIEGE-NLVDRLKRQVAYDRKCMNALYKELEEERSASAIAAN  578

Query  1140  namamiTRLQAEKASKHMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLD  1319
              AMAMITRLQ EKA+ HM+A QY RMMEEQAEYD +  +   D++ ++E+E++ LE++L+
Sbjct  579   QAMAMITRLQEEKAALHMEALQYLRMMEEQAEYDVDALEKANDLLAEKEKELQDLEAELE  638

Query  1320  VYRDKF  1337
              YR  F
Sbjct  639   YYRLNF  644


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +3

Query  231  IEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH  410
            +++NL      L  +  E+++I LLL+D  L++    FA + EL++PC  C+R+D    +
Sbjct  11   VQRNLKGFTTVLRTAACEWLLIFLLLIDAVLSYLLTRFAHYCELQIPCILCSRLDHIFGN  70

Query  411  RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLS  542
                 Y N  +C +H+ +ISSL  C++H K+ D + MCE CL S
Sbjct  71   EKPGSYRN-LLCGNHRSEISSLISCNIHGKLVDGQGMCEICLSS  113



>dbj|BAC42783.1| unknown protein [Arabidopsis thaliana]
Length=1113

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYY  431
            AL L ++  E++++ +L V+   ++    FA + EL+ PC  C+ +D  L   ++L   +
Sbjct  9    ALALAFN--EWLLMFMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILRRTKDLKKTH  66

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             D IC  HK +ISSL YCH H K+ D++ MCE CL SFA
Sbjct  67   WDIICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFA  105


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  893   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  952

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD+
Sbjct  953   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQ  988



>emb|CDX93536.1| BnaA06g05120D [Brassica napus]
Length=964

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQAL--VHRNLNFY  428
            AL L ++  E+++I++L ++   ++   +FA + +L+ PC  C+ +D  L    ++L   
Sbjct  16   ALSLAFN--EWLLILMLFINSIFSYLITKFADYSDLQSPCLMCSSLDHILGRTTKHLKKS  73

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            + D +C  HK +ISSL YCH H K+ D++ MCE CL SFA
Sbjct  74   HWDMVCSKHKTEISSLVYCHAHGKLVDVRGMCEACLFSFA  113


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 10/154 (6%)
 Frame = +3

Query  894   PLSDSPRMST-KKTRTMSIDYS------ALSRSDPNNYDLVTTTGFNEGNGSAGIIQHLK  1052
             P   SP++ST ++T+ + +D         L R++ N      +    EG   +     LK
Sbjct  689   PRGISPKISTDQETKDLDLDMQLLIQKRMLERNESNLSLEEVSVSEIEGESES---DRLK  745

Query  1053  RQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEEQA  1232
             RQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKA   M+A Q  RMMEEQA
Sbjct  746   RQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKALFQMEALQNLRMMEEQA  805

Query  1233  EYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             EYD E  Q L D+++ +E+ I+ LE++++ +RD+
Sbjct  806   EYDMEAIQKLNDLLVDKEKLIQDLEAEIEYFRDQ  839



>ref|NP_172357.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117250.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE28348.1| uncharacterized protein AT1G08800 [Arabidopsis thaliana]
 gb|AEE28349.1| uncharacterized protein AT1G08800 [Arabidopsis thaliana]
Length=1113

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYY  431
            AL L ++  E++++ +L V+   ++    FA + EL+ PC  C+ +D  L   ++L   +
Sbjct  9    ALALAFN--EWLLMFMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILRRTKDLKKTH  66

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
             D IC  HK +ISSL YCH H K+ D++ MCE CL SFA
Sbjct  67   WDIICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFA  105


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  893   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  952

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD+
Sbjct  953   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQ  988



>ref|XP_010100076.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXB81312.1| Cytochrome P450 94A1 [Morus notabilis]
Length=1418

 Score = 85.5 bits (210),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query  282  EFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKR  461
            E+++I LLL+DG L++   +FA + +L+ PC  C+RID  +  +    Y  D +C  H  
Sbjct  27   EWILIFLLLIDGVLSYLLTKFAHYCKLQTPCILCSRIDHVIGSKKPGIY-RDLLCSDHIS  85

