BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24558_g3_i1 len=1720 path=[1:0-833 835:834-859 4912:860-1719]

Length=1720
                                                                      Score     E

ref|XP_009764197.1|  PREDICTED: uncharacterized acetyltransferase...    453   1e-150   
ref|XP_009625193.1|  PREDICTED: uncharacterized acetyltransferase...    447   3e-148   
ref|XP_009782781.1|  PREDICTED: uncharacterized acetyltransferase...    446   6e-148   
ref|XP_004244447.2|  PREDICTED: uncharacterized acetyltransferase...    439   2e-145   
ref|XP_006342478.1|  PREDICTED: uncharacterized acetyltransferase...    438   9e-145   
ref|XP_004253191.2|  PREDICTED: uncharacterized acetyltransferase...    435   2e-143   
ref|XP_006367771.1|  PREDICTED: uncharacterized acetyltransferase...    427   2e-140   
ref|XP_011071701.1|  PREDICTED: uncharacterized acetyltransferase...    417   6e-137   
gb|ABK94771.1|  unknown                                                 400   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_002304177.2|  hypothetical protein POPTR_0003s05590g             399   8e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009589621.1|  PREDICTED: uncharacterized acetyltransferase...    399   2e-129   
ref|XP_002304178.2|  anthranilate N-hydroxycinnamoyl/benzoyltrans...    394   5e-128   Populus trichocarpa [western balsam poplar]
gb|ABK94986.1|  unknown                                                 394   5e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007047323.1|  HXXXD-type acyl-transferase family protein, ...    393   2e-127   
ref|XP_007204351.1|  hypothetical protein PRUPE_ppa005715mg             392   4e-127   
ref|XP_011000815.1|  PREDICTED: uncharacterized acetyltransferase...    392   5e-127   
ref|XP_009762458.1|  PREDICTED: uncharacterized acetyltransferase...    391   2e-126   
ref|XP_008241487.1|  PREDICTED: uncharacterized acetyltransferase...    390   2e-126   
ref|XP_006480712.1|  PREDICTED: uncharacterized acetyltransferase...    390   3e-126   
ref|XP_008241486.1|  PREDICTED: uncharacterized acetyltransferase...    390   5e-126   
ref|XP_009625194.1|  PREDICTED: uncharacterized acetyltransferase...    389   5e-126   
ref|XP_002533255.1|  Anthranilate N-benzoyltransferase protein, p...    389   1e-125   Ricinus communis
ref|XP_006428978.1|  hypothetical protein CICLE_v10011715mg             388   3e-125   
ref|XP_007203275.1|  hypothetical protein PRUPE_ppa025470mg             387   8e-125   
ref|XP_007204343.1|  hypothetical protein PRUPE_ppa005635mg             386   9e-125   
ref|XP_004289208.1|  PREDICTED: uncharacterized acetyltransferase...    387   1e-124   
ref|XP_009343279.1|  PREDICTED: uncharacterized acetyltransferase...    386   2e-124   
ref|XP_006480713.1|  PREDICTED: uncharacterized acetyltransferase...    385   2e-124   
ref|XP_009367311.1|  PREDICTED: uncharacterized acetyltransferase...    385   5e-124   
ref|XP_008361493.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    384   8e-124   
ref|XP_008382283.1|  PREDICTED: uncharacterized acetyltransferase...    384   8e-124   
ref|XP_010274412.1|  PREDICTED: uncharacterized acetyltransferase...    384   1e-123   
ref|XP_002282951.2|  PREDICTED: uncharacterized protein LOC100245729    394   4e-122   Vitis vinifera
ref|XP_009589622.1|  PREDICTED: uncharacterized acetyltransferase...    377   3e-121   
ref|XP_008342727.1|  PREDICTED: uncharacterized acetyltransferase...    377   5e-121   
ref|XP_007047327.1|  HXXXD-type acyl-transferase family protein, ...    377   6e-121   
ref|XP_009338991.1|  PREDICTED: uncharacterized acetyltransferase...    376   9e-121   
ref|XP_002282930.1|  PREDICTED: uncharacterized acetyltransferase...    375   2e-120   Vitis vinifera
ref|XP_004231858.1|  PREDICTED: uncharacterized acetyltransferase...    375   2e-120   
ref|XP_008338333.1|  PREDICTED: uncharacterized acetyltransferase...    375   2e-120   
ref|XP_008367983.1|  PREDICTED: uncharacterized acetyltransferase...    375   3e-120   
ref|XP_011071710.1|  PREDICTED: uncharacterized acetyltransferase...    372   1e-119   
ref|XP_008351423.1|  PREDICTED: uncharacterized acetyltransferase...    373   2e-119   
gb|EYU35826.1|  hypothetical protein MIMGU_mgv1a006141mg                372   3e-119   
emb|CBI21394.3|  unnamed protein product                                372   5e-119   
gb|KDP31965.1|  hypothetical protein JCGZ_12426                         369   6e-118   
ref|XP_006339875.1|  PREDICTED: uncharacterized acetyltransferase...    366   6e-117   
ref|XP_004288019.1|  PREDICTED: uncharacterized acetyltransferase...    366   9e-117   
gb|KHN18660.1|  Putative acetyltransferase                              363   5e-116   
ref|XP_007204008.1|  hypothetical protein PRUPE_ppa025918mg             362   5e-115   
ref|XP_007021469.1|  HXXXD-type acyl-transferase family protein, ...    360   7e-115   
ref|XP_007204342.1|  hypothetical protein PRUPE_ppa005630mg             360   2e-114   
gb|KDP31964.1|  hypothetical protein JCGZ_12425                         359   3e-114   
ref|XP_003549969.1|  PREDICTED: uncharacterized acetyltransferase...    358   4e-114   
ref|XP_007203667.1|  hypothetical protein PRUPE_ppa026934mg             357   1e-113   
ref|XP_004511082.1|  PREDICTED: uncharacterized acetyltransferase...    357   2e-113   
gb|KEH31452.1|  anthranilate N-benzoyltransferase                       357   3e-113   
ref|XP_004509128.1|  PREDICTED: uncharacterized acetyltransferase...    356   3e-113   
ref|XP_003524646.1|  PREDICTED: uncharacterized acetyltransferase...    356   4e-113   
ref|XP_004230696.1|  PREDICTED: uncharacterized acetyltransferase...    352   5e-111   
gb|AAV50009.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase      344   3e-109   Malus domestica [apple tree]
ref|XP_004288018.1|  PREDICTED: uncharacterized acetyltransferase...    345   1e-108   
ref|XP_008352605.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    343   5e-108   
ref|XP_004230695.1|  PREDICTED: uncharacterized acetyltransferase...    343   1e-107   
gb|KEH31455.1|  anthranilate N-benzoyltransferase                       341   4e-107   
ref|XP_003628043.1|  Acetyltransferase, putative                        340   5e-107   
ref|XP_006346306.1|  PREDICTED: uncharacterized acetyltransferase...    341   8e-107   
ref|XP_010314808.1|  PREDICTED: uncharacterized acetyltransferase...    337   9e-107   
ref|XP_004509127.1|  PREDICTED: uncharacterized acetyltransferase...    340   1e-106   
ref|XP_006346302.1|  PREDICTED: uncharacterized acetyltransferase...    338   6e-106   
gb|KEH31453.1|  HXXXD-type acyl-transferase family protein              337   1e-105   
ref|XP_003602051.1|  Acetyltransferase, putative                        336   2e-105   
ref|XP_010915552.1|  PREDICTED: uncharacterized acetyltransferase...    336   3e-105   
gb|KEH16419.1|  HXXXD-type acyl-transferase family protein              335   4e-105   
ref|XP_009349545.1|  PREDICTED: uncharacterized acetyltransferase...    336   6e-105   
ref|XP_002523237.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    333   2e-104   Ricinus communis
ref|XP_007155908.1|  hypothetical protein PHAVU_003G242200g             333   2e-104   
ref|XP_008361429.1|  PREDICTED: uncharacterized acetyltransferase...    332   2e-103   
ref|XP_010109793.1|  putative acetyltransferase                         332   2e-103   
gb|KHN15623.1|  Putative acetyltransferase                              331   2e-103   
ref|XP_003550055.1|  PREDICTED: uncharacterized acetyltransferase...    331   2e-103   
ref|XP_008352555.1|  PREDICTED: uncharacterized acetyltransferase...    331   4e-103   
gb|KEH31450.1|  HXXXD-type acyl-transferase family protein              330   5e-103   
ref|XP_010915553.1|  PREDICTED: uncharacterized acetyltransferase...    330   7e-103   
ref|XP_003638160.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    330   7e-103   
ref|XP_004233972.1|  PREDICTED: uncharacterized acetyltransferase...    329   2e-102   
ref|XP_010317216.1|  PREDICTED: uncharacterized acetyltransferase...    329   2e-102   
ref|XP_007136698.1|  hypothetical protein PHAVU_009G066300g             328   3e-102   
ref|XP_008338376.1|  PREDICTED: uncharacterized acetyltransferase...    326   2e-101   
ref|XP_007203377.1|  hypothetical protein PRUPE_ppa025976mg             324   8e-101   
ref|XP_003629582.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    324   1e-100   
gb|KEH29083.1|  HXXXD-type acyl-transferase family protein              324   1e-100   
ref|XP_010270496.1|  PREDICTED: uncharacterized acetyltransferase...    324   2e-100   
ref|XP_003604963.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    322   6e-100   
ref|XP_010109796.1|  putative acetyltransferase                         324   1e-99    
ref|XP_007024494.1|  HXXXD-type acyl-transferase family protein, ...    320   4e-99    
gb|AFK35573.1|  unknown                                                 319   7e-99    
gb|EYU46590.1|  hypothetical protein MIMGU_mgv1a005681mg                316   3e-97    
ref|XP_008801989.1|  PREDICTED: uncharacterized acetyltransferase...    315   3e-97    
gb|ABC47847.1|  N-hydroxycinnamoyl/benzoyltransferase 5                 315   7e-97    Glycine max [soybeans]
gb|KEH33177.1|  HXXXD-type acyl-transferase family protein              313   2e-96    
gb|KHN04490.1|  Putative acetyltransferase                              314   2e-96    
ref|XP_007136704.1|  hypothetical protein PHAVU_009G066900g             312   8e-96    
ref|XP_007136696.1|  hypothetical protein PHAVU_009G066100g             311   9e-96    
ref|XP_009409404.1|  PREDICTED: uncharacterized acetyltransferase...    312   1e-95    
ref|XP_007136703.1|  hypothetical protein PHAVU_009G066800g             311   2e-95    
ref|XP_010933132.1|  PREDICTED: uncharacterized acetyltransferase...    309   6e-95    
ref|XP_008778923.1|  PREDICTED: uncharacterized acetyltransferase...    309   1e-94    
ref|XP_007136702.1|  hypothetical protein PHAVU_009G066700g             308   2e-94    
ref|XP_010927209.1|  PREDICTED: uncharacterized acetyltransferase...    308   2e-94    
ref|XP_007136697.1|  hypothetical protein PHAVU_009G066200g             308   4e-94    
ref|XP_003528298.1|  PREDICTED: uncharacterized acetyltransferase...    307   4e-94    
ref|XP_010558666.1|  PREDICTED: uncharacterized acetyltransferase...    307   6e-94    
ref|XP_006659753.1|  PREDICTED: uncharacterized acetyltransferase...    307   6e-94    
ref|XP_007136701.1|  hypothetical protein PHAVU_009G066600g             307   7e-94    
ref|XP_006385480.1|  anthranilate N-hydroxycinnamoyl/benzoyltrans...    303   8e-94    
ref|XP_003605002.1|  Acetyltransferase, putative                        306   8e-94    
ref|XP_003603061.1|  N-hydroxycinnamoyl/benzoyltransferase              306   1e-93    
gb|AES73312.2|  HXXXD-type acyl-transferase family protein              306   1e-93    
ref|XP_003605008.1|  Acetyltransferase, putative                        305   1e-93    
emb|CDP11973.1|  unnamed protein product                                305   2e-93    
ref|XP_010924632.1|  PREDICTED: uncharacterized acetyltransferase...    305   3e-93    
ref|XP_009115699.1|  PREDICTED: uncharacterized acetyltransferase...    305   3e-93    
ref|XP_010110811.1|  putative acetyltransferase                         305   3e-93    
ref|XP_006360905.1|  PREDICTED: uncharacterized acetyltransferase...    303   4e-93    
ref|XP_008787703.1|  PREDICTED: uncharacterized acetyltransferase...    304   7e-93    
ref|XP_003604999.1|  Acetyltransferase, putative                        303   8e-93    
ref|NP_201516.1|  HXXXD-type acyl-transferase-like protein              303   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003523954.1|  PREDICTED: uncharacterized acetyltransferase...    303   1e-92    
emb|CDP11972.1|  unnamed protein product                                302   3e-92    
gb|KHN04489.1|  Putative acetyltransferase                              303   5e-92    
ref|XP_007149064.1|  hypothetical protein PHAVU_005G037900g             302   5e-92    
gb|ABC47861.1|  N-hydroxycinnamoyl/benzoyltransferase 2                 301   6e-92    Glycine max [soybeans]
ref|XP_003622067.1|  Acetyltransferase, putative                        300   2e-91    
ref|XP_003523950.1|  PREDICTED: uncharacterized acetyltransferase...    300   4e-91    
gb|ACU18586.1|  unknown                                                 300   4e-91    Glycine max [soybeans]
ref|XP_006385479.1|  hypothetical protein POPTR_0003s05570g             295   5e-91    
gb|KHN04491.1|  Putative acetyltransferase                              300   5e-91    
ref|XP_008452574.1|  PREDICTED: uncharacterized acetyltransferase...    299   7e-91    
ref|XP_003523662.1|  PREDICTED: uncharacterized acetyltransferase...    299   8e-91    
ref|XP_009103449.1|  PREDICTED: uncharacterized acetyltransferase...    297   2e-90    
gb|KFK28407.1|  hypothetical protein AALP_AA8G510900                    297   3e-90    
ref|XP_004501558.1|  PREDICTED: uncharacterized acetyltransferase...    297   3e-90    
ref|XP_004291090.1|  PREDICTED: uncharacterized acetyltransferase...    297   3e-90    
ref|XP_008452578.1|  PREDICTED: uncharacterized acetyltransferase...    297   3e-90    
ref|XP_004141386.1|  PREDICTED: uncharacterized acetyltransferase...    296   7e-90    
ref|XP_006659752.1|  PREDICTED: uncharacterized acetyltransferase...    296   7e-90    
gb|AES73322.2|  HXXXD-type acyl-transferase family protein              296   8e-90    
ref|XP_002865024.1|  transferase family protein                         296   1e-89    
ref|XP_006393913.1|  hypothetical protein EUTSA_v10004238mg             295   1e-89    
gb|KGN55211.1|  hypothetical protein Csa_4G640970                       296   1e-89    
ref|XP_002444907.1|  hypothetical protein SORBIDRAFT_07g001180          296   2e-89    Sorghum bicolor [broomcorn]
ref|XP_004972479.1|  PREDICTED: uncharacterized acetyltransferase...    295   3e-89    
ref|NP_001143242.1|  uncharacterized protein LOC100275767               295   3e-89    Zea mays [maize]
ref|XP_004163245.1|  PREDICTED: uncharacterized acetyltransferase...    295   3e-89    
ref|XP_002284916.2|  PREDICTED: uncharacterized acetyltransferase...    294   5e-89    Vitis vinifera
gb|AES73315.2|  HXXXD-type acyl-transferase family protein              294   6e-89    
ref|XP_003603064.1|  N-hydroxycinnamoyl/benzoyltransferase              293   7e-89    
ref|XP_003603072.1|  N-hydroxycinnamoyl/benzoyltransferase              293   1e-88    
dbj|BAJ97438.1|  predicted protein                                      293   1e-88    
ref|XP_006280460.1|  hypothetical protein CARUB_v10026392mg             292   2e-88    
gb|KEH31451.1|  HXXXD-type acyl-transferase family protein              292   2e-88    
ref|XP_003523951.1|  PREDICTED: uncharacterized acetyltransferase...    293   2e-88    
emb|CAN78155.1|  hypothetical protein VITISV_032623                     296   2e-88    Vitis vinifera
ref|XP_004141387.1|  PREDICTED: uncharacterized acetyltransferase...    292   3e-88    
ref|XP_010927437.1|  PREDICTED: uncharacterized acetyltransferase...    291   4e-88    
ref|XP_002876021.1|  transferase family protein                         291   8e-88    
ref|XP_010426570.1|  PREDICTED: uncharacterized acetyltransferase...    291   8e-88    
ref|XP_009777111.1|  PREDICTED: uncharacterized acetyltransferase...    285   9e-88    
ref|NP_001060826.1|  Os08g0111300                                       291   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004163247.1|  PREDICTED: uncharacterized acetyltransferase...    291   1e-87    
emb|CDY01434.1|  BnaA07g12070D                                          290   1e-87    
ref|XP_003603067.1|  N-hydroxycinnamoyl/benzoyltransferase              290   2e-87    
ref|XP_008452576.1|  PREDICTED: uncharacterized acetyltransferase...    290   2e-87    
ref|XP_003571295.1|  PREDICTED: uncharacterized acetyltransferase...    290   3e-87    
ref|XP_010515389.1|  PREDICTED: uncharacterized acetyltransferase...    289   3e-87    
ref|XP_003525889.1|  PREDICTED: uncharacterized acetyltransferase...    289   3e-87    
ref|XP_010438408.1|  PREDICTED: uncharacterized acetyltransferase...    289   4e-87    
gb|ABC47860.1|  N-hydroxycinnamoyl/benzoyltransferase 1                 289   4e-87    Glycine max [soybeans]
ref|XP_004501559.1|  PREDICTED: uncharacterized acetyltransferase...    289   5e-87    
ref|XP_003571308.1|  PREDICTED: uncharacterized acetyltransferase...    289   5e-87    
ref|XP_004163246.1|  PREDICTED: uncharacterized acetyltransferase...    289   6e-87    
ref|XP_006404046.1|  hypothetical protein EUTSA_v10010370mg             288   7e-87    
emb|CDY12811.1|  BnaC07g16220D                                          289   8e-87    
gb|ACU20865.1|  unknown                                                 288   8e-87    Glycine max [soybeans]
gb|KHN22332.1|  Putative acetyltransferase                              288   9e-87    
ref|XP_004141265.1|  PREDICTED: uncharacterized acetyltransferase...    288   1e-86    
ref|XP_010447938.1|  PREDICTED: uncharacterized acetyltransferase...    288   1e-86    
ref|XP_004972476.1|  PREDICTED: uncharacterized acetyltransferase...    288   1e-86    
ref|XP_004141385.1|  PREDICTED: uncharacterized acetyltransferase...    288   1e-86    
ref|XP_006292899.1|  hypothetical protein CARUB_v10019164mg             287   2e-86    
ref|XP_004291089.1|  PREDICTED: uncharacterized acetyltransferase...    287   2e-86    
ref|XP_010426573.1|  PREDICTED: uncharacterized acetyltransferase...    286   3e-86    
emb|CDP06257.1|  unnamed protein product                                286   4e-86    
ref|XP_010692375.1|  PREDICTED: uncharacterized acetyltransferase...    286   5e-86    
ref|XP_003603071.1|  N-hydroxycinnamoyl/benzoyltransferase              297   6e-86    
gb|EAZ05362.1|  hypothetical protein OsI_27565                          286   7e-86    Oryza sativa Indica Group [Indian rice]
gb|EAZ05363.1|  hypothetical protein OsI_27566                          286   7e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_003523952.2|  PREDICTED: uncharacterized acetyltransferase...    286   8e-86    
ref|XP_010426574.1|  PREDICTED: uncharacterized acetyltransferase...    285   8e-86    
gb|KHN29658.1|  Putative acetyltransferase                              285   9e-86    
ref|NP_001060827.1|  Os08g0111800                                       285   1e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEE67923.1|  hypothetical protein OsJ_25794                          285   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010252439.1|  PREDICTED: uncharacterized acetyltransferase...    285   2e-85    
ref|XP_003566996.1|  PREDICTED: uncharacterized acetyltransferase...    285   2e-85    
emb|CDY47454.1|  BnaC09g31030D                                          285   2e-85    
gb|KDO84111.1|  hypothetical protein CISIN_1g044173mg                   284   3e-85    
emb|CDY39539.1|  BnaC07g07070D                                          284   3e-85    
ref|NP_001130851.1|  hypothetical protein                               285   3e-85    Zea mays [maize]
ref|XP_008452575.1|  PREDICTED: uncharacterized acetyltransferase...    284   3e-85    
ref|NP_001060828.1|  Os08g0112200                                       285   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452572.1|  PREDICTED: uncharacterized acetyltransferase...    284   4e-85    
ref|XP_006307509.1|  hypothetical protein CARUB_v10009133mg             283   5e-85    
ref|XP_007226559.1|  hypothetical protein PRUPE_ppa024441mg             283   6e-85    
ref|XP_008648377.1|  PREDICTED: uncharacterized acetyltransferase...    285   6e-85    
ref|XP_010110810.1|  putative acetyltransferase                         283   8e-85    
ref|XP_007017180.1|  HXXXD-type acyl-transferase family protein         283   9e-85    
ref|XP_006473294.1|  PREDICTED: uncharacterized acetyltransferase...    283   1e-84    
ref|XP_008220248.1|  PREDICTED: uncharacterized acetyltransferase...    283   1e-84    
ref|XP_010441191.1|  PREDICTED: uncharacterized acetyltransferase...    284   1e-84    
ref|XP_010503697.1|  PREDICTED: uncharacterized acetyltransferase...    282   2e-84    
ref|XP_004972478.1|  PREDICTED: uncharacterized acetyltransferase...    283   2e-84    
ref|XP_009102495.1|  PREDICTED: uncharacterized acetyltransferase...    282   2e-84    
ref|XP_007221613.1|  hypothetical protein PRUPE_ppb015328mg             281   3e-84    
ref|XP_010064180.1|  PREDICTED: uncharacterized acetyltransferase...    282   3e-84    
emb|CDP06258.1|  unnamed protein product                                281   4e-84    
ref|XP_006291132.1|  hypothetical protein CARUB_v10017245mg             281   4e-84    
ref|XP_008220251.1|  PREDICTED: uncharacterized acetyltransferase...    281   4e-84    
ref|XP_010677336.1|  PREDICTED: uncharacterized acetyltransferase...    281   5e-84    
ref|XP_010445080.1|  PREDICTED: uncharacterized acetyltransferase...    281   5e-84    
ref|XP_010444690.1|  PREDICTED: uncharacterized acetyltransferase...    281   5e-84    
ref|XP_010677339.1|  PREDICTED: uncharacterized acetyltransferase...    281   5e-84    
ref|XP_008393786.1|  PREDICTED: uncharacterized acetyltransferase...    281   6e-84    
ref|XP_009101733.1|  PREDICTED: uncharacterized acetyltransferase...    280   1e-83    
ref|XP_002316230.1|  transferase family protein                         280   1e-83    Populus trichocarpa [western balsam poplar]
emb|CDX83118.1|  BnaA01g21180D                                          280   1e-83    
ref|XP_008452577.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    280   2e-83    
ref|XP_009121271.1|  PREDICTED: uncharacterized acetyltransferase...    280   3e-83    
ref|XP_008378023.1|  PREDICTED: uncharacterized acetyltransferase...    279   3e-83    
ref|XP_010447937.1|  PREDICTED: uncharacterized acetyltransferase...    278   4e-83    
ref|XP_008347613.1|  PREDICTED: uncharacterized acetyltransferase...    279   4e-83    
gb|KDP41703.1|  hypothetical protein JCGZ_16110                         278   4e-83    
gb|KDP42394.1|  hypothetical protein JCGZ_02451                         278   5e-83    
gb|EEC82800.1|  hypothetical protein OsI_27569                          278   6e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_190597.1|  HXXXD-type acyl-transferase family protein            278   7e-83    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11280.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    278   7e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393787.1|  PREDICTED: uncharacterized acetyltransferase...    278   9e-83    
ref|XP_010059908.1|  PREDICTED: uncharacterized acetyltransferase...    278   1e-82    
ref|XP_003603068.1|  N-hydroxycinnamoyl/benzoyltransferase              276   1e-82    
ref|XP_008361421.1|  PREDICTED: uncharacterized acetyltransferase...    281   1e-82    
ref|NP_198629.2|  HXXXD-type acyl-transferase-like protein              277   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659050.1|  PREDICTED: uncharacterized acetyltransferase...    278   2e-82    
gb|KGN55210.1|  hypothetical protein Csa_4G640960                       276   2e-82    
ref|XP_010436746.1|  PREDICTED: uncharacterized acetyltransferase...    276   3e-82    
ref|XP_002870866.1|  hypothetical protein ARALYDRAFT_916554             275   4e-82    
ref|XP_009365277.1|  PREDICTED: uncharacterized acetyltransferase...    276   4e-82    
ref|XP_003580171.2|  PREDICTED: uncharacterized acetyltransferase...    276   5e-82    
gb|EAZ05408.1|  hypothetical protein OsI_27617                          276   5e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_010433186.1|  PREDICTED: uncharacterized acetyltransferase...    275   8e-82    
ref|XP_009359877.1|  PREDICTED: uncharacterized acetyltransferase...    275   1e-81    
gb|KDP42392.1|  hypothetical protein JCGZ_02449                         275   1e-81    
ref|XP_010059906.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    275   1e-81    
ref|XP_009775187.1|  PREDICTED: uncharacterized acetyltransferase...    275   1e-81    
ref|XP_011029557.1|  PREDICTED: uncharacterized acetyltransferase...    275   1e-81    
gb|ABR18470.1|  unknown                                                 274   1e-81    Picea sitchensis
ref|XP_010064177.1|  PREDICTED: uncharacterized acetyltransferase...    275   2e-81    
ref|XP_004141266.1|  PREDICTED: uncharacterized acetyltransferase...    274   2e-81    
ref|XP_004972480.1|  PREDICTED: uncharacterized acetyltransferase...    275   2e-81    
ref|XP_004171369.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    274   2e-81    
ref|NP_190599.2|  HXXXD-type acyl-transferase family protein            274   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002443750.1|  hypothetical protein SORBIDRAFT_07g001310          275   2e-81    Sorghum bicolor [broomcorn]
emb|CAB62309.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    274   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|EMT27286.1|  Putative acetyltransferase                              278   2e-81    
ref|XP_006374905.1|  transferase family protein                         274   3e-81    
ref|XP_010503698.1|  PREDICTED: uncharacterized acetyltransferase...    273   4e-81    
ref|XP_009613516.1|  PREDICTED: uncharacterized acetyltransferase...    273   6e-81    
ref|XP_006354858.1|  PREDICTED: uncharacterized acetyltransferase...    272   7e-81    
ref|XP_006354859.1|  PREDICTED: uncharacterized acetyltransferase...    272   1e-80    
ref|XP_006374906.1|  anthranilate N-hydroxycinamoyl/bensoiltransf...    272   1e-80    
ref|XP_010503699.1|  PREDICTED: uncharacterized acetyltransferase...    272   1e-80    
ref|XP_002467259.1|  hypothetical protein SORBIDRAFT_01g022200          272   1e-80    
emb|CDY07540.1|  BnaC06g15240D                                          271   2e-80    
ref|XP_010059907.1|  PREDICTED: uncharacterized acetyltransferase...    271   2e-80    
ref|XP_004289209.1|  PREDICTED: uncharacterized acetyltransferase...    267   2e-80    
ref|XP_006354860.1|  PREDICTED: uncharacterized acetyltransferase...    270   6e-80    
ref|XP_009103919.1|  PREDICTED: uncharacterized acetyltransferase...    270   6e-80    
ref|XP_006404045.1|  hypothetical protein EUTSA_v10011149mg             270   7e-80    
ref|XP_006659051.1|  PREDICTED: uncharacterized acetyltransferase...    270   8e-80    
ref|XP_008220250.1|  PREDICTED: uncharacterized acetyltransferase...    269   9e-80    
gb|KFK25764.1|  hypothetical protein AALP_AA8G156600                    269   1e-79    
ref|XP_004238137.1|  PREDICTED: uncharacterized acetyltransferase...    270   1e-79    
gb|KFK33265.1|  hypothetical protein AALP_AA6G352200                    268   1e-79    
ref|XP_010064179.1|  PREDICTED: uncharacterized acetyltransferase...    270   2e-79    
dbj|BAK07674.1|  predicted protein                                      269   2e-79    
gb|EMT11091.1|  Putative acetyltransferase                              268   2e-79    
ref|XP_006291128.1|  hypothetical protein CARUB_v10017241mg             268   2e-79    
ref|XP_004291088.1|  PREDICTED: uncharacterized acetyltransferase...    268   3e-79    
ref|XP_011076731.1|  PREDICTED: uncharacterized acetyltransferase...    269   3e-79    
ref|XP_002510186.1|  Anthranilate N-benzoyltransferase protein, p...    268   4e-79    
ref|XP_006435679.1|  hypothetical protein CICLE_v10031464mg             268   4e-79    
ref|NP_190596.1|  HXXXD-type acyl-transferase-like protein              268   4e-79    
ref|XP_002876020.1|  transferase family protein                         268   5e-79    
gb|EMT19626.1|  Putative acetyltransferase                              268   6e-79    
ref|XP_010412689.1|  PREDICTED: uncharacterized acetyltransferase...    267   6e-79    
ref|XP_010447942.1|  PREDICTED: uncharacterized acetyltransferase...    267   1e-78    
ref|XP_006293141.1|  hypothetical protein CARUB_v10019447mg             266   1e-78    
ref|XP_010431204.1|  PREDICTED: uncharacterized acetyltransferase...    265   2e-78    
gb|KDO69082.1|  hypothetical protein CISIN_1g012489mg                   265   5e-78    
ref|XP_010677650.1|  PREDICTED: uncharacterized acetyltransferase...    265   9e-78    
ref|XP_010503695.1|  PREDICTED: uncharacterized acetyltransferase...    264   1e-77    
ref|XP_009123701.1|  PREDICTED: uncharacterized acetyltransferase...    264   2e-77    
gb|KCW66379.1|  hypothetical protein EUGRSUZ_F00195                     263   2e-77    
ref|XP_007203290.1|  hypothetical protein PRUPE_ppa025724mg             261   2e-77    
ref|XP_003603062.1|  N-hydroxycinnamoyl/benzoyltransferase              271   2e-77    
emb|CDY01691.1|  BnaC04g30610D                                          263   2e-77    
gb|AFF19201.1|  BAHD acyltransferase                                    264   2e-77    
ref|NP_196404.1|  HXXXD-type acyl-transferase family protein            263   3e-77    
dbj|BAF01091.1|  N-hydroxycinnamoyl/benzoyltransferase - like pro...    263   3e-77    
ref|XP_009399826.1|  PREDICTED: uncharacterized acetyltransferase...    262   3e-77    
ref|XP_004239936.1|  PREDICTED: BAHD acyltransferase DCR-like           263   3e-77    
ref|XP_009139801.1|  PREDICTED: uncharacterized acetyltransferase...    263   3e-77    
gb|EPS57660.1|  hypothetical protein M569_17156                         262   4e-77    
ref|XP_006403341.1|  hypothetical protein EUTSA_v10003208mg             263   4e-77    
emb|CBI30421.3|  unnamed protein product                                264   4e-77    
emb|CDX74510.1|  BnaA04g08790D                                          262   4e-77    
gb|EEC79821.1|  hypothetical protein OsI_21274                          263   5e-77    
ref|XP_010107871.1|  putative acetyltransferase                         263   5e-77    
ref|XP_007205148.1|  hypothetical protein PRUPE_ppa005318mg             263   6e-77    
ref|XP_006434729.1|  hypothetical protein CICLE_v10003138mg             262   7e-77    
ref|XP_010101800.1|  BAHD acyltransferase DCR                           262   8e-77    
ref|XP_010442114.1|  PREDICTED: uncharacterized acetyltransferase...    262   8e-77    
ref|NP_196403.1|  HXXXD-type acyl-transferase family protein            262   9e-77    
emb|CBI31531.3|  unnamed protein product                                262   1e-76    
ref|XP_004957081.1|  PREDICTED: uncharacterized acetyltransferase...    262   1e-76    
emb|CDY24938.1|  BnaC03g22340D                                          261   2e-76    
gb|KDP44821.1|  hypothetical protein JCGZ_01321                         262   2e-76    
ref|XP_004239937.1|  PREDICTED: BAHD acyltransferase DCR-like           261   2e-76    
ref|NP_001056538.1|  Os06g0103200                                       261   3e-76    
ref|XP_002311205.2|  transferase family protein                         261   3e-76    
ref|XP_011036002.1|  PREDICTED: uncharacterized acetyltransferase...    261   4e-76    
dbj|BAK02497.1|  predicted protein                                      261   4e-76    
ref|XP_002436317.1|  hypothetical protein SORBIDRAFT_10g000330          261   4e-76    
ref|XP_010107873.1|  putative acetyltransferase                         259   5e-76    
gb|AAT38406.1|  HCBT-like putative PR                                   260   5e-76    
ref|XP_008239572.1|  PREDICTED: BAHD acyltransferase DCR                260   6e-76    
emb|CDY21238.1|  BnaC02g28850D                                          259   7e-76    
gb|KFK31810.1|  hypothetical protein AALP_AA6G161600                    259   7e-76    
ref|XP_004972474.1|  PREDICTED: uncharacterized acetyltransferase...    260   7e-76    
emb|CDX93218.1|  BnaC04g46780D                                          259   8e-76    
ref|XP_010423922.1|  PREDICTED: uncharacterized acetyltransferase...    260   9e-76    
ref|XP_006355659.1|  PREDICTED: BAHD acyltransferase DCR-like           259   9e-76    
ref|XP_006850498.1|  hypothetical protein AMTR_s00035p00220050          259   1e-75    
emb|CDY18724.1|  BnaA09g06710D                                          258   1e-75    
emb|CDP14056.1|  unnamed protein product                                259   1e-75    
ref|XP_007009084.1|  HXXXD-type acyl-transferase family protein         259   2e-75    
ref|XP_009139772.1|  PREDICTED: uncharacterized acetyltransferase...    258   2e-75    
ref|XP_011041436.1|  PREDICTED: uncharacterized acetyltransferase...    259   2e-75    
ref|XP_002871293.1|  transferase family protein                         258   2e-75    
ref|XP_006280430.1|  hypothetical protein CARUB_v10026362mg             258   3e-75    
gb|AAM69843.1|  HCBT-like putative defense response protein             261   3e-75    
gb|EMT06482.1|  Putative acetyltransferase                              258   3e-75    
ref|XP_006367422.1|  PREDICTED: uncharacterized acetyltransferase...    258   3e-75    
ref|XP_009781170.1|  PREDICTED: uncharacterized acetyltransferase...    258   3e-75    
ref|XP_007224078.1|  hypothetical protein PRUPE_ppa015472mg             258   4e-75    
emb|CCG48011.1|  HCBT-like defense response protein,putative,expr...    258   4e-75    
emb|CDY55902.1|  BnaAnng13950D                                          259   4e-75    
emb|CDX81073.1|  BnaC03g03270D                                          258   4e-75    
gb|EYU19983.1|  hypothetical protein MIMGU_mgv1a005405mg                258   5e-75    
emb|CDX71519.1|  BnaC04g17540D                                          256   7e-75    
ref|XP_004964259.1|  PREDICTED: uncharacterized acetyltransferase...    257   9e-75    
ref|XP_006291156.1|  hypothetical protein CARUB_v10017273mg             256   1e-74    
ref|XP_009602090.1|  PREDICTED: uncharacterized acetyltransferase...    256   1e-74    
emb|CDY48117.1|  BnaC02g03740D                                          258   1e-74    
ref|XP_004302658.1|  PREDICTED: BAHD acyltransferase DCR-like           256   1e-74    
ref|XP_010544154.1|  PREDICTED: uncharacterized acetyltransferase...    256   2e-74    
ref|XP_010464414.1|  PREDICTED: uncharacterized acetyltransferase...    255   2e-74    
gb|AAM73656.1|AF390211_1  AER                                           256   2e-74    
emb|CDY40431.1|  BnaA04g20860D                                          255   3e-74    
ref|XP_011084938.1|  PREDICTED: uncharacterized acetyltransferase...    256   3e-74    
ref|XP_010690020.1|  PREDICTED: uncharacterized acetyltransferase...    256   3e-74    
gb|AHB08888.1|  HXXXD-type acyl-transferase family protein              256   3e-74    
ref|XP_007047324.1|  HXXXD-type acyl-transferase family protein         251   3e-74    
ref|XP_004246337.2|  PREDICTED: uncharacterized acetyltransferase...    255   4e-74    
ref|XP_003557286.1|  PREDICTED: uncharacterized acetyltransferase...    255   4e-74    
ref|XP_010481938.1|  PREDICTED: uncharacterized acetyltransferase...    254   5e-74    
emb|CDY07045.1|  BnaA04g22700D                                          254   6e-74    
ref|XP_002865023.1|  transferase family protein                         253   7e-74    
ref|XP_008648721.1|  PREDICTED: uncharacterized acetyltransferase...    254   8e-74    
ref|XP_009370265.1|  PREDICTED: BAHD acyltransferase DCR-like           254   9e-74    
ref|XP_006405800.1|  hypothetical protein EUTSA_v10027774mg             253   1e-73    
ref|NP_201517.1|  BAHD acyltransferase family protein                   253   1e-73    
gb|AAK96747.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferas...    253   1e-73    
ref|XP_004239935.1|  PREDICTED: BAHD acyltransferase DCR                253   1e-73    
ref|XP_010426569.1|  PREDICTED: uncharacterized acetyltransferase...    253   2e-73    
ref|XP_002881688.1|  transferase family protein                         254   2e-73    
ref|XP_006363050.1|  PREDICTED: BAHD acyltransferase DCR-like           253   2e-73    
ref|XP_006393914.1|  hypothetical protein EUTSA_v10004231mg             252   3e-73    
ref|XP_009123702.1|  PREDICTED: uncharacterized acetyltransferase...    252   3e-73    
ref|XP_002436318.1|  hypothetical protein SORBIDRAFT_10g000340          253   3e-73    
emb|CDX81339.1|  BnaC09g07500D                                          252   3e-73    
ref|XP_010444687.1|  PREDICTED: uncharacterized acetyltransferase...    252   3e-73    
ref|XP_008801988.1|  PREDICTED: uncharacterized acetyltransferase...    250   4e-73    
ref|XP_002865022.1|  hypothetical protein ARALYDRAFT_919995             252   4e-73    
ref|XP_008449203.1|  PREDICTED: BAHD acyltransferase DCR-like           252   5e-73    
ref|NP_199097.1|  HXXXD-type acyl-transferase-like protein              252   5e-73    
ref|XP_009358855.1|  PREDICTED: uncharacterized acetyltransferase...    253   6e-73    
gb|EAZ38666.1|  hypothetical protein OsJ_23059                          252   7e-73    
ref|XP_006280479.1|  hypothetical protein CARUB_v10026415mg             251   8e-73    
ref|XP_006295818.1|  hypothetical protein CARUB_v10024944mg             252   8e-73    
ref|XP_010494242.1|  PREDICTED: uncharacterized acetyltransferase...    251   9e-73    
ref|XP_009123700.1|  PREDICTED: uncharacterized acetyltransferase...    251   1e-72    
ref|XP_010517384.1|  PREDICTED: uncharacterized acetyltransferase...    252   1e-72    
ref|XP_006355661.1|  PREDICTED: uncharacterized acetyltransferase...    251   1e-72    
ref|XP_004147890.1|  PREDICTED: BAHD acyltransferase DCR-like           251   1e-72    
ref|XP_009125428.1|  PREDICTED: uncharacterized acetyltransferase...    252   2e-72    
ref|XP_006480972.1|  PREDICTED: uncharacterized acetyltransferase...    251   2e-72    
ref|XP_006601956.1|  PREDICTED: uncharacterized acetyltransferase...    250   4e-72    
ref|XP_006429311.1|  hypothetical protein CICLE_v10011647mg             250   4e-72    
ref|XP_007163519.1|  hypothetical protein PHAVU_001G240800g             250   4e-72    
ref|XP_004289211.1|  PREDICTED: uncharacterized acetyltransferase...    246   4e-72    
gb|EMT09482.1|  Putative acetyltransferase                              249   4e-72    
ref|XP_006399268.1|  hypothetical protein EUTSA_v10013445mg             249   5e-72    
ref|XP_002308212.1|  transferase family protein                         249   6e-72    
ref|XP_006850491.1|  hypothetical protein AMTR_s00035p00187610          248   9e-72    
ref|XP_008241494.1|  PREDICTED: uncharacterized acetyltransferase...    245   9e-72    
ref|XP_010515390.1|  PREDICTED: uncharacterized acetyltransferase...    248   1e-71    
ref|NP_001060829.1|  Os08g0112300                                       249   1e-71    
ref|XP_008378022.1|  PREDICTED: uncharacterized acetyltransferase...    248   2e-71    
ref|XP_006287651.1|  hypothetical protein CARUB_v10000861mg             248   2e-71    
ref|NP_001058873.1|  Os07g0142700                                       248   2e-71    
gb|KFK44567.1|  hypothetical protein AALP_AA1G274300                    248   2e-71    
ref|XP_003519380.1|  PREDICTED: uncharacterized acetyltransferase...    248   2e-71    
ref|XP_009131022.1|  PREDICTED: uncharacterized acetyltransferase...    248   2e-71    
ref|XP_004162750.1|  PREDICTED: LOW QUALITY PROTEIN: BAHD acyltra...    248   2e-71    
ref|XP_007026775.1|  HXXXD-type acyl-transferase family protein         248   2e-71    
emb|CDY40314.1|  BnaA10g27540D                                          247   3e-71    
ref|XP_002526860.1|  Anthocyanin 5-aromatic acyltransferase, puta...    248   4e-71    
ref|XP_008388189.1|  PREDICTED: uncharacterized acetyltransferase...    247   5e-71    
ref|XP_007009085.1|  HXXXD-type acyl-transferase family protein         247   7e-71    
emb|CAD40568.2|  OSJNBa0069D17.11                                       246   8e-71    
gb|KDP24482.1|  hypothetical protein JCGZ_25046                         246   8e-71    
gb|AFF19200.1|  BAHD acyltransferase                                    247   8e-71    
ref|XP_010512943.1|  PREDICTED: uncharacterized acetyltransferase...    246   9e-71    
gb|AGT37414.1|  anthocyanin 5-aromatic acyltransferase                  246   9e-71    
gb|KFK25164.1|  hypothetical protein AALP_AA8G074700                    246   1e-70    
ref|XP_009143263.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-70    
ref|XP_010452751.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-70    
ref|XP_002322965.1|  transferase family protein                         246   1e-70    
ref|XP_009141856.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-70    
ref|XP_002871292.1|  transferase family protein                         245   2e-70    
ref|XP_009112358.1|  PREDICTED: uncharacterized acetyltransferase...    245   2e-70    
ref|NP_195741.1|  HXXXD-type acyl-transferase-like protein              246   2e-70    
ref|XP_003605004.1|  Acetyltransferase, putative                        243   2e-70    
emb|CDP09318.1|  unnamed protein product                                244   2e-70    
ref|XP_011019146.1|  PREDICTED: BAHD acyltransferase DCR                245   2e-70    
gb|KFK36890.1|  hypothetical protein AALP_AA4G185300                    245   2e-70    
ref|XP_002868804.1|  hypothetical protein ARALYDRAFT_330642             244   3e-70    
ref|XP_006399269.1|  hypothetical protein EUTSA_v10013445mg             245   3e-70    
gb|EMT30235.1|  Putative acetyltransferase                              244   3e-70    
gb|KDO53236.1|  hypothetical protein CISIN_1g0453721mg                  244   3e-70    
ref|XP_002873021.1|  transferase family protein                         245   3e-70    
gb|ABK28209.1|  unknown                                                 245   5e-70    
ref|XP_010667128.1|  PREDICTED: uncharacterized acetyltransferase...    244   5e-70    
gb|KFK28409.1|  hypothetical protein AALP_AA8G511100                    243   5e-70    
ref|XP_002276050.1|  PREDICTED: uncharacterized acetyltransferase...    244   6e-70    
ref|NP_181527.1|  HXXXD-type acyl-transferase-like protein              244   6e-70    
emb|CAN80937.1|  hypothetical protein VITISV_005841                     244   6e-70    
ref|XP_003545239.1|  PREDICTED: uncharacterized acetyltransferase...    244   7e-70    
ref|XP_011094979.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    244   7e-70    
ref|XP_009626925.1|  PREDICTED: uncharacterized acetyltransferase...    244   8e-70    
ref|XP_009103448.1|  PREDICTED: uncharacterized acetyltransferase...    243   9e-70    
gb|AES71111.2|  HXXXD-type acyl-transferase family protein              243   1e-69    
ref|XP_006398644.1|  hypothetical protein EUTSA_v10013380mg             244   1e-69    
ref|XP_006411242.1|  hypothetical protein EUTSA_v10016586mg             244   1e-69    
emb|CDY01433.1|  BnaA07g12060D                                          242   1e-69    
ref|XP_009601485.1|  PREDICTED: uncharacterized acetyltransferase...    243   1e-69    
ref|XP_010664927.1|  PREDICTED: uncharacterized acetyltransferase...    239   2e-69    
emb|CDX78313.1|  BnaA03g02250D                                          243   2e-69    
ref|XP_010666565.1|  PREDICTED: uncharacterized acetyltransferase...    242   2e-69    
ref|XP_010412688.1|  PREDICTED: uncharacterized acetyltransferase...    241   3e-69    
ref|XP_006355660.1|  PREDICTED: uncharacterized acetyltransferase...    242   4e-69    
ref|XP_008442462.1|  PREDICTED: uncharacterized acetyltransferase...    243   4e-69    
gb|AFK36953.1|  unknown                                                 239   4e-69    
ref|XP_010452012.1|  PREDICTED: uncharacterized acetyltransferase...    242   5e-69    
ref|XP_010095065.1|  BAHD acyltransferase DCR                           242   5e-69    
emb|CBI21396.3|  unnamed protein product                                238   6e-69    
ref|XP_010549240.1|  PREDICTED: uncharacterized acetyltransferase...    241   9e-69    
ref|XP_004137729.1|  PREDICTED: BAHD acyltransferase DCR-like           241   9e-69    
gb|EAZ30436.1|  hypothetical protein OsJ_14486                          240   1e-68    
emb|CDX74815.1|  BnaA05g05610D                                          239   1e-68    
ref|XP_009141855.1|  PREDICTED: uncharacterized acetyltransferase...    241   2e-68    
ref|XP_006287610.1|  hypothetical protein CARUB_v10000822mg             241   2e-68    
ref|XP_007141793.1|  hypothetical protein PHAVU_008G226200g             241   2e-68    
gb|EYU40126.1|  hypothetical protein MIMGU_mgv1a021786mg                235   2e-68    
ref|XP_006591380.1|  PREDICTED: uncharacterized acetyltransferase...    241   2e-68    
ref|XP_007133941.1|  hypothetical protein PHAVU_010G005200g             240   3e-68    
ref|XP_010256629.1|  PREDICTED: BAHD acyltransferase DCR                240   3e-68    
ref|XP_010491403.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-68    
emb|CDY18638.1|  BnaA09g07570D                                          239   3e-68    
ref|XP_002531355.1|  Anthocyanin 5-aromatic acyltransferase, puta...    239   4e-68    