Query  462  DISSLSYCHVHKKISDIKTMCENCLLSF  545
            +ISSL  CHVH K++D   MC++C+ SF
Sbjct  86   EISSLICCHVHGKLADGHGMCDDCIFSF  113


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             I+  LKRQV  ++K + ++  EL+EERNASA+A N AMAMITRLQ EKA+ HM+A QY R
Sbjct  557   IVDRLKRQVEYDKKCIKTLYKELEEERNASAVATNEAMAMITRLQEEKAALHMEALQYLR  616

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYR  1328
             MMEEQAEYD +  +   D++ ++E+E++ +E++L++Y+
Sbjct  617   MMEEQAEYDVDALEKANDLLAEKEKEMQDMEAELELYK  654



>ref|XP_011002939.1| PREDICTED: myosin-9 [Populus euphratica]
Length=925

 Score = 85.1 bits (209),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +3

Query  300  LLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKRDISSLS  479
            +L ++   ++   +FA  +EL+ PC  C+R+D  L  + L +Y+ D IC +HK +ISSL 
Sbjct  34   MLFINAIFSYLITKFACQWELQTPCLLCSRLDHILGSKKLKYYW-DLICGNHKLEISSLV  92

Query  480  YCHVHKKISDIKTMCENCLLSFA  548
            +CH H  + ++  MCENCL SFA
Sbjct  93   FCHSHNNLVNVHGMCENCLFSFA  115


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  ++K L ++  EL+EERNAS IA N AMAMITR+Q EKA+ HM+A Q  RM
Sbjct  606   IDRLKRQVEHDKKLLSALYKELEEERNASTIAVNQAMAMITRIQEEKATLHMEALQSLRM  665

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQAEYD E  Q   D++ ++E+E++ LE +L+ YR KF
Sbjct  666   MEEQAEYDMEALQKTNDLLTEKEKEVQDLEEELEFYRSKF  705



>ref|NP_001044407.1| Os01g0775200 [Oryza sativa Japonica Group]
 dbj|BAD52954.1| IFA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF06321.1| Os01g0775200 [Oryza sativa Japonica Group]
 gb|EEE55470.1| hypothetical protein OsJ_03646 [Oryza sativa Japonica Group]
Length=896

 Score = 85.1 bits (209),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = +3

Query  1041  QHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMM  1220
             + L+RQ+ L+RKS+  +C EL+EERNASAIAA+ A+AMITRLQ +KA+  M+A  YQRMM
Sbjct  612   ERLRRQIDLDRKSIHLLCKELEEERNASAIAASQALAMITRLQDDKAAMQMEALHYQRMM  671

Query  1221  EEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF--GP  1343
             EEQAEYD +      +++ +RE++IE LE++L+ YR +F  GP
Sbjct  672   EEQAEYDSDALAKANELLAQREQQIEELEAELENYRMQFAGGP  714


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query  306  LVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYC  485
             +D    F    FA+   L  PC FC+R+D  L +    FY  + IC++HK +ISSL++C
Sbjct  29   FIDAVYCFLVTRFARLCRLPAPCPFCSRLDHVLGNEKPCFY-RELICKTHKSEISSLAFC  87

Query  486  HVHKKISDIKTMCENC  533
             +H+K++  ++MCE C
Sbjct  88   RLHQKLAGAQSMCERC  103



>ref|XP_009611490.1| PREDICTED: uncharacterized protein LOC104104974 isoform X1 [Nicotiana 
tomentosiformis]
Length=874

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              NE  G + I+  LKRQV  +++ + ++  EL+EER+ASAIAAN AMAMITRLQ EKAS 
Sbjct  530   INEIEGES-IVDRLKRQVEHDQRCINALYKELEEERSASAIAANQAMAMITRLQEEKASL  588

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             HM+A QY RMMEEQAEYD E  +   D++ +RE+E++ LE++L+++R+ +
Sbjct  589   HMEALQYLRMMEEQAEYDMEALERANDLLAEREKELQDLEAELELFRNNY  638


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 14/167 (8%)
 Frame = +3

Query  258  LFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYND  437
            + L  +  E+ ++ +L +D  L++   +FA ++EL+ PC  C+R D     +    Y   
Sbjct  19   IVLSSAACEWFLMFMLFLDAALSYLITKFACYYELQTPCMLCSRFDNIFGDKKTGCYRR-  77

Query  438  TICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---NVF  608
             +C +HK +IS   +CHVH  ++D++ MCE CL+SFA +           +  +   +  
Sbjct  78   LLCRNHKEEISFQVFCHVHGNLADVRAMCEECLVSFATENILVKESDNLMMAKLGNKSFI  137

Query  609  ADKPNFQRCSCCMEFLGGKGKYTRSMSQVA----------PPPSPRA  719
               P    CSCC +    +    R +   +           PP PRA
Sbjct  138  PSSPGPWICSCCQKTWRARSSAQRLLQLTSVGFGASKANVKPPLPRA  184



>ref|NP_197174.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF01185.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92330.1| uncharacterized protein AT5G16720 [Arabidopsis thaliana]
Length=675

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ L+  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M+A QYQRM
Sbjct  357   IERLRETVRAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQMEALQYQRM  416

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L  +++KRE+E E L+ +L+VYR K
Sbjct  417   MEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEVYRAK  455


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++ F  +F  +FA FF LK  C  C ++D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSFFTYFIVKFASFFGLKQVCLLCPKLDR  65

Query  399  ALVHRNLN-FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                +  N F Y + +C++H  +++SLS+C  H K+S+   +C +C
Sbjct  66   IFERKPENRFTYKELLCQNHIAELASLSFCRTHGKLSESANLCSDC  111



>gb|KDO68504.1| hypothetical protein CISIN_1g002931mg [Citrus sinensis]
Length=788

 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  +R+ + ++  ELDEER+A+A+AAN AMAMITRLQ EK++ HM A QY RM
Sbjct  448   IDRLKRQVEYDRRCMNALYKELDEERSAAAVAANEAMAMITRLQEEKSALHMDALQYLRM  507

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD EE +   D+I ++E++I+ LE +L+ YR K
Sbjct  508   MEEQAEYDMEELEKANDLIAEKEKQIQDLEEELEYYRLK  546



>gb|KDO68505.1| hypothetical protein CISIN_1g002931mg [Citrus sinensis]
Length=789

 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I  LKRQV  +R+ + ++  ELDEER+A+A+AAN AMAMITRLQ EK++ HM A QY RM
Sbjct  449   IDRLKRQVEYDRRCMNALYKELDEERSAAAVAANEAMAMITRLQEEKSALHMDALQYLRM  508

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD EE +   D+I ++E++I+ LE +L+ YR K
Sbjct  509   MEEQAEYDMEELEKANDLIAEKEKQIQDLEEELEYYRLK  547



>ref|XP_009403743.1| PREDICTED: uncharacterized protein LOC103987227 [Musa acuminata 
subsp. malaccensis]
Length=1106

 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LK  +  E+K+L ++  EL+EER+ASAIAAN  MAMITRLQ EKA+  M+A QYQR+
Sbjct  737   VDQLKAALKAEQKALSALYTELEEERSASAIAANQTMAMITRLQQEKAAMQMEALQYQRL  796

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MEEQ++YD+E  Q+L ++++KRE+E + LE +L+VYR K 
Sbjct  797   MEEQSDYDQEALQLLNELMMKREKEKQDLEKELEVYRKKI  836


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  + A+ L Y+VLE+ +I+LLL++G  A+    FA FF LK PC FC+R+D 
Sbjct  6    FATVLHRNGNKIAVVLAYAVLEWTLILLLLLNGLFAYLIARFADFFGLKPPCVFCSRVDH  65

Query  399  ALVH------RNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
               H      R       D +C+ H  +++ + YC  H+++++   MCE+C
Sbjct  66   HFEHRADGRGRRQRGACRDLLCDEHAAEVAGMGYCARHQRLAEAGDMCEDC  116