>ref|XP_009764197.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=454

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 307/457 (67%), Gaps = 23/457 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS--RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--  258
             IS C V  + +  +   +   ++E+TPWDLQFL +  IQKGLLF  PTPQQ+   F S  
Sbjct  7     ISTCLVKLSSSNNNGNNTTISQIEMTPWDLQFLLVDTIQKGLLFKKPTPQQENTLFKSFS  66

Query  259   --NLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTV  432
               +LI HLKTSLS  LDFFPPLAG F+T  N  D+T S ++ CNNAGVEF  A A  +TV
Sbjct  67    SLSLIDHLKTSLSRALDFFPPLAGHFSTTKNAHDDTISFFITCNNAGVEFTHAIAPQLTV  126

Query  433   AAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGT  612
               IL+  +  VP I+ SLF LN + N + + KPL+G+Q+TEL+DGYFI CT++HS+GDGT
Sbjct  127   EEILE--SCYVPPIVHSLFPLNKMCNIERVTKPLLGIQVTELVDGYFIGCTMSHSVGDGT  184

Query  613   SFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSE-----RLPPPQR  777
              FWNFFNSW+E+S G    S  P+ +RWFP+N    P+HLP  +E  E      LPP   
Sbjct  185   CFWNFFNSWSEISNGSEFISRFPVLKRWFPENIKP-PIHLPLKLEDQELYECMELPP---  240

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSN-EDVHL  954
               L ER+FHLSK NI +LK K+NSEMGT  ISSLQ+++AHLWR++TR R LHS  E+V +
Sbjct  241   --LKERIFHLSKENIGKLKAKSNSEMGTKSISSLQAFLAHLWRSITRCRQLHSKEEEVTI  298

Query  955   ILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             I+ +G R R+  P  EGYWGNA +F    I AG++L KGLGW A QI K V   ++ + V
Sbjct  299   IIVVGTRPRLNPPLAEGYWGNAAYFKPVKITAGELLEKGLGWAALQINKIVASQNN-DVV  357

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
              K+Y ++VE P          +N L ISSSP+F VY  DFGWGKPV VRSG  NK DGKV
Sbjct  358   VKLYKEWVEKPVLFTKSSLFVANRLTISSSPKFSVYSTDFGWGKPVAVRSGIANKGDGKV  417

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             TLF G EEGSVDIE+ + P TLL +END EF+E  T+
Sbjct  418   TLFPGAEEGSVDIEVCLLPKTLLAMENDEEFMEAVTV  454



>ref|XP_009625193.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Nicotiana tomentosiformis]
Length=457

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 242/460 (53%), Positives = 307/460 (67%), Gaps = 26/460 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS------RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqff  252
             IS C VGAA    S+  +       ++E+TPWDLQFL +  IQKGLLF  PTPQQ+   F
Sbjct  7     ISTCLVGAASKLSSSNNNGNNTTISQIEMTPWDLQFLLVDTIQKGLLFRKPTPQQENTLF  66

Query  253   NSNL----IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKAS  420
              S      I HLKTSLS TLDFFPPLAGRF+T  N  D+T S ++ CNNAGVEF  A A 
Sbjct  67    KSLSSLSLIDHLKTSLSRTLDFFPPLAGRFSTTKNANDDTISFFITCNNAGVEFTHAIAP  126

Query  421   GVTVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSL  600
              +TV  IL+  +  VP I+ SLF LN + N + + KPL+G+Q+TEL++GYFI CT++HS+
Sbjct  127   ELTVEEILE--SCYVPPIVHSLFPLNKMRNIECVTKPLLGIQVTELVNGYFIGCTMSHSV  184

Query  601   GDGTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSE-----RLP  765
             GDGT FWNFFNSW+E+S G    S  P+ +RWFP+N    P+HLP  +E  E      LP
Sbjct  185   GDGTCFWNFFNSWSEISSGSEFISRLPVLKRWFPENIKP-PIHLPLNLEDQELYECMELP  243

Query  766   PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
             P     L ER+FHLSK +I +LK KANSEMGT+ ISSLQ+++AHLW++VTR R L S E+
Sbjct  244   P-----LKERIFHLSKESIGKLKAKANSEMGTNSISSLQAFLAHLWKSVTRCRQLDSKEE  298

Query  946   VHLILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
             V + + +G R R+  P  EGYWGNA +F      AG++L KGLGW A Q+ K +   ++ 
Sbjct  299   VTISIVVGTRPRLNPPLAEGYWGNAAYFKPVKRTAGELLEKGLGWAALQMNKIIASQNN-  357

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
             EEV K+Y ++VE P          +N L ISSSP+F VY  DFGWGK V VRSG  NK D
Sbjct  358   EEVVKLYKEWVEKPVLFTKGSLFVANRLTISSSPKFSVYSTDFGWGKAVAVRSGMANKGD  417

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GKVTLF G EEGSVDIE+ + P TLL +END EF++  T+
Sbjct  418   GKVTLFPGAEEGSVDIEVCLLPETLLAMENDEEFMKAVTV  457



>ref|XP_009782781.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=441

 Score =   446 bits (1146),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 301/446 (67%), Gaps = 16/446 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAA--RSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNL  264
             IS   VG         N +S+ +E+TPWDLQFL +  IQKGLLFH P         N++ 
Sbjct  7     ISTSLVGTTSNILNSENNISK-IEMTPWDLQFLLLDTIQKGLLFHKPK-------ENTSF  58

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAIL  444
             I H+KTSLS TL+FFPPL+GRF+TV N +D+T S+ +DCNNAGVEF  A A  +TV+AIL
Sbjct  59    IEHIKTSLSRTLNFFPPLSGRFSTVKNADDDTISIVIDCNNAGVEFTHAVAPLLTVSAIL  118

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
             +  +++VP I+ +LF LN + N + + KPL+GVQ+TEL+DGYFI C +NHSLGDGT FW+
Sbjct  119   E--SVHVPPIIHTLFPLNNVRNFECVSKPLLGVQVTELIDGYFIGCAMNHSLGDGTCFWH  176

Query  625   FFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFH  804
             FFNSW+E+SRG+   S  P+  RWFP+N    P+HLP  ++  +     +   L ER+FH
Sbjct  177   FFNSWSEISRGYEIISKIPVSNRWFPEN-MNLPIHLPLKLDDEKLFEVFEIPHLKERIFH  235

Query  805   LSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
             LSK +IA+LK KANSEM T  ISSLQ+++AHLWR+VTR R L + E+V + L IG R+R+
Sbjct  236   LSKESIAKLKGKANSEMETKSISSLQAFLAHLWRSVTRCRKLDAKEEVVIGLIIGTRSRL  295

Query  985   G--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
                LPE Y+GNA+        AG++L  GLGW A ++ K V    + EEV K+Y ++ E+
Sbjct  296   NPPLPEVYFGNAIHVKRVKTTAGELLENGLGWAAMELNKVVNSQ-NSEEVVKIYKEWAEN  354

Query  1159  PAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
             P           + L ISSSPR ++Y  DFGWGKPV VRSG  NK DGK+TLF G EEGS
Sbjct  355   PVLFSKSTLFVGSKLAISSSPRHNIYNTDFGWGKPVAVRSGMANKSDGKITLFPGVEEGS  414

Query  1339  VDIELSIHPHTLLGLENDAEFLEYFT  1416
             VDIE+   P TL  +END+EF+E  T
Sbjct  415   VDIEICCLPKTLQAMENDSEFMEAVT  440



>ref|XP_004244447.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=437

 Score =   439 bits (1129),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 293/445 (66%), Gaps = 18/445 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S C V A+  + S  V+  +E+TPWDLQFL +  IQKGLLFH P  +          I 
Sbjct  7     VSSCLVRAS--SNSQNVNLNIEITPWDLQFLLVDTIQKGLLFHKPKKEN---------ID  55

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             +LK SLS TL FFPPLAGRF+ V N +D T S +++CNNAGVEF+ A AS ++V+ I+D 
Sbjct  56    NLKKSLSHTLHFFPPLAGRFSIVKNSDDETISFFINCNNAGVEFIHANASKLSVSMIIDS  115

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             +   VP I+ SLF LN I N +G+ KPL GVQITEL+DGYFI CT+NH+LGDGT FW+FF
Sbjct  116   TY--VPNIIHSLFPLNNIRNFEGVTKPLFGVQITELVDGYFIGCTMNHTLGDGTCFWHFF  173

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLS  810
             NSWAE+SRG    S  PI ER+FP+     P+H P  ++  +     +   L +RVFHLS
Sbjct  174   NSWAEISRGRKIISRVPILERYFPEKIHV-PIHFPMNLDDEKLFEKIEIPTLVKRVFHLS  232

Query  811   KVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGL  990
             K NI RLK+KAN EM  + ISSLQ+Y+AHLWR VTR R +   E+V++ + IG R+R+  
Sbjct  233   KENITRLKKKANDEMSINSISSLQAYLAHLWRCVTRCRKIDDREEVYIGILIGARSRLKP  292

Query  991   P--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP-  1161
             P  EGY+GNAV        A ++L  GLGWVA QI K V   +  +EV KMY  ++E+P 
Sbjct  293   PLLEGYFGNAVHIKIVKTSARELLENGLGWVAMQINKMVVSQN-SKEVIKMYKGWIENPI  351

Query  1162  AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSV  1341
               N   +      L I SS RF++YG DFGWGKP+ VRSG  NK DG +TLF G  EGSV
Sbjct  352   IFNKTRVFVDETRLSIGSSTRFNIYGNDFGWGKPIGVRSGMANKRDGGITLFQGANEGSV  411

Query  1342  DIELSIHPHTLLGLENDAEFLEYFT  1416
             DIE+ + PHTL  +END EF+E  T
Sbjct  412   DIEVCMCPHTLQAMENDQEFMEMVT  436



>ref|XP_006342478.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=455

 Score =   438 bits (1126),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 230/453 (51%), Positives = 299/453 (66%), Gaps = 14/453 (3%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNG---VSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS-  258
             IS C V A+  + + G   +S+ +E+TPWDLQFL +  IQKGLLF  PTPQQQ     S 
Sbjct  7     ISTCLVRASSNSNNGGNKHISQNIEMTPWDLQFLLVETIQKGLLFKKPTPQQQNNLVKSL  66

Query  259   ---NLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVY-VDCNNAGVEFVEAKASGV  426
                +L+ HLK SL+ TLDFFPPL GR++T  N  DNT + + + CNN+G EF  A A  +
Sbjct  67    NSLSLVDHLKASLARTLDFFPPLVGRYSTTKNPNDNTITSFSITCNNSGAEFTHAIAPEL  126

Query  427   TVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGD  606
             TV  IL+  +  VP I+ SLF LN + N   + KPL+GVQ+TEL+DGYFI CT++HSLGD
Sbjct  127   TVKEILE--SCYVPTIVHSLFPLNKVRNMQCVTKPLLGVQVTELVDGYFIGCTMSHSLGD  184

Query  607   GTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             GT FW+FFNSW+E++RGF   S  P  ERWFP N    P++ P  +   +         L
Sbjct  185   GTCFWHFFNSWSEITRGFELISQFPALERWFPQNINP-PIYFPLELVDEKLYECIDMPIL  243

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ER+FHLSK N+ +LK KANSEM T  ISSLQ+++AHLWR+VTR   +++NE+V L + +
Sbjct  244   KERIFHLSKENVCKLKAKANSEMDTKSISSLQAFLAHLWRSVTRCNCVNANEEVTLNIIV  303

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             G R R+   LP+ YWGNAV   +  +KAG++L   LG+ A QI K V   ++ EEV   Y
Sbjct  304   GTRTRLNPPLPQEYWGNAVILKSIKVKAGELLENQLGFSALQINKVVVSQNY-EEVIDSY  362

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
               +VE P     ++   +N L ISSSP+F VY  DFGWGKPV VRSG  NK DGKVTLF 
Sbjct  363   KGWVEKPVMFSKKLLLMANKLSISSSPKFSVYSCDFGWGKPVGVRSGMANKGDGKVTLFP  422

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             G EEGSVDIE+ +   TLL +END EF+E+ T+
Sbjct  423   GVEEGSVDIEVCLLTSTLLAMENDEEFMEFVTV  455



>ref|XP_004253191.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum lycopersicum]
Length=454

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 231/453 (51%), Positives = 300/453 (66%), Gaps = 15/453 (3%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGV---SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS-  258
             +S C V A+  + +NG+   S+ +E+TPWDLQFL +  IQKGLLF  PTPQQQ     S 
Sbjct  7     VSTCVVRASSNS-NNGITHTSQNIEMTPWDLQFLLVETIQKGLLFKKPTPQQQNNLIKSL  65

Query  259   ---NLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVY-VDCNNAGVEFVEAKASGV  426
                +L+ HLK SLS TLDFFPPLAGRF+T  N  DNT + + + CNN+G EF  A A  +
Sbjct  66    NSLSLVDHLKASLSRTLDFFPPLAGRFSTTKNPNDNTITSFSITCNNSGAEFTHAIAPEL  125

Query  427   TVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGD  606
             TV  IL+     VP I+ S F LN + N   + KPL+GVQ+TEL+DGYFI CT++HSLGD
Sbjct  126   TVKEILESCY--VPTIVHSFFPLNKVRNVQCVTKPLLGVQVTELVDGYFIGCTMSHSLGD  183

Query  607   GTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             GT FW+FFNSW+E++RGF   S  P  ERWFP N    P++ P  ++  +     +   +
Sbjct  184   GTCFWHFFNSWSEITRGFELISRFPTLERWFPQNVNP-PIYFPLELDDEKLDVCMEMPIV  242

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFHLSK N+++LK KAN EM T  ISSLQ+++AHLWR VTR   +++NE+V L + I
Sbjct  243   KERVFHLSKENVSKLKAKANYEMDTKSISSLQAFLAHLWRCVTRCNRVNANEEVILNIVI  302

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             G R R+   LPE YWGNA       +KAG++L  GLG+ A  I K V   ++ EEV   Y
Sbjct  303   GTRTRLDPPLPEEYWGNAAIIKPIKVKAGELLENGLGYAALLINKVVASQNY-EEVMDSY  361

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              ++VE+P     +    +N L ISSSP+F+VY  DFGWGKPV VRSG  NK +GKVTLF 
Sbjct  362   RRWVENPVIVSKKSLFVANRLSISSSPKFNVYSCDFGWGKPVGVRSGMANKDNGKVTLFR  421

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             G EEGSVDIE+ +   TLL +END EF+E+ T+
Sbjct  422   GVEEGSVDIEVCLMTSTLLAMENDEEFMEFITV  454



>ref|XP_006367771.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=450

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 221/426 (52%), Positives = 286/426 (67%), Gaps = 11/426 (3%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++E+TPWDL+ + +  IQKGL+FH P  + +     S+ I HLK SL  TL FFPPLAGR
Sbjct  31    KIEMTPWDLKLILLETIQKGLIFHKPK-KDENNIHKSSFIDHLKKSLCHTLHFFPPLAGR  89

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
             F+ V N +D+T S ++ CNN GVE + A    +TV+ ILD ++  VP I+ SLF LN   
Sbjct  90    FSIVKNSDDDTVSFFITCNNVGVELIHANTPKLTVSMILDSTH--VPSIIHSLFPLNNTR  147

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N +G+ KPL GVQITEL+DGYFI CT+NH+LGDGT FW+FFNSWAE+SRG+   S  PI 
Sbjct  148   NFEGVTKPLFGVQITELVDGYFIGCTMNHTLGDGTCFWHFFNSWAEISRGYKIISKVPIF  207

Query  688   ERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGTSI  867
             ER+FP+     P+H P  ++  +     +   L ERVFHLSK NI RLK KAN+EMG + 
Sbjct  208   ERYFPEKIDV-PIHFPMNLDDQKLF---EVRTLMERVFHLSKENIGRLKNKANNEMGINS  263

Query  868   ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFITESIK  1041
             ISSLQ+Y+AHLWR VTR R L + ++V + + IG R+R+   LPEGY+GNA+        
Sbjct  264   ISSLQAYLAHLWRCVTRCRKLDAGKEVIITIPIGARSRLNPPLPEGYFGNAIHGKQVKTS  323

Query  1042  AGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA-HNGAEIPSSSNTLGISSS  1218
              G++L  GLGWVA QI K V   +  EEV K+Y  +VE+P       +   +N L ISSS
Sbjct  324   VGELLENGLGWVAMQINKMVVSQN-SEEVVKIYKGWVENPVILKKGSVYEGNNRLLISSS  382

Query  1219  PRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAE  1398
             PR ++YG DFGWG P+ VRSG  NK DGK+TLF G +EGSVDIE+ I   TL  LEND E
Sbjct  383   PRHNIYGNDFGWGNPIGVRSGMANKSDGKITLFPGEKEGSVDIEVCILQETLQALENDQE  442

Query  1399  FLEYFT  1416
             F+E+ T
Sbjct  443   FMEFVT  448



>ref|XP_011071701.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=440

 Score =   417 bits (1073),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 223/453 (49%), Positives = 296/453 (65%), Gaps = 29/453 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             +S C V  A    SN +S  ++ELTPWDLQFL + PIQKG+LFH+P  Q         +I
Sbjct  7     LSSCLVPTA----SNEISMSKLELTPWDLQFLLLEPIQKGILFHSPKSQDF-----QTII  57

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             HHLKTSLS TLDFFPPLAGR  T+ N+++ TC   VDCNNAGVEF  A A GV+V+ I+ 
Sbjct  58    HHLKTSLSRTLDFFPPLAGRLGTIRNDDNTTC-FLVDCNNAGVEFTHAVAGGVSVSDIVG  116

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              + I  PQI+ SLF L G+ N +G+ KPLMGVQ+TEL+DG FIACT NH++ DGTSFW+F
Sbjct  117   PAYI--PQIVSSLFPLKGVSNCEGVSKPLMGVQVTELVDGVFIACTANHAVIDGTSFWHF  174

Query  628   FNSWAELSRGFHQPSTTPIHERWFPDNTTTCP--VHLPPMIES--SERLPPPQRAFLAER  795
             FNSW+E+SRG    S TP+ ERWFP N +     + LPPM +S     +PPP      ER
Sbjct  175   FNSWSEISRGLETISKTPVFERWFPANISKDNRLIPLPPMDQSLLHSFVPPPS----LER  230

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNL-----HSNEDVHLIL  960
             VF  S+ ++  LK KANSE GT  ISS Q+ +AHLWR VTR RN       +N++V L+L
Sbjct  231   VFQFSRESVVMLKAKANSEAGTDKISSFQALIAHLWRNVTRRRNQLRIEKANNQEVELLL  290

Query  961   GIGMRARMGLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              +G R+R+ LP+ Y+GNAV+ +      G++L  GLG+ A ++ + V + S E  +  + 
Sbjct  291   LVGTRSRIPLPDAYFGNAVYVVKTVANEGELLENGLGYAALKVNELVAQQSSEAAI-ALA  349

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              ++V++P            T  ++SSPR DVY  DFGWGKP+ VRSG G K+DGK+TL+ 
Sbjct  350   EEWVKNPIIFNKR--PHVITFAVTSSPRHDVYSTDFGWGKPIAVRSGKGQKIDGKMTLYP  407

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
               E G +D+E+ + P TL  +E DAEF+E  TI
Sbjct  408   AAEPGGIDVEVCLAPATLQAMEQDAEFMEAVTI  440



>gb|ABK94771.1| unknown [Populus trichocarpa]
Length=440

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 280/430 (65%), Gaps = 18/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELT  DL+ L +  IQKGLLF  P          ++LI HLKTSLS TLD F PLAGR
Sbjct  23    RIELTQCDLKLLLVDAIQKGLLFLKPK----SLEDQNSLIQHLKTSLSRTLDCFNPLAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP IL S F LNG L
Sbjct  79    LAAV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPILHSFFPLNGFL  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N + + KPL+ VQ+TEL+DG F+ CT+NHS  DGTSFWNFFNSW+E+ RG    S TP+ 
Sbjct  136   NYEAVSKPLLAVQVTELVDGIFVGCTMNHSAVDGTSFWNFFNSWSEIHRGLDHVSKTPVL  195

Query  688   ERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             ERW   + + + P+ LP  I    S   +P P    L ERVFH +K  IA LK KAN+E 
Sbjct  196   ERWSLLNGSISPPIRLPLSIIKNNSDSIIPSP----LQERVFHFTKGKIAMLKAKANAEA  251

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T+ ISSLQS +AH+WRA TRAR +  +++V L + IG+RAR+   LPE Y GNA+    
Sbjct  252   ATTSISSLQSLLAHIWRATTRARLVEHDKEVDLRIFIGLRARLQPPLPESYCGNAIVSGI  311

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGI  1209
              +++  D+L +GLG+VA +I K V  ++ + +V       +++P+          ++LGI
Sbjct  312   VTLRTRDILEQGLGFVALEINKVVSSYT-KNKVTDALASLLKNPSPFTKADVGRIHSLGI  370

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLEN  1389
             SSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G EEGS+D+E S+ P TL  L N
Sbjct  371   SSSPRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGN  430

Query  1390  DAEFLEYFTI  1419
             D EF++  TI
Sbjct  431   DLEFMDAVTI  440



>ref|XP_002304177.2| hypothetical protein POPTR_0003s05590g [Populus trichocarpa]
 gb|EEE79156.2| hypothetical protein POPTR_0003s05590g [Populus trichocarpa]
Length=440

 Score =   399 bits (1025),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 215/430 (50%), Positives = 280/430 (65%), Gaps = 18/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELT  DL+ L +  IQKGLLF  P          ++LI HLKTSLS TLD F PLAGR
Sbjct  23    RIELTQCDLKLLLVDAIQKGLLFLKPK----SLEDQNSLIQHLKTSLSRTLDCFNPLAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP IL S F LNG L
Sbjct  79    LAAV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPILHSFFPLNGFL  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N + + KPL+ VQ+TEL+DG F+ CT+NHS  DGTSFWNFFNSW+E+ RG    S TP+ 
Sbjct  136   NYEAVSKPLLAVQVTELVDGIFVGCTMNHSAVDGTSFWNFFNSWSEIHRGLDHVSKTPVL  195

Query  688   ERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             ERW   + + + P+ LP  I    S   +P P    L ERVFH +K  IA LK KAN+E 
Sbjct  196   ERWSLLNGSISPPIRLPLSIIKNNSDSIIPSP----LQERVFHFTKGKIAMLKAKANAEA  251

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T+ ISSLQS +AH+WRA TRAR +  +++V L + IG+RAR+   LP+ Y GNA+    
Sbjct  252   ATTSISSLQSLLAHIWRATTRARLVEHDKEVDLRIFIGLRARLQPPLPQSYCGNAIVSGI  311

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGI  1209
              +++  D+L +GLG+VA +I K V  ++ + +V       +++P+          ++LGI
Sbjct  312   VTLRTRDILEQGLGFVALEINKVVSSYT-KNKVTDALASLLKNPSPFTKADVGRIHSLGI  370

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLEN  1389
             SSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G EEGS+D+E S+ P TL  L N
Sbjct  371   SSSPRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGN  430

Query  1390  DAEFLEYFTI  1419
             D EF++  TI
Sbjct  431   DLEFMDAVTI  440



>ref|XP_009589621.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Nicotiana tomentosiformis]
Length=451

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 289/455 (64%), Gaps = 22/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqq-qqqffNSNLI  267
             +S C +        N  ++ + LTPWDLQ L + PIQKGLLF  P PQQ ++   +S +I
Sbjct  7     VSTCVIMPGKPIDRNSPTKNIHLTPWDLQLLTVDPIQKGLLFRKPNPQQHRKLATSSEII  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             + LKTSLS TLDFFP LAGR A   N  DNT S +++CNN G EF  A A G+TVA I++
Sbjct  67    NRLKTSLSDTLDFFPLLAGRLAACKNS-DNTLSFFINCNNEGAEFTHATAPGLTVADIVE  125

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              +   VP+I++S F LNG+ N +G+ KPL+ VQ+TEL+DG+FI CT+NH + DGTSFW+F
Sbjct  126   PTY--VPKIVKSFFPLNGVHNFEGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFWHF  183

Query  628   FNSWAELSRGFHQPSTT---PIHERWFPDNTTT-CPVHLPPMIESSERLPPPQRAFLAER  795
             FNSW+E+SR      T    P+ ERWFP  T +   V LP      E  PP     L ER
Sbjct  184   FNSWSEISRTRSSNLTVNKLPVLERWFPKFTASQIHVTLPKEHLYDEFDPP----LLEER  239

Query  796   VFHLSKVNIARLKEKANSEMGT---SIISSLQSYMAHLWRAVTRARN-LHSNEDVHLILG  963
             VFH SK NIA+LK KANSE GT   + ISSLQ+ +AHLW+ V R R    ++E     + 
Sbjct  240   VFHFSKENIAQLKAKANSEFGTDQKTCISSLQAVLAHLWQTVIRCRTGTKADEKFSFKIL  299

Query  964   IGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             IG R R+  P  EGY+GNAV F+  +  A ++L    GW A Q+ K V   +HEE V   
Sbjct  300   IGARPRLQPPLREGYFGNAVHFVNVTTTARELLENNSGWAALQMNKVVAMQTHEE-VMNF  358

Query  1138  YMKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
             Y  +V++P     +E+   +N+L  SSSPRFDVYG DFGWG+P+ VRSG GNK DGK+T+
Sbjct  359   YQSWVKNPKIVKKSEV--VTNSLIASSSPRFDVYGNDFGWGRPIAVRSGAGNKHDGKMTI  416

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G EEGS+DIE  + P TL  +  DA F+E  T+
Sbjct  417   FSGVEEGSIDIEACLTPETLHAMGEDANFMEAVTV  451



>ref|XP_002304178.2| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
 gb|EEE79157.2| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
Length=440

 Score =   394 bits (1013),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 211/430 (49%), Positives = 280/430 (65%), Gaps = 18/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELT  DL+ L +  IQKGLLF  P          ++LI HLKTSLS TLD F PLAGR
Sbjct  23    RIELTQCDLKLLLVDAIQKGLLFLKPK----SLEDQNSLIQHLKTSLSRTLDCFNPLAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              ATV   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP IL S F LNG+L
Sbjct  79    LATV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPILHSFFPLNGLL  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N + + KPL+ VQ+TEL+DG F+ CT+NH+  DGTSFWNFFNSW+E+ RG    S TP+ 
Sbjct  136   NYEAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGTSFWNFFNSWSEIHRGLDHVSKTPVL  195

Query  688   ERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             ERW   + + + P+ LP  I        +P P    L ERVFH +K  IA LK KAN+E 
Sbjct  196   ERWSLLNGSISPPIRLPLSIIKNNPGSFIPSP----LQERVFHFTKGKIAMLKAKANAEA  251

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T+ ISSLQS +AH+WRA TRAR    ++++ L + IG+RAR+   LPE Y+GNA+    
Sbjct  252   ATTSISSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARLQPPLPESYFGNAIVSGI  311

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGI  1209
              +++  ++L +GLG+VA ++ K V  ++ + +V       +++P+          ++L I
Sbjct  312   VTLRTREILEQGLGFVALEVNKVVSSYT-KNKVTDALASVLKNPSPLTKADLGRIHSLAI  370