>gb|EYU26862.1| hypothetical protein MIMGU_mgv1a001409mg [Erythranthe guttata]
Length=825

 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  264  LIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFYYNDTI  443
            L+ +VLE++++ ++ VD   ++    FA++ +L++PC  C+R+D  L +   +F++ D  
Sbjct  33   LVSAVLEWMLMFMIFVDASFSYLVTRFARYCQLQIPCLLCSRLDHVLGNEKDSFHW-DLF  91

Query  444  CESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            C +HK +ISSL  C  H K+ D+   CE C  SFA
Sbjct  92   CHNHKLNISSLVLCQHHNKLVDVHGTCETCFFSFA  126


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  1035  IIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQR  1214
             ++  LKRQV  +++ + ++  EL+EERNASAIA N +MAMITRLQ EKA+ HM+A Q  R
Sbjct  520   VLDRLKRQVEHDKRIMATLYKELEEERNASAIAVNQSMAMITRLQEEKAALHMEALQSIR  579

Query  1215  MMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             MMEEQAEYD E  Q   D++ ++E+ I+ LE +L++ R++ 
Sbjct  580   MMEEQAEYDGEALQNANDLLTEKEKLIQDLEFELEMLRNQL  620



>ref|XP_009611491.1| PREDICTED: uncharacterized protein LOC104104974 isoform X2 [Nicotiana 
tomentosiformis]
Length=817

 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  1008  FNEGNGSAGIIQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASK  1187
              NE  G + I+  LKRQV  +++ + ++  EL+EER+ASAIAAN AMAMITRLQ EKAS 
Sbjct  473   INEIEGES-IVDRLKRQVEHDQRCINALYKELEEERSASAIAANQAMAMITRLQEEKASL  531

Query  1188  HMQASQYQRMMEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             HM+A QY RMMEEQAEYD E  +   D++ +RE+E++ LE++L+++R+ +
Sbjct  532   HMEALQYLRMMEEQAEYDMEALERANDLLAEREKELQDLEAELELFRNNY  581


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 52/128 (41%), Gaps = 14/128 (11%)
 Frame = +3

Query  375  FFCTRIDQALVHRNLNFYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPd  554
              C+R D     +    Y    +C +HK +IS   +CHVH  ++D++ MCE CL+SFA +
Sbjct  1    MLCSRFDNIFGDKKTGCYRR-LLCRNHKEEISFQVFCHVHGNLADVRAMCEECLVSFATE  59

Query  555  kdssdyyaaddvkSV---NVFADKPNFQRCSCCMEFLGGKGKYTRSMSQVA---------  698
                       +  +   +     P    CSCC +    +    R +   +         
Sbjct  60   NILVKESDNLMMAKLGNKSFIPSSPGPWICSCCQKTWRARSSAQRLLQLTSVGFGASKAN  119

Query  699  -PPPSPRA  719
              PP PRA
Sbjct  120  VKPPLPRA  127



>ref|XP_010475694.1| PREDICTED: uncharacterized protein LOC104755067 [Camelina sativa]
 ref|XP_010475695.1| PREDICTED: uncharacterized protein LOC104755067 [Camelina sativa]
 ref|XP_010475696.1| PREDICTED: uncharacterized protein LOC104755067 [Camelina sativa]
 ref|XP_010475697.1| PREDICTED: uncharacterized protein LOC104755067 [Camelina sativa]
Length=1060

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 83/161 (52%), Gaps = 18/161 (11%)
 Frame = +3

Query  255  ALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVH-RNLNFYY  431
            AL L ++  E++++++L V+   ++    FA + EL+ PC  C+ +D  L   ++    +
Sbjct  17   ALALAFN--EWLLMLMLFVNSIFSYVIARFADYSELQSPCLMCSNLDHILGRTKHSKKPH  74