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLEN  1389
             SSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G EEGS+D+E S+ P TL  L N
Sbjct  371   SSSPRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGN  430

Query  1390  DAEFLEYFTI  1419
             D EF++  TI
Sbjct  431   DLEFMDAVTI  440



>gb|ABK94986.1| unknown [Populus trichocarpa]
Length=440

 Score =   394 bits (1013),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 211/430 (49%), Positives = 281/430 (65%), Gaps = 18/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELT  DL+ L +  IQKGLLF  P    +     ++LI HLKTSLS TLD F PLAGR
Sbjct  23    RIELTQCDLKLLLVDAIQKGLLFLKP----KSLEDQNSLIQHLKTSLSRTLDCFNPLAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              ATV   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP IL S F LNG+L
Sbjct  79    LATV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPILHSFFPLNGLL  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N + + KPL+ VQ+TEL+DG F+ CT+NH+  DGTSFWNFFNSW+E+ RG    S TP+ 
Sbjct  136   NYEAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGTSFWNFFNSWSEIHRGLDHVSKTPVL  195

Query  688   ERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             ERW   + + + P+ LP  I        +P P    L ERVFH +K  IA LK KAN+E 
Sbjct  196   ERWSLLNGSISPPIRLPLSIIKNNPGSFIPSP----LQERVFHFTKGKIAMLKAKANAEA  251

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T+ ISSLQS +AH+WRA TRAR    ++++ L + IG+RAR+   LPE Y+GNA+    
Sbjct  252   ATTSISSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARLQPPLPESYFGNAIVSGI  311

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGI  1209
              +++  ++L +GLG+VA ++ K V  ++ + +V       +++P+          ++L I
Sbjct  312   VTLRTREILEQGLGFVALEVNKVVSSYT-KNKVTDALASVLKNPSPLTKADLGRIHSLAI  370

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLEN  1389
             SSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G EEGS+D+E S+ P TL  L N
Sbjct  371   SSSPRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGN  430

Query  1390  DAEFLEYFTI  1419
             D EF++  TI
Sbjct  431   DLEFMDAVTI  440



>ref|XP_007047323.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX91480.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=445

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/435 (49%), Positives = 284/435 (65%), Gaps = 7/435 (2%)
 Frame = +1

Query  121   AARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI-HHLKTSLSST  297
             AA   G + RVELTPWDLQ L +G IQKGL+F  P   Q++Q  N  LI HHL TSLS T
Sbjct  14    AANHKGKTERVELTPWDLQLLLVGSIQKGLIFPKPKQPQERQTGNYTLIIHHLNTSLSHT  73

Query  298   LDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQIL  477
             LD+FPPL+GR A+    +D+T S ++DCNNAG  FV A A GVT++ IL+     VP I+
Sbjct  74    LDYFPPLSGRLAST-EHDDDTISFFIDCNNAGALFVHAAADGVTISDILEPGGY-VPHIV  131

Query  478   RSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG  657
              S F LNG+ N +G  +PL+ VQ+TEL+DG FI CT+NH + DGTSFW+FFN WAE+SRG
Sbjct  132   HSFFPLNGVKNYEGTFQPLLAVQVTELVDGIFIGCTINHMVVDGTSFWHFFNFWAEISRG  191

Query  658   FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
                 S  P+ +RWF D  T  P+H+P             R  L ERV H +K NIA+LK 
Sbjct  192   SVHLSKPPVLQRWFLDG-TDLPIHIPQAYVKQVHEELFTRPPLRERVCHFTKENIAKLKA  250

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPEGYWGNA  1014
             KAN+E GT  ISSLQ+ ++H+W++V R + L  NE+++  + +G R R+  LPE Y+GNA
Sbjct  251   KANAEAGTDKISSLQALLSHIWQSVIRNKTLDPNEEINYRMLVGARPRLNELPEQYFGNA  310

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             V   + ++K  ++L +GLG VAW++ + V   +  E+++K    +  SP         +S
Sbjct  311   VQAGSITMKVKELLEQGLGNVAWEMNRLVATQT-VEKLKKFLEDWTASPKLMSMG-SMAS  368

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTL  1374
             N L  SSSP F++YG DFGWG+PV VRSG GNK DGK+T+F G EEGS+DIE  + P TL
Sbjct  369   NALVTSSSPWFNIYGNDFGWGRPVAVRSGCGNKHDGKITVFRGVEEGSIDIEACLCPDTL  428

Query  1375  LGLENDAEFLEYFTI  1419
               + ND EF+E  TI
Sbjct  429   EAMANDEEFMEAVTI  443



>ref|XP_007204351.1| hypothetical protein PRUPE_ppa005715mg [Prunus persica]
 gb|EMJ05550.1| hypothetical protein PRUPE_ppa005715mg [Prunus persica]
Length=447

 Score =   392 bits (1008),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 215/441 (49%), Positives = 289/441 (66%), Gaps = 29/441 (7%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             +R +ELTPWDLQ L + PIQKGLLFH P          S  I HLK SLS TLDFFPPLA
Sbjct  19    TRAIELTPWDLQLLLVDPIQKGLLFHKPKNF-------SQNIQHLKASLSRTLDFFPPLA  71

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLN  498
             GR AT+ ++EDN  S +++CNNAGV FV AKA GVT++ + D  ++ VP+ ++   F LN
Sbjct  72    GRLATIEHDEDNALSFFINCNNAGVLFVHAKADGVTLSDVKD--SLYVPRDLVNHFFPLN  129

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF-HQPST  675
             G+ N  G  KPL+ VQ+TEL DG FI CT+NH++ DGTSFW+FFNSW+E+SRG     S 
Sbjct  130   GLKNFQGTSKPLLAVQVTELADGIFIGCTINHTVVDGTSFWHFFNSWSEISRGSSDHVSK  189

Query  676   TPIHERWFPDNTTTCPVHLP-PMIESS------ERLPPPQRAFLAERVFHLSKVNIARLK  834
             +P+ +RWFPD     P+ +P   +E        + +P P    L ERVF  SK  +A+LK
Sbjct  190   SPVLQRWFPDEINR-PIRIPFSKLEDQVSGKFIDNIPTPNN--LKERVFCFSKEKVAQLK  246

Query  835   EKANSEM----GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPE  996
              KA++E+      + ISSLQ+ +AHLWR++ R     S+E+    L IG R RM   LP+
Sbjct  247   AKASAEIEIENTNTKISSLQAVLAHLWRSIVRGSKYSSDEETSYRLLIGARPRMKPPLPQ  306

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGA  1176
              Y+GNAV   T ++KAG+VL +GLG+VAW++ K V  H+ EE++R     +V+ P     
Sbjct  307   QYFGNAVQAGTVTMKAGEVLERGLGFVAWEMNKMVALHT-EEKLRSFLECWVQEPKL-LT  364

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELS  1356
             E   ++N L  SSSPRF+VYG DFGWG+PV VRSG GNK  GK+T+F G EEGS+DIE+ 
Sbjct  365   EDNMAANALVTSSSPRFNVYGNDFGWGRPVGVRSGAGNKSHGKITVFAGVEEGSIDIEVC  424

Query  1357  IHPHTLLGLENDAEFLEYFTI  1419
             +   TL  + ND+EF++  T+
Sbjct  425   LLAETLEAMGNDSEFMDVVTL  445



>ref|XP_011000815.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Populus 
euphratica]
Length=440

 Score =   392 bits (1006),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 213/439 (49%), Positives = 284/439 (65%), Gaps = 19/439 (4%)
 Frame = +1

Query  124   ARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTL  300
             A S+ V+  R+ELT  DL+ L +  IQKGLLF  P          ++LI HLKTSLS TL
Sbjct  14    ATSDKVTDERIELTQCDLKLLLVDAIQKGLLFLKPK----SLEDQNSLIQHLKTSLSRTL  69

Query  301   DFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILR  480
             D F  LAGR A V   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP I+ 
Sbjct  70    DCFNLLAGRIAAV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPIVH  126

Query  481   SLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF  660
             S F LNGI N + + KPL+ VQ+TEL+DG F+ CT+NH+  DG+SFWNFFNSW+E+ RG 
Sbjct  127   SFFPLNGISNYEAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGSSFWNFFNSWSEIHRGL  186

Query  661   HQPSTTPIHERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIAR  828
                S TP+ ERW   + T + P+ LP  I    S   +P P    L ERVFH +K  IA 
Sbjct  187   DHISKTPVLERWSLLNGTISPPIRLPLSIIKNNSDSFIPSP----LQERVFHFTKGKIAV  242

Query  829   LKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGY  1002
             LK KAN E  T+ ISSLQS +AH+WRA TRAR +  ++++ LI+ IG+RAR+   LPE Y
Sbjct  243   LKAKANDEAATTSISSLQSLLAHIWRATTRARLVEHDKEIDLIILIGLRARLQPPLPESY  302

Query  1003  WGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI  1182
              GNA+     +++  ++L +GLG+VA +I K V  ++ + +V  +    +++P+      
Sbjct  303   CGNAIVSGIVTLRTREILEQGLGFVALEINKVVSSYT-KNKVTDVLASVLKNPSPLTKAD  361

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
                 ++L ISSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G E+GS+D+E S+ 
Sbjct  362   IGRIHSLAISSSPRHNVYGTDFGWGRPVAVRSGSGNKFDGKLTLFPGLEDGSIDVEFSVL  421

Query  1363  PHTLLGLENDAEFLEYFTI  1419
             P TL  L ND EF++  TI
Sbjct  422   PETLKALGNDLEFMDAVTI  440



>ref|XP_009762458.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=451

 Score =   391 bits (1004),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 293/455 (64%), Gaps = 22/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqq-qqqffNSNLI  267
             +S C + +      N  ++ + LTPWDLQ L + PIQKGLLF  P PQQ  +   +S +I
Sbjct  7     VSTCVIRSGKPIDRNSPTKNIHLTPWDLQLLTVDPIQKGLLFRKPNPQQHTELATSSEII  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             + LKTSLS TL++FP L GR     N  DNT S +++C+N G EF  A A G+TVA I+ 
Sbjct  67    NRLKTSLSDTLNYFPLLVGRLVASKNS-DNTLSFFINCSNEGAEFTHATAPGLTVADIVK  125

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              +   VP+I++S F LNG+ N +G+CKP++ VQ+TEL+DG+FI CT+NH + DGTSFW+F
Sbjct  126   PTY--VPKIVKSFFPLNGVRNYEGVCKPVLAVQVTELVDGFFIGCTVNHCVADGTSFWHF  183

Query  628   FNSWAELSRGFHQPSTT---PIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAER  795
              NSW+E+SR      T    P+ ERWFP  T + P+H+  P     +   PP    L ER
Sbjct  184   INSWSEISRTRSCNLTVNKPPVLERWFPRFTAS-PIHVTLPKEHLYDEFDPP---LLEER  239

Query  796   VFHLSKVNIARLKEKANSEMGT---SIISSLQSYMAHLWRAVTRARN-LHSNEDVHLILG  963
             VFH SK NIA+LK KANSE GT   + ISSLQ+ +AHLW++V   R+ ++++E+    + 
Sbjct  240   VFHFSKKNIAQLKAKANSEFGTNQKTCISSLQAVLAHLWQSVICCRSGINADENFSFKIL  299

Query  964   IGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             IG R R+   LPEGY+GNAV F+  +  A ++L    GW A Q+ K V   +H EE+   
Sbjct  300   IGARPRLQPPLPEGYFGNAVHFVNVTTTARELLQNNSGWAALQMNKVVAMQTH-EEIMIF  358

Query  1138  YMKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
             Y  +V++P     +E+   +N+L  SSSPRF+VY  DFGWG+P+ VRSG GNK DGK+T+
Sbjct  359   YQSWVKNPKIVKKSEV--VTNSLIASSSPRFNVYANDFGWGRPIAVRSGAGNKHDGKMTI  416

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G EEGS+DIE  + P TL  +  DA+F+E  T+
Sbjct  417   FSGVEEGSIDIEACLTPETLHAMGEDAKFMEAVTV  451



>ref|XP_008241487.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=445

 Score =   390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 213/439 (49%), Positives = 289/439 (66%), Gaps = 27/439 (6%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             +R +ELTPWDLQ L + PIQKGLLFH P          S  I HLK SLS TLDFFPPLA
Sbjct  19    TRAIELTPWDLQLLLVDPIQKGLLFHKPKNF-------SQNIQHLKASLSRTLDFFPPLA  71

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLN  498
             GR  T+ ++E+NT S +++CNNAGV FV AKA GVT++ + D  ++ VP+ ++   F LN
Sbjct  72    GRLTTIEHDEENTLSFFINCNNAGVLFVHAKADGVTLSDVKD--SLYVPRDLVNYFFPLN  129

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF-HQPST  675
             G+ N  G  KPL+ VQ+TEL+DG FI CT+NH++ DGTSFW+FFNSW+E+SRG     S 
Sbjct  130   GVKNFQGTSKPLLAVQVTELVDGVFIGCTINHTVVDGTSFWHFFNSWSEISRGSSDHVSK  189

Query  676   TPIHERWFPDNTTTCPVHLP-PMIESS------ERLPPPQRAFLAERVFHLSKVNIARLK  834
             +P+ +RWF D     P+ +P   +E        + +P P    L ERVF  SK  +A+LK
Sbjct  190   SPVLQRWFLDEINR-PIRIPFSKLEDQVSGKFIDNIPTPNN--LKERVFCFSKEKVAQLK  246

Query  835   EKANSEM--GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGY  1002
              KA++E+    + ISSLQ+ +AHLWR++ R     S+E+    L IG R RM   LP+ Y
Sbjct  247   AKASAEIENTNTKISSLQAVLAHLWRSIVRGSKYSSDEETSYRLLIGARPRMKPPLPQQY  306

Query  1003  WGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI  1182
             +GNAV   T ++KAG+VL +GLG+VAW++ K V  H+ EE++R     +V+ P     E 
Sbjct  307   FGNAVQAATVTMKAGEVLERGLGFVAWEMNKMVALHT-EEKLRSFLECWVQEPKL-LTED  364

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
               ++N L  SSSPRF+VYG DFGWG+PV VRSG GNK  GK+T+F G EEGS+DIE+ + 
Sbjct  365   NMAANALVTSSSPRFNVYGNDFGWGRPVGVRSGAGNKSHGKITVFAGVEEGSIDIEVCLL  424

Query  1363  PHTLLGLENDAEFLEYFTI  1419
               TL  + ND+EF++  T+
Sbjct  425   AETLEAMGNDSEFMDVVTL  443



>ref|XP_006480712.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=448

 Score =   390 bits (1003),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 223/452 (49%), Positives = 296/452 (65%), Gaps = 20/452 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISK  V AA     N    R++LTPWDL+ +Q   IQKGLLF  P P       + NLIH
Sbjct  7     ISKSTVCAAIHREPN---LRIDLTPWDLKLIQFDTIQKGLLFRKP-PNDNTDTSSLNLIH  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEED-NTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             HLKTSLS TLD+FP LAGR AT+ + +D NT SVY++CNNAG EFV A A GV+VA I+ 
Sbjct  63    HLKTSLSRTLDYFPALAGRLATIEHHDDSNTISVYINCNNAGAEFVHATADGVSVADII-  121

Query  448   QSNINVP-QILRSLFTLNGILNRDGI--CKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
              S + VP +I+ S F LNG+ N   I   KPL+GVQ+TEL+DG FIACT+NHS+ DGTSF
Sbjct  122   -SPVYVPNEIVYSFFPLNGVTNCQCISEAKPLLGVQVTELVDGIFIACTINHSVVDGTSF  180

Query  619   WNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAE  792
             W+FFNSW+E+SRG    S  P+ ER F   +   P+ LP   +  S    PPP    L +
Sbjct  181   WHFFNSWSEISRGSDCISKLPVLERGFLSESEYFPIRLPLWSIEPSGTHTPPPN---LRQ  237

Query  793   RVFHLSKVNIARLKEKANSEMG-TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             RVFH +K NIA+LK KAN+E+G T+ ISSLQ+ ++ +WR+ TR R+L  +E+V  +LGIG
Sbjct  238   RVFHFTKENIAKLKAKANAEIGSTNKISSLQAILSQIWRSFTRNRSLDPDEEVLFMLGIG  297

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
             +R R+   LP  Y+GNA      S+KA   L +GLG VA ++ K +  ++ EE+++    
Sbjct  298   VRQRLQPPLPPEYFGNAAQGEFVSMKARYQLEQGLGNVALKMNKFIAAYT-EEKIKNFLE  356

Query  1144  KFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              + ++P       +P  +N    SSSPRF+ YG DFGWG+P+ VRSG  NK+DGK+TLF 
Sbjct  357   SWGKNPEILTWDSLPMKNNACFASSSPRFNFYGNDFGWGRPMAVRSGPANKVDGKITLFA  416

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
             G EEGSVD+E    P TL G+ ND EF+++ +
Sbjct  417   GVEEGSVDVEACFLPETLQGMGNDTEFMQFVS  448



>ref|XP_008241486.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=446

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 282/428 (66%), Gaps = 12/428 (3%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             +RR+ELTPWDLQ L +  +QKGLLFH P+   + +   + L+ HLK+SLS TLD F PLA
Sbjct  22    TRRIELTPWDLQLLLVDQVQKGLLFHKPSSTYENEDLKNGLVQHLKSSLSLTLDIFYPLA  81

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLFTLN  498
             GR A   +E+DN+ S  VDCN AGV FV A A+GVTVA ILD   + VP  I+ SLFT+N
Sbjct  82    GRLAITEHEDDNSSSFSVDCNGAGVGFVHAVANGVTVADILDP--VLVPDDIVYSLFTMN  139

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQPS  672
             G+LN + +  PL+ VQ+TEL+DG FI CT+NH + DG+ FW FFN+W+E+SR  GF + S
Sbjct  140   GVLNYESVSNPLLAVQVTELVDGIFIGCTVNHCVVDGSIFWRFFNTWSEISRDHGFGKIS  199

Query  673   TTP-IHERWFPDNTTTCPVHLPPM-IESSERLPPPQRAFLAERVFHLSKVNIARLKEKAN  846
               P I  R F D     PV +P    +  E+  PP    L +R+FH  K  +A+LK KAN
Sbjct  200   QPPLIFGREFLDGIIDLPVRIPFFHNQIPEKFLPP--GSLQQRMFHFPKEKLAQLKAKAN  257

Query  847   SEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPEGYWGNAVFF  1023
             +EMGT+ ISSLQ+ +AHLW ++TR + L  +++   +L +G+R R   LPE Y GNAV  
Sbjct  258   AEMGTTKISSLQALLAHLWVSITRNKRLSPDQETKYLLLVGLRQRFQPLPEEYLGNAVLL  317

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTL  1203
              T +   GD+L +GLGW A ++ K +   + E+EVRK   ++V+SP  +      S N+L
Sbjct  318   GTVTSTVGDLLKQGLGWAALEMNKMIASKT-EQEVRKHLEEWVKSPKLSKMGT-LSVNSL  375

Query  1204  GISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGL  1383
                SSPRF+V+G DFGWG+P+ VRSG GNK DGK+T+F G E+GS+D E  +   TL  L
Sbjct  376   ATGSSPRFNVFGNDFGWGRPLAVRSGAGNKFDGKLTVFPGTEDGSIDFEACLSSQTLQAL  435

Query  1384  ENDAEFLE  1407
               DAEF++
Sbjct  436   AQDAEFMD  443



>ref|XP_009625194.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Nicotiana tomentosiformis]
Length=420

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 279/460 (61%), Gaps = 63/460 (14%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS------RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqff  252
             IS C VGAA    S+  +       ++E+TPWDLQFL +  IQKGLLF  PTPQQ+   F
Sbjct  7     ISTCLVGAASKLSSSNNNGNNTTISQIEMTPWDLQFLLVDTIQKGLLFRKPTPQQENTLF  66

Query  253   NSNL----IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKAS  420
              S      I HLKTSLS TLDFFPPLAGRF+T  N  D+T S ++ CNNAGVEF  A A 
Sbjct  67    KSLSSLSLIDHLKTSLSRTLDFFPPLAGRFSTTKNANDDTISFFITCNNAGVEFTHAIAP  126

Query  421   GVTVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSL  600
              +TV  IL+  +  VP I+ SLF LN + N + + KPL+G+Q+TEL++GYFI CT++HS+
Sbjct  127   ELTVEEILE--SCYVPPIVHSLFPLNKMRNIECVTKPLLGIQVTELVNGYFIGCTMSHSV  184

Query  601   GDGTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSE-----RLP  765
             GDGT FWNFFNSW+E+S G    S  P+ +RWFP+N    P+HLP  +E  E      LP
Sbjct  185   GDGTCFWNFFNSWSEISSGSEFISRLPVLKRWFPENIKP-PIHLPLNLEDQELYECMELP  243

Query  766   PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
             P     L ER+FHLSK +I +LK KANSEMGT                            
Sbjct  244   P-----LKERIFHLSKESIGKLKAKANSEMGT----------------------------  270

Query  946   VHLILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                      R R+  P  EGYWGNA +F      AG++L KGLGW A Q+ K +   ++ 
Sbjct  271   ---------RPRLNPPLAEGYWGNAAYFKPVKRTAGELLEKGLGWAALQMNKIIASQNN-  320

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
             EEV K+Y ++VE P          +N L ISSSP+F VY  DFGWGK V VRSG  NK D
Sbjct  321   EEVVKLYKEWVEKPVLFTKGSLFVANRLTISSSPKFSVYSTDFGWGKAVAVRSGMANKGD  380

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GKVTLF G EEGSVDIE+ + P TLL +END EF++  T+
Sbjct  381   GKVTLFPGAEEGSVDIEVCLLPETLLAMENDEEFMKAVTV  420



>ref|XP_002533255.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF29117.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=437

 Score =   389 bits (998),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/428 (48%), Positives = 281/428 (66%), Gaps = 17/428 (4%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +R+ELT  DL+ L +G IQKGLLF  P       + + NL+ HL+TSLS TLDFF PLAG
Sbjct  22    QRIELTSSDLKLLLVGAIQKGLLFPKPK-----SWHDRNLLQHLRTSLSRTLDFFFPLAG  76

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R AT+ N++D TC  ++ CNNAG +FV A A  VT++ +L+   I VP I+ S F LNGI
Sbjct  77    RLATLQNDDDTTC-FFISCNNAGAQFVHAVAENVTISDVLEP--IYVPPIVHSFFPLNGI  133

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPI  684
              N +G+ +PL+ +Q+TEL+DG FI CT+NH++ DGT+FWNF N W++++RG      TP+
Sbjct  134   KNHEGVSQPLVAIQVTELVDGIFIGCTMNHTVADGTTFWNFINCWSQIARGSDHVPRTPV  193

Query  685   HERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGT  861
              E WF  +   CPV LP  +I++ +   PP    L ERVFH SK  I  LK +AN+E G 
Sbjct  194   IEHWF-RSERYCPVRLPISIIKTDDEFTPPP---LQERVFHFSKEKITGLKARANAEAGI  249

Query  862   SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVFFITES  1035
               ISSLQS +AHLWR V R R L  N++ +  L IG+R+R+   +PE Y+GNA+   T +
Sbjct  250   DKISSLQSLLAHLWRGVIRNRKLDPNQEPNFHLQIGIRSRLQPKIPEEYFGNAIQVGTVN  309

Query  1036  IKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISS  1215
             +KAG+++  G+G+ A QI K +  ++ E+ VR      ++SP         + N L  SS
Sbjct  310   LKAGELVEHGVGYAALQINKMIACYT-EDNVRNNLEFSIKSPKLVTMNT-LTRNALITSS  367

Query  1216  SPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDA  1395
             SPRF+VYG DFGWG+P+ VRSG  NK DGKVT+F G EEGS+DIE+ I P  L  + ND+
Sbjct  368   SPRFNVYGNDFGWGRPIAVRSGPANKFDGKVTIFPGAEEGSIDIEVCILPQVLQAIGNDS  427

Query  1396  EFLEYFTI  1419
             EF++  T+
Sbjct  428   EFMDAITV  435



>ref|XP_006428978.1| hypothetical protein CICLE_v10011715mg [Citrus clementina]
 gb|ESR42218.1| hypothetical protein CICLE_v10011715mg [Citrus clementina]
Length=448

 Score =   388 bits (996),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 222/452 (49%), Positives = 295/452 (65%), Gaps = 20/452 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISK  V AA     N    R++LTPWDL+ +Q   IQKGLLF  P P       + NLIH
Sbjct  7     ISKSTVCAAIHREPN---LRIDLTPWDLKLIQFDTIQKGLLFRKP-PNDNTDTSSLNLIH  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEED-NTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             HLKTSLS TLD+FP LAGR AT+ + +D NT SVY++CNNAG EFV A A GV+VA I+ 
Sbjct  63    HLKTSLSRTLDYFPALAGRLATIEHHDDSNTISVYINCNNAGAEFVHATADGVSVADII-  121

Query  448   QSNINVP-QILRSLFTLNGILNRDGI--CKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
              S + VP +I+ S F LNG+ N   I   KPL+GVQ+TEL+DG FIACT+NHS+ DGTSF
Sbjct  122   -SPVYVPNEIVYSFFPLNGVTNCQCISEAKPLLGVQVTELVDGIFIACTINHSVVDGTSF  180

Query  619   WNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAE  792
             W+FFNSW+E+SRG    S  P+ ER F   +   P+ LP   +  S    PPP    L +
Sbjct  181   WHFFNSWSEISRGSDCISKLPVLERGFLSESEYFPIRLPLWSIEPSGTHTPPPN---LRQ  237

Query  793   RVFHLSKVNIARLKEKANSEMG-TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             RVFH +K NIA+LK KAN+E+G T+ ISSLQ+ ++ +WR+ TR R+L  +E+V  +LGIG
Sbjct  238   RVFHFTKENIAKLKAKANAEIGSTNKISSLQAILSQIWRSFTRNRSLDPDEEVLFMLGIG  297

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
             +R R+   LP  Y+GNA      S+KA   L +GLG VA ++ K +  ++ EE+++    
Sbjct  298   VRQRLQPPLPPEYFGNAAQGEFVSMKARYQLEQGLGNVALKMNKFIAAYT-EEKIKNFLE  356

Query  1144  KFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              + ++P       +P  +N    SSSPRF+ YG DFGWG+P+ VRSG  NK+DGK+TLF 
Sbjct  357   SWGKNPEILTWDSLPMKNNACFASSSPRFNFYGNDFGWGRPMAVRSGPANKVDGKITLFA  416

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
             G EEGSVD+E      TL G+ ND EF+++ +
Sbjct  417   GVEEGSVDVEACFLAQTLQGMGNDTEFMQFVS  448



>ref|XP_007203275.1| hypothetical protein PRUPE_ppa025470mg [Prunus persica]
 gb|EMJ04474.1| hypothetical protein PRUPE_ppa025470mg [Prunus persica]
Length=446

 Score =   387 bits (993),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 278/428 (65%), Gaps = 12/428 (3%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             +RR+ELTPWDLQ L +  +QKGLLFH P    + +   + L+ HLK+SLS TLD F PLA
Sbjct  22    TRRIELTPWDLQLLLVDQVQKGLLFHKPFSTYENEDLKNGLVEHLKSSLSLTLDIFYPLA  81

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLFTLN  498
             GR A   +E+DN+ S  VDCN AG  FV A A GVTVA ILD   + VP  I+ SLFT+ 
Sbjct  82    GRLAITEHEDDNSSSFSVDCNGAGAGFVHAVADGVTVADILDP--VLVPDDIVYSLFTMT  139

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQPS  672
             G+LN + +  PL+ VQ+TEL+DG FI CT+NH + DG+ FW FFN+W+E+SR  GF + S
Sbjct  140   GVLNYESVSNPLLAVQVTELVDGIFIGCTMNHCVVDGSIFWRFFNTWSEISRDHGFGKIS  199

Query  673   TTP-IHERWFPDNTTTCPVHLPPM-IESSERLPPPQRAFLAERVFHLSKVNIARLKEKAN  846
               P I  R F D     PV +P    +  ++  PP    L +R+FH  K  IA+LK KAN
Sbjct  200   QPPLIFGREFFDGIIDLPVRIPFFHNQIPDKFLPP--GPLQQRMFHFPKEKIAQLKAKAN  257

Query  847   SEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPEGYWGNAVFF  1023
             +EMGT+ ISSLQ+ +AHLW  +TR R L  +++   +L +G+R R   LPE Y GNAV F
Sbjct  258   AEMGTTKISSLQALLAHLWVCITRNRRLSPDQETKYLLLVGLRQRFQPLPEEYLGNAVLF  317

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTL  1203
              T +   GD+L +GLGW A ++ K +   + E+EVRK   ++V+SP  +      S N+L
Sbjct  318   GTVTSTVGDLLKQGLGWAALEMNKMIASKT-EQEVRKHLEEWVKSPKLSKMGT-LSVNSL  375

Query  1204  GISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGL  1383
                SSPRF+V+G DFGWG+P+ VRSG GNK DGK+T+F G E+GS+D E  +   TL  L
Sbjct  376   ATGSSPRFNVFGNDFGWGRPLAVRSGAGNKFDGKLTVFPGAEDGSIDFEACLSSQTLQAL  435

Query  1384  ENDAEFLE  1407
               DAEF++
Sbjct  436   AQDAEFMD  443



>ref|XP_007204343.1| hypothetical protein PRUPE_ppa005635mg [Prunus persica]
 gb|EMJ05542.1| hypothetical protein PRUPE_ppa005635mg [Prunus persica]
Length=450

 Score =   386 bits (992),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 216/444 (49%), Positives = 286/444 (64%), Gaps = 38/444 (9%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N +++R+ELTPWDLQ + +  IQKGLLFH P     +Q   ++L  HLK SLS TLD F 
Sbjct  18    NELAQRIELTPWDLQVILLDHIQKGLLFHKPESSTYEQDPITSLTEHLKRSLSLTLDIFY  77

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLF  489
             PLAGR A   NE+DNT S  VDCN AG EFV A A GVTVA ILD  ++ VP  I+ S F
Sbjct  78    PLAGRLAITENEDDNTTSFSVDCNGAGAEFVHAVADGVTVADILD--SVLVPDDIVHSFF  135

Query  490   TLNGILNRDGI-CKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR----  654
              +NG LN +G   KPL+ VQITEL+DG FI CT+NHS+ DG+SFW+FFN+W+E+SR    
Sbjct  136   LMNGFLNYEGSGSKPLLAVQITELVDGIFIGCTMNHSVVDGSSFWHFFNTWSEISRRVST  195

Query  655   ---GFHQPSTTPIHERWFPDNTTTCPVHLP------PMIESSERLPPPQRAFLAERVFHL  807
                   QP   P   R F +     PV LP      P I  S  L       L +RVFH 
Sbjct  196   NCGKILQPP--PAFGRDFLNGMIDLPVRLPIFQNKIPKIRFSAPL-------LQQRVFHF  246

Query  808   SKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG  987
             SK  IA+LK KAN+EMGT+ ISSLQ+ +AHLW +VTR ++L ++++    + +GMR R+ 
Sbjct  247   SKQKIAQLKAKANAEMGTTRISSLQALLAHLWVSVTRNQHLETDQETQYKVLVGMRQRLQ  306

Query  988   --LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
               LP+ Y GNAV F   +   G++L +GLGW AW++ KT+   + E++VRK+   +++ P
Sbjct  307   PPLPDEYLGNAVLFGIVTSTVGELLERGLGWAAWEMNKTISSQT-EQDVRKLLEGWIKDP  365

Query  1162  AHNGAEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
                  ++P     +SN+L   SSPRF+V+G DFGWG+P+ VRSG GNK DGK+T+F G E
Sbjct  366   -----KVPKLDGLASNSLLTGSSPRFNVFGNDFGWGRPLAVRSGVGNKFDGKLTVFPGAE  420

Query  1330  EGSVDIELSIHPHTLLGLENDAEF  1401
             +GS+D E  + P TL  L +DAEF
Sbjct  421   DGSIDFEACLLPQTLQALAHDAEF  444



>ref|XP_004289208.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 211/437 (48%), Positives = 270/437 (62%), Gaps = 23/437 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ELTP D+Q L +  IQKGLLFH P  Q         LI HLK S S TLD F PLAGR
Sbjct  53    KLELTPCDVQLLLVDTIQKGLLFHKPDKQSL------KLIEHLKVSFSRTLDIFYPLAGR  106

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNGI  504
              A   NE+DNT S  +DCN AG EFV A A GVTVA ILD   + VP  I+ SLF +NG+
Sbjct  107   LAVTANEDDNTTSFSLDCNGAGAEFVHAAADGVTVAHILDP--VLVPDNIVYSLFLMNGV  164

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPI  684
             LN +G  KPL+ VQ+T+L+DG FI  T+NHS+GDGT FWNFFN+W+E+SR        PI
Sbjct  165   LNDEGKSKPLLAVQVTDLVDGIFIGMTMNHSVGDGTCFWNFFNTWSEISRSGTSTMAKPI  224

Query  685   HERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMG  858
               R F D     P+ +P        +++ PP  A L +RVFH  K  IA LK KAN +M 
Sbjct  225   FGREFLDGIIHLPIRIPFFQYPNPEDKVVPPM-ASLQQRVFHFRKEKIAALKSKANVQMA  283

Query  859   TSIISSLQSYMAHLWRAVTRARNLHSN--------EDVHLILGIGMRARMGLP--EGYWG  1008
             T  ISSLQ+ M HLW ++TRAR L S+        E    ++ +GMR R+ +P  + Y G
Sbjct  284   TCKISSLQALMGHLWVSITRARGLISSATEYEVSQEITKYMVIVGMRQRLHVPLSDQYLG  343

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS  1188
             NAV F T +   G++L  GLG+ A ++ K +   + E+EV+K    FVE+P+        
Sbjct  344   NAVLFGTATTTVGELLQGGLGFAAMELNKVIALQT-EQEVKKFLEAFVENPSLPKRGAVM  402

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
              SN+L   SSPRFDVYG DFGWG+PV VRSG GNK+DGK+T+F G EEGS+D E  + P 
Sbjct  403   KSNSLLTGSSPRFDVYGNDFGWGRPVAVRSGSGNKVDGKLTVFAGAEEGSIDFEACLSPQ  462

Query  1369  TLLGLENDAEFLEYFTI  1419
             TL  L  D EF++   +
Sbjct  463   TLQALVEDEEFMQSVAV  479



>ref|XP_009343279.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=450

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 296/457 (65%), Gaps = 27/457 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS C V AA    +   S +RVELTPWDLQFL + PIQKGLLFHN           S  I
Sbjct  7     ISTCTVQAASHNVNEYCSTQRVELTPWDLQFLLVDPIQKGLLFHNAKTL-------SQHI  59

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
              HLK +LS TLDFFPPL+GR AT+ + ++NT S +++CNNAG  FV AKA GVT++ I  
Sbjct  60    QHLKAALSRTLDFFPPLSGRLATI-HHDNNTTSFFINCNNAGALFVHAKADGVTLSDI--  116

Query  448   QSNINVPQ-ILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               ++ VP+ ++ S F +NG  N +G  KPL+ VQ+TEL+DG FI CT+NH++ DGTSFW+
Sbjct  117   NESVYVPRAVVHSFFPINGAKNYEGTSKPLLAVQVTELMDGIFIGCTVNHTVVDGTSFWH  176

Query  625   FFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP-PMIE---SSERLPPPQRAFLAE  792
             FFNSW+E+SRGF   S  P+ +RW  D T + P+ +P   IE   S + +   +   L E
Sbjct  177   FFNSWSEISRGFDFVSKPPVLKRWLLDGTIS-PIRIPFSKIEDQVSDKHIGNIRVPLLKE  235

Query  793   RVFHLSKVNIARLKEKANSEM----GTSIISSLQSYMAHLWRAVTRARN--LHSNEDVHL  954
             RVFH SK  IA+LK KAN+E+      + ISSLQ+ +AHLWR++ R  N  L  +++   
Sbjct  236   RVFHFSKEKIAQLKAKANAEIQLENSRTKISSLQAVLAHLWRSIIRGSNGDLDPDKESSY  295

Query  955   ILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              L IG R+RM  P  + Y+GNAV   T +IKA + +  GLG+VAW++ K V  H+ EE++
Sbjct  296   RLLIGARSRMNPPLSQQYFGNAVQAGTVTIKAREAIESGLGFVAWEMNKMVALHT-EEKL  354

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             RK    +V+ P     E   + + L  SSSPRFDVYG DFGWG+PV VRSG GNK  GK+
Sbjct  355   RKFLEFWVQEPKL-LKEGNMAVHALVTSSSPRFDVYGNDFGWGRPVGVRSGAGNKSHGKI  413

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             T+F G EEGS+DIE  +   TL  + ND+EF++  T+
Sbjct  414   TVFSGVEEGSIDIEACLLAETLEAMGNDSEFMDAVTV  450



>ref|XP_006480713.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=448

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 294/452 (65%), Gaps = 20/452 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISK  V AA     N    R++LTPWDL+ +Q   IQKGLLF  P P       + NLIH
Sbjct  7     ISKSTVCAAIHREPN---LRIDLTPWDLKLIQFDTIQKGLLFRKP-PNDNTDTSSLNLIH  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEED-NTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             HLKTSLS TLD+FP LAGR AT+ + +D NT SVY++CNNAG EFV A A GV+VA I+ 
Sbjct  63    HLKTSLSRTLDYFPALAGRLATIEHHDDSNTISVYINCNNAGAEFVHATADGVSVADII-  121

Query  448   QSNINVP-QILRSLFTLNGILNRDGI--CKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
              S + VP +I+ S F LNG+ N   I   KPL+GVQ+TEL+DG FIACT+NHS+ DGTSF
Sbjct  122   -SPVYVPNEIVYSFFPLNGVTNCQCISEAKPLLGVQVTELVDGIFIACTINHSVVDGTSF  180

Query  619   WNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAE  792
             W+FFNSW+E+SRG    S  P+ ER F   +   P+ LP   +  S    PPP    L +
Sbjct  181   WHFFNSWSEISRGSDCISKLPVLERGFLSESEYFPIRLPLWSIEPSGTHTPPPN---LRQ  237

Query  793   RVFHLSKVNIARLKEKANSEMG-TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             RVFH +K NIA+LK KAN+E+G T+ ISSLQ+ ++ +WR+ TR R+L  +E+V  +LGIG
Sbjct  238   RVFHFTKENIAKLKAKANAEIGSTNKISSLQAILSQIWRSFTRNRSLDPDEEVLFMLGIG  297

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
             +R R+   LP  Y+GNA      S+KA   L +GLG VA ++ K +  ++ +E+++    
Sbjct  298   VRQRLQPPLPPEYFGNAAQGEFVSMKARYQLEQGLGNVALKMNKFIAAYT-DEKIKNFLE  356

Query  1144  KFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              + + P       +P  +N    SSSPRF+ YG DFGWG+P+ VRSG  NK+DGK+TLF 
Sbjct  357   SWGKIPEILTWDSLPMKNNACFASSSPRFNFYGNDFGWGRPMAVRSGPANKVDGKITLFA  416

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
             G EEGSVD+E      TL G+ ND EF+++ +
Sbjct  417   GVEEGSVDVEACFLAQTLQGMGNDTEFMQFVS  448



>ref|XP_009367311.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=450

 Score =   385 bits (988),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 296/457 (65%), Gaps = 27/457 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS C V AA    +   S +RVELTPWDLQFL + PIQKGLLFHN           S  I
Sbjct  7     ISTCTVQAASHNVNEYCSTQRVELTPWDLQFLLVDPIQKGLLFHNAKTL-------SQHI  59

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
              HLK +LS TLDFFPPL+GR AT+ + ++NT S +++CNNAG  FV AKA GVT++ I  
Sbjct  60    QHLKAALSRTLDFFPPLSGRLATI-HHDNNTTSFFINCNNAGALFVHAKADGVTLSDI--  116

Query  448   QSNINVPQ-ILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               ++ VP+ ++ S F LNG  N +G  KPL+ VQ+TEL+DG FI CT+NH++ DGTSFW+
Sbjct  117   NESVYVPRAVVHSFFPLNGAKNYEGTSKPLLAVQVTELMDGIFIGCTVNHTVVDGTSFWH  176

Query  625   FFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP-PMIE---SSERLPPPQRAFLAE  792
             FFNSW+E+SRGF   S  P+ +RW  D T + P+ +P   IE   S + +   +   L E
Sbjct  177   FFNSWSEISRGFDFVSKPPVLKRWLLDGTIS-PIRIPFSKIEDQVSDKHIGNIRVPLLKE  235

Query  793   RVFHLSKVNIARLKEKANSEM----GTSIISSLQSYMAHLWRAVTRARN--LHSNEDVHL  954
             RVFH SK  IA+LK KAN+E+      + ISSLQ+ +AHLWR++ R  N  L  +++   
Sbjct  236   RVFHFSKEKIAQLKAKANAEIQLENTRTKISSLQAVLAHLWRSIIRGSNGDLDPDKESSY  295

Query  955   ILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
                IG R+RM  P  + Y+GNAV   T +IKA +V+ +GLG+VAW++ K V  H+ EE++
Sbjct  296   PFIIGARSRMNPPLSQQYFGNAVQAGTVTIKAREVIERGLGFVAWEMNKMVALHT-EEKL  354

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             RK    +V+ P     +   ++N L  S SPRFDVYG DFGWG+PV VRSG GNK   K+
Sbjct  355   RKFLEFWVQEPKL-LTDGNMAANALVTSGSPRFDVYGNDFGWGRPVGVRSGAGNKSHRKI  413

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             T+F G EEGS+DIE  +   TL  + ND+EF++  T+
Sbjct  414   TVFSGVEEGSIDIEACLLAETLEAMGNDSEFMDAVTV  450



>ref|XP_008361493.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Malus domestica]
Length=449

 Score =   384 bits (986),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 289/455 (64%), Gaps = 24/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   V AA    +   S RVELTPWDLQ L + PIQKGLLFHNP    Q        I 
Sbjct  7     ISTSTVQAASHNVNEYCSTRVELTPWDLQXLLVDPIQKGLLFHNPKTLXQH-------IQ  59

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK SLS TLDFFPPL+GR AT+ + +DNT S +++CNNAG  FV AKA GVTV+ I ++
Sbjct  60    HLKXSLSRTLDFFPPLSGRLATI-HHDDNTTSFFINCNNAGALFVHAKAYGVTVSDI-NE  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             S      ++ S F LNG    +G  KPL+ VQ+TEL DG FI CT+NH++ DGTSFW+FF
Sbjct  118   SGYVPRDVVHSFFPLNGAKXYEGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTSFWHFF  177

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP----PMIESSERLPPPQRAFLAERV  798
             NSW+E+SRGF   S  P+ +RW  D T + P+ +P        S + +   +   L ERV
Sbjct  178   NSWSEISRGFDXVSKPPVLKRWLLDGTIS-PIRIPFSKIXDQVSDKXIGNIRVPLLKERV  236

Query  799   FHLSKVNIARLKEKANSEM----GTSIISSLQSYMAHLWRAVTRARN--LHSNEDVHLIL  960
             FH SK  IA+LK KAN+E+        ISSLQ+ + HLWR++ R  N  L  +++    L
Sbjct  237   FHFSKEKIAQLKAKANAEIQLENTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKESSYRL  296

Query  961   GIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
              IG R+RM  P  + Y+GNAV   T +IKA +V+ +GLG+VAW++ K V  H+ EE++RK
Sbjct  297   LIGARSRMNPPLSQQYFGNAVQAGTVTIKAREVIKRGLGFVAWEMNKMVALHT-EEKLRK  355

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                 +V+ P     E   ++N L  SSSP FDVYG DFGWG+PV VRSGGGNK  GK+T+
Sbjct  356   FLECWVQEPKLL-TEGNMAANALXTSSSPXFDVYGNDFGWGRPVGVRSGGGNKSHGKITV  414

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G EEGS+DIE  +   TL  + ND+EF++  T+
Sbjct  415   FSGVEEGSIDIEACLLAETLEAMGNDSEFMDAVTV  449



>ref|XP_008382283.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=450

 Score =   384 bits (986),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 284/436 (65%), Gaps = 24/436 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             RVELTPWDLQ L + PIQKGLLFHNP          S  I HLK SLS TLDFFPPL+GR
Sbjct  27    RVELTPWDLQLLLVDPIQKGLLFHNPKTL-------SQHIQHLKVSLSRTLDFFPPLSGR  79

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              AT+ + +DNT S +++CNNAG  FV AKA GVTV+ I ++S      ++ S F LNG  
Sbjct  80    LATI-HHDDNTTSFFINCNNAGALFVHAKAYGVTVSDI-NESGYVPRDVVHSFFPLNGAK  137

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N +G  KPL+ VQ+TEL DG FI CT+NH++ DGTSFW+FFNSW+E+SRGF   S  P+ 
Sbjct  138   NYEGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDFVSKPPVL  197

Query  688   ERWFPDNTTTCPVHLP-PMIE---SSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             +RW  D T + P+ +P   IE   S + +   +   L ERVFH SK  IA+LK KAN+E+
Sbjct  198   KRWLLDGTIS-PIRIPFSKIEDQVSDKXIGNIRVPLLKERVFHFSKEKIAQLKAKANAEI  256

Query  856   ----GTSIISSLQSYMAHLWRAVTRARN--LHSNEDVHLILGIGMRARMGLP--EGYWGN  1011
                     ISSLQ+ + HLWR++ R  N  L  +++    L IG R+RM  P  + Y+GN
Sbjct  257   QLENTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKESSYRLLIGARSRMNPPLSQQYFGN  316

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS  1191
             AV   T +IKA +V+ +GLG+VAW++ K V  H+ EE++RK    +V+ P     E   +
Sbjct  317   AVQAGTVTIKAREVIKRGLGFVAWEMNKMVALHT-EEKLRKFLECWVQEPKL-LTEGNMA  374

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
             +N L  SSSPRFDVYG DFGWG+PV VRSG GNK  GK+T+F   EEGS+DIE  +   T
Sbjct  375   ANALXTSSSPRFDVYGNDFGWGRPVGVRSGXGNKSHGKITVFSXVEEGSIDIEACLLAET  434

Query  1372  LLGLENDAEFLEYFTI  1419
             L  + ND+EF++  T+
Sbjct  435   LEAMGNDSEFMDAVTV  450



>ref|XP_010274412.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nelumbo 
nucifera]
Length=449

 Score =   384 bits (985),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/450 (47%), Positives = 287/450 (64%), Gaps = 22/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISKC V  A    S    +R+EL  WDL+FL +  IQKGLL+  PT +  ++  N  +I+
Sbjct  7     ISKCTVQPANPHES---IQRIELNQWDLRFLPVHYIQKGLLYLKPTFRPGKEEEN-EVIN  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
              LKTSLS TLDFF PLAGR AT  + +D+T SV++DCN+AG EF+ A A   TVA ILD 
Sbjct  63    LLKTSLSRTLDFFVPLAGRLATT-SHDDDTMSVFIDCNDAGAEFIHASAD-FTVADILDP  120

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                  P+++ S F LNG++N +GI KPL+ VQ+TEL DG F+ACT+NH + DGTSFW+FF
Sbjct  121   PY--TPRVVYSFFPLNGVVNFEGITKPLLAVQVTELTDGIFVACTVNHVVADGTSFWHFF  178

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERL-----PPPQRAFLAER  795
             NSW+E+ RG  + S  P+ +RWFP  T  CPV     I + E+      PPP    L ER
Sbjct  179   NSWSEICRGADRISRPPVLQRWFPTGTN-CPVRF--SISNKEKFSVRYTPPP----LEER  231

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             VF  +K  IA LK KAN+E GT  ISSLQ+ +AH+WR+V RAR L S++++   L IG R
Sbjct  232   VFQFTKEKIASLKAKANTECGTDRISSLQAILAHIWRSVARARGLDSDQEICYWLIIGKR  291

Query  976   ARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
             +R+   LP+ ++G  V   T + K G++L +GLGW AW + + V  H+     + +    
Sbjct  292   SRLKPPLPDEHFGCFVEGGTATAKVGELLDRGLGWAAWLLNQVVASHNDPTAEKSLVESQ  351

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
              + P     +    +N L   SSPRF+VYG D GWG+P+ VRSG GNK DGK+T+F G  
Sbjct  352   TKQPKFVSMDSIVYNNLLLTGSSPRFNVYGNDLGWGRPLAVRSGCGNKFDGKITVFQGRS  411

Query  1330  EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             EGSVD+E  + P TL+ L +DAEF++  T+
Sbjct  412   EGSVDVEACLSPQTLMVLGDDAEFMDAVTV  441



>ref|XP_002282951.2| PREDICTED: uncharacterized protein LOC100245729 [Vitis vinifera]
Length=949

 Score =   394 bits (1013),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 207/433 (48%), Positives = 283/433 (65%), Gaps = 18/433 (4%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NLIHHLKTSLSSTLDFFPP  315
             +RR+ELTPWDLQ L +G I+KGLLF  PTP  ++    +   ++ HLKTSLS TLDFF P
Sbjct  523   TRRIELTPWDLQLLLLGSIKKGLLFLKPTPGPEENGLQTITAIVDHLKTSLSRTLDFFYP  582

Query  316   LAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTL  495
             LAGR  T +NE+D+T   ++DCN AG +F+ A A GVTVA ILD   + VP+I+ S F L
Sbjct  583   LAGRLGTTVNEDDDTTCFFIDCNGAGAQFIHAAAGGVTVADILDP--VYVPKIVSSFFPL  640

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPST  675
             +G+ N  G+ +PL+ VQ+TEL+DG F+ C+LNH +GDG SFW+FFNSW+E+SRG ++ S 
Sbjct  641   DGVQNYHGVTQPLLAVQVTELVDGIFVGCSLNHVVGDGKSFWHFFNSWSEISRGPNKISV  700

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             +P+ +RWF D+T   P+ +P      +R  P   + + E VF  +K  IA LK +AN+EM
Sbjct  701   SPVFKRWFGDDTDY-PIRIPRSAMVFDR--PITSSPVQEMVFRSAKEKIAGLKARANAEM  757

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDV--HLILGIGMRARMGLPEGYWGNAVFFIT  1029
             G   ISSLQ+ +AHLWR   R R L  +++   HL + +  R R  +P+ Y+G A+   T
Sbjct  758   GIDRISSLQALLAHLWRCTIRTRRLPEDQETSYHLCIDMRTRRRPQMPQQYFGVALQRGT  817

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS----SN  1197
              ++K G++LG GLG VAWQ+ K +   +  E        F+ES A +   I  S    SN
Sbjct  818   LTMKVGELLGMGLGHVAWQMNKMISTFTEVEAT-----NFLESWAKDPKPISYSTVTMSN  872

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
                ++SSPRF+VYG DFGWG+PV VRSGGG KLDGK T+  G EEGS+DIE+   P TL 
Sbjct  873   AFIMASSPRFNVYGTDFGWGRPVAVRSGGGIKLDGKTTISQGAEEGSIDIEVCSSPETLQ  932

Query  1378  GLENDAEFLEYFT  1416
              +  DA+F+E  T
Sbjct  933   AMLEDADFMEAVT  945


 Score =   367 bits (942),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 200/430 (47%), Positives = 272/430 (63%), Gaps = 10/430 (2%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NLIHHLKTSLSSTLDFFPP  315
             ++R+ELTPWDL  L +GPI +GLLF  PTP  ++    +   ++ HLKTSLS TLDFF P
Sbjct  22    TKRIELTPWDLHVLLLGPITRGLLFLKPTPGPEENGLQTMTAIVDHLKTSLSRTLDFFYP  81

Query  316   LAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTL  495
             LAGR  T +N++D+T   ++DCN AG +F+ A A GVTVA ILD   + VP+I+ S F+ 
Sbjct  82    LAGRLGTTVNDDDDTTCFFIDCNGAGAQFIHAAAGGVTVADILDP--VYVPEIVSSFFSQ  139

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPST  675
             + + N   + +PL+ VQ+TEL+DG F+ CTLN  L DG SFW+FFNSW+E+SRG ++ S 
Sbjct  140   DEVQNYQDVTQPLLSVQVTELVDGIFVGCTLNRVLADGKSFWHFFNSWSEISRGSNKISL  199

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             +P+ +RWF D+T   P+ +P      ER  P   + + E  FH SK  IA LK +AN+EM
Sbjct  200   SPVFKRWFGDDTHY-PIRIPQSAMVFER--PTTSSPVQEMFFHFSKGKIAGLKARANAEM  256

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVFFIT  1029
             GT  ISSLQ+ MAH WR+  RAR+L  +++    L I MR R    +P+ Y+G AV    
Sbjct  257   GTDRISSLQALMAHFWRSTIRARHLPEDQETICTLAIDMRPRRHPQMPQQYFGVAVQGGI  316

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGI  1209
              ++K G++LG GLG VAWQ+ K +   + E +       + + P             L +
Sbjct  317   VTMKVGELLGMGLGHVAWQMNKIISTFT-EVKATNFLKSWAKDPKPATDSTIMMRIALIM  375

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLEN  1389
             + SPRF+VYG DFGWG+PV VR GGG KL+GK T F G EEGS+DIE  + P TL  L  
Sbjct  376   AGSPRFNVYGNDFGWGRPVAVRGGGGIKLNGKATSFQGAEEGSIDIEACLSPETLKALME  435

Query  1390  DAEFLEYFTI  1419
             DAEF+  F I
Sbjct  436   DAEFMGCFFI  445



>ref|XP_009589622.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Nicotiana tomentosiformis]
Length=441

 Score =   377 bits (968),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 216/455 (47%), Positives = 281/455 (62%), Gaps = 32/455 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqq-qqqffNSNLI  267
             +S C +        N  ++ + LTPWDLQ L + PIQKGLLF  P PQQ ++   +S +I
Sbjct  7     VSTCVIMPGKPIDRNSPTKNIHLTPWDLQLLTVDPIQKGLLFRKPNPQQHRKLATSSEII  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             + LKTSLS TLDFFP LAGR A   N  DNT S +++CNN G EF  A A G+TVA I++
Sbjct  67    NRLKTSLSDTLDFFPLLAGRLAACKNS-DNTLSFFINCNNEGAEFTHATAPGLTVADIVE  125

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              +   VP+I++S F LNG+ N           ++TEL+DG+FI CT+NH + DGTSFW+F
Sbjct  126   PTY--VPKIVKSFFPLNGVHN----------FEVTELVDGFFIGCTINHCVADGTSFWHF  173

Query  628   FNSWAELSRGFHQPSTT---PIHERWFPDNTTT-CPVHLPPMIESSERLPPPQRAFLAER  795
             FNSW+E+SR      T    P+ ERWFP  T +   V LP      E  PP     L ER
Sbjct  174   FNSWSEISRTRSSNLTVNKLPVLERWFPKFTASQIHVTLPKEHLYDEFDPP----LLEER  229

Query  796   VFHLSKVNIARLKEKANSEMGT---SIISSLQSYMAHLWRAVTRARN-LHSNEDVHLILG  963
             VFH SK NIA+LK KANSE GT   + ISSLQ+ +AHLW+ V R R    ++E     + 
Sbjct  230   VFHFSKENIAQLKAKANSEFGTDQKTCISSLQAVLAHLWQTVIRCRTGTKADEKFSFKIL  289

Query  964   IGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             IG R R+  P  EGY+GNAV F+  +  A ++L    GW A Q+ K V   +HEE V   
Sbjct  290   IGARPRLQPPLREGYFGNAVHFVNVTTTARELLENNSGWAALQMNKVVAMQTHEE-VMNF  348

Query  1138  YMKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
             Y  +V++P     +E+   +N+L  SSSPRFDVYG DFGWG+P+ VRSG GNK DGK+T+
Sbjct  349   YQSWVKNPKIVKKSEV--VTNSLIASSSPRFDVYGNDFGWGRPIAVRSGAGNKHDGKMTI  406

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G EEGS+DIE  + P TL  +  DA F+E  T+
Sbjct  407   FSGVEEGSIDIEACLTPETLHAMGEDANFMEAVTV  441



>ref|XP_008342727.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=455

 Score =   377 bits (968),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 205/440 (47%), Positives = 275/440 (63%), Gaps = 23/440 (5%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N  ++R+ELTPWDLQF+  G  QKGLLFH P      ++ N +LI HL+ SLS TLD F 
Sbjct  18    NESTQRIELTPWDLQFILFGYAQKGLLFHKPNSTTYDKYPNKSLIQHLQASLSLTLDIFY  77

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLF  489
             PLAGR A   NE+DN  S  VDCN  G +FV A A GVTVA ILD   + VP  I+ S F
Sbjct  78    PLAGRLAITENEDDNITSFSVDCNGTGAQFVYAVADGVTVADILDP--VLVPSDIVHSFF  135

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP  669
              +NG+LN +G+ KPL+ VQ+TEL+DG FI  T+NHS+ DG++FW FFN+W+E+SR  H  
Sbjct  136   FMNGVLNYEGVSKPLLAVQVTELVDGIFIGFTMNHSVVDGSTFWLFFNTWSEISR--HAE  193

Query  670   STT----------PIHERWFPDNTTTCPVHLPPM---IESSERLPPPQRAFLAERVFHLS  810
             ++T          PI  R F D     PV +P     I  +    PP  A L +R+F  S
Sbjct  194   TSTASCGKISQPPPIFSREFFDGIIDFPVRIPNFHNQIPKNRSSTPP--AALHQRIFKFS  251

Query  811   KVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-  987
             K  IA+LK KAN+EMGT+ ISSLQ+ +AHLW ++ R ++ + +++    L IG+R R   
Sbjct  252   KEKIAQLKAKANAEMGTTKISSLQALLAHLWLSIIRNKHFNPDQETKYTLQIGLRQRFQS  311

Query  988   -LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA  1164
              LPE Y GN V F T +    D+L  GLGW AW+I K +   + ++EVRK   +++ESP 
Sbjct  312   PLPEEYLGNLVQFGTATSTVIDLLEHGLGWAAWEINKMIASKT-KDEVRKYLEEWIESPK  370

Query  1165  HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVD  1344
                    +S  + G  SSPRF++YG DFGWG+P+ V+SG  NK +GK+T+  G E+GS++
Sbjct  371   LFQLNNLASDYSFGTGSSPRFNMYGNDFGWGRPLAVKSGSSNKAEGKLTVAPGAEDGSIE  430

Query  1345  IELSIHPHTLLGLENDAEFL  1404
              E  + P TL  L  DAEFL
Sbjct  431   FEACLPPQTLQDLAEDAEFL  450



>ref|XP_007047327.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX91484.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=449

 Score =   377 bits (967),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 201/431 (47%), Positives = 280/431 (65%), Gaps = 22/431 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+E TPWDLQ L +G +Q GLLFH P PQ+++    + LI HLK SLS TLDFF PLAGR
Sbjct  34    RIEQTPWDLQHLLVGYLQWGLLFHKPKPQEEEP--ENGLIQHLKASLSRTLDFFAPLAGR  91

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A++   +D T S ++DCNNAG  FV A A  VT++ +++   + VP I  S F ++G+ 
Sbjct  92    LASI-EHDDKTTSFFIDCNNAGALFVHAVAEKVTISDLIEP--VYVPTIFDSFFQMDGVK  148

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N +G  KPL+ VQ+TEL+DG FIAC++NHS+ DGTSFW+FFNSW+E+SRG    S  PI 
Sbjct  149   NVEGTSKPLLAVQVTELVDGIFIACSMNHSVVDGTSFWHFFNSWSEVSRGSDHLSKPPIF  208

Query  688   ERWFPDNTTTCPVHLPPMIE---SSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMG  858
             +R F D     P+ +P  +      E +PPP    L  RVFHL+K +I ++K KAN+EM 
Sbjct  209   QRQFLDGIDY-PIRIPQTLYLHIQDEFVPPP----LQVRVFHLAKQDIVKIKTKANAEMN  263

Query  859   TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLPEGYWGNAVFFITES  1035
             T+ ISSLQ+  +H W+++ R R+L  N++  + L IG+R ++  LPE Y+GNAV     +
Sbjct  264   TNKISSLQAVFSHFWQSIMRHRHLDPNQESIIFLVIGLRQKLQQLPEEYFGNAVQSAIVT  323

Query  1036  IKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS---SNTLG  1206
             +KAG++L KGLG  AWQ+ KTV  H+ E+     +M F+ES  ++     +S   +N L 
Sbjct  324   LKAGELLEKGLGNAAWQMNKTVANHTEEK-----FMNFLESWVNSPRLYQTSQMMNNALL  378

Query  1207  ISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLE  1386
              +SSPRFD+YG DFGWG+P+  R+G G+K  G +    G EEGS+ I + + P T   LE
Sbjct  379   TASSPRFDIYGNDFGWGRPIAERTGAGSKCGGVLAASCGVEEGSIQIRVCLSPETFQALE  438

Query  1387  NDAEFLEYFTI  1419
             ND EF+   TI
Sbjct  439   NDEEFMAALTI  449



>ref|XP_009338991.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=455

 Score =   376 bits (966),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 274/440 (62%), Gaps = 23/440 (5%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N  ++R+ELTPWDLQF+  G  QKGLLFH P      ++ N +LI HL+ SLS TLD F 
Sbjct  18    NESTQRIELTPWDLQFILFGYAQKGLLFHKPNSTTYDKYPNKSLIQHLQASLSLTLDIFY  77

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLF  489
             PLAGR A   NE+DNT S  V+CN  G + + A A GVTVA ILD   + VP  I+ S F
Sbjct  78    PLAGRLAITENEDDNTTSFSVNCNGVGAQLIHAAADGVTVADILDP--VLVPSDIVHSFF  135

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP  669
              +NG+LN +G+ KPL+ VQ+TEL+DG FI  T+NHS+ DG++FW FFN+W+E+SR  H  
Sbjct  136   FMNGVLNYEGVSKPLLAVQVTELVDGIFIGFTMNHSVVDGSTFWLFFNTWSEISR--HAE  193

Query  670   STT----------PIHERWFPDNTTTCPVHLPPM---IESSERLPPPQRAFLAERVFHLS  810
             ++T          PI  R   D     PV +P     I  +    PP  A L +R F  S
Sbjct  194   TSTANCGKISQPPPIFSRELFDGIIDFPVRIPNFHNQIPKNRSSTPP--AALHQRTFKFS  251

Query  811   KVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-  987
             K  IA+LK KAN+EMGT+ ISSLQ+ +AHLW ++ R ++L+ +++    L IG+R R   
Sbjct  252   KEKIAQLKAKANAEMGTTKISSLQALLAHLWLSIIRNKHLNPDQETKYTLQIGLRQRFQS  311

Query  988   -LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA  1164
              LPE Y GN V F T +    D+L  GLGW AW+I K +   + ++EVRK   +++ESP 
Sbjct  312   PLPEEYLGNLVQFGTATSTVSDLLEHGLGWAAWEINKMIASKT-KDEVRKYLEEWIESPK  370

Query  1165  HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVD  1344
                    +S  + G  SSPRF++YG DFGWG+P+ VRSG  NK +GK+T+  G E+GS++
Sbjct  371   LFQLNNLASDYSFGTGSSPRFNMYGNDFGWGRPLAVRSGASNKAEGKLTVASGAEDGSIE  430

Query  1345  IELSIHPHTLLGLENDAEFL  1404
              E  + P TL  L  DAEF+
Sbjct  431   FEACLPPQTLQDLAEDAEFM  450



>ref|XP_002282930.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Vitis 
vinifera]
Length=437

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 285/436 (65%), Gaps = 17/436 (4%)
 Frame = +1

Query  124   ARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLD  303
             A  N  ++R+ELTPW+LQ L +  IQ+GLLF  P+        NS++I HLKTSLS TLD
Sbjct  15    ASQNESTQRIELTPWELQLLLLSSIQQGLLFLKPS---TPPQENSSIIDHLKTSLSRTLD  71

Query  304   FFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRS  483
              F PLAGR    +N+ DNT S +++CN AG +FV A A  VTVA +L+ +   VP+I+ S
Sbjct  72    SFYPLAGRLGATVND-DNTTSFFINCNGAGAQFVHAAAHDVTVADVLEPAY--VPRIVLS  128

Query  484   LFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFH  663
              F L+G+ N  G+ +PL+ VQ+TEL+DG FI CT+NH + DGTSFW+FFNSW+E SR  +
Sbjct  129   FFPLHGVRNSAGVSEPLLAVQVTELVDGIFIGCTVNHMVADGTSFWHFFNSWSEASRSSN  188

Query  664   QPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
               S  PI + WF D+T    + +P   ++ +    PP     L E+VFH +K  IA LK 
Sbjct  189   SISLPPIFKPWFVDDTHYS-IQIPQSALVSAIPTTPP-----LQEKVFHFTKDKIATLKA  242

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGN  1011
             +AN+EMGT  ISS Q+ +AHLWR+V R R L  +++      IG+R R+   LP+ Y+G 
Sbjct  243   RANAEMGTDQISSSQALLAHLWRSVIRNRGLAEDQETRYNFPIGIRPRLRPPLPQQYFGV  302

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS  1191
             AV   T ++KAG++L  GLG  AWQ+ KTV  ++ EE   K    +V++P   G      
Sbjct  303   AVQPGTVTMKAGELLELGLGHAAWQVNKTVAAYT-EEGATKFLESWVKNPKLLGGGTTMI  361

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
             +++L +S+SP+F VYGADFGWGKPV VRSGGGNKLDGK T F G EEGS+DI++ + P T
Sbjct  362   NDSLYMSNSPQFHVYGADFGWGKPVAVRSGGGNKLDGKTTFFPGSEEGSIDIQVCLSPET  421

Query  1372  LLGLENDAEFLEYFTI  1419
             L  +  DAEF+E  TI
Sbjct  422   LEAMMEDAEFMEAVTI  437



>ref|XP_004231858.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=453

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 278/439 (63%), Gaps = 33/439 (8%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqq--qqqffNSNLIHHLKTSLSSTLDFFPP  315
             S++++LTPWDLQ L + PIQKGL F  P P+Q  +    +S +I+ LK SLS TL+ FP 
Sbjct  20    SKKIQLTPWDLQLLTVDPIQKGLFFRKPNPEQPKELAKSSSEIINRLKVSLSDTLNHFPL  79

Query  316   LAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTL  495
             LAGR     N  D T S +VDCNN G EF    A  +TV  IL+Q+   VP+I++  F L
Sbjct  80    LAGRLIASKNS-DGTSSFFVDCNNEGAEFNYVTAPDLTVDDILEQTY--VPKIVKYFFPL  136

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG------  657
             NG+ N +G+ KPL+ VQ+TEL+DG+FI CT+NH + DGTSFW+FFN W+E++R       
Sbjct  137   NGVCNYEGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFWHFFNCWSEIARSGDSNLI  196

Query  658   FHQPSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVFHLSKVNIAR  828
              ++P   P+ +RWFP+   + P+H+P     +     LP      L ERVFH SK NIA+
Sbjct  197   VNKP---PVLDRWFPEFVAS-PIHVPLSNEHVHDEFDLP-----LLEERVFHFSKENIAQ  247

Query  829   LKEKANSEMGTS---IISSLQSYMAHLWRAVTRAR-NLHSNEDVHLILGIGMRARMG--L  990
             LK KANSE G      ISSLQ+ +AH+W++V R R   ++NE     L IG R R+   L
Sbjct  248   LKAKANSEYGNDQKICISSLQAVLAHIWQSVIRCRCGTNANEKFSFKLLIGARTRLQPHL  307

Query  991   PEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA-H  1167
             PEGY+GNAV F+  +  A ++L    GW A QI K V   +H EEV   Y  +V++P   
Sbjct  308   PEGYFGNAVHFVNVTTTAREMLEHDSGWAAMQINKVVSTQTH-EEVMNFYQNWVKNPKIV  366

Query  1168  NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDI  1347
               +E+   +N+L  SSSPRFDVYG DFGWG+PV VRSG GNK DGK+T+F G EEGS+DI
Sbjct  367   KKSEV--VANSLIASSSPRFDVYGNDFGWGRPVGVRSGAGNKHDGKMTIFCGAEEGSIDI  424

Query  1348  ELSIHPHTLLGLENDAEFL  1404
             E  + P TL  +  D +F+
Sbjct  425   EACLTPETLHAMGQDTKFM  443



>ref|XP_008338333.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=461

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 287/445 (64%), Gaps = 29/445 (7%)
 Frame = +1

Query  130   SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             SN  ++++ELTPWDLQ + +  IQKGLLFH P     +++ N +LI HLK SLS TLD F
Sbjct  27    SNEFTQKIELTPWDLQLILLDHIQKGLLFHKPNSNTYKKYPNKSLIXHLKASLSLTLDIF  86

Query  310   PPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLF  489
              PLAGR     NE+DNT S  V+CN AG EFV A A  VTVA +LD  ++    I+ S F
Sbjct  87    YPLAGRLTITENEDDNTTSFSVNCNGAGAEFVHAVADVVTVADVLD-PDLVPDDIVYSFF  145

Query  490   TLNGILNRD-GICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR----  654
              +NG+LN + G+ KPL+ VQ+TEL+DG FI CT+NHS+ DG+SFW+FFN+W+E+SR    
Sbjct  146   LMNGVLNYEGGVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEISRRGST  205

Query  655   --GFHQPSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVFHLSKVN  819
                  QP   PI  R +       PV +P     I  ++ L P     L +RVFH SK  
Sbjct  206   NGKLSQPP--PIFGREYLGGIIDLPVRIPFFQNQIPKTKFLAP----ILKQRVFHFSKET  259

Query  820   IARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LP  993
             IA+LK KANSEMGT+ ISSLQ+ +AHLW +VTR + L + ++    + +GMR R+   LP
Sbjct  260   IAQLKAKANSEMGTTKISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQRLQPPLP  319

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
             + Y GNAV F   +   G++L +GLGW AW++ K +   + E +VRK+   ++++P    
Sbjct  320   DQYLGNAVLFGIVTSSVGELLERGLGWAAWEMNKMIAAQT-EHDVRKLLEDWIKNP----  374

Query  1174  AEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSV  1341
              ++P+    +SN+L   SSPRFDV+G DFGWG+P+ VRSG GNK DGK+T+F G EEGS+
Sbjct  375   -KVPNLGSLASNSLLTGSSPRFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQGAEEGSI  433

Query  1342  DIELSIHPHTLLGLENDAEFLEYFT  1416
             D E  + P TL  L +DAEF+   T
Sbjct  434   DFEACLSPQTLHALAHDAEFMASLT  458



>ref|XP_008367983.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=461

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 286/445 (64%), Gaps = 29/445 (7%)
 Frame = +1

Query  130   SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             SN  ++++ELTPWDLQ + +  IQKGLLFH P     +++ N +LI HLK SLS TLD F
Sbjct  27    SNEFTQKIELTPWDLQLILLDHIQKGLLFHKPNSNTYKKYPNKSLIQHLKASLSLTLDIF  86

Query  310   PPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLF  489
              PLAGR     NE+DNT S  V+CN AG EFV A A  VTVA +LD  ++    I+ S F
Sbjct  87    YPLAGRLTITENEDDNTTSFSVNCNGAGAEFVHAVADVVTVADVLD-PDLVPDDIVYSFF  145

Query  490   TLNGILNRD-GICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR----  654
              +NG+LN + G+ KPL+ VQ+TEL+DG FI CT+NHS+ DG+SFW+FFN+W+E+SR    
Sbjct  146   LMNGVLNYEGGVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEISRRGST  205

Query  655   --GFHQPSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVFHLSKVN  819
                  QP   PI  R +       PV +P     I  ++ L P     L +RVFH SK  
Sbjct  206   NGKLSQPP--PIFGREYLGGIIDLPVRIPFFQNQIPKTKFLAP----ILKQRVFHFSKET  259

Query  820   IARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LP  993
             IA+LK KANSEMGT+ ISSLQ+ +AHLW +VTR + L + ++    + +GMR R+   LP
Sbjct  260   IAQLKAKANSEMGTTKISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQRLQPPLP  319

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
             + Y GNAV F   +   G++L +GLGW AW + K +   + E +VRK+   ++++P    
Sbjct  320   DQYLGNAVLFGIVTSSVGELLERGLGWAAWXMNKMIAAQT-EHDVRKLLEDWIKNP----  374

Query  1174  AEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSV  1341
              ++P+    +SN+L   SSPRFDV+G DFGWG+P+ VRSG GNK DGK+T+F G EEGS+
Sbjct  375   -KVPNLGSLASNSLLTGSSPRFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQGAEEGSI  433

Query  1342  DIELSIHPHTLLGLENDAEFLEYFT  1416
             D E  + P TL  L +DAEF+   T
Sbjct  434   DFEACLSPQTLHALAHDAEFMASLT  458



>ref|XP_011071710.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=416

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 205/453 (45%), Positives = 274/453 (60%), Gaps = 53/453 (12%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSR-RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS C V  A    +N +S  R+ELTPWDL  L + PIQKG+LF+ P  Q         +I
Sbjct  7     ISSCVVRTA----TNEISMPRLELTPWDLSLLLLDPIQKGILFYKPKSQDF-----QTII  57

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
             HHLKTSLS TLDFF PLAGR  T  N+++ TC  +VDCNNAG EF  A    V+V+ I+ 
Sbjct  58    HHLKTSLSRTLDFFSPLAGRLGTTQNDDNTTC-FFVDCNNAGAEFTHAIVDAVSVSDIVG  116

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              +    PQI+ S F LNG+ N +G+  PL+ VQ+TEL+DG+FI CT NH++ DGTSFW+F
Sbjct  117   PTY--KPQIVSSFFPLNGVANCEGVSMPLVAVQVTELVDGFFIGCTANHAVIDGTSFWHF  174

Query  628   FNSWAELSRGFHQPSTTPIHERWFPDNTTTCP--VHLPPMIES--SERLPPPQRAFLAER  795
              N+W+E+SRG      TP+ ERWFP N +     + LPP+ +S     +PPP    L ER
Sbjct  175   INTWSEISRGLETILKTPVFERWFPTNISNDNRLIPLPPLDKSLLQSFVPPP----LVER  230