Query  432  NDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFAPdkdssdyyaaddvkSV---N  602
             D IC  HK +ISSL YCH H K+ D++ MCE CL SFA    S+       V  +   +
Sbjct  75   WDMICSKHKSEISSLVYCHAHGKLVDVRGMCETCLFSFATTNKSNAETYRLLVGKLGDNS  134

Query  603  VFADK------PNFQR---CSCCMEFLGGKGKYTRSMSQVA  698
             F  K      PN  +   C+CC +  G +   T + +QVA
Sbjct  135  YFGSKTGRSTNPNCSKLTDCTCCNQLWGTQ---TAAATQVA  172


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  1047  LKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRMMEE  1226
             LKRQV  +RK L  +  EL+EER+ASA+A N AMAMITRLQ EKAS  M+A Q  RMMEE
Sbjct  840   LKRQVDYDRKLLTGLYKELEEERSASAVATNQAMAMITRLQEEKASFQMEALQNLRMMEE  899

Query  1227  QAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             QAEYD E  Q L D++++RE+ I+ LE++++ +RD+
Sbjct  900   QAEYDMEAIQRLNDLLVEREKLIQDLEAEIEYFRDQ  935



>ref|XP_002871733.1| hypothetical protein ARALYDRAFT_909657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47992.1| hypothetical protein ARALYDRAFT_909657 [Arabidopsis lyrata subsp. 
lyrata]
Length=688

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             I+ L+  V  E+++L  +  EL+EER+ASAI+AN  MAMITRLQ EKA   M+A QYQRM
Sbjct  362   IERLRETVRAEQEALRDLYAELEEERSASAISANQTMAMITRLQEEKAKVQMEALQYQRM  421

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDK  1334
             MEEQAEYD+E  Q+L  +++KRE+E E L+ +L+VYR K
Sbjct  422   MEEQAEYDQEALQLLNHLMVKREKEKEQLQRELEVYRAK  460


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  219  FRCFIEQNLGRSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQ  398
            F   + +N  R  + L+Y+ LE++++  + ++ F  +F  +FA FF LK  C  C ++D+
Sbjct  6    FATKLSRNTNRITVILVYAFLEWLLMFFIFLNSFFTYFIVKFASFFGLKQVCLLCPKLDR  65

Query  399  ALVHRNLN-FYYNDTICESHKRDISSLSYCHVHKKISDIKTMCENC  533
                   N F Y + +C++H  +++SLS+C  H K+S+   +C +C
Sbjct  66   IFERNPENRFTYRELLCQNHIAELASLSFCTTHGKLSESANLCSDC  111



>gb|KEH24568.1| zein-binding protein [Medicago truncatula]
Length=873

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +3

Query  249  RSALFLIYSVLEFVMIVLLLVDGFLAFFSYEFAKFFELKMPCFFCTRIDQALVHRNLNFY  428
            R    L  ++LE+++I+ L +    ++   +FA + +LK PC FC+R+D  L  +    Y
Sbjct  21   RITTSLASALLEWLLIIFLFISAIFSYVITKFANYCKLKTPCLFCSRLDHVL-GKQKRGY  79

Query  429  YNDTICESHKRDISSLSYCHVHKKISDIKTMCENCLLSFA  548
            Y D IC  HK +IS L +C  H K+ +I+ +CE C+LS A
Sbjct  80   YLDLICSLHKSEISELVFCRAHDKLVNIQGVCETCVLSSA  119


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  1038  IQHLKRQVLLERKSLVSVCMELDEERnasaiaannamamiTRLQAEKASKHMQASQYQRM  1217
             +  LKRQV  +RK + ++  EL+EERNASAIAA+ A+AMITRLQ EKA+ HM+A Q+ RM
Sbjct  537   VDKLKRQVDHDRKLMNALYKELEEERNASAIAASQALAMITRLQEEKATLHMEALQHLRM  596

Query  1218  MEEQAEYDREEKQILKDMILKREEEIEALESDLDVYRDKF  1337
             M+EQ+EY+ E  Q   D++ ++E+E+E LE+ ++ YR KF
Sbjct  597   MDEQSEYELEALQKANDLLAEKEKELEDLEAKVEFYRKKF  636



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4673920521768