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHS-----NEDVHLIL  960
             VFH S+ ++A+LK KAN+E GT  ISSLQ+  AHLWR+V R RN  S     +++V L+ 
Sbjct  231   VFHFSRESVAKLKAKANAEAGTDKISSLQALSAHLWRSVIRCRNQLSIQKVNSQEVDLVF  290

Query  961   GIGMRARMGLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              +G R+R+ LP+ Y+GNAV  +      G++L  GLG+ A ++ + V + S         
Sbjct  291   VVGTRSRIPLPDSYFGNAVHIVKTVANEGELLENGLGYAALKVNELVAQQSL--------  342

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
                                 L  + SPR +VY ADFGWGKP+ VRSG G K DGK+TLF 
Sbjct  343   -------------------ILWKNGSPRHNVYSADFGWGKPIAVRSGKGQKGDGKMTLFP  383

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
               E G +D+E  + P TL  +E DAEF++  TI
Sbjct  384   AAEPGGIDVEACLAPATLKVMEADAEFMDAVTI  416



>ref|XP_008351423.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=456

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 205/442 (46%), Positives = 274/442 (62%), Gaps = 26/442 (6%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N  ++R+ELTPWDLQF+  G  QKGLLFH P P    ++   +LI HL+TSLS TLD F 
Sbjct  18    NESTQRIELTPWDLQFILFGYSQKGLLFHKPKPSTYDKYPXKSLIQHLQTSLSLTLDIFY  77

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLF  489
             PLAGR A   NE+DNT S  VDCN AG +FV A A GVTVA ILD   + VP  I+ S F
Sbjct  78    PLAGRLAITENEDDNTTSFSVDCNGAGAQFVHAVADGVTVADILDP--VLVPSDIVHSFF  135

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS------  651
               NG+LN +G+ +PL+ VQ+TEL DG FI CT NHS+ DG++FW FFN+ +E+S      
Sbjct  136   FFNGVLNYEGVSEPLLAVQVTELFDGIFIGCTTNHSVVDGSTFWRFFNTXSEISRRTETS  195

Query  652   ----RGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR-----AFLAERVFH  804
                 R   QP   PI  R F D      +  P  I +     P  R     A L +R+F+
Sbjct  196   TENCRKISQPP--PIFSREFFDGGI---IDFPVRIANFHNQVPKNRSPALSAPLHQRIFN  250

Query  805   LSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRAR-  981
              SK  IA+LK KAN+EMGT+ ISSLQ+ +AHLW ++ R ++L+ +++    L +G+R R 
Sbjct  251   FSKEKIAQLKAKANAEMGTTKISSLQALLAHLWLSIIRNKHLNPDQESKYTLLVGLRQRF  310

Query  982   -MGLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
              + LPE Y GN V F T +    D+L  GLGW AW+I K +   + ++EVRK   +++ES
Sbjct  311   QLPLPEEYLGNVVQFGTVTSTVSDLLEHGLGWTAWEINKMIASKT-KDEVRKYLEEWIES  369

Query  1159  PAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
             P        +S  + G  SSPRF++YG DFGWG+P+ VRSG  NK  GK+T+  G E+GS
Sbjct  370   PQLIQLNNLASDYSFGTGSSPRFNMYGNDFGWGRPLAVRSGAANKSVGKLTVAPGAEDGS  429

Query  1339  VDIELSIHPHTLLGLENDAEFL  1404
             ++ E  + P TL  L+ DAEF+
Sbjct  430   IEFEACLSPQTLQALDEDAEFI  451



>gb|EYU35826.1| hypothetical protein MIMGU_mgv1a006141mg [Erythranthe guttata]
Length=455

 Score =   372 bits (956),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 290/460 (63%), Gaps = 35/460 (8%)
 Frame = +1

Query  94    SKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHH  273
             S C V  A    +  +SR ++LTPWDLQFL + PIQKG+LFH P      Q   + +I H
Sbjct  8     SSCLVQMASNGNNKSMSR-MDLTPWDLQFLLLDPIQKGILFHKPE----SQQLRNTIIDH  62

Query  274   LKTSLSSTLDFFPPLAGRFAT-VMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             LK +LS TL FFPPLAGR  T V+   DN  S +VDCNNAG EF  A A+ V V+ I + 
Sbjct  63    LKNTLSRTLSFFPPLAGRLGTAVVGNGDNNVSYFVDCNNAGAEFTHAVAAEVCVSDISEP  122

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             + I  P+I+ S F LNG+ N DGI KPL GVQ+TEL+DG+FI+CT NH++ DGTSFW+FF
Sbjct  123   NYI--PEIVSSFFPLNGVSNIDGISKPLFGVQVTELVDGFFISCTANHAIIDGTSFWHFF  180

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPP-----PQRAFLAER  795
             NSW+E+SRGF + S  P+ E+WFP N     + LPP+ E +  LP      PQ   L +R
Sbjct  181   NSWSEISRGFDKISKMPLFEKWFPSNCNDGLILLPPL-EQNNLLPKRHVMMPQ---LLQR  236

Query  796   VFHLSKVNIARLKEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLH--------SNED  945
             VFH SK ++A+LK KANSE G+   IISSLQ   AHLWR++ R +N +          E+
Sbjct  237   VFHFSKESVAKLKAKANSEAGSDKIIISSLQVVSAHLWRSIARNKNRNRRTPQINTQEEE  296

Query  946   VHLIL--GIGMRARMGLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
             V  I+   +G RAR+ L +GY+GN  +    SI   ++LGKGLG++  +I + V    + 
Sbjct  297   VCCIMLFVVGARARIPLGDGYFGNGTYIAKTSISETELLGKGLGYLGMKINEFVASQ-NR  355

Query  1120  EEVRKMYMKFVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNK  1293
             EEV K    ++E P     G+     + TL I+SSPR +VYG DFGWGKP+ VRSG   K
Sbjct  356   EEVVKFVEDWIEKPTIVRKGS---IGNCTLAITSSPRHNVYGNDFGWGKPIAVRSGKSQK  412

Query  1294  LDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYF  1413
              DGK+T F   E+G +D+E+ +   T+  +E+DAEFL+ F
Sbjct  413   FDGKMTTFPAAEDGGIDVEVCLAAETMQAMESDAEFLDAF  452



>emb|CBI21394.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 197/433 (45%), Positives = 269/433 (62%), Gaps = 50/433 (12%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NLIHHLKTSLSSTLDFFPP  315
             +RR+ELTPWDLQ L +G I+KGLLF  PTP  ++    +   ++ HLKTSLS TLDFF P
Sbjct  22    TRRIELTPWDLQLLLLGSIKKGLLFLKPTPGPEENGLQTITAIVDHLKTSLSRTLDFFYP  81

Query  316   LAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTL  495
             LAGR  T +NE+D+T   ++DCN AG +F+ A A GVTVA ILD   + VP+I+ S F L
Sbjct  82    LAGRLGTTVNEDDDTTCFFIDCNGAGAQFIHAAAGGVTVADILDP--VYVPKIVSSFFPL  139

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPST  675
             +G+ N  G+ +PL+ VQ+TEL+DG F+ C+LNH +GDG SFW+FFNSW+E+SRG ++ S 
Sbjct  140   DGVQNYHGVTQPLLAVQVTELVDGIFVGCSLNHVVGDGKSFWHFFNSWSEISRGPNKISV  199

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             +P+ +RWF D+ T  P+ +P                                  +AN+EM
Sbjct  200   SPVFKRWFGDD-TDYPIRIP----------------------------------RANAEM  224

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDV--HLILGIGMRARMGLPEGYWGNAVFFIT  1029
             G   ISSLQ+ +AHLWR   R R L  +++   HL + +  R R  +P+ Y+G A+   T
Sbjct  225   GIDRISSLQALLAHLWRCTIRTRRLPEDQETSYHLCIDMRTRRRPQMPQQYFGVALQRGT  284

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS----SN  1197
              ++K G++LG GLG VAWQ+ K +   +  E        F+ES A +   I  S    SN
Sbjct  285   LTMKVGELLGMGLGHVAWQMNKMISTFTEVEAT-----NFLESWAKDPKPISYSTVTMSN  339

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
                ++SSPRF+VYG DFGWG+PV VRSGGG KLDGK T+  G EEGS+DIE+   P TL 
Sbjct  340   AFIMASSPRFNVYGTDFGWGRPVAVRSGGGIKLDGKTTISQGAEEGSIDIEVCSSPETLQ  399

Query  1378  GLENDAEFLEYFT  1416
              +  DA+F+E  T
Sbjct  400   AMLEDADFMEAVT  412



>gb|KDP31965.1| hypothetical protein JCGZ_12426 [Jatropha curcas]
Length=466

 Score =   369 bits (948),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 203/450 (45%), Positives = 284/450 (63%), Gaps = 21/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   V A  +  S   ++R+EL   DL+FL +  IQKGLLFH P P + +   +   + 
Sbjct  31    ISTSIVQATSSKES---TQRIELMSSDLKFLLVETIQKGLLFHKPKPPEGKIS-DKTFLQ  86

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK SLS TL+FF PLAGR ATV   +DNT S ++DCNN+GV+F+ A A  +T++ IL+ 
Sbjct  87    HLKHSLSFTLNFFTPLAGRLATV-EHDDNTVSFFIDCNNSGVQFIHAVADNITISDILEP  145

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
               I VP I+ S F LNG+ N  GI KPL+ VQ+TEL DG FI CT+NH + DGT+FWNF 
Sbjct  146   --IYVPSIVHSFFPLNGMKNYHGISKPLVAVQVTELDDGIFIGCTMNHVVADGTTFWNFI  203

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVF  801
             NSW+E+SRG    +  P+ E WF  N+  CP+ LP  +    +SE +P  ++    ERVF
Sbjct  204   NSWSEISRGSDHITKPPVFEHWFRSNSYNCPIRLPLSVIKTNNSEAIPTLKQ----ERVF  259

Query  802   HLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTR-ARNLHSNEDVHLILGIGMRA  978
             H +K  IA LKEKA +E G   IS+LQS +AHLWR+V R  +++  +++ +    IG+R 
Sbjct  260   HFTKEKIAWLKEKAKTESGCERISTLQSILAHLWRSVIRNEQSIDPDQETNFHFHIGIRT  319

Query  979   RMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+   +PE Y+G A    T ++KA +++  GLG+ A QI + +  ++ E++VR     +V
Sbjct  320   RLQPPIPEEYFGTATQTGTVTLKARELMENGLGYAALQINRMIAGYT-EDKVRNNLESWV  378

Query  1153  ESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             ++P  +     P   N L  SSSPRF+VYG DF WG+P+ VRSG GNK   K+TLF   E
Sbjct  379   KNPKLYKQGGFP--ENDLITSSSPRFNVYGNDFNWGRPIAVRSGPGNKYCRKITLFPEAE  436

Query  1330  EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             EGSVDIE+S  P  L  + +D EF++  T+
Sbjct  437   EGSVDIEVSFSPEILTAMGSDPEFMDAVTV  466



>ref|XP_006339875.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=451

 Score =   366 bits (940),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 206/457 (45%), Positives = 284/457 (62%), Gaps = 34/457 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSN-GVSRRVELTPWDLQFLQIGPIQKGLLFHNPT--PqqqqqffNSN  261
             ++K  V +    RS   + ++++LTPWDLQ L +  IQKGL FH P     ++    +S 
Sbjct  1     MTKLQVVSTCVIRSQKSIEKKIQLTPWDLQLLTVDSIQKGLFFHKPNLQQHRELAKSSSE  60

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAI  441
             +I+ LK SLS TL+ FP LAGR     N +D T S +VDCNN G EF    A  +TVA I
Sbjct  61    IINRLKISLSDTLNHFPLLAGRLVVSKNSDD-TLSFFVDCNNEGAEFTFVTAPDLTVADI  119

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L+Q+ +  P+I++S F LNG+ N +G+ KPL+ VQ+TEL+DG+FI CT+NH + DGTSFW
Sbjct  120   LEQTYM--PKIVKSFFPLNGVRNYEGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFW  177

Query  622   NFFNSWAELSRG------FHQPSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQ  774
             +FFN W+E++R        ++P   P+ +RWFP+   + P+H+P     +     LP   
Sbjct  178   HFFNCWSEIARNGDSNLIVNKP---PVLDRWFPEFVAS-PIHVPLSKEHVHDEFDLP---  230

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTS---IISSLQSYMAHLWRAVTRAR-NLHSNE  942
                L ERVFH SK NIA+LK KANSE G      ISSLQ+ +AHLW++V R R   +++E
Sbjct  231   --LLEERVFHFSKENIAQLKAKANSEYGNDQKICISSLQAVLAHLWQSVIRCRCGTNADE  288

Query  943   DVHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSH  1116
                  L IG R R+   L EGY+GNAV F+  +  A ++L    GW A Q+ K V   +H
Sbjct  289   KFSFKLLIGARPRLQPHLLEGYFGNAVHFVNVTTTAREMLEHDSGWAALQMNKVVSTQTH  348

Query  1117  EEEVRKMYMKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNK  1293
              EEV   Y  +V++P     +E+   +N+L  SSS RFDVYG DFGWG+PV VRSG GNK
Sbjct  349   -EEVMNFYQSWVKNPKIVKKSEV--VANSLIASSSSRFDVYGNDFGWGRPVAVRSGAGNK  405

Query  1294  LDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
              DGK+T+F G E+GS+DIE  + P TL  +  D +F+
Sbjct  406   HDGKMTIFCGAEQGSIDIEACLTPETLHAMGQDTKFM  442



>ref|XP_004288019.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=449

 Score =   366 bits (939),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 198/438 (45%), Positives = 282/438 (64%), Gaps = 18/438 (4%)
 Frame = +1

Query  124   ARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLD  303
             + ++ ++ RVELTPWDL+ L++  IQKGL F  P     ++  + NLI HLK SLS TLD
Sbjct  16    SENDELTHRVELTPWDLRLLKLEYIQKGLPFQKPA----EKGVDQNLIQHLKVSLSRTLD  71

Query  304   FFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILR  480
                PLAGR + + NE+  TC  +++CN+AG +FV A   GV VA ILD   + +P +I+ 
Sbjct  72    ILHPLAGRLSQIENEDGTTC-FFINCNSAGAQFVHAAHDGVRVADILDP--VYIPDEIIE  128

Query  481   SLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF  660
             +LF++N +LN +G  KPL+ VQ+TEL DG FI C++NH++ DGTSFW+FFN+W+ +SR  
Sbjct  129   NLFSMNSVLNYEGTSKPLLAVQVTELADGIFIGCSINHAVADGTSFWHFFNTWSLISRSG  188

Query  661   HQPS---TTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIA  825
                +   +TP+  R F D     PV +P   +    + +     + L +RVFH  K  +A
Sbjct  189   SDDTVSQSTPVFGRHFLDGLIDLPVRVPFSQIQIQRQLIQQTPSSNLLQRVFHFPKEKVA  248

Query  826   RLKEKANSEMGTSIISSLQSYMAHLWRAVTRAR-NLHSNEDVHLILGIGMRARMG--LPE  996
             +LK KAN+EM TS ISSLQ+ MAHLWRA TR R +L SNE++   + IG+R +M   LP+
Sbjct  249   QLKAKANAEMSTSNISSLQALMAHLWRATTRGRCDLKSNEEITYRIAIGLRQKMKPPLPD  308

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA-HNG  1173
              Y GNA+  ++    A D+L  GLGW A +I K +     E+  R++   +V++P+    
Sbjct  309   LYMGNALRGVSTYSTASDLLQHGLGWAALKINKAISAMRPEDVTRELE-DWVKAPSIRPN  367

Query  1174  AEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIEL  1353
                 +S + L   SSPRF+VYG DFGWG+PV VRSG  NK++GK+T+F G EEGS+D E+
Sbjct  368   LRAETSVHGLLTGSSPRFNVYGNDFGWGRPVAVRSGSANKMNGKLTVFPGAEEGSIDFEV  427

Query  1354  SIHPHTLLGLENDAEFLE  1407
              + P TL  +ENDAEF+E
Sbjct  428   CLLPETLHAMENDAEFME  445



>gb|KHN18660.1| Putative acetyltransferase [Glycine soja]
Length=441

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 204/444 (46%), Positives = 271/444 (61%), Gaps = 18/444 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A  +  ++   ++++LTPWDLQFL I  IQ+GLLF N            N I 
Sbjct  7     ISTTTIKAPPSHNNHDSVQKIDLTPWDLQFLPIETIQEGLLFRN--------KHTKNQIE  58

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HL+ SLSSTL FFPPLAGR   ++   DNT S ++ CNNAG  FV A A   TV  IL  
Sbjct  59    HLQHSLSSTLAFFPPLAGRL-VILQHHDNTVSSHIVCNNAGALFVHAVADNTTVVDILQP  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP I+ S F LNG+ N +G  +PL+ VQ+TEL+DG F+A T+NH + DG SFW+F 
Sbjct  118   KY--VPPIVCSFFPLNGVKNHEGTSQPLLAVQVTELVDGIFVAVTINHIVADGKSFWHFV  175

Query  631   NSWAELSRGFHQPSTTPIHERWFP---DNTTTCPVHLPPMIESSERLPPPQRAFLAERVF  801
             NSWAE+SRG  + S  P  ER+FP   D     P       E  E     +   L+ERVF
Sbjct  176   NSWAEISRGIPKISKIPFFERFFPVGIDRAIRFPFTKVEEKEEGEHSQNLEPKTLSERVF  235

Query  802   HLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRAR  981
             H +K  I+ LK KAN+E  T  ISSLQ+ +  LWRAV+R +++   E+VH +L IG+RAR
Sbjct  236   HFTKRKISELKSKANAEANTDKISSLQAVLTLLWRAVSRCKHMGPQEEVHFVLLIGVRAR  295

Query  982   MGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVE  1155
             M  P  E Y+GNA+     ++KAG++L  GLG  A +I K +  HSH E+V+  Y     
Sbjct  296   MIPPLEEDYFGNAILAGRVTMKAGELLEGGLGKGALEINKMISLHSH-EKVKNHYESLAR  354

Query  1156  SPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEG  1335
             +P  +   I  ++N+L ISSSPRFD+YG DFGWGKPV VRSG  N  +GKVT+F G +E 
Sbjct  355   TPMLSTPGI-GAANSLMISSSPRFDIYGNDFGWGKPVAVRSGDANIGNGKVTVFAGSKED  413

Query  1336  SVDIELSIHPHTLLGLENDAEFLE  1407
             S+DI +S+    L  + ND EF++
Sbjct  414   SIDIHVSLPYEILEAMGNDPEFVD  437



>ref|XP_007204008.1| hypothetical protein PRUPE_ppa025918mg [Prunus persica]
 gb|EMJ05207.1| hypothetical protein PRUPE_ppa025918mg [Prunus persica]
Length=452

 Score =   362 bits (928),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 207/443 (47%), Positives = 272/443 (61%), Gaps = 41/443 (9%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ELTPWDL+ +Q   IQKG+LFH      + +  N +L+  LK SLS TL+ F PLAGR
Sbjct  25    KIELTPWDLRLIQFDYIQKGILFHK---SAETEDSNVSLVQRLKDSLSLTLNIFYPLAGR  81

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLFTLNGI  504
                  N ED+T S+ + CN AG EFV A A GV VA IL   N  +P  ++ +LF+LN +
Sbjct  82    LVVSENAEDSTVSISIKCNGAGAEFVHAAADGVKVADIL---NPYIPDHVIFNLFSLNEV  138

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-GFH---QPS  672
              N +G+ KPL+  Q+TELLDG FI C+LNH + DGTSFW+FFN+WAE+SR G H   QP 
Sbjct  139   RNYEGVSKPLLSAQVTELLDGIFIGCSLNHLVADGTSFWHFFNTWAEISRSGSHKILQPR  198

Query  673   TTPIHERWFPDNTTTCPVHLP---------PMIESSERLPPPQRAFLAERVFHLSKVNIA  825
               P+  R F D     PVHLP         P+I+SS        AFL   VFH  K  IA
Sbjct  199   --PVFGRQFLDGVIDLPVHLPFSYSEIIGEPIIKSSSF-----NAFLQRVVFHFPKEKIA  251

Query  826   RLKEKANSEMGT-SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM---GLP  993
             +LK KAN+EMGT S ISSLQ+ MAHLW+A TRAR+L  ++ V+    IG+R R     LP
Sbjct  252   KLKAKANAEMGTTSNISSLQALMAHLWQATTRARHLQPDQQVNYRFAIGLRQRWEPETLP  311

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
             + Y G A+  +  +  A ++L  GLGW A QI K +   +  E+ R   + +V  P    
Sbjct  312   KEYLGTAIIGVNVTAIASELLQNGLGWAASQINKKISSLT-PEQARNDLVDWVNKPTL--  368

Query  1174  AEIPSSSN-----TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
               IP+  N      L   SSPRF+VYG DFGWG+P+ VRSG G+K+DGK+T+F G EEGS
Sbjct  369   --IPNMRNPTLLARLLTGSSPRFNVYGNDFGWGRPLAVRSGAGDKMDGKLTVFPGAEEGS  426

Query  1339  VDIELSIHPHTLLGLENDAEFLE  1407
             +D E  + P T+  + +DAEF+E
Sbjct  427   IDFEACLLPETIQTMMDDAEFME  449



>ref|XP_007021469.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY12994.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=442

 Score =   360 bits (925),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 275/442 (62%), Gaps = 17/442 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   V AA   +     +R+EL PWDL FL +    KGLL++ P   +++      ++H
Sbjct  7     ISNSIVRAANPKKE---VQRIELAPWDLMFLAMDYAPKGLLYYKPK-LKKEGELGETIVH  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
              LKTSLS TLD+F PLAGR AT+   EDNT S ++DCNNAGV FV A A+G+T++ I+  
Sbjct  63    QLKTSLSQTLDYFSPLAGRLATI-ELEDNTSSFFIDCNNAGVLFVHAAANGITISDIIGP  121

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             S   VP  +R+LF LN + N +   KPL+ +Q+TEL DG FI+CT NH + DGTSF +FF
Sbjct  122   SA--VPSFVRTLFQLNEVKNYESTSKPLLAIQVTELADGIFISCTYNHVVVDGTSFVHFF  179

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPP--MIESSERLPPPQRAFLAERVFH  804
             N WAE+SRG  + +  P  +RWFP N    PV +P   +    + +PP     L  R FH
Sbjct  180   NCWAEISRGSIELAKPPALQRWFP-NGIEGPVGIPNSYLTYGHDFIPP----CLQVRFFH  234

Query  805   LSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
              +K +IA LK KAN+E+GT  ISSLQ+ ++H+WR V R +NL   E+ +  L +  ++R+
Sbjct  235   FTKASIANLKAKANAEVGTDKISSLQALLSHIWRTVIRCKNLDPVEETNFFLPVSAKSRL  294

Query  985   -GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
               L + Y GNA+     ++K  D+L KGLG  AW+I K++   S EE++      + ESP
Sbjct  295   YQLSQQYIGNAMQGKVITMKVKDLLEKGLGNAAWEINKSIASQS-EEKMTTFLESWKESP  353

Query  1162  AHNGAEIPSS-SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
                 A + S+ SN L +  SPRFD Y  DFGWG+P+ +RSG GNK DGK+T++GG EEGS
Sbjct  354   LLLTAGLASTVSNLLVLGGSPRFDYYSVDFGWGRPIAIRSGVGNKHDGKITVYGGLEEGS  413

Query  1339  VDIELSIHPHTLLGLENDAEFL  1404
             +DIE    P TL  L N  EF+
Sbjct  414   MDIEACFIPETLQALANCKEFM  435



>ref|XP_007204342.1| hypothetical protein PRUPE_ppa005630mg [Prunus persica]
 gb|EMJ05541.1| hypothetical protein PRUPE_ppa005630mg [Prunus persica]
Length=450

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 275/435 (63%), Gaps = 25/435 (6%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             ++R+ELTPWDL+ +Q+  IQKGLLFH P     ++  N +LI HLK SLS TL+ F PLA
Sbjct  23    AQRIELTPWDLRLIQLDYIQKGLLFHKPV----EKEANQSLIQHLKASLSHTLNIFYPLA  78

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLFTLN  498
             GR A V  +EDNT    ++CN  G  FV A A GV V+ ILD  ++ VP  I+ +LF+LN
Sbjct  79    GRLA-VTEDEDNTTCFSINCNGDGALFVHASADGVEVSDILD--SVYVPADIVSNLFSLN  135

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-GFHQPST  675
              + N +GI KPL+ VQ+TEL DG+FI C++NH + DGTSFW+FFN+W+E+SR GF + S 
Sbjct  136   EVPNFEGISKPLLAVQVTELFDGFFIGCSINHMVVDGTSFWHFFNTWSEISRIGFDKISQ  195

Query  676   -TPIH-ERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEK  840
               P+   R + D+    P+HLP     I S   +  P    L   VFH  K  +A LK K
Sbjct  196   PCPVFGRREYHDSLIDLPIHLPMSYDEIRSKHLIIGPSSYSLQTVVFHFPKEKLAELKAK  255

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNA  1014
             AN+EM  + IS+LQ+ MAHLW A TR R+L+ N++V  ++ +G+R ++   LP+ Y+GN 
Sbjct  256   ANAEMVNNNISTLQALMAHLWLATTRCRHLNPNQEVTYLIAVGLRQKLKPPLPKEYFGNG  315

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             V  +     A ++L  GLGW A QI KT+   +  EE RK    + ++P      +P  S
Sbjct  316   VLGVNVKSSASELLHHGLGWAASQINKTIASLT-AEEARKYLQGWEKAPIF----LPKFS  370

Query  1195  NT----LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
             +     L   SSPRF+VYG DFGWG+PV VRSG  N +DGK+T+F G EEGSVD E  + 
Sbjct  371   DPKMVGLLTGSSPRFNVYGNDFGWGRPVAVRSGAANNMDGKLTVFPGAEEGSVDFEACLL  430

Query  1363  PHTLLGLENDAEFLE  1407
             P T+  + +DAEF+E
Sbjct  431   PETIQAMLDDAEFME  445



>gb|KDP31964.1| hypothetical protein JCGZ_12425 [Jatropha curcas]
Length=446

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 195/431 (45%), Positives = 270/431 (63%), Gaps = 19/431 (4%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             ++R+E TP+DL FL +    +GLLF  PT  Q  +  N N+I HLK SLS TL+ FPP A
Sbjct  22    AQRIEFTPFDLPFLVVDYTNRGLLFLEPTTLQLSKLKNENVIDHLKNSLSKTLEIFPPFA  81

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             G  AT+ NE D T S ++DCN+AG  FV A A  VTVA ILD  ++ VP  + S F +NG
Sbjct  82    GCLATIENE-DKTTSFFIDCNDAGAWFVHANAKTVTVADILD--SLYVPSFVHSFFLMNG  138

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS----RGFHQP  669
             +   +G  KPL+ VQ+TEL+DG FI  T NH++ DGTSFWNF N  +++S    +   Q 
Sbjct  139   VYKFEGHSKPLLAVQVTELVDGIFIGFTYNHAIADGTSFWNFVNKLSDMSISCEKKLLQT  198

Query  670   STTPIHERWFPDNTTTCPVHLPPMIE---SSERLPPPQRAFLAERVFHLSKVNIARLKEK  840
             S       WF D     P+ +P       S+  + PP    L ERVFH S+  IA+LK K
Sbjct  199   SRPVFGFDWFLDGIDH-PIRVPFSYNEAISNRFISPP----LLERVFHFSQKKIAQLKTK  253

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNA  1014
             AN+E+GTS ISSLQ+ +  LWR++ R RNL S+++++  + + MR R+   LP+ Y+GNA
Sbjct  254   ANAEIGTSKISSLQAILGQLWRSIIRPRNLDSDQEIYCRVLVNMRQRLQPPLPDKYFGNA  313

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             V F   +  AG++L  GLG+ A QI K V + + + EVRK    +V+ P  +     ++S
Sbjct  314   VLFGIAATTAGELLANGLGFAALQINKMVARQT-DSEVRKYLEGWVKRPTLSKLS-SAAS  371

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTL  1374
             N L ++SSPRF+V+G DFGWG+PV VR G GN  DGK+T+F G EEGSVD++  + P  L
Sbjct  372   NALIVASSPRFNVFGNDFGWGRPVAVRGGAGNNYDGKITVFPGVEEGSVDVQACLLPQIL  431

Query  1375  LGLENDAEFLE  1407
               +E D EF++
Sbjct  432   HAMEEDEEFMD  442



>ref|XP_003549969.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|KHN01667.1| Putative acetyltransferase [Glycine soja]
Length=443

 Score =   358 bits (920),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 203/445 (46%), Positives = 268/445 (60%), Gaps = 18/445 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A  +  ++   ++++LTPWDLQFL I  IQ+GLLF N            N I 
Sbjct  7     ISTTTIKAPPSHNNHDSVQKIDLTPWDLQFLPIETIQEGLLFRN--------KHTKNQIE  58

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HL+ SLSSTL FFPPLAGR   ++   DNT S ++ CNNAG  FV A A   TV  IL  
Sbjct  59    HLQHSLSSTLAFFPPLAGRL-VILQHHDNTVSSHIVCNNAGALFVHAVADNTTVVDILQP  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP I+ S F LNG+ N +G  +P++ VQ+TELLDG FIA T+NH + DG SFW+F 
Sbjct  118   KY--VPPIVCSFFPLNGVKNHEGTSQPVLAVQVTELLDGVFIAFTINHVVADGKSFWHFV  175

Query  631   NSWAELSRGFHQPSTTPIHERWFP---DNTTTCPVHLPPMIESSERLPPPQRAFLAERVF  801
             NSWAE+SRG  + S  P  ER+FP   D     P       E  E     +   L+ERVF
Sbjct  176   NSWAEISRGIPKISKIPFFERFFPVGIDRAIRFPFTKVEEKEEGEHSQNLEPKTLSERVF  235

Query  802   HLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRAR  981
             H +K  I+ LK KAN+E  T  ISSLQ+ +  LWRAV+R +++   E+VH +L IG R R
Sbjct  236   HFTKRKISELKSKANAEANTDKISSLQAVLTLLWRAVSRCKHMGPQEEVHFVLLIGARPR  295

Query  982   M--GLPEGYWGNAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             +   L   Y+GNA      ++KA ++L + G G  A +I K +  HSH E+VR  Y  +V
Sbjct  296   LIPPLANDYFGNAALVGRATMKAEELLQEGGFGMGASEINKVISSHSH-EKVRSYYESWV  354

Query  1153  ESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE  1332
              +P        ++SN+L  S SPRF+VYG DFGWGKP+ VRSGG NK  GK+TLFGG EE
Sbjct  355   RTPRLFAIGRLANSNSLATSGSPRFNVYGNDFGWGKPLTVRSGGANKSSGKITLFGGAEE  414

Query  1333  GSVDIELSIHPHTLLGLENDAEFLE  1407
             GS+DIE+ +    L  + ND+E ++
Sbjct  415   GSMDIEVCLPYVILEAIGNDSELMD  439



>ref|XP_007203667.1| hypothetical protein PRUPE_ppa026934mg, partial [Prunus persica]
 gb|EMJ04866.1| hypothetical protein PRUPE_ppa026934mg, partial [Prunus persica]
Length=443

 Score =   357 bits (917),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 277/432 (64%), Gaps = 18/432 (4%)
 Frame = +1

Query  139   VSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPL  318
             ++RR++LTP DLQ +QI   QKGLLFH P      Q  ++NL+ HLK SLS TLD F PL
Sbjct  21    LARRIQLTPCDLQLIQIYYNQKGLLFHKPA----DQEQSNNLVQHLKASLSRTLDIFYPL  76

Query  319   AGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP-QILRSLFTL  495
             AGR A + NE++NT   +++CN AG +FV A A  V VA IL    + +P +I+  LF L
Sbjct  77    AGRLAPIENEDNNTTCFFINCNGAGAQFVHATADCVKVADIL--GPLCIPDEIVYHLFPL  134

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG----FH  663
             N + N +GI KPL+ VQ+TEL+DG FI C++NH++ DGTSFW+FFN+W+E+S        
Sbjct  135   NAVRNYEGISKPLLAVQVTELVDGIFIGCSINHAVVDGTSFWHFFNTWSEISSAGCNNIS  194

Query  664   QPSTTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEK  840
             QP   P   R F D+    PV LP    E + +L       L   +FH SK  +A LK K
Sbjct  195   QPP--PFFGRQFLDSVIDLPVQLPFSYGEITRKLVRRSSESLQRVLFHFSKQKVAELKSK  252

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNA  1014
             AN+E+G + ISSLQ+ MAHLWRA TR+RNL+ ++++   + +G+R R+   LPE Y GNA
Sbjct  253   ANAEIGINNISSLQALMAHLWRAATRSRNLNPDQEIIYRVMVGLRQRLKPPLPEEYLGNA  312

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAH-NGAEIPSS  1191
             V  +     AG++L  GLGW A QIK+ +   +  +E RK   ++V++P   +     S+
Sbjct  313   VKAVLVKSTAGELLHHGLGWAALQIKEQIASLT-ADEARKSLEEWVKTPIFVSNISNIST  371

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
             S+ L   SSPRF+V+G DFGWG+P+ VRSG  +K +G++T+F G EEGS+D+E  + P  
Sbjct  372   SSALLTGSSPRFNVFGNDFGWGRPLAVRSGAADKTNGRLTVFPGAEEGSIDVEACLFPEA  431

Query  1372  LLGLENDAEFLE  1407
             L  +++D EF+E
Sbjct  432   LQAMKDDKEFME  443



>ref|XP_004511082.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=448

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/443 (45%), Positives = 274/443 (62%), Gaps = 28/443 (6%)
 Frame = +1

Query  130   SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             +N   + ++LTPWDLQFL  G  QKGLL+H+P     ++   SN IHHLK SLS+TLDFF
Sbjct  21    NNSTDQEIDLTPWDLQFLPFGVNQKGLLYHHP-----KELNTSNQIHHLKHSLSTTLDFF  75

Query  310   PPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLF  489
             PP  GR   +    DNT S  + CNN G  F+ A A   +VA IL+ + +  P IL S F
Sbjct  76    PPFTGRLK-ITEHRDNTISCSITCNNEGALFLHAIAKNTSVADILEPTYL--PPILHSFF  132

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP  669
              LNG+ N  G  +PL+ VQ+TELLDG FI  T+NH + DG S W+F NSWAE+S+G  + 
Sbjct  133   PLNGVKNYQGTSQPLLAVQVTELLDGIFIGFTINHVVVDGKSIWHFVNSWAEISKGCLKT  192

Query  670   STTPIHERWFPDNTTTCPVHLPPMIESS----------ERLPPPQRAFLAERVFHLSKVN  819
             S  P  ERWFP+N    P+  P  IE            + L PP      ER+FH +K N
Sbjct  193   SKLPTFERWFPNNIIQRPIRFPFTIEQQNNNSNNKGEDQNLNPP------ERLFHFTKEN  246

Query  820   IARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLP  993
             IA+LK KAN E+GT  +SSLQ+   H+WR++ R++ L   E+V  ++ IG+R R+   L 
Sbjct  247   IAKLKLKANIEVGTKKLSSLQALFTHIWRSIIRSKLLEPQEEVKYMVVIGIRPRLVPALQ  306

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGW-VAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN  1170
             E Y+GNA+     ++K G++L +G     AW++ K +  HS +E+++K Y  + ++P   
Sbjct  307   EDYFGNAMIICGVTMKVGELLEEGGLGKSAWEMNKMIALHS-DEKLKKHYETWSKTPTFI  365

Query  1171  GAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIE  1350
                  ++SNTL  SSSP FDVYG DFGWGKPV VRSGG NK +GK+++F G EEGS+D+E
Sbjct  366   TPGSVANSNTLVTSSSPWFDVYGNDFGWGKPVGVRSGGANKKNGKISVFAGVEEGSMDLE  425

Query  1351  LSIHPHTLLGLENDAEFLEYFTI  1419
             + +    L  + ND EF+ + +I
Sbjct  426   VCLPYEILEAIGNDPEFMAFVSI  448



>gb|KEH31452.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=447

 Score =   357 bits (915),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/428 (44%), Positives = 261/428 (61%), Gaps = 21/428 (5%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             R ++LTPWDLQFL +  IQKG+LFH   P       N N I+HLK +LS+TL +FPPL G
Sbjct  28    RIIDLTPWDLQFLLVETIQKGILFHQTIP-------NQNQINHLKQTLSTTLSYFPPLTG  80

Query  325   RFATVMNE--EDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             R     +    +N  S  + CNN G  F+ AKA   TV+ IL  +   VP I+ S F LN
Sbjct  81    RLIITQHNVTTNNNTSCSIICNNIGALFIHAKAENTTVSDILKPNY--VPSIVHSFFPLN  138

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT  678
             G+ N +   +P++GVQ+TEL +G FI  TLNH + DG  FW+F N+W+++S+ F      
Sbjct  139   GVKNYEATSQPILGVQVTELANGIFIGLTLNHVVCDGKMFWHFINTWSQISKNFQSIPKL  198

Query  679   PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMG  858
             P  +RWFP N    P+  P     S+R  PPQ   L ER+FH +K  IA LK KAN E  
Sbjct  199   PSFQRWFP-NEVELPIRFPFTKTESQRRKPPQN--LPERIFHFTKEKIAELKSKANEETK  255

Query  859   T----SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             T    + ISSLQ+ ++H+WR V R++ L   ED   +L IG+R RM  P  E Y+GNA  
Sbjct  256   TKNVQTKISSLQALLSHVWRCVVRSKKLDPEEDFRYVLVIGVRPRMTPPLDEDYFGNAGI  315

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
               + ++KAG++L  G+G  + ++ K +   S +E++R  Y  +++ P   G    + +N+
Sbjct  316   IGSVTMKAGEILECGIGKCSLEMNKMIMLRS-DEKIRDDYECWLKMPKLFGINSLAGANS  374

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
             L  SSSPRFDVY  DFGWGKPV VRSGG NK +GK+T+F G +EGS+DIE+ +    L  
Sbjct  375   LATSSSPRFDVYDNDFGWGKPVGVRSGGANKSNGKITVFAGADEGSIDIEVCLSYEILEA  434

Query  1381  LENDAEFL  1404
             L NDAEF+
Sbjct  435   LGNDAEFM  442



>ref|XP_004509128.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=437

 Score =   356 bits (914),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 272/434 (63%), Gaps = 19/434 (4%)
 Frame = +1

Query  115   AGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSS  294
             A +  +N  + +++LTPWDL FLQ+  IQKGLLFH+          + N I+HLK +LSS
Sbjct  14    APSHHNNSSTHKIDLTPWDLPFLQVETIQKGLLFHH--------TIHPNQINHLKHTLSS  65

Query  295   TLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQI  474
             TL FFPPLAGR     ++++N  S ++ CNN G  FV A A   TVA IL Q N  VP +
Sbjct  66    TLSFFPPLAGRLVITHHKDNNNASCFIICNNLGALFVHATAQNTTVADIL-QPNY-VPPV  123

Query  475   LRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR  654
             + S F LNG+ N +   +P++ +Q+TELLDG FI  T+NH + DG SFW+F NSW+++S+
Sbjct  124   VHSFFPLNGVKNCESTSQPILAIQVTELLDGVFIGFTINHVVSDGKSFWHFVNSWSQISK  183

Query  655   GFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLK  834
             G H+ +  P  +RWFP N    P+ LP    ++E L  P    L ER+FH +K  IA LK
Sbjct  184   G-HKIAKLPSLKRWFP-NDIELPIKLP--FTTTELLKEPSFNKLPERIFHFTKEKIAELK  239

Query  835   EKANSEMGTSII--SSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGY  1002
              KAN+E  T  I  SSLQ+ ++H+WR V R + L   E+V  +L IG+R RM   L E Y
Sbjct  240   SKANAEAETEKIKISSLQAVLSHVWRCVIRCKRLDPQEEVRYVLLIGVRPRMVPQLEEEY  299

Query  1003  WGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI  1182
             +GNA      ++KAG+V   G+G VA ++ K +  HS +E++ + Y  ++ +P       
Sbjct  300   FGNAALVCGVTMKAGEVQESGIGNVAMEMNKMISLHS-DEKIMESYECWLRTPRLLTIGG  358

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
              +  N+L  SSSPRFDVYG DFGWGKPV VRSGG NK +GK+++F G +EGS+DIE+ + 
Sbjct  359   MTGGNSLATSSSPRFDVYGNDFGWGKPVAVRSGGANKNNGKISVFVGADEGSMDIEVCLP  418

Query  1363  PHTLLGLENDAEFL  1404
                L  + ND EF+
Sbjct  419   FEILEAMGNDTEFM  432



>ref|XP_003524646.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|KHN42862.1| Putative acetyltransferase [Glycine soja]
Length=436

 Score =   356 bits (913),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 198/428 (46%), Positives = 266/428 (62%), Gaps = 16/428 (4%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N  +++++LTPWDL+ L I  I++GLLF N       +    N I HL+ SLSSTL FFP
Sbjct  18    NNSTQKIDLTPWDLRLLTIETIRRGLLFRN-------EKHTPNQIKHLQHSLSSTLAFFP  70

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             PLAGR   ++   DN  S ++ CNNAG  FV A A   TVA IL      VP I+RS F 
Sbjct  71    PLAGRLV-ILEHHDNIVSSHIVCNNAGALFVHAVADNTTVADILQPKY--VPLIVRSFFQ  127

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS  672
             LNG+ N +G  +PL+ VQ+TEL+DG F+A T+NH + DG SFW+F NSWAE+SRG  + S
Sbjct  128   LNGVRNYEGTSQPLLAVQVTELVDGIFVAVTINHIVADGKSFWHFVNSWAEISRGNPKIS  187

Query  673   TTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
               P  +R F D    CP+  P   E     P  +R  L  R+FH +K  +  LK KAN+E
Sbjct  188   KLPTLQRCFLDG-IDCPILFPFTKEEHLHSPNLKRQPLPNRIFHFTKEKVLELKSKANAE  246

Query  853   MGT-SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVFF  1023
               T  IISSLQ+ +  LWR+V R +++   E+VH +L IG+RARM  P  E Y+GNA+  
Sbjct  247   ANTDKIISSLQALLTLLWRSVIRCQHVGPQEEVHFVLLIGVRARMIPPLEEDYFGNAILA  306

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTL  1203
                ++KAG++L  GLG  A +I K +  HSH E+V+  Y     +P  +   I  ++N+L
Sbjct  307   GRVTMKAGELLEGGLGKGALEINKMISLHSH-EKVKNHYESLARTPMLSTPGI-GAANSL  364

Query  1204  GISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGL  1383
              ISSSPRFD+YG DFGWGKPV VRSG  N  +GKVT+F G +E S+DI +S+    L  +
Sbjct  365   MISSSPRFDIYGNDFGWGKPVAVRSGDANIGNGKVTVFAGSKEDSIDIHVSLPYEILEAM  424

Query  1384  ENDAEFLE  1407
              ND EF++
Sbjct  425   GNDPEFVD  432



>ref|XP_004230696.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
 ref|XP_004230697.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=471

 Score =   352 bits (903),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 198/453 (44%), Positives = 276/453 (61%), Gaps = 19/453 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN--  261
             IS   V AAG ++ +  +   +ELTPWD+  LQI   Q GLL+  PT +Q +    S   
Sbjct  8     ISTWTVKAAGTSQHHTDNCEIIELTPWDILALQIDYAQSGLLYPMPTGEQVRDVSKSTNT  67

Query  262   --LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVA  435
               LI HL+ SLS  LDF+PP  GR   +  E+  T S  ++CNNAGV F  A A GVT+ 
Sbjct  68    TTLIDHLRVSLSRALDFYPPFCGRLEAI-TEQSGTTSFVINCNNAGVLFSHAIAGGVTIR  126

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICK-PLMGVQITELLDGYFIACTLNHSLGDGT  612
              I++ +   VP ++R  F+LNG+ N++   + P + VQ+TEL+DG FI CT NH + DGT
Sbjct  127   DIIESNC--VPHVVRDFFSLNGVQNQEATSQLPCLAVQVTELVDGIFIGCTNNHVVVDGT  184

Query  613   SFWNFFNSWAELSRGFHQPSTTPIHERWFP---DNTTTCPVHLP-PMIESSERLPPPQRA  780
             SFWNF+NSWAELSRG    S  P  +R FP   D      + +P   I S ++  PP   
Sbjct  185   SFWNFYNSWAELSRGSKIISKIPFLKREFPFKIDGFYPNRISIPNERINSGDKFIPPALQ  244

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L E+VFH +K NI +LK KAN EM T+ ISSLQ+ +AH+WR+V R R L  NE+    +
Sbjct  245   MLREKVFHFTKENIYKLKAKANHEMNTTKISSLQAVLAHVWRSVIRCRRLDHNEETTFEV  304

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
              I MR ++   LPEGY+GNA++ +T +IK G +L  G GW A QI +++  H H E+++ 
Sbjct  305   SINMREKVNPPLPEGYFGNAIYPVTVTIKTGQLLEHGFGWAALQINESIASHDH-EKLKC  363

Query  1135  MYMKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVT  1311
             +Y  +++ P      E+P  SN   + +SPRF+ +  DFGWGKP+  RSG GN LDGK+T
Sbjct  364   IYENWMKDPEIQKLDELP--SNYFMLHNSPRFNFFKYDFGWGKPIAHRSGEGNMLDGKIT  421

Query  1312  LFGGCEEGSVDIELSIHPHTLLGLENDAEFLEY  1410
             +  G EEGS+ +E+ +   T+  LE D  F E+
Sbjct  422   VSPGVEEGSMIVEICLSSETIQALEEDIIFGEF  454



>gb|AAV50009.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase [Malus domestica]
Length=398

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 261/400 (65%), Gaps = 17/400 (4%)
 Frame = +1

Query  256   SNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVA  435
             S  I HLK SLS TLDFFPPL+GR AT+ + +DNT S +++CNNAG  FV AKA GVTV+
Sbjct  4     SQHIQHLKVSLSRTLDFFPPLSGRLATI-HHDDNTTSFFINCNNAGALFVHAKAYGVTVS  62

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              I ++S      ++ S F LNG  N +G  KPL+ VQ+TEL DG FI CT+NH++ DGTS
Sbjct  63    DI-NESGYVPRDVVHSFFPLNGAKNYEGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTS  121

Query  616   FWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLP-PMIE---SSERLPPPQRAF  783
             FW+FFNSW+E+SRGF   S  P+ +RW  D T + P+ +P   IE   S + +   +   
Sbjct  122   FWHFFNSWSEISRGFDFVSKPPVLKRWLLDGTIS-PIRIPFSKIEDQVSDKYIGNIRVPL  180

Query  784   LAERVFHLSKVNIARLKEKANSEM----GTSIISSLQSYMAHLWRAVTRARN--LHSNED  945
             L ERVFH SK  IA+LK KAN+E+        ISSLQ+ + HLWR++ R  N  L  +++
Sbjct  181   LKERVFHFSKEKIAQLKAKANAEIQLENTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKE  240

Query  946   VHLILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                 L IG R+RM  P  + Y+GNAV   T +IKA +V+ +GLG+VAW++ K V  H+ E
Sbjct  241   SSYRLLIGARSRMNPPLSQQYFGNAVQAGTVTIKAREVIKRGLGFVAWEMNKMVALHT-E  299

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
             E++RK    +V+ P     E   ++N L  SSSPRFDVYG DFGWG+PV VRSG GNK  
Sbjct  300   EKLRKFLECWVQEPKLL-TEGNMAANALVTSSSPRFDVYGNDFGWGRPVGVRSGAGNKSH  358

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GK+T+F   EEGS+DIE  +   TL  + ND+EF++  T+
Sbjct  359   GKITVFSAVEEGSIDIEACLLAETLEAMGNDSEFMDAVTV  398



>ref|XP_004288018.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 270/438 (62%), Gaps = 30/438 (7%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             RR+ELTPWDL+ + +G  QKGLLFH        Q  N  LI HLK SLS TLD F PLAG
Sbjct  25    RRIELTPWDLRMINLGYHQKGLLFHK----SADQEVNHGLIQHLKASLSRTLDIFYPLAG  80

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNG  501
             R A    E+  TC + +DCN +G +FV A +  VTVA +L+ + I  P  I+ +LF LN 
Sbjct  81    RLAVTEVEDKVTC-ISIDCNGSGAQFVHAASDCVTVADLLNPACI--PDGIIHNLFPLNS  137

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-GFHQPSTT  678
             ++N +GI  PL+ VQ+T+L+DG FI C+ NH+  DGTSFW+FFN+W+E+SR G    S  
Sbjct  138   VVNYEGISNPLLAVQVTQLVDGIFIGCSANHAAIDGTSFWHFFNTWSEISRIGSDHVSQI  197

Query  679   PIHERWFPDNTTTCPVHLP----PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKAN  846
             P      P   T  P+ LP     +I+   R  P     L   VFH SK  +  LK KAN
Sbjct  198   P-----RPVCATGLPIRLPFSYSKIIKGKNRTEPSTDDSLQRVVFHFSKEKMTELKAKAN  252

Query  847   SEMGTS-IISSLQSYMAHLWRAVTRAR-NLHSNEDVHLILGIGMRARMG--LPEGYWGNA  1014
             +EMGT+ +ISSLQ+ +AHLWRA+ R++ NL  +E    ++ +G+R R+   LP+ Y GNA
Sbjct  253   AEMGTNNVISSLQALVAHLWRAIIRSKHNLSPDEQTTYMVVVGLRQRLKPPLPKEYLGNA  312

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA--HNGAEIP-  1185
             +  +     AG++L +GLGWVA QI K +   +   EV +   +++ SP    N +++P 
Sbjct  313   LLGVMVKSTAGELLQQGLGWVALQINKRIASMT-AGEVSRYLEEWMTSPVLVPNPSDVPK  371

Query  1186  ----SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIEL  1353
                 SSS  L I SSPRF+VYG DFGWG+PV VRSG   K +G +T+F G EEGS+D E 
Sbjct  372   ITTSSSSVNLLIGSSPRFNVYGNDFGWGRPVAVRSGTAAKQNGNLTVFPGAEEGSIDFEA  431

Query  1354  SIHPHTLLGLENDAEFLE  1407
              + P TL  ++ DAEF+E
Sbjct  432   CLLPETLQAMKEDAEFME  449



>ref|XP_008352605.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Malus domestica]
Length=460

 Score =   343 bits (881),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 191/431 (44%), Positives = 271/431 (63%), Gaps = 21/431 (5%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             R +ELTPWD + +Q+  IQKGLLF  P          S+LI HLK SLS TLD F PLAG
Sbjct  24    RLIELTPWDSRLIQLDYIQKGLLFQKPA--------ESSLIQHLKDSLSRTLDIFYPLAG  75

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNG  501
             R A   N++       ++CN  G +FV A A GV VA ILD   + VP+ I+ + F++NG
Sbjct  76    RLAVTENKDKTPSCFSINCNGDGGQFVHAAADGVGVADILDP--VYVPEDIVSNFFSMNG  133

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP  681
             ILN +G+ KPL  VQ+T+L+DG FI CT+NHS+ +G+SFW+FFN+W+++SR        P
Sbjct  134   ILNYEGVSKPLXAVQVTKLVDGIFIGCTMNHSVVEGSSFWHFFNTWSKISRSGKNSEPPP  193

Query  682   IHER-WFPDNTTTCPVHLPPMIES-SERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             I +R    D     P+ +P      S+++  P      +RVFH SK  IA LK KAN+EM
Sbjct  194   IFDRXQLLDGLFHLPIPMPFSHSGISDKVTRPISLNSLQRVFHFSKEKIAHLKSKANAEM  253

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
             GT+ ISSLQ+ MAH WRA+TR  +L+ ++ +   + +G+R ++   LP+   GNA+  ++
Sbjct  254   GTNNISSLQALMAHHWRAITRCGHLNPDQVISYRVAVGLRQKLKPPLPKECLGNALQGVS  313

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP---AHNGAEIPSSSNT  1200
                 A ++L  GLGW A  I KT+   +  EEV+K    +V +P   ++  + IP+S++T
Sbjct  314   VKSTACELLQHGLGWAALHINKTIASLT-AEEVKKTLKDWVNAPLILSNMRSNIPTSTST  372

Query  1201  --LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTL  1374
               L I SSP+F+VYG DFG G+PV VRSG  NK++GK+ +F G EEGS+D E+ + P TL
Sbjct  373   VSLLIGSSPQFNVYGNDFGLGRPVAVRSGAANKMNGKIAVFPGAEEGSIDFEVCLLPETL  432

Query  1375  LGLENDAEFLE  1407
               +  DAEF+E
Sbjct  433   HAMAEDAEFME  443



>ref|XP_004230695.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=470

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 192/456 (42%), Positives = 278/456 (61%), Gaps = 27/456 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSN-GVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS---  258
             IS C V + G ++ +      +ELTPWD+  LQI   Q GLLF  PT +Q +    S   
Sbjct  8     ISTCTVKSCGRSQHHPDNCEIIELTPWDIYELQIEYFQNGLLFLMPTFEQVRDVSKSTNT  67

Query  259   -NLIHHLKTSLSSTLDFFPPLAGRF--ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVT  429
              +LI HL+ SLS TLDFFPP  GR   A    E+  T   +V+CNN GV+F  A A GVT
Sbjct  68    TSLIDHLRVSLSRTLDFFPPFCGRLEAAQAQEEKSGTTGFFVNCNNVGVQFNHAIADGVT  127

Query  430   VAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDG  609
             V  I+ +SN+ VP ++   F L+G+ N +   +P + VQ+TEL+DG FI C+ NH+L DG
Sbjct  128   VGDIM-ESNL-VPHVVHDFFPLSGVQNTEATSQPFLAVQVTELVDGVFIGCSANHALVDG  185

Query  610   TSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTT--TCPVHLP-PMIESSERLPPPQRA  780
             +S+W+F+NSWAE+SRG +  S  P  +R FP      +  +++P   I + ++  PP   
Sbjct  186   SSYWHFYNSWAEISRGCNVISKIPYLKRKFPFKMDHFSDRIYIPNERINAGDKFTPPA--  243

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L E+ FH S+ N+++LK KAN +M T+ ISSLQ+ +AHLW++V R R L  +E+    +
Sbjct  244   -LREKAFHFSRENVSKLKAKANHQMNTTKISSLQAVLAHLWQSVIRCRRLDHSEETTFEV  302

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
              I MR R+   LPEG++GNA++    +IK G++L  G GW A QI KT+  H H E+++ 
Sbjct  303   SIDMRKRLNPPLPEGFFGNAIYPAPTTIKTGELLKHGFGWAALQINKTIATHDH-EKLKC  361

Query  1135  MYMKFVESPAHNGAEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDG  1302
             +Y  +++ P     E+P      SN   ++ SP+F+VY  DFGWGKP+  R G GN LDG
Sbjct  362   IYENWMKEP-----EVPKLGDLPSNYFMLNGSPQFNVYKYDFGWGKPIAHRGGVGNLLDG  416

Query  1303  KVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEY  1410
             K+T+  G EEGS+ +E+ +   T+  LE D  F E+
Sbjct  417   KITVAPGLEEGSMIVEICLSSETIQALEEDIIFGEF  452



>gb|KEH31455.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=447

 Score =   341 bits (874),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/437 (43%), Positives = 259/437 (59%), Gaps = 18/437 (4%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N  S+++ LTPWDL  LQ+   QKGLLFHN     Q     SN I HLK +LSSTL FFP
Sbjct  19    NTNSKKIHLTPWDLSSLQVEMNQKGLLFHN----HQNPKDTSNQIQHLKNTLSSTLVFFP  74

Query  313   PLAGRFATVMNEEDN------TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQI  474
             PL GR      E+D+      T S ++ CNN G  F+ A A   +V  I+  +   VP I
Sbjct  75    PLTGRLIIEHQEDDDNSINDDTTSCFILCNNLGALFIHAAAENTSVFDIVKPNY--VPSI  132

Query  475   LRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR  654
             + S F  N + N +G  KPL+ VQ+TEL+DG FI  ++NH + DG SFW+F NSW+E+SR
Sbjct  133   VHSFFPFNKVKNYEGTSKPLLAVQVTELVDGIFIGFSINHVVVDGKSFWHFINSWSEISR  192

Query  655   GFHQPSTTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARL  831
             GF Q S  P   RWF D +   P+  P    E+ +     +     ER+FH +K  IA+L
Sbjct  193   GFDQLSKLPTLNRWFLDESIEIPIKFPFTKEENGKSTEIDENPVPLERIFHFTKEKIAKL  252

Query  832   KEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYW  1005
             K KAN E   + ISSLQ+ + HLW+AV R +N+   E++   L I +R R+  P  E Y+
Sbjct  253   KSKANEEANINKISSLQALLTHLWQAVIRGQNIDPEEEIMYCLVIDVRGRIIPPLHENYF  312

Query  1006  GNAVFFITESIKAGDVLGKG-LGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI  1182
             GNA+      +KA ++L +G  G VA+++ K +  H  ++ V++ Y  +V++P      +
Sbjct  313   GNALQVGGVKMKAKELLAEGAFGKVAFEMNKMIASHC-DDTVKRHYESWVKNPRLFQGRL  371

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
              SS   L  SSSPRFDVYG DFGWGKPV VRSGG NK DG +T+F G EEGS+D+E+ + 
Sbjct  372   -SSVKALATSSSPRFDVYGNDFGWGKPVAVRSGGANKSDGTITMFSGIEEGSIDVEVCLS  430

Query  1363  PHTLLGLENDAEFLEYF  1413
                L  + ND +F+  F
Sbjct  431   YDILEAMGNDPQFIHIF  447



>ref|XP_003628043.1| Acetyltransferase, putative [Medicago truncatula]
 gb|ABE88091.1| Transferase family [Medicago truncatula]
 gb|AET02519.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=442

 Score =   340 bits (873),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/421 (45%), Positives = 260/421 (62%), Gaps = 14/421 (3%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             ++LTPWDLQFL  G  QKGL++H+P+         SN I HLK SLSSTL+FFPP  GR 
Sbjct  28    IDLTPWDLQFLPFGVNQKGLIYHHPS-----NLDTSNQIEHLKHSLSSTLEFFPPFTGRL  82

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
               +   EDNT S  + CNN G  FV A A   +V  I+  +    P+IL S F  NG+ N
Sbjct  83    K-IKEHEDNTISCSITCNNVGALFVHAAAENTSVDDIIGATY--HPKILHSFFPFNGVKN  139

Query  511   RDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIHE  690
              +G   PL+ VQ+TEL++G FIACT+NH + DGTS W+F NSWA++S G  + S  P  E
Sbjct  140   YEGTSMPLLAVQVTELVNGIFIACTVNHVVADGTSIWHFINSWAKISNGSLEISKIPSFE  199

Query  691   RWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGTSII  870
             RWF D+    P+  P  IE        ++  L ER+FH +K NIA+LK KAN E GT  I
Sbjct  200   RWFSDDIQP-PIQFPFTIEPQNIHHKEEKLNLYERMFHFTKENIAKLKFKANLEAGTKNI  258

Query  871   SSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVFFITESIKA  1044
             SSLQ+   H+WR++ R++NL   E+VH ++ IG+R R+   L + Y+GNA+     S+K 
Sbjct  259   SSLQALFTHIWRSIIRSKNLDPEEEVHYVVVIGVRPRLIPLLKKDYFGNALIDPAVSMKV  318

Query  1045  GDVL-GKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSP  1221
             GD+L   GLG  A ++ K +   S +E ++  Y  ++++P+    +   +  TL  SSSP
Sbjct  319   GDLLQDNGLGKGALEMNKMIALQS-DEMLKNEYESWLKTPSF-ITDAKFNCKTLVGSSSP  376

Query  1222  RFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEF  1401
              FDVYG DFGWGKPV VR+GG NK +G + +F G E+ S+D+E+ +   TL  + ND EF
Sbjct  377   WFDVYGNDFGWGKPVGVRTGGANKENGNICVFQGVEKDSMDLEVCLSHETLEAIGNDPEF  436

Query  1402  L  1404
             +
Sbjct  437   M  437



>ref|XP_006346306.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=471

 Score =   341 bits (874),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 195/456 (43%), Positives = 278/456 (61%), Gaps = 25/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS---  258
             IS   V AAG ++ +  + + +ELTPWD+  LQI   Q GLL+  PT +Q +    S   
Sbjct  8     ISTWTVKAAGGSQHHTDNCKIIELTPWDILALQIDYAQSGLLYPMPTLEQVRDVSKSTNT  67

Query  259   -NLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVA  435
              +LI HL+ SLS  LDF+PP  GR   +  E+  T S  ++CNNAGV+F  A A GVT+ 
Sbjct  68    TSLIDHLRVSLSRALDFYPPFCGRLEAI-TEQRGTTSFVINCNNAGVQFNHAIADGVTIR  126

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICK-PLMGVQITELLDGYFIACTLNHSLGDGT  612
              I+ +SN  VP ++R  F+LNG+ N++ I + P + VQ+TEL+DG FI C  NH+L DGT
Sbjct  127   DIM-ESNC-VPHVVRDFFSLNGVQNQEAISQLPCLAVQVTELVDGIFIGCANNHALVDGT  184

Query  613   SFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTT--TCPVHLP-PMIESSERLPPPQRAF  783
             SFW+F+NSWAE+SRGF+  S  P  +R FP      +  + +P   I S ++  PP    
Sbjct  185   SFWHFYNSWAEVSRGFNVISKIPYLKRKFPFKIDHFSDRISIPNERINSGDKFIPPALQM  244

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             L E++FH SK N+++LK KAN EM TS ISSLQ+ + H+W +V R R L  +E+    + 
Sbjct  245   LREKLFHFSKENVSKLKAKANHEMNTSKISSLQAVVTHVWLSVIRCRRLDHSEETTFEVS  304

Query  964   IGMRARM---GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
             I MR +     LPEG++GNA++    +IK G++L  G GW A QI KT+  H H E+++ 
Sbjct  305   IDMRRKRLNPPLPEGFFGNAIYPAPTTIKTGELLEHGFGWAALQINKTIASHDH-EKLKC  363

Query  1135  MYMKFVESPAHNGAEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDG  1302
             +Y  ++  P     E+P      SN   ++ SP+FD Y  DFGWG+P+  RSG GN LDG
Sbjct  364   IYENWMNDP-----EVPKLGDLPSNYFMLNGSPQFDFYKYDFGWGQPIAHRSGVGNMLDG  418

Query  1303  KVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEY  1410
             K+T+  G EEGS+ +E+ +   T+  L  D  F E+
Sbjct  419   KITVSPGLEEGSMILEICLSSETIQALVEDIIFGEF  454



>ref|XP_010314808.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum lycopersicum]
Length=372

 Score =   337 bits (865),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 182/368 (49%), Positives = 240/368 (65%), Gaps = 15/368 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGV---SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS-  258
             +S C V A+  + +NG+   S+ +E+TPWDLQFL +  IQKGLLF  PTPQQQ     S 
Sbjct  7     VSTCVVRASSNS-NNGITHTSQNIEMTPWDLQFLLVETIQKGLLFKKPTPQQQNNLIKSL  65

Query  259   ---NLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVY-VDCNNAGVEFVEAKASGV  426
                +L+ HLK SLS TLDFFPPLAGRF+T  N  DNT + + + CNN+G EF  A A  +
Sbjct  66    NSLSLVDHLKASLSRTLDFFPPLAGRFSTTKNPNDNTITSFSITCNNSGAEFTHAIAPEL  125

Query  427   TVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGD  606
             TV  IL+     VP I+ S F LN + N   + KPL+GVQ+TEL+DGYFI CT++HSLGD
Sbjct  126   TVKEILESCY--VPTIVHSFFPLNKVRNVQCVTKPLLGVQVTELVDGYFIGCTMSHSLGD  183

Query  607   GTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             GT FW+FFNSW+E++RGF   S  P  ERWFP N    P++ P  ++  +     +   +
Sbjct  184   GTCFWHFFNSWSEITRGFELISRFPTLERWFPQNVNP-PIYFPLELDDEKLDVCMEMPIV  242

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFHLSK N+++LK KAN EM T  ISSLQ+++AHLWR VTR   +++NE+V L + I
Sbjct  243   KERVFHLSKENVSKLKAKANYEMDTKSISSLQAFLAHLWRCVTRCNRVNANEEVILNIVI  302

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             G R R+   LPE YWGNA       +KAG++L  GLG+ A  I K V   ++ EEV   Y
Sbjct  303   GTRTRLDPPLPEEYWGNAAIIKPIKVKAGELLENGLGYAALLINKVVASQNY-EEVMDSY  361

Query  1141  MKFVESPA  1164
              ++VE+P 
Sbjct  362   RRWVENPV  369



>ref|XP_004509127.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=451

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 264/450 (59%), Gaps = 20/450 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A     +N  ++++ LTPWDL  L +   QKGLLFHNP           N I+
Sbjct  7     ISTTTIQAPSNINTNS-TQKIHLTPWDLFCLPVEIDQKGLLFHNPQ----NTKDTLNQIN  61

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTC-----SVYVDCNNAGVEFVEAKASGVTVA  435
             HLK +LSSTL FFP L GR     ++ED+       S ++ CNN G  F+ A A   +V+
Sbjct  62    HLKNTLSSTLAFFPSLTGRLIINHHQEDDNNNNNTTSCFILCNNVGALFIHALAQNTSVS  121

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              IL  +   VP I+ S F LN + N +G  KPL+ +Q+TEL+DG FI  ++NH + DG S
Sbjct  122   DILKPNY--VPSIVHSFFPLNKVRNYEGTSKPLLAIQVTELVDGIFIGVSINHVVVDGNS  179

Query  616   FWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA--  789
              W+F NSWAE+SRGFHQPS  P   RWF D T   P+      +  + +      F+   
Sbjct  180   LWHFINSWAEISRGFHQPSKLPTLNRWFYDGTIETPIKFSFAKDEKQNIEIENSGFVPEL  239

Query  790   --ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
               ER+FH +K  IA+LK KAN E  T+ ISSLQ+ + HLW+A+ R +N+   E++   L 
Sbjct  240   PRERIFHFTKEKIAKLKSKANEEANTNKISSLQALLTHLWQAMIRCQNIDPEEEIMYSLP  299

Query  964   IGMRARM--GLPEGYWGNAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRK  1134
             IG+R R    LPE Y+GNA+      +KA ++L + G G VA ++ K +  H   + V++
Sbjct  300   IGVRGRTVPPLPENYFGNALEVGVVKVKAKELLVEGGFGKVALEMNKVIGSHC-GDNVKR  358

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
              Y  +V++P    +   SS   L  SSSPRFDVYG DFGWGKPV VR GGGN+ DG +TL
Sbjct  359   NYECWVKNPVLLQSGALSSVKALATSSSPRFDVYGNDFGWGKPVAVRGGGGNRSDGTITL  418

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
             F G EEGS+D+E+ +  H L  + N  +F+
Sbjct  419   FSGLEEGSIDVEVCLSYHILEAMGNLPQFI  448



>ref|XP_006346302.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346303.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346304.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346305.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X4 [Solanum tuberosum]
Length=467

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 190/453 (42%), Positives = 275/453 (61%), Gaps = 18/453 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-RRVELTPWDLQFLQIGPIQKGLLFHNPT----PqqqqqffN  255
             IS   V AAG ++ +  + + +EL+PWD+  LQI   Q GLLF  PT        +    
Sbjct  8     ISTWTVKAAGRSQHHTDNCKIIELSPWDILELQIDYFQTGLLFLMPTFEQLRDISKATNT  67

Query  256   SNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVA  435
             S+LI HL+ SLS  LDFFPP  GR  T  +E++ T S +++CNN G + + A A G+ V+
Sbjct  68    SSLIDHLRVSLSRALDFFPPFCGRLDTTKDEQNGTTSFFINCNNDGAQLIHATAHGIRVS  127

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              I+ +S+ N P ++R  F LNG+ N +   +P   VQ+TEL DG FI C+ NH + DGTS
Sbjct  128   DIV-ESDYN-PYVVRDFFPLNGVQNLEATSQPCFAVQVTELEDGVFIGCSNNHVVVDGTS  185

Query  616   FWNFFNSWAELSRGFHQPSTTPIHERWFPDNTT--TCPVHLP-PMIESSERLPPPQRAFL  786
             FW+F+NSW E+SRGF+  S  P  +R FP N    +  + +P   + +  R  PP    L
Sbjct  186   FWHFYNSWTEISRGFNVISKLPFLKRQFPFNINHFSDRISIPNERVNAGHRFIPP--PML  243

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFH +K ++A+LK KAN EM T+ ISSLQ+ +AH+WR+V R R L  +E+    + I
Sbjct  244   RERVFHFAKESVAKLKAKANLEMSTTKISSLQAVLAHVWRSVIRCRRLDLSEETTFEVSI  303

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              MR R+   LPEG++GNA+   T +IK G++L    GW A QI +T+  H  +E+++ +Y
Sbjct  304   DMRERLNPPLPEGFFGNAICPATVTIKTGELLEHEFGWAALQINETIALHD-QEKLKCIY  362

Query  1141  MKFVESP-AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               ++  P      ++P  SN   +++SPRFD Y  DFGWGKP+  R G GN L+GK+T+ 
Sbjct  363   ESWMNDPEVVKLGDLP--SNYFMLNNSPRFDFYKYDFGWGKPITHRGGIGNMLEGKITVS  420

Query  1318  GGCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
              G EEGS+ +E+ +   T+  LE D  F E+ T
Sbjct  421   PGQEEGSMILEICLSSETIQALEEDVIFGEFVT  453



>gb|KEH31453.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=433

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/432 (44%), Positives = 255/432 (59%), Gaps = 41/432 (9%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHN-PTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             ++ LTPWDL+FL +  IQKGLLFH  P P       N N I+HLK +LS+TL +FPPL G
Sbjct  25    KINLTPWDLRFLPLETIQKGLLFHQQPIPSTS----NQNQINHLKQTLSTTLSYFPPLTG  80

Query  325   RFATVMNEEDN------TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSL  486
             R     +          +CS+   CNN G  FV AKA   TV+ IL+ +   VP I+ S 
Sbjct  81    RLIITQHNVTTNNNNNTSCSIL--CNNLGALFVHAKAENTTVSNILEPNY--VPSIVHSF  136

Query  487   FTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQ  666
             F LNG+ N +   +P++ VQ+TEL +G FI  T+NH + DG SFW+F N+W+++S+  H+
Sbjct  137   FPLNGVKNHEATSQPILAVQVTELANGIFIGFTVNHVVSDGKSFWHFVNTWSQISKNSHE  196

Query  667   PSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKAN  846
              +  P  ++                 E+  R PP     L ER+FH +K  IA LK KA 
Sbjct  197   VTKLPSFKQ----------------TEAKSRKPPQN---LPERIFHFTKEKIAELKSKAT  237

Query  847   SEMGTS----IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWG  1008
              E  T      ISSLQ  ++H+WR V R++ L   ED   IL IG+R RM  P  E Y+G
Sbjct  238   EETKTENVQIKISSLQVLLSHVWRCVVRSKKLDPQEDFCYILSIGVRPRMIPPLEEDYFG  297

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS  1188
             NA      ++KAG++L  G+G VA ++ K +  HS +E++R  Y  ++  P   G ++ +
Sbjct  298   NASMIGGVTMKAGEILECGIGKVALELNKMIMSHS-DEKIRDYYECWLRMPKIFGIDVLT  356

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
               NTLG SSSPRFDVYG DFGWGKPV VR GG NK +GK+T+F G EEGS+D+E+ +   
Sbjct  357   GGNTLGTSSSPRFDVYGNDFGWGKPVGVRCGGANKNNGKITVFAGVEEGSIDVEVCLSYE  416

Query  1369  TLLGLENDAEFL  1404
              L  L NDAEFL
Sbjct  417   ILEALGNDAEFL  428



>ref|XP_003602051.1| Acetyltransferase, putative [Medicago truncatula]
 ref|XP_003630461.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES72302.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase, putative 
[Medicago truncatula]
Length=434

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 195/431 (45%), Positives = 266/431 (62%), Gaps = 22/431 (5%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N   ++++LTPWDL++L I P +KGLL+H+P           N I HLK SLSSTL FFP
Sbjct  16    NSSDQKIDLTPWDLRYLLIAPTKKGLLYHHPLV--------PNQIQHLKHSLSSTLAFFP  67

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             PLAGR   + + +DNT S  V CNNAG  FV A A    V  IL  +   VP I+ S F 
Sbjct  68    PLAGRLE-ITDHKDNTVSCSVTCNNAGALFVHAAAENTCVGDILGCTY--VPPIVDSFFP  124

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG-FHQP  669
             L  + N +G  +PL+ VQ+TEL+DG+FI  T NH++ DG S W F NSWA++SRG  +Q 
Sbjct  125   LTRVKNYEGTSQPLLAVQVTELVDGFFIGFTFNHAVVDGESTWLFINSWAKISRGCCNQV  184

Query  670   STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF-LAERVFHLSKVNIARLKEKAN  846
             S     ERWFP      P+  P  IE  +        F  +ER+FH +K  IA+LK KAN
Sbjct  185   SKLITLERWFPSGIQH-PIRFPFTIEPQKNDSDDNEKFNPSERLFHFTKEKIAQLKLKAN  243

Query  847   SEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVF  1020
              E+GT+ ISSLQS   HLWR+V R++    +E+V+ ++ IG R+R    LPE Y+GNAV 
Sbjct  244   MEIGTNKISSLQSLFTHLWRSVIRSKQFDPHEEVYYMVAIGARSRFVPPLPEDYFGNAVE  303

Query  1021  FITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSN  1197
                 ++KAG++L   GLG  AW I K +   S+ EE++  Y+ ++E+P        +  N
Sbjct  304   VCRVTMKAGELLEDGGLGKGAWAIHKMISLQSN-EELKNHYVSWLENPNIVRFFTAAGKN  362

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
             TL  S+SP FDVYG DFGWG+PV VRS  GNK+ G +T+F G EEGS+D ++ + PH +L
Sbjct  363   TLASSNSPWFDVYGNDFGWGEPVAVRS--GNKISGMITVFAGKEEGSMDFQVCL-PHKIL  419

Query  1378  -GLENDAEFLE  1407
               + ND +F++
Sbjct  420   EAMGNDHDFMD  430



>ref|XP_010915552.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=461

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/440 (43%), Positives = 260/440 (59%), Gaps = 27/440 (6%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +R  LTPWDL    +  IQKGLLF N  P          +I  LK+SLS+ L  F PLAG
Sbjct  24    KRCHLTPWDLAMFSVHYIQKGLLFANLPPSLS----TDQIIDRLKSSLSTALLHFYPLAG  79

Query  325   RFATVMNEEDNT----CSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             RF T    ++N       + +DCN  G EF+ A A  +TV+ +L  S+ +VP  +RS F 
Sbjct  80    RFVTEEAHDENQKVTGLFLSIDCNGEGAEFIHAIADKITVSDVLSPSD-DVPSFIRSFFP  138

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQ  666
             L+G +N DG  +PL+ +Q+TEL DG FI C+ NH++GDGTS+WNFFN+WA+++R  G   
Sbjct  139   LDGAINHDGHTQPLLSIQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQIARTKGVAP  198

Query  667   PSTTPIHERWFPDNTTTCPVHLP-----PMIESSERLPPPQRAFLAERVFHLSKVNIARL  831
              S  P+H+RWF D + T P+ LP       IES    PPP R    E++FH S  +IARL
Sbjct  199   LSRPPVHDRWFIDGSDTAPIKLPFTHPDDFIESFS--PPPLR----EKIFHFSVQSIARL  252

Query  832   KEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYW  1005
             K KAN E GT+ ISS Q+  A +WR++TR RNL +++     L    R R+  P    Y+
Sbjct  253   KAKANQECGTNSISSHQALSALVWRSITRTRNLSADQKTSCRLAAQNRGRLSPPLSPDYF  312

Query  1006  GNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP  1185
             GN+++ I  +   G++L   LGW AW + +TV  H ++  +R   M ++  P      + 
Sbjct  313   GNSIYPIIGTTTVGELLNHDLGWAAWLLNRTVADH-NDSTIRGRLMAWMARPVVYPQSLF  371

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIH  1362
                + + + SSPRFD+YG DFGWGKPV  RSG  NK DGKVT + G E  GSVD+E+ + 
Sbjct  372   DPFSVM-MGSSPRFDLYGCDFGWGKPVAGRSGSANKFDGKVTSYLGWEGVGSVDLEVCLV  430

Query  1363  PHTLLGLENDAEFLEYFTIP  1422
             P ++  LE+D EF+     P
Sbjct  431   PESMSALESDEEFMSVVCPP  450



>gb|KEH16419.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   335 bits (860),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 264/443 (60%), Gaps = 14/443 (3%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S   + A+    S+     + LTPWDLQFL  G  QKGLL+ +P      +   +N I 
Sbjct  7     LSTTTIHASNHNLSDSTYHTIHLTPWDLQFLPFGFNQKGLLYQHP-----FELDRTNQIQ  61

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK SLSSTLD F P  GR       E NT S  + CNN G  FV A A  ++VA I+  
Sbjct  62    HLKDSLSSTLDIFWPFTGRLKITTEHEANTISCSIVCNNEGALFVHAVAKNISVADIVRP  121

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             +    P I  S F LNG+ N +G  +PL+ +Q+TEL+DG FI  T+NH + DGTSFW+F 
Sbjct  122   TY--HPPIHHSFFALNGVKNYEGTSQPLLAIQVTELVDGIFIGFTVNHVIVDGTSFWHFI  179

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ-RAFLAERVFHL  807
             NSWAE+S+G  + S  P  +RWF      CP+  P  IES       + +    ERVFH 
Sbjct  180   NSWAEISKGCLKISKLPTFDRWFSKG-IECPIRFPFTIESRYNDNDEEGKINFPERVFHF  238

Query  808   SKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-  984
              K +IA+LK KAN E+GT  ISSLQ+   H+WR++ R + L    +V  +L IG+R R+ 
Sbjct  239   KKESIAKLKFKANLEVGTKNISSLQAIFTHIWRSIIRCKKLDPQAEVKFVLDIGIRPRLI  298

Query  985   -GLPEGYWGNAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
               LPE Y+GNAV     SI+A D+L   GLG  + ++ K +  HS +E ++  Y  ++ +
Sbjct  299   PPLPEDYFGNAVIDCVVSIRADDLLKDGGLGKGSLEMNKMIVLHS-DERLKNHYENWLIT  357

Query  1159  PAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
             P+   + + ++S++L I  SP FDVYG DFGWGKPV VRSGG NK +GK+ ++ G E+GS
Sbjct  358   PSFVTSGM-ANSDSLVIGGSPWFDVYGNDFGWGKPVGVRSGGSNKRNGKIYVYAGVEDGS  416

Query  1339  VDIELSIHPHTLLGLENDAEFLE  1407
             +D+E+ +    L  + ND EF++
Sbjct  417   MDLEVCLPCEILEAIRNDPEFMD  439



>ref|XP_009349545.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=458

 Score =   336 bits (861),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 188/449 (42%), Positives = 265/449 (59%), Gaps = 36/449 (8%)
 Frame = +1

Query  130   SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             ++ ++ R+EL PWDL+ +QI    KGLLF        +   +++LI HLK++L+ TL+ F
Sbjct  19    NDELNHRIELAPWDLRLIQIDYTHKGLLFKK----SAETEESTSLIDHLKSTLARTLNIF  74

Query  310   PPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLF  489
              PLAGR A   N +DNT S+++DCN  G EFV A A GV V  IL+   +    I+  LF
Sbjct  75    YPLAGRLALTKNGDDNTGSLFIDCNGDGAEFVHAAADGVKVVDILESVYL-ADDIVNHLF  133

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-----  654
             ++    N +G+ KPL+ VQ+TEL+DG FI C++NH + DGTSFW+FFN+W+E+SR     
Sbjct  134   SMMEAWNYEGVTKPLLAVQVTELVDGIFIGCSINHMVVDGTSFWHFFNTWSEISRVEPSG  193

Query  655   GFHQPSTTPIHERWFPDNTTTCPVHLP------------PMIESSERLPPPQRAFLAERV  798
                QP   P+  R F D     P+ LP             +   S  L   QR      V
Sbjct  194   KISQPR--PVFARQFHDGLIDLPIQLPFSYVQEIMTKKSVIGHGSSSLNSSQRV-----V  246

Query  799   FHLSKVNIARLKEKANSEMGTS---IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             FH  K  +A LK KAN EMGT+    ISSLQ+ MAHLWRAVTRARNL+ +++V  ++ +G
Sbjct  247   FHFPKEKVAELKSKANVEMGTTDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYLIAVG  306

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
             +R RM   LP+ Y GNAV  +     AG+++  GLGW A++I + +      EEVRK   
Sbjct  307   LRQRMEPPLPKEYLGNAVLGVLVKCTAGELVQHGLGWAAFRINEKI-GSLKAEEVRKYKE  365

Query  1144  KFVESPAH-NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              +V++P      ++   +  L   SSPR++VYG DFGWG+PV VRSG   +  G +T++ 
Sbjct  366   DWVKAPTFLPNLQMDPETLDLCTGSSPRYNVYGNDFGWGRPVAVRSGIQERKVGSLTVYP  425

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
             G EEGS+D E  + P TL  +  D EF++
Sbjct  426   GAEEGSIDFEACLWPETLRAMAEDVEFMQ  454



>ref|XP_002523237.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF39158.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=423

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/427 (43%), Positives = 258/427 (60%), Gaps = 30/427 (7%)
 Frame = +1

Query  136   GVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPP  315
             G  +++EL+  D+  + +  IQ G+LF NP P Q       NLI HLKTSLS TLDFF P
Sbjct  19    GSIQKLELSSSDVSLILLQYIQMGILFPNPEPSQV-----ENLIQHLKTSLSRTLDFFFP  73

Query  316   LAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTL  495
             LAGR AT   ++D T   ++DCNNAG  FV A A   TV+ IL+     VP  + S F L
Sbjct  74    LAGRLATA-QQDDTTICYFIDCNNAGAHFVHAVAESATVSDILEP--FYVPPSVHSFFPL  130

Query  496   NGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPST  675
             NG  N +G+ KPL+ VQ+TEL D  FI   +NH + DG +FWNF NSW+E+SRG  Q S 
Sbjct  131   NGCKNYEGVSKPLLAVQVTELADRVFIGFAVNHVVADGIAFWNFINSWSEISRGSDQISE  190

Query  676   TPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              P+ E WF    + CP+ LP  +I++ +   PPQ     ER+ H  K  I RL+ KAN+E
Sbjct  191   PPLFEHWFRGAESYCPISLPLALIKTDDESTPPQ---FRERILHFGKETIGRLRAKANAE  247

Query  853   MGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM---GLPEGYWGNAVFF  1023
              GT  ISSLQS +AH+WR+V R + L  +++    L I +R+RM    LP+         
Sbjct  248   AGTDRISSLQSILAHVWRSVIRNKQLDPSQETTFRLPIEVRSRMLQSKLPK---------  298

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTL  1203
             + E +       +GLG+ A Q+ K +  ++ E+ +R     +++SP + G     S N L
Sbjct  299   VREPLDE----QQGLGYAALQMNKAIACYT-EDNIRNDIESWIKSP-NLGTVSELSKNAL  352

Query  1204  GISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGL  1383
             G+ +SPRF+VYG DFGWG+P+ VRSG GNK DGK+ +F G +E ++D+++ ++P  +  +
Sbjct  353   GVGNSPRFNVYGNDFGWGRPIAVRSGLGNKFDGKIIVFPGAKECNIDLQICLNPDVMHAM  412

Query  1384  ENDAEFL  1404
             END EFL
Sbjct  413   ENDPEFL  419



>ref|XP_007155908.1| hypothetical protein PHAVU_003G242200g [Phaseolus vulgaris]
 gb|ESW27902.1| hypothetical protein PHAVU_003G242200g [Phaseolus vulgaris]
Length=441

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 204/446 (46%), Positives = 267/446 (60%), Gaps = 29/446 (7%)
 Frame = +1

Query  115   AGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNP--TPqqqqqffNSNLIHHLKTSL  288
             A A  ++   R++ LTPWDLQFL    IQKGLLF N   TP Q         I HL+ SL
Sbjct  14    ATAHNNDNSPRKLHLTPWDLQFLPTETIQKGLLFGNVKLTPFQ---------IQHLQHSL  64

Query  289   SSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVP  468
             SSTL FFPPLAGR A ++       S ++ CNNAG  FV A A   TVA IL      VP
Sbjct  65    SSTLAFFPPLAGRLA-ILQHHHTIVSSHILCNNAGALFVHAAAPNTTVAHILHPKY--VP  121

Query  469   QILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL  648
              I+ S F+ NG+ N +G  +PL+ VQ+TEL+DG FIA T+NH + DG S W+F NSWAE+
Sbjct  122   LIVSSFFSTNGVKNYEGTTQPLLAVQVTELVDGIFIALTVNHVVADGKSLWHFVNSWAEI  181

Query  649   SRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLP---PPQRAFLAERVFHLSKVN  819
             SRG  Q S  P   R+FPD     P+  P   E   +      PQ     ERVFH +K  
Sbjct  182   SRGSLQISKLPSLRRYFPDG-IDHPILFPFTKEEENQRSSNLKPQTPL--ERVFHFTKEI  238

Query  820   IARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--  993
             IA LK KAN+E  T  ISSLQ+ +  LWRAVTR + +   E+VH +L IG+ ++M  P  
Sbjct  239   IAALKSKANAEANTDRISSLQALLTLLWRAVTRCKRVDPQENVHYVLFIGVWSKMVPPLA  298

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
             EGY+GN+V     ++KAG++L  GLG  A ++ K +  HSH E+V+  Y  +V  P    
Sbjct  299   EGYFGNSVIATVVTMKAGELLEGGLGKGALEMNKAISLHSH-EKVKNHYESWVRRP--RL  355

Query  1174  AEIPS---SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGG-NKLDGKVTLFGGCEEGSV  1341
               +PS    SN L  SSSPRF+++G DFGWGKP  VR GGG +K +G +T+FGG EEGS+
Sbjct  356   LTLPSGVAGSNYLITSSSPRFNIFGNDFGWGKPEAVRIGGGPHKRNGMITVFGGAEEGSI  415

Query  1342  DIELSIHPHTLLGLENDAEFLEYFTI  1419
             DI  ++    L  + N+ EF++  +I
Sbjct  416   DIVANLPYWILEAMGNEPEFMDAVSI  441



>ref|XP_008361429.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=458

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 259/443 (58%), Gaps = 35/443 (8%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             R +EL PWDL+ +QI  I KGLLF        +   +++LI HLK++L+ TL+ F PLAG
Sbjct  25    RSIELAPWDLRLIQIDYIHKGLLFKK----SAETEESNSLIDHLKSTLARTLNIFYPLAG  80

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R A   N  DNT S ++DCN  G EFV A A GV V  IL+   +    I+  LF++   
Sbjct  81    RLALTKNXNDNTGSFFIDCNGDGAEFVHAAADGVKVVDILESVYL-ADDIVNHLFSMMEA  139

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-----GFHQP  669
              N +G+ KPL+ VQ+TEL+DG FI C++NH + DGTS W+FFN+W+E+SR        QP
Sbjct  140   WNYEGVXKPLLAVQVTELVDGIFIGCSINHMVVDGTSXWHFFNTWSEISRVEPSGKISQP  199

Query  670   STTPIHERWFPDNTTTCPVHLP-----------PMIESSERLPPPQRAFLAERVFHLSKV  816
                P+  R F D     P+ LP           P+   S  L  PQR      VFH  K 
Sbjct  200   R--PVFARQFHDGMIDLPIQLPFSYVQEIMTKKPVGHGSSSLNSPQRV-----VFHFPKE  252

Query  817   NIARLKEKANSEMGT---SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG  987
              +A LK KAN EMGT   + ISSLQ+ MAHLWRAVTRARNL+ +++V   +  G+R RM 
Sbjct  253   KVAELKSKANVEMGTMDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYRIVAGLRQRME  312

Query  988   --LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
               LP+ Y GNAV  +     AG++   GLGW A++I + +      EEVRK    +V++P
Sbjct  313   PPLPKEYLGNAVLGVLVKCTAGELAQHGLGWAAFRINEKIGALK-AEEVRKFMEDWVKAP  371

Query  1162  AH-NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
                  +++   +  L   SSPRF+VYG DFGWG+P+ VRS    +  G +++F G EEGS
Sbjct  372   TFLPNSQMDPETLDLFTGSSPRFNVYGNDFGWGRPIAVRSRIQERWVGSLSVFPGAEEGS  431

Query  1339  VDIELSIHPHTLLGLENDAEFLE  1407
             +D E  + P T+  +  DAEF++
Sbjct  432   IDFEACLWPETVRAMAEDAEFMQ  454



>ref|XP_010109793.1| putative acetyltransferase [Morus notabilis]
 gb|EXC24719.1| putative acetyltransferase [Morus notabilis]
Length=458

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 194/440 (44%), Positives = 256/440 (58%), Gaps = 32/440 (7%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             RR+ELTPWDL+F     IQKG+LF  P         ++ L+ HLK +LS  L+ F PLAG
Sbjct  27    RRIELTPWDLRFSTYEHIQKGILFLKPA---DDFSLSTTLVDHLKATLSRALEIFYPLAG  83

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R A + NE D T  +++DCN AG  FV A   G T A IL QS I    I+ S F + G+
Sbjct  84    RLAVIENE-DGTAILFIDCNGAGAHFVHAVIDGATAADIL-QSPIVPDDIVYSFFPMKGV  141

Query  505   LNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR----GFHQ  666
              N +      PL+ VQ+TE++DG FIACT+NH  GDGTSFW+FFN W+E+SR    G   
Sbjct  142   RNGEAAFSKLPLLAVQVTEVVDGIFIACTMNHCAGDGTSFWHFFNVWSEISRQSFDGSVS  201

Query  667   PSTTPIHERWFPDNTTTCPVHLP---PMIESSER-LPPPQRAFLAERVFHLSKVNIARLK  834
               + P+  R   D     P+  P    +I   +R + PP    L +R+F  SK  IA LK
Sbjct  202   RCSRPVFGRERLDGFVNHPISFPFSRDLISKVKREVSPPN---LQQRMFRFSKAKIAELK  258

Query  835   EKANSEM------GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--L  990
              KAN+EM          ISSLQ+ +AHLW +VTR R +  +E+V   +  GMR R+   L
Sbjct  259   AKANAEMEIITESNEITISSLQALLAHLWISVTRNRRIDPDEEVGYKVAAGMRTRIQPPL  318

Query  991   PEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA--  1164
             PEGY+G+AV  +     A ++L  GLGW AW+I + +   +   EVRK    + +SP   
Sbjct  319   PEGYFGSAVLAVMPKCTARELLENGLGWSAWKINRAIASQT-ATEVRKFLEDWAQSPTLP  377

Query  1165  HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVD  1344
             H G      +NTL   SSPRFDVYG DFGWG+P+ VRSG   K DGK+T+F G EEGS++
Sbjct  378   HIGK---YPANTLLTGSSPRFDVYGNDFGWGRPIAVRSGPAAKFDGKLTVFPGAEEGSIE  434

Query  1345  IELSIHPHTLLGLENDAEFL  1404
              E+ +   TL  L  DAEF+
Sbjct  435   FEVCLLDETLESLACDAEFM  454



>gb|KHN15623.1| Putative acetyltransferase [Glycine soja]
Length=433

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 262/444 (59%), Gaps = 23/444 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S   + A+    ++   ++++LTPWDLQF  IG IQ+GLLF      +  Q      I 
Sbjct  1     MSTTTIKASSNNYNDNSVQKIDLTPWDLQFFHIGSIQRGLLFRKEKNTEYCQ------IE  54

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HL+ SLSSTL FFP LAGR A ++   DNT S ++ C+N GV FV A A   TVA IL  
Sbjct  55    HLQHSLSSTLAFFPLLAGRLA-ILEHHDNTVSSHIVCDNKGVPFVHAAAHNTTVADILQP  113

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP ILRS F LNG+ N +   +P++ VQ+TEL DG FIA ++NH + DG SFW F 
Sbjct  114   KY--VPPILRSFFALNGVKNYEATSQPVLAVQVTELFDGIFIALSINHVVADGKSFWLFV  171

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHL----PPMIESSERLPPPQRAFLAERV  798
             NSWAE+SRG  + S  P  +R F D     P+          E S+ L P  R     RV
Sbjct  172   NSWAEISRGSLKISKFPSLKRCFLDGVDR-PIRFLFTKELEKEPSKNLQPQTRPV---RV  227

Query  799   FHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRA  978
             FH +K  IA LK KAN+E  T  ISSLQ+ +A+LWR+V R +++  +E++   + +G+R 
Sbjct  228   FHFTKEKIADLKSKANAEANTDKISSLQALLANLWRSVIRCQHVEPHEEIQFTMPVGVRP  287

Query  979   RM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+   LPE Y+GNA      ++KAG++L   LG +A +I K +   S +E+V+  Y  + 
Sbjct  288   RVVPPLPEDYFGNAALIGRVTMKAGELLQGELGKIALEINKMISSQS-DEKVKNHYESWA  346

Query  1153  ESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE  1332
              +P   G    + SNTL + SSPRF++YG DFGWGKP+ VRSGG       V LF G EE
Sbjct  347   RTPRQRGV---AYSNTLNVGSSPRFNIYGNDFGWGKPMAVRSGGDFMSYSIVFLFAGFEE  403

Query  1333  GSVDIELSIHPHTLLGLENDAEFL  1404
             GS+DIE+ +    L  + ND EF+
Sbjct  404   GSIDIEVFLPYEILEAMGNDPEFM  427



>ref|XP_003550055.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=439

 Score =   331 bits (849),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 262/444 (59%), Gaps = 23/444 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S   + A+    ++   ++++LTPWDLQF  IG IQ+GLLF      +  Q      I 
Sbjct  7     MSTTTIKASSNNYNDNSVQKIDLTPWDLQFFHIGSIQRGLLFRKEKNTEYCQ------IE  60

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HL+ SLSSTL FFP LAGR A ++   DNT S ++ C+N GV FV A A   TVA IL  
Sbjct  61    HLQHSLSSTLAFFPLLAGRLA-ILEHHDNTVSSHIVCDNKGVPFVHAAAHNTTVADILQP  119

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP ILRS F LNG+ N +   +P++ VQ+TEL DG FIA ++NH + DG SFW F 
Sbjct  120   KY--VPPILRSFFALNGVKNYEATSQPVLAVQVTELFDGIFIALSINHVVADGKSFWLFV  177

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHL----PPMIESSERLPPPQRAFLAERV  798
             NSWAE+SRG  + S  P  +R F D     P+          E S+ L P  R     RV
Sbjct  178   NSWAEISRGSLKISKFPSLKRCFLDGVDR-PIRFLFTKELEKEPSKNLQPQTRPV---RV  233

Query  799   FHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRA  978
             FH +K  IA LK KAN+E  T  ISSLQ+ +A+LWR+V R +++  +E++   + +G+R 
Sbjct  234   FHFTKEKIADLKSKANAEANTDKISSLQALLANLWRSVIRCQHVEPHEEIQFTMPVGVRP  293

Query  979   RM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+   LPE Y+GNA      ++KAG++L   LG +A +I K +   S +E+V+  Y  + 
Sbjct  294   RVVPPLPEDYFGNAALIGRVTMKAGELLQGELGKIALEINKMISSQS-DEKVKNHYESWA  352

Query  1153  ESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE  1332
              +P   G    + SNTL + SSPRF++YG DFGWGKP+ VRSGG       V LF G EE
Sbjct  353   RTPRQRGV---AYSNTLNVGSSPRFNIYGNDFGWGKPMAVRSGGDFMSYSIVFLFAGFEE  409

Query  1333  GSVDIELSIHPHTLLGLENDAEFL  1404
             GS+DIE+ +    L  + ND EF+
Sbjct  410   GSIDIEVFLPYEILEAMGNDPEFM  433



>ref|XP_008352555.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=458

 Score =   331 bits (848),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 258/443 (58%), Gaps = 35/443 (8%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             R +EL PWDL+ +QI  I KGLLF        +   +++LI HLK++L+ TL+ F PLAG
Sbjct  25    RSIELAPWDLRLIQIDYIHKGLLFKK----SAETEESNSLIDHLKSTLARTLNIFYPLAG  80

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R A   N  DNT S ++DCN  G EFV A A GV V  IL+   +    I+  LF++   
Sbjct  81    RLALTKNXNDNTGSFFIDCNGDGAEFVHAAADGVKVVDILESVYL-ADDIVNHLFSMMEA  139

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-----GFHQP  669
              N +G+ KPL+ VQ+TEL+DG FI C++NH + DGTS W+FFN+W+E+SR        QP
Sbjct  140   WNYEGVXKPLLAVQVTELVDGIFIGCSINHMVVDGTSXWHFFNTWSEISRVEPSGKISQP  199

Query  670   STTPIHERWFPDNTTTCPVHLP-----------PMIESSERLPPPQRAFLAERVFHLSKV  816
                P+  R F D     P+ LP           P+   S  L  PQR      VFH  K 
Sbjct  200   R--PVFARQFHDGMIDLPIQLPFSYVQEIMTKKPVGHGSSSLNSPQRV-----VFHFPKE  252

Query  817   NIARLKEKANSEMGT---SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG  987
              +A LK KAN EMGT   + ISSLQ+ MAHLWRAVTRARNL+ +++V   +  G+R RM 
Sbjct  253   KVAELKSKANVEMGTXDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYRIVAGLRQRME  312

Query  988   --LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
               LP+ Y GNAV  +     AG++   GLGW A++I + +      EEVRK    +V++P
Sbjct  313   PPLPKEYLGNAVLGVLVKCTAGELAQHGLGWAAFRINEKIGALK-AEEVRKFMEDWVKAP  371

Query  1162  AH-NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
                  +++   +  L   SSPRF+VYG DFGWG+P+ VRS    +  G +++F G EEGS
Sbjct  372   TFLPNSQMDPETLDLFTGSSPRFNVYGNDFGWGRPIAVRSRIQERWVGSLSVFPGAEEGS  431

Query  1339  VDIELSIHPHTLLGLENDAEFLE  1407
             +D E  + P T   +  DAEF++
Sbjct  432   IDFEACLWPETXRAMAEDAEFMQ  454



>gb|KEH31450.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=451

 Score =   330 bits (847),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 190/463 (41%), Positives = 268/463 (58%), Gaps = 38/463 (8%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A      N     ++L PWDL++L++ PIQKGLLFH P         N+N I 
Sbjct  7     ISTTTIQAKKHVDDNSTHTIIDLAPWDLKYLKMAPIQKGLLFHKP---------NTNQID  57

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK +LSSTL+FFPPLAGR     ++E N  S  + CNNAG  FV AKA    +A IL  
Sbjct  58    HLKQTLSSTLNFFPPLAGRLVITQHDEPNNASCSIICNNAGALFVHAKAEHTAIADILQP  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP I+ SLF LN I N  G  +PL+ VQ+TEL+DG FI   +NH   D  SFW+F 
Sbjct  118   KY--VPPIVSSLFLLNEIQNHKGTSQPLLAVQVTELIDGIFIGFAINHVGVDAKSFWHFI  175

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA------FLAE  792
             NSWAE+S+GF++P+  P  +RWF +N    P+   P  + +++ P    A       L+ 
Sbjct  176   NSWAEISQGFNKPTNIPSFKRWFTNNINR-PIRF-PFTKEAQKQPFTNEAQNQQCEVLSH  233

Query  793   RVFHLSKVNIARLKEKANSEMGTS------IISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
             R+FH SK  I +LK KAN+E+ +S      IISSLQ+ ++H+WR +   +NL   E    
Sbjct  234   RIFHFSKEQILQLKSKANAEISSSNSSEKIIISSLQALLSHVWRLIISKQNLKPEERSAF  293

Query  955   ILGIGMRARM--GLPEGYWGNAVFFITESI-KAGDVLGKGLGWVAWQIKKTVEKHSHEEE  1125
             +L I  R RM   L + Y+G+ +      I + G+++  G+G +A ++ K +   SH E+
Sbjct  294   VLPIDCRTRMCPKLEDNYFGSGIGATGYVIMQVGELMESGIGKIAMEMNKVISIQSHHEK  353

Query  1126  VRKMYMKFVESPAHNGAEIP----SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNK  1293
             V   Y  ++++P+     IP    SSSN L  SSSPRF+ YG DFGWGKP+ VR+G G K
Sbjct  354   VVNNYESWLKTPS-----IPEAGRSSSNLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLK  408

Query  1294  LD-GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              + G+V + GG EEGSVDI++ +    L  + ND   ++  T+
Sbjct  409   RNIGRVIVLGGEEEGSVDIQVCLPYDILEAMGNDHLSMDPITV  451



>ref|XP_010915553.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=469

 Score =   330 bits (847),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 183/432 (42%), Positives = 257/432 (59%), Gaps = 25/432 (6%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +R  LTPWDL    +  IQKGLLF N  P          +I  LK+SLS+TL  F PL G
Sbjct  29    KRCHLTPWDLAMFSLHYIQKGLLFANLPPSLS----TDQIIDRLKSSLSTTLLHFYPLTG  84

Query  325   RFATVMNEEDNTCSV----YVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             RF T    ++N   +    ++DCN  G EF+ A A  VTV+ +L  S+ +VP  ++S F 
Sbjct  85    RFVTEEAHDENQKVIGIFWWIDCNGEGAEFIHAIADKVTVSDVLSPSD-DVPSFIQSFFP  143

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQ  666
             L+G +N DG  +PL+ VQ+TEL DG FI C+ NH++GDGTS+WNFFN+WA+++R  G   
Sbjct  144   LDGAINHDGHTQPLLAVQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQIARTKGVAP  203

Query  667   PSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
              S  P+H+RWF D   T P+ LP   P        PPP R    E++FH S  +IA+LK 
Sbjct  204   LSRPPVHDRWFIDGYDTAPIKLPFTHPHDFIERFSPPPFR----EKIFHFSARSIAQLKA  259

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGN  1011
             +AN E GT+ +SS Q+  A +WR++TR RNL +++     L    R+R+  P    Y+GN
Sbjct  260   RANQECGTNSVSSFQALTAVVWRSITRTRNLPADQKTSCRLAAENRSRLNPPLSPAYFGN  319

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP-AHNGAEIPS  1188
             +V+ I  +   G++L  GLGW AW + +TV  H ++  +R   M ++  P  +  +    
Sbjct  320   SVYPIAATTTVGELLNHGLGWAAWLLNRTVADH-NDSTIRGRLMAWMARPMVYRQSGFDR  378

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHP  1365
              S  +G  SSPRFD+YG DFGWGK V  RSG  +K DGKVT + G E  GS+D+E+ + P
Sbjct  379   FSVLMG--SSPRFDMYGCDFGWGKAVAARSGSASKFDGKVTSYPGWEGGGSMDLEICLVP  436

Query  1366  HTLLGLENDAEF  1401
              ++  LE D EF
Sbjct  437   KSMSMLETDDEF  448



>ref|XP_003638160.1| Anthranilate N-hydroxycinnamoyl/benzoyltransferase [Medicago 
truncatula]
Length=451

 Score =   330 bits (846),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 188/463 (41%), Positives = 269/463 (58%), Gaps = 38/463 (8%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A      N   + ++L PWDL++L++ PIQKGLLFH P         N+N I 
Sbjct  7     ISTTTIQATKHGDENSTHKIIDLVPWDLKYLKLAPIQKGLLFHKP---------NTNQID  57

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK +LSSTL+FFPPLAGR     ++E N  S  + CNNAG  FV AKA    +A IL  
Sbjct  58    HLKQTLSSTLNFFPPLAGRLVITQHDEPNNASCSIICNNAGALFVHAKAEHTAIADILQP  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
                 VP I+ SLF LN + N +G  +PL+ VQ+TEL+DG FI   +NH   D  SFW+F 
Sbjct  118   KY--VPPIVSSLFLLNEVQNYEGTSQPLLAVQVTELIDGIFIGFAINHVGVDAKSFWHFI  175

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA------FLAE  792
             NSWAE+S+GF++P+  P  +RWF +N    P+   P  + +++ P    A        + 
Sbjct  176   NSWAEISQGFNKPTNIPSFKRWFSNNINR-PIRF-PFTKEAQKQPFTNEAQNQQCEVSSH  233

Query  793   RVFHLSKVNIARLKEKANSEMGTS------IISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
             R+FH SK  I +LK KAN+E+ +S      IISSLQ+ ++H+WR +   +NL   E    
Sbjct  234   RIFHFSKEQILQLKSKANAEISSSNSSEKIIISSLQALLSHVWRLIISKQNLKPEERSAF  293

Query  955   ILGIGMRARM--GLPEGYWGNAVFFITESI-KAGDVLGKGLGWVAWQIKKTVEKHSHEEE  1125
             +L I  R RM   L + Y+G+ +      I + G+++  G+G +A ++ K +   SH E+
Sbjct  294   VLPIDCRTRMCPKLEDNYFGSGIGATGYVIMQVGELMESGIGKIAMEMNKVISIQSHHEK  353

Query  1126  VRKMYMKFVESPAHNGAEIP----SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNK  1293
             V   Y  ++++P+     IP    SSSN L  SSSPRF+ YG DFGWGKP+ VR+G G K
Sbjct  354   VVNNYESWLKTPS-----IPEAGRSSSNLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLK  408

Query  1294  LD-GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              + G+V + GG EEGSVDI++ +    L  + ND   ++  T+
Sbjct  409   RNIGRVIVLGGEEEGSVDIQVCLPYDILEAMGNDHLSMDAITV  451



>ref|XP_004233972.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum lycopersicum]
Length=457

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/433 (42%), Positives = 262/433 (61%), Gaps = 25/433 (6%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqq----qqqffNSNLIHHLKTSLSSTLDFFPPL  318
             +ELTPWD+  LQI   Q G+L + PT QQ     +    ++L+ HL+ SLS  LDFFPPL
Sbjct  32    IELTPWDILELQIEYGQGGVLCYMPTSQQMKDITKATNTTSLMDHLRVSLSRVLDFFPPL  91

Query  319   AGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
              GR      EE+ +   ++ CN+AGV+F  A A GVTV  I+DQS   VP ++R  F LN
Sbjct  92    CGRLEA---EEEQSGGFFIKCNDAGVQFNHAVADGVTVDDIMDQSKC-VPHVVRDFFPLN  147

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT  678
             G+ N +   KP +GVQ+TEL+DG FI CT NHSL DG+SFW+FF SWAE+SRGF+  S  
Sbjct  148   GVRNIEATSKPFLGVQVTELVDGIFIGCTANHSLLDGSSFWHFFTSWAEISRGFNVISQI  207

Query  679   PIHERWFP------DNTTTCP-VHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
             P  +R FP       N    P   +    +S+    PP    L +++FH +K +IA+LK 
Sbjct  208   PFLKRQFPFEIDNFSNRICIPNERINSNSDSTHEHDPPA---LQDKIFHFTKESIAKLKS  264

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGN  1011
             KAN EM T+ ISSLQ+ +AH+W+++ R RNL  NE+    + + MR R+   LPEG++GN
Sbjct  265   KANLEMKTTKISSLQAVLAHVWQSIIRCRNLDHNEETTFEVPMDMRKRLNPPLPEGFFGN  324

Query  1012  AVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG-AEIP  1185
             A++  T ++KAGD+L   G  W A QI + +  H H E+ +++Y  +++ P      ++P
Sbjct  325   AIYPATITVKAGDLLKDGGFEWAALQINEMIASHDH-EKFKRIYENWMKDPEITKLGDLP  383

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
                N   + +SPRF+    DFGWGKP+  R G  N L+GK+ +  G EEGS+  E+ + P
Sbjct  384   --RNYFMLHNSPRFNYNKYDFGWGKPIAQRGGMSNMLEGKIDVSPGIEEGSMIFEICLSP  441

Query  1366  HTLLGLENDAEFL  1404
              T+  LE    F+
Sbjct  442   KTIQALEEHKMFV  454



>ref|XP_010317216.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum lycopersicum]
Length=452

 Score =   329 bits (843),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/433 (42%), Positives = 262/433 (61%), Gaps = 25/433 (6%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqq----qqqffNSNLIHHLKTSLSSTLDFFPPL  318
             +ELTPWD+  LQI   Q G+L + PT QQ     +    ++L+ HL+ SLS  LDFFPPL
Sbjct  27    IELTPWDILELQIEYGQGGVLCYMPTSQQMKDITKATNTTSLMDHLRVSLSRVLDFFPPL  86

Query  319   AGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
              GR      EE+ +   ++ CN+AGV+F  A A GVTV  I+DQS   VP ++R  F LN
Sbjct  87    CGRLEA---EEEQSGGFFIKCNDAGVQFNHAVADGVTVDDIMDQSKC-VPHVVRDFFPLN  142

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT  678
             G+ N +   KP +GVQ+TEL+DG FI CT NHSL DG+SFW+FF SWAE+SRGF+  S  
Sbjct  143   GVRNIEATSKPFLGVQVTELVDGIFIGCTANHSLLDGSSFWHFFTSWAEISRGFNVISQI  202

Query  679   PIHERWFP------DNTTTCP-VHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
             P  +R FP       N    P   +    +S+    PP    L +++FH +K +IA+LK 
Sbjct  203   PFLKRQFPFEIDNFSNRICIPNERINSNSDSTHEHDPPA---LQDKIFHFTKESIAKLKS  259

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGN  1011
             KAN EM T+ ISSLQ+ +AH+W+++ R RNL  NE+    + + MR R+   LPEG++GN
Sbjct  260   KANLEMKTTKISSLQAVLAHVWQSIIRCRNLDHNEETTFEVPMDMRKRLNPPLPEGFFGN  319

Query  1012  AVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG-AEIP  1185
             A++  T ++KAGD+L   G  W A QI + +  H H E+ +++Y  +++ P      ++P
Sbjct  320   AIYPATITVKAGDLLKDGGFEWAALQINEMIASHDH-EKFKRIYENWMKDPEITKLGDLP  378

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
                N   + +SPRF+    DFGWGKP+  R G  N L+GK+ +  G EEGS+  E+ + P
Sbjct  379   --RNYFMLHNSPRFNYNKYDFGWGKPIAQRGGMSNMLEGKIDVSPGIEEGSMIFEICLSP  436

Query  1366  HTLLGLENDAEFL  1404
              T+  LE    F+
Sbjct  437   KTIQALEEHKMFV  449



>ref|XP_007136698.1| hypothetical protein PHAVU_009G066300g [Phaseolus vulgaris]
 gb|ESW08692.1| hypothetical protein PHAVU_009G066300g [Phaseolus vulgaris]
Length=460

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 193/456 (42%), Positives = 268/456 (59%), Gaps = 20/456 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLI  267
             +S+CFV  +G A+ +   R   LTPWD+  L +  IQKGLLF  P T    Q  F  NL+
Sbjct  9     VSECFVKPSGQAQES--DRICNLTPWDISMLSLHHIQKGLLFQKPKTLVVDQHHFIENLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PL+GR  T   E  ++ ++YVDC+N+ G  F+ A    +T++ IL
Sbjct  67    EKLKHSLSLTLFHFYPLSGRLVTHKTEHPSSYTIYVDCSNSSGARFIHATLD-MTISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP I+ S F L+  +N DG   PL+ +++TEL+DG FI C++NH++GDGTS+WN
Sbjct  126   --SPVDVPPIVHSFFDLHKAVNHDGHTMPLLSIKVTELVDGVFIGCSMNHNIGDGTSYWN  183

Query  625   FFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FFN+W+++ +   Q        S  PIH RWFPD     PV   P     E +   +   
Sbjct  184   FFNAWSQIFQAQAQGNEHDVPISCYPIHNRWFPDGCG--PVINLPFKHHDEFISRFEAPL  241

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             L  R+FH S  +IARLKE+ANSE  T+ ISSLQS  AH+WR VTRAR    +E     L 
Sbjct  242   LRGRIFHFSSESIARLKERANSESKTTKISSLQSLSAHVWRCVTRARQTAHDERTSCKLA  301

Query  964   IGMRARMGLPEG--YWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  R+RM  P    Y+G+AV  ++     G++L   LGW AW++   V  H+    VR M
Sbjct  302   INNRSRMEPPLAAEYFGSAVSVVSADSTGGELLENDLGWAAWKVHLAVANHN-GRVVRDM  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               ++++ P      +   S+ + ISSSP+FD+YG +FG GK V V SG  NK DG VT +
Sbjct  361   LKEWLQHPVIYQLGVNIDSSCVMISSSPKFDMYGNEFGMGKAVAVLSGYANKFDGNVTAY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
              G +  GS+D ELS+ PH +  LE+D EF+E  + P
Sbjct  421   PGRDGGGSIDFELSLSPHVMTALESDEEFMEAVSQP  456



>ref|XP_008338376.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   326 bits (836),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 260/450 (58%), Gaps = 48/450 (11%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             R +ELTPWD++ +QI  IQKGLLF     +++    +S+LI HLK++LS TL+ F PLAG
Sbjct  25    RSIELTPWDMRLIQIDYIQKGLLFKKSAKREK----SSSLIDHLKSTLSRTLNNFYPLAG  80

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R A   N+ DNTCS +++CN  G EFV A A GV V  ILD S      I+  LF +   
Sbjct  81    RLALTKNDNDNTCSFFINCNGNGAEFVXAAADGVKVEDILD-SVYFADDIVNHLFCMMDA  139

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-----GFHQP  669
              N +GI KPL+ VQ+TEL+DG FI C++NH + DGTSFW+FFN+W+E+SR        QP
Sbjct  140   WNYEGITKPLVAVQVTELVDGIFIGCSINHVVVDGTSFWHFFNTWSEISRVGPSGKISQP  199

Query  670   STTPIHERWFPDNTTTCPVHL-----------PPMI-------ESSERLPPPQRAFLAER  795
                P+  R F D     P+ L            P+I        SS+R+           
Sbjct  200   R--PVFAREFYDGVIDLPIQLXFSNIQEIMTKKPLIGHGLSSSNSSQRV-----------  246

Query  796   VFHLSKVNIARLKEKANSEMGTS---IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
             VFH  K  +  LK KAN E GT+    ISSLQ+ MAHLWRAVTRARNL+ +++V   + +
Sbjct  247   VFHFRKEKVVELKSKANVEXGTTDNNTISSLQALMAHLWRAVTRARNLNPDQEVSYRIAV  306

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             G+R RM   LP+ Y GN    +     AG++   GLGW A+ I K +      EE RK  
Sbjct  307   GVRQRMEXPLPKEYIGNGALGLIVKCTAGELXRHGLGWAAFLINKKI-GSLKAEEARKYM  365

Query  1141  MKFVESPAH-NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +V++P   +  +  +++  L   SS RF+VYG DFGWG+PV VRS    +  GK+T+F
Sbjct  366   EDWVKAPTFLSNPQRDTATLDLLTGSSXRFNVYGNDFGWGRPVAVRSRTQERKVGKLTVF  425

Query  1318  GGCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
              G EEGS+D E  + P T+  +  D EF++
Sbjct  426   PGPEEGSIDFECCLWPETIRAMAEDVEFMQ  455



>ref|XP_007203377.1| hypothetical protein PRUPE_ppa025976mg [Prunus persica]
 gb|EMJ04576.1| hypothetical protein PRUPE_ppa025976mg [Prunus persica]
Length=438

 Score =   324 bits (831),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 186/434 (43%), Positives = 261/434 (60%), Gaps = 37/434 (9%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELTPWDL+ +Q+  IQKGLLF  P     +   +++LI HL+ +LS TL+ F PLAGR
Sbjct  24    RIELTPWDLRLIQLDYIQKGLLFQKPA----ELEQSNSLIQHLQATLSQTLNIFYPLAGR  79

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNGI  504
              A + NE++ TC   ++CN+ G  FV A A GV +A ILD  ++ VP  I+ +LF++   
Sbjct  80    LAVIENEDNTTC-FSINCNSDGALFVHAAADGVKMADILD--SVYVPDDIVNNLFSMKEA  136

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPI  684
              N +GI KPL+  Q+TEL+DG FI C++NH+  DGTSFW+FFN+W+E+SR          
Sbjct  137   WNYEGISKPLLAAQVTELVDGIFIGCSINHTAADGTSFWHFFNTWSEISR----------  186

Query  685   HERWFPDNTTTCPVHLPPM----IESSERL--PPPQRAFLAERVFHLSKVNIARLKEKAN  846
                         P+HLP      I+S + +         L   VFH  K  +A LK KAN
Sbjct  187   -----LGGVIDLPIHLPSSYVNEIKSKQLIIGHGSSSDSLQRVVFHFPKEKVAWLKSKAN  241

Query  847   SEMGT----SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWG  1008
             +EMGT      ISSLQ+ MAHLWRA+TR R+L+ +++V   + +G+R R+   LP+ Y G
Sbjct  242   AEMGTIDSNISISSLQALMAHLWRAITRGRHLNPDQEVAYRVAVGLRQRLNPRLPKEYLG  301

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS  1188
             NA+  +     AG++L  GLGW A QI KT+   +  EE RK    +V++P      +  
Sbjct  302   NALLGVIVKCTAGELLEHGLGWAASQINKTIASLT-AEEARKYMEDWVKAPTFLSNMLGE  360

Query  1189  SSNT-LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
              +N  L   SSPRF+VYG DFGWG PV VRSG   +  GK+T+F G E+GS+D E  +  
Sbjct  361   PTNVELVTGSSPRFNVYGNDFGWGSPVAVRSGIPERKLGKLTVFPGPEDGSIDFEACLLT  420

Query  1366  HTLLGLENDAEFLE  1407
              TL  + +DAEF++
Sbjct  421   ETLRAMADDAEFMK  434



>ref|XP_003629582.1| Anthranilate N-hydroxycinnamoyl/benzoyltransferase [Medicago 
truncatula]
 gb|AET04058.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 185/440 (42%), Positives = 254/440 (58%), Gaps = 26/440 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   + A          + + LTPWDL  L+I PIQ+GLLFH P          +N I 
Sbjct  7     ISTSAIQARNHGGDKSTHKIIHLTPWDLGLLKIDPIQQGLLFHKP---------KTNQIQ  57

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK +LSSTL FFPPL GR     ++E N  S  + CNNAG  FV A A   T+A IL  
Sbjct  58    HLKQTLSSTLHFFPPLVGRLVISQHDEHNNASCSIICNNAGALFVHAIAENTTIAHILRP  117

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             +   VP I+ SLF LNG+ N  G  +PL+ VQ+TEL+DG FI   +NH + D  SFW+F 
Sbjct  118   NY--VPPIVHSLFHLNGVKNYKGTSQPLLAVQVTELIDGIFIGIEMNHVVVDAKSFWHFV  175

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLS  810
             NS  E+S GF++P+  P  ER+FP+N    P+  P   E+  +           R+FH +
Sbjct  176   NSGVEISHGFNKPTKIPSFERFFPNNINHHPIRFPFTKETQSQQFEVSH---PHRIFHFT  232

Query  811   KVNIARLKEKANSEMGTS------IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             K  I +LK KAN+E+ +S      IISSLQ+ ++H WR     +NL   E+    L I  
Sbjct  233   KEQILQLKSKANAEISSSCGGDKIIISSLQALLSHFWRLTISKQNLKPEENTIFRLPIDC  292

Query  973   RARM--GLPEGYWGNAVFFITESI-KAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             R RM   L E Y+GNA+    + I K G+++ + G+G  A ++ K + K SH E+V   Y
Sbjct  293   RTRMCPKLAENYFGNAIGVYGDVIMKVGELIKEGGIGKAAMEMNKMISKESHHEKVMNNY  352

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGG-NKLDGKVTLF  1317
               ++++P    A +  SSN   +S+SPRFD YG DFGWGKP+ VR+G G  K  GKVT+F
Sbjct  353   ESWLKTPIIGEAGMLRSSNVYLVSNSPRFDFYGNDFGWGKPIAVRNGVGLQKNIGKVTIF  412

Query  1318  GGCEEGSVDIELSIHPHTLL  1377
              G EEGS+DI++ + P+ +L
Sbjct  413   CGAEEGSIDIQVCL-PYDIL  431



>gb|KEH29083.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=440

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 186/434 (43%), Positives = 255/434 (59%), Gaps = 27/434 (6%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             + +++LTPWDLQFL     +KGLL+H+P          S+ I  L  SLSS L FF PLA
Sbjct  19    NHKIDLTPWDLQFLLYPTNKKGLLYHHPLA--------SDQIQRLTHSLSSALSFFQPLA  70

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             GR   +   ED+  S  V CNNAGV F+ A A    VA IL  +   VP ++RS F  N 
Sbjct  71    GRLK-ITEHEDSIVSCSVTCNNAGVNFIHAAAKDTCVADILKPTY--VPSVVRSFFPFND  127

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG-FHQPSTT  678
             + N +G  KPL+ VQ+TEL+DG FI    NH + DG S W+F NSWAE+SRG  HQ S +
Sbjct  128   VRNYEGTSKPLLAVQVTELVDGIFIGFNFNHVVADGQSTWHFINSWAEMSRGCHHQISNS  187

Query  679   PIHERWFPDNTTTCPVHLPPMIESSER--------LPPPQRAFLAERVFHLSKVNIARLK  834
             P  ERWFP N    P+  P  IE  +             ++ FL+ER+FH +K  I +LK
Sbjct  188   PTLERWFP-NGIQRPIRFPLTIEPQKNHSDGLSFSSSDDEKLFLSERIFHFTKKKIMQLK  246

Query  835   EKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWG  1008
              K N+E+ T  ISSLQ+ + HLW +V R+++L   ED      IG+R R+   LPE Y+G
Sbjct  247   SKVNAEIDTKKISSLQALLTHLWCSVIRSKHLDPQEDALNTFIIGVRPRLVPPLPEDYFG  306

Query  1009  NAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP  1185
             NA+      +K G++L + G+G  A  + K +  HS+ E+++  Y  ++ +P     +  
Sbjct  307   NAIIGCGFKMKVGELLEEGGIGKGALLMNKLIALHSN-EKLKNDYESWLRNPNFIRLDSL  365

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
             S+ N L ISSSP+FDVYG DFGWGKPV VRS  GNK +G V  F G EE S+D+++ +  
Sbjct  366   STKNFLAISSSPKFDVYGNDFGWGKPVAVRS--GNKTNGMVCAFAGIEEASIDLQVCLPY  423

Query  1366  HTLLGLENDAEFLE  1407
               L  + ND EF++
Sbjct  424   KILEAMGNDPEFMD  437



>ref|XP_010270496.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nelumbo 
nucifera]
Length=457

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 274/456 (60%), Gaps = 25/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LI  267
             IS+C V  A     +  S+   L PWDL  L +  IQKGLLF  P P   Q + + + +I
Sbjct  10    ISRCSVKPAHLPDES--SQPYYLNPWDLAMLTVHYIQKGLLFAKPPPSDNQDYPSIDAII  67

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNT-CSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             + LK SLS TL  F PLAGRF TV   ++    +V+VDC ++ G EF+ A A  VTVA +
Sbjct  68    NRLKHSLSRTLVHFFPLAGRFVTVQKRDNPPPYTVFVDCKDSPGAEFIHAVAD-VTVADV  126

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S I+VP  ++S FT +G +N DG   PL+ VQ+TELLDG F+ C+ NH++GDGTSFW
Sbjct  127   L--SPIDVPHFVQSFFTHDGAVNHDGHTMPLLAVQVTELLDGVFVGCSFNHTIGDGTSFW  184

Query  622   NFFNSWAELSR--GFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERL----PPPQRAF  783
             +FFN+WAEL+R  G    S  P+ +RWFPD     P+   P    SE +    PPP R  
Sbjct  185   HFFNTWAELTRDQGKDYISRPPVLKRWFPDGQG--PIINLPFTHHSEFIDRYRPPPLR--  240

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
               ER+FH S  ++ARLK +AN+E  T++IS+ QS  A +WR+VTR RNL SN+     L 
Sbjct  241   --ERIFHFSPQSLARLKARANAESKTTVISTFQSLCALVWRSVTRVRNLPSNQKTSCRLA  298

Query  964   IGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  R R+  P    Y+GN +  ++ +  AG++L   LGW AW + + V  H+ +  +R  
Sbjct  299   INNRTRLNPPISPDYFGNCIQTVSGTTTAGELLSHDLGWAAWMLHQAVVNHT-DSVLRSW  357

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGA-DFGWGKPVQVRSGGGNKLDGKVTL  1314
                ++++P+           ++ I SSPRFD+YG  DFGWG+ V +RSG  NK DGKV+ 
Sbjct  358   LETWMKAPSLYQIGRFFDPYSVMIGSSPRFDMYGGNDFGWGQGVAIRSGFANKFDGKVSS  417

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G E  GSVD+E+ + P  +  LE+D EF+E  ++
Sbjct  418   FPGKEGGGSVDLEVCLSPEKMSALESDEEFMEAVSL  453



>ref|XP_003604963.1| Anthranilate N-hydroxycinnamoyl/benzoyltransferase [Medicago 
truncatula]
 gb|AES87160.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   322 bits (825),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 178/433 (41%), Positives = 256/433 (59%), Gaps = 30/433 (7%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N   + + L+PWDL+FL++ PIQ+GLLFH P          +N I HLK +LSSTL+FFP
Sbjct  22    NSSDKIIHLSPWDLKFLKLAPIQRGLLFHKP---------KTNQIDHLKKTLSSTLNFFP  72

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             PLAGR     ++E N  S  + CNN G  FV AKA   T+A IL      VP ++ SLF 
Sbjct  73    PLAGRLVITQHDEPNNASCSIVCNNVGALFVHAKAENTTIADILQPKY--VPPVVSSLFL  130

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS  672
              N + N +G  +PL+ VQ+TEL+DG FI  T+NH   D  SFW+F NSWAE+++GF++P+
Sbjct  131   FNEVKNYEGTSQPLLAVQVTELIDGIFIGFTINHVCVDAKSFWHFINSWAEIAQGFNKPT  190

Query  673   TTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
               P  ERWFP+N    P+  P   ++  +    Q    + R+FH +K  I +LK KAN+E
Sbjct  191   KVPSFERWFPNNVNR-PIRFPFTKDAQNQ----QCDVSSNRIFHFTKEQILQLKSKANAE  245

Query  853   MGTS---------IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEG  999
             + +           ISSLQ+ ++HLWR     +N +S E    +L I  R RM   L E 
Sbjct  246   ISSGSSNSSDKIITISSLQALLSHLWRLFISKQNRNSEERSAFVLPIDCRTRMCPKLEEN  305

Query  1000  YWGNAVFFITESI-KAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGA  1176
             Y+GN +  +   I + G+++  G+G +A ++ K +   SH E++      ++++P+    
Sbjct  306   YFGNGIGAVGCVIMQIGELMESGIGKIAMEMNKEISSKSHHEKIMSDIESWLKTPSI-LE  364

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD-GKVTLFGGCEEGSVDIEL  1353
              + S+SN L  SSSPRF+ YG DFGWGKP+ VR+G G K + G V + GG EEGS+DIE+
Sbjct  365   PVKSASNLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLKRNIGIVNVLGGEEEGSIDIEV  424

Query  1354  SIHPHTLLGLEND  1392
             S   + L  + ND
Sbjct  425   SFPYNILEAIGND  437



>ref|XP_010109796.1| putative acetyltransferase [Morus notabilis]
 gb|EXC24722.1| putative acetyltransferase [Morus notabilis]
Length=535

 Score =   324 bits (831),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 263/458 (57%), Gaps = 31/458 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISK  V  A + +     RR+ELTPWDL++     IQKG+LF  PT         + L+ 
Sbjct  9     ISKSPVLPAASDQHKKFGRRIELTPWDLRYSLHDYIQKGILFLKPT--NVFSLITTTLVD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK +LS  L+ F PLAGR A V+ +ED T   ++DCN AG  FV A   GVT A IL Q
Sbjct  67    HLKATLSQALEIFYPLAGRLA-VIEKEDGTAIFFIDCNGAGAHFVHAVIDGVTAADIL-Q  124

Query  451   SNINVPQILRSLFTLNGILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
             S I    I+ S F + G++N +      PL+ VQ+TE++DG FIACT+NH  GDG SFW+
Sbjct  125   SPIVPDDIVYSFFPMKGVVNGEAAFSKLPLLAVQVTEVVDGIFIACTMNHCAGDGKSFWH  184

Query  625   FFNSWAELSR----GFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLP----PPQRA  780
             FFN W+E+SR    G     + P+  R   D     P+  P   +S  ++     PP   
Sbjct  185   FFNVWSEISRQSFDGSVSRCSRPVFGRERFDGFVNLPISFPFSRDSISKVKREVSPPN--  242

Query  781   FLAERVFHLSKVNIARLKEKANSEM------GTSIISSLQSYMAHLWRAVTRARNLHSNE  942
              L +R+F  SK  IA LK KA++EM          ISSLQ+ +AHL  +VTR R +  +E
Sbjct  243   -LQQRMFRFSKAKIAELKAKASAEMEIITESNEIAISSLQALLAHLCISVTRNRRIDPDE  301

Query  943   DVHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSH  1116
             +V   + +GMR R+   LPEGY+G+A   +     A ++L  GLGW AW+I + +   + 
Sbjct  302   EVGYKVAVGMRTRIQPPLPEGYFGSAALVVMPKCTARELLENGLGWSAWKINRAIASQT-  360

Query  1117  EEEVRKMYMKFVESPA--HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGN  1290
               EVRK+   + + P   + G  +   +NTL   SSPRFDVYG DFGWG+P+ VRSG   
Sbjct  361   ATEVRKLLEDWAQRPTLPYIGKIL---ANTLLTGSSPRFDVYGNDFGWGRPIAVRSGPAA  417

Query  1291  KLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
             K DGK+T+F G EEGS++ E+ +   TL  L  DAEF+
Sbjct  418   KFDGKLTVFPGAEEGSIEFEVCLLVETLESLACDAEFM  455



>ref|XP_007024494.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY27116.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=444

 Score =   320 bits (820),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 187/437 (43%), Positives = 268/437 (61%), Gaps = 25/437 (6%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffN--SNLIHHLKTSLSSTLDFFP  312
             +++++LTPWDLQFL    IQ+GLL+  P  P    Q     + ++ ++K  LSSTL +F 
Sbjct  22    AQKMDLTPWDLQFLLAEYIQRGLLYQIPEVPDVYDQEEEIGNIVVFYMKMFLSSTLSYFA  81

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             PLAGR +T    + NT S  +DCNNAG  FV A A GVT + I+  + I  P ++ S F 
Sbjct  82    PLAGRLSTT-EHDGNTVSFSIDCNNAGALFVHAVADGVTTSNIIQPAYI--PAVVDSFFP  138

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS  672
             LNGI N  G   PL+ VQ+TEL+DG+FI+ ++NHS+ DG SF++FFNSW  ++    Q S
Sbjct  139   LNGIKNYQGTSNPLLAVQVTELVDGFFISVSVNHSIVDGASFFHFFNSWLAIACDPTQLS  198

Query  673   TTPIHER-WFPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEK  840
               P+ +R +F D     P+ LP         + +PPP R     RVFH S+ N+A+LK K
Sbjct  199   KPPVFQRDFFKD--IDFPIRLPRSYFHQTHDKFIPPPLRV----RVFHFSRENVAKLKAK  252

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPEGYWGNAV  1017
             ANSE+GT  ISSLQ+ ++HLWRAV R R    +E+ +  L I  R ++  LPE Y+GN +
Sbjct  253   ANSEVGTKDISSLQALLSHLWRAVIRNRKADPDEETNYCLMISGRPKLQQLPERYFGNVL  312

Query  1018  FFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK-FVESPAHN--GAEIPS  1188
                  ++K  ++L  GLG  A Q+ K V   +H EE+ K ++K ++E+P     G  +  
Sbjct  313   QVGAITMKVKELLDLGLGNAARQMNKVVA--AHNEEMFKNFLKTWMETPKLRTMGNMV--  368

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
              SN+L  S SPRF++YG + G G P+ +RSG  NK DG+VT+  G EEGS+DIE+ + P 
Sbjct  369   -SNSLVTSDSPRFNIYGGETGLGTPIAIRSGPANKFDGRVTVHCGVEEGSIDIEICLAPA  427

Query  1369  TLLGLENDAEFLEYFTI  1419
             T   +END EF++  T+
Sbjct  428   TFGAMENDNEFMDAVTL  444



>gb|AFK35573.1| unknown [Medicago truncatula]
Length=443

 Score =   319 bits (818),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/433 (41%), Positives = 255/433 (59%), Gaps = 30/433 (7%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N   + + L+PWDL+FL++ PIQ+GLLFH P          +N I HLK +LSSTL+FFP
Sbjct  22    NSSDKIIHLSPWDLKFLKLAPIQRGLLFHKP---------KTNQIDHLKKTLSSTLNFFP  72

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             PLAGR     ++  N  S  + CNN G  FV AKA   T+A IL      VP ++ SLF 
Sbjct  73    PLAGRLVITQHDGPNNASCSIVCNNVGALFVHAKAENTTIADILQPKY--VPPVVSSLFL  130

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS  672
              N + N +G  +PL+ VQ+TEL+DG FI  T+NH   D  SFW+F NSWAE+++GF++P+
Sbjct  131   FNEVKNYEGTSQPLLAVQVTELIDGIFIGFTINHVCVDAKSFWHFINSWAEIAQGFNKPT  190

Query  673   TTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
               P  ERWFP+N    P+  P   ++  +    Q    + R+FH +K  I +LK KAN+E
Sbjct  191   KVPSFERWFPNNVNR-PIRFPFTKDAQNQ----QCDVSSNRIFHFTKEQILQLKSKANAE  245

Query  853   MGTS---------IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEG  999
             + +           ISSLQ+ ++HLWR     +N +S E    +L I  R RM   L E 
Sbjct  246   ISSGSSNSSDKIITISSLQALLSHLWRLFISKQNRNSEERSAFVLPIDCRTRMCPKLEEN  305

Query  1000  YWGNAVFFITESI-KAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGA  1176
             Y+GN +  +   I + G+++  G+G +A ++ K +   SH E++      ++++P+    
Sbjct  306   YFGNGIGAVGCVIMQIGELMESGIGKIAMEMNKEISSKSHHEKIMSDIESWLKTPSI-LE  364

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD-GKVTLFGGCEEGSVDIEL  1353
              + S+SN L  SSSPRF+ YG DFGWGKP+ VR+G G K + G V + GG EEGS+DIE+
Sbjct  365   PVKSASNLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLKRNIGIVNVLGGEEEGSIDIEV  424

Query  1354  SIHPHTLLGLEND  1392
             S   + L  + ND
Sbjct  425   SFPYNILEAIGND  437



>gb|EYU46590.1| hypothetical protein MIMGU_mgv1a005681mg [Erythranthe guttata]
Length=474

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 194/475 (41%), Positives = 271/475 (57%), Gaps = 49/475 (10%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS C +  A  + +     R+ LT WDL  L +   QKGLLF  P+P Q+       LIH
Sbjct  12    ISTCKIKVASESTA-----RINLTAWDLGLLFLEYSQKGLLFRKPSPHQE----TRTLIH  62

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVE----FVEAKASGVT--V  432
             HLK+SL  TL FFPPLAGR  T  +++    + ++DC++  +E    FV AK       V
Sbjct  63    HLKSSLQRTLHFFPPLAGRLLTTTSDDGAATTFFIDCSSNNIEGGALFVHAKVEDANFGV  122

Query  433   AAILDQS-NINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDG  609
             A +L  S N  VP+I+ S F L G+ N  G+ +PLM VQ+TEL DG F+ C++NH L DG
Sbjct  123   ADVLGSSTNYYVPEIVGSFFPLTGVRNHGGVTQPLMAVQVTELADGLFVGCSINHLLVDG  182

Query  610   TSFWNFFNSWAELSRG--FHQPSTTPIHER-------------WFPDNTTTCPVHLP---  735
             TSFW+FFNSWA++SRG   +  S  PI  R             +  D      +HLP   
Sbjct  183   TSFWHFFNSWAQISRGDNINPISKPPILNRDQINLDLSGSGSIYIHDKHL---IHLPNNN  239

Query  736   -PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMG---TSIISSLQSYMAHLW  903
                  ++ +    +R  L +R+FHLSK ++A+LK +AN EMG      ISSLQ+ +AH+W
Sbjct  240   NNNNNNNNQAESRRRQVLKDRIFHLSKESVAKLKRRANEEMGEISKGKISSLQAIVAHVW  299

Query  904   RAVTRARNLHSN--EDVHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLG  1071
             R + R R    +  E     + +G R RM   LPE Y+GNAVF    +++   +L  GLG
Sbjct  300   RCIIRCRFAMDDCEETTTFEVPMGARQRMEPPLPEEYFGNAVFPGIVTVETSKLLENGLG  359

Query  1072  WVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAE-IPSSSNTLGISSSPRFDVY-GAD  1245
             W AWQI + V   +   +V+++Y  +++ P     E +P   N+  + +SPRFDVY G D
Sbjct  360   WAAWQINRMVGSGNGPGKVKELYTGWIKEPVFLQFEGLP--RNSFILINSPRFDVYDGND  417

Query  1246  FGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEY  1410
             FGWGKPV VRSG  +  DG++T+  G  EGSVDIE  + P TL  + +D+EF+EY
Sbjct  418   FGWGKPVAVRSGKASSSDGRITVTRGVGEGSVDIEACLAPETLSAMADDSEFMEY  472



>ref|XP_008801989.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=464

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 177/430 (41%), Positives = 250/430 (58%), Gaps = 21/430 (5%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +R  LTPWDL       IQKGLLF N  P          +I  LK+SLS+ L  F PLAG
Sbjct  24    KRFHLTPWDLAMFSCHYIQKGLLFANLPPSLS----TDQIIDRLKSSLSTALLHFYPLAG  79

Query  325   RFAT--VMNEEDNTCSVY--VDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
             RF T    +E      ++  +DCN  G EF+ A A  VTV+ +L  S+ +VP  ++S F 
Sbjct  80    RFVTEEARDENQKVTGIFWSIDCNGEGAEFIHAIAREVTVSDVLSPSD-DVPSFVQSFFP  138

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQ  666
             L+G ++ DG  +PL+ VQ+TEL DG FI C+ NH++GDGTS+WNFFN+WA+++R  G   
Sbjct  139   LDGAVDHDGHAQPLLAVQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQITRTKGVAA  198

Query  667   PSTTPIHERWFPDNTTTCPVHLPPMIESS--ERLPPPQRAFLAERVFHLSKVNIARLKEK  840
              S  P+++RWF D     PV LP        ER  PP    L E++ H S  +IA+LK +
Sbjct  199   LSRPPVYDRWFIDGYDNPPVKLPFSHPDDFIERFSPPP---LREKIVHFSAQSIAQLKAR  255

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNA  1014
             AN   GT+ ISS Q+  A +WR++TR RNL +++     +    RAR+  P    Y+GN+
Sbjct  256   ANQARGTNSISSFQALSALVWRSITRTRNLPADQKTSCRMAAQNRARLSPPLSPDYFGNS  315

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             ++ I  +   G++L   LGW AW + +TV +H  +  +R     ++  P      +    
Sbjct  316   MYPIIATTTVGELLNHDLGWAAWLLNRTVAEHD-DSAIRDKLRAWMARPVVYRLSMFDRF  374

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHT  1371
             + + + SSPRFDVYG +FGWGK V  RSG  NK DGKVT + G E  GSVD+E+ + P +
Sbjct  375   SVM-MGSSPRFDVYGCEFGWGKAVAARSGSANKFDGKVTSYSGWEGGGSVDLEICLVPES  433

Query  1372  LLGLENDAEF  1401
             +  LE+D EF
Sbjct  434   MSVLESDEEF  443



>gb|ABC47847.1| N-hydroxycinnamoyl/benzoyltransferase 5 [Glycine max]
Length=465

 Score =   315 bits (807),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 190/458 (41%), Positives = 273/458 (60%), Gaps = 29/458 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+   G A+ + +     LTPWD+  + +  IQKGLLF  P      Q F  NL+ 
Sbjct  9     VSECFIKPLGQAKESNLI--CHLTPWDIAMMSLHYIQKGLLFKKPATLVDPQDFMENLLE  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN-AGVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAG+  T   ++  + +++VDCNN +G  F+ A    +T++ IL 
Sbjct  67    KLKHSLSLTLFHFYPLAGQLVTQKTQDPPSYTIFVDCNNTSGARFIYATLD-ITISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I+VP I+ S F  +  +N DG   PL+ +Q+TELLDG FI C++NH++GDGTS+WNF
Sbjct  125   -SPIDVPPIVHSFFDHHKAVNHDGHTMPLLSIQVTELLDGVFIGCSMNHTIGDGTSYWNF  183

Query  628   FNSWAEL-----SRGFHQPSTT-----PIHERWFPDNTTTCPVHLPPMIESS--ERLPPP  771
             FN+W+E+     ++G    +T      PIH RWFPD      ++LP   E    +R   P
Sbjct  184   FNTWSEIFFQTQAQGLEYDATVPISRHPIHNRWFPDGCGPL-INLPFKHEDEFIDRFESP  242

Query  772   QRAFLAERVFHLSKVNIARLKEKANSE--MGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
             +   L  R+FH S  +IA+LK +ANSE    TS ISS QS  AH+WR+VTRAR L ++E 
Sbjct  243   K---LRVRIFHFSAESIAKLKARANSESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEI  299

Query  946   VHLILGIGMRARMG--LPEGYWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSH  1116
                 L I  R+R+   LP  Y+GNAV  + T    AG++L K LGW AW++   V  + +
Sbjct  300   TSCKLAISNRSRLEPPLPHEYFGNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAV-ANQN  358

Query  1117  EEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKL  1296
             ++ VR+   ++++ P      +     T+ +SSSPRF++YG +FG GK V V SG  NK 
Sbjct  359   DKAVRQKLKEWLKLPVVYQLGVHFDPCTVTMSSSPRFNMYGNEFGMGKAVAVLSGYANKN  418

Query  1297  DGKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLE  1407
             DG VT + G E EGS+D+E+ + P  +  LE+D EF+E
Sbjct  419   DGNVTAYQGYEGEGSIDLEICLSPDAVSALESDEEFME  456



>gb|KEH33177.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=449

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 194/455 (43%), Positives = 261/455 (57%), Gaps = 49/455 (11%)
 Frame = +1

Query  133   NGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFP  312
             N    +++LTPWDL+ L + P  KGLL+H+P          SN I  LK SLSSTL FFP
Sbjct  16    NSTDEKIDLTPWDLKVLLVEPTHKGLLYHHP--------LESNQIPQLKQSLSSTLAFFP  67

Query  313   PLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT  492
              LAGR   + + EDNT S  V CNNAGV FV A      V  IL  + I  P IL S + 
Sbjct  68    LLAGRLE-ITDHEDNTMSCSVTCNNAGVLFVHATTENTCVGDILGCTYI--PPILNSFYP  124

Query  493   LNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG--FHQ  666
             LNGI N +G  +PL  VQ+TEL+DG FI  T NH + DGTS W F NSWAE+SRG   +Q
Sbjct  125   LNGIKNYEGTSQPLFAVQVTELVDGIFIGFTFNHVVVDGTSAWYFINSWAEISRGGCCNQ  184

Query  667   PSTTPIHERWFPDNTTTCPVHLPPMIE-------------------SSERLPPPQRAFLA  789
              S     ERWFPD    CP+  P   +                   ++E+L P      +
Sbjct  185   TSKLSTLERWFPDG-IQCPIRFPFTKKLQNNQSDGLSFSSSNNEKLNNEKLNP------S  237

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
              R+FH +K  I++LK KAN E GT+ ISSLQ+  AHLW +V R+  L   E+ + ++GIG
Sbjct  238   VRLFHFTKEKISQLKLKANLETGTNKISSLQALFAHLWCSVIRSDQLDPQENAYFMVGIG  297

Query  970   MRARM--GLPEGYWGNAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             +R R    LPE Y+GNAV     ++K G++L + G G  AW++ +T+  HS+ E+++  Y
Sbjct  298   VRQRFVPPLPEDYFGNAVVASMVAMKVGELLEEGGFGKCAWKMHETICLHSN-EKLKNDY  356

Query  1141  MKFVESPA--HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
               +V +P     G    +  + L  SSS  FDVYG +FGWGKPV VRS  GNK  G   +
Sbjct  357   ENWVRNPIIYRLGDSNVADYHVLASSSSQWFDVYGNNFGWGKPVAVRS--GNKQSGLFAV  414

Query  1315  FGGCEEGSVDIELSIHPHTLL-GLENDAEFLEYFT  1416
             F G EEGS+D+++ + PH +L  + ND  F+ + +
Sbjct  415   FAGIEEGSMDLQVCL-PHKILEAMGNDPVFMNFVS  448



>gb|KHN04490.1| Putative acetyltransferase [Glycine soja]
Length=465

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 188/458 (41%), Positives = 273/458 (60%), Gaps = 29/458 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+   G A+ + +     LTPWD+  + +  IQKGLLF  P      Q F  NL+ 
Sbjct  9     VSECFIKPLGQAKESNLI--CHLTPWDIAMMSLHYIQKGLLFKKPATLVDPQDFMENLLE  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN-AGVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAG+  T   ++  + +++VDCNN +G  F+ A    +T++ IL 
Sbjct  67    KLKHSLSLTLFHFYPLAGQLVTQKTQDPPSYTIFVDCNNTSGARFIYATLD-ITISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++VP I+ S F  +  +N DG   PL+ +Q+TELLDG FI C++NH++GDGTS+WNF
Sbjct  125   -SPVDVPPIVHSFFDHHKAVNHDGHTMPLLSIQVTELLDGVFIGCSMNHTIGDGTSYWNF  183

Query  628   FNSWAEL-----SRGFHQPSTT-----PIHERWFPDNTTTCPVHLPPMIESS--ERLPPP  771
             FN+W+E+     ++G    +T      PIH RWFPD      ++LP   E    +R   P
Sbjct  184   FNTWSEIFFQTQAQGLEYDATVPISRHPIHNRWFPDGCGPL-INLPFKHEDEFIDRFESP  242

Query  772   QRAFLAERVFHLSKVNIARLKEKANSE--MGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
             +   L  R+FH S  +IA+LK +ANSE    TS ISS QS  AH+WR+VTRAR L ++E 
Sbjct  243   K---LRVRIFHFSAESIAKLKARANSESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEI  299

Query  946   VHLILGIGMRARMG--LPEGYWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSH  1116
                 L I  R+R+   LP  Y+GNAV  + T    AG++L K LGW AW++   V  + +
Sbjct  300   TSCKLAISNRSRLEPPLPHEYFGNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAV-ANQN  358

Query  1117  EEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKL  1296
             ++ VR+   ++++ P      +     T+ +SSSPRF++YG +FG GK + V SG  NK 
Sbjct  359   DKAVRQKLKEWLKLPVVYQLGVHFDPCTVTMSSSPRFNMYGNEFGMGKAIAVLSGYANKN  418

Query  1297  DGKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLE  1407
             DG VT + G E EGS+D+E+ + P  +  LE+D EF+E
Sbjct  419   DGNVTAYQGYEGEGSIDLEICLSPDAVSALESDEEFME  456



>ref|XP_007136704.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
 gb|ESW08698.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
Length=461

 Score =   312 bits (799),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 185/456 (41%), Positives = 264/456 (58%), Gaps = 21/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV   G    +  +    LT WD+  L I  IQKGLLF  P     Q  F  NL+ 
Sbjct  9     ISECFVKPHGLTEVS--NETCHLTHWDISMLSIHYIQKGLLFKKPETLVHQHDFIQNLLD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PL+GR  T   +   + +++VDCNN+ GV F  A    VT++ IL 
Sbjct  67    KLKHSLSLTLSHFYPLSGRLVTHKTQNPPSYAIFVDCNNSDGVRFTHATLD-VTISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++ P I  S F  +  +N DG   PL+ +Q+TEL+DG FI C++NHS+GDGTS+WNF
Sbjct  125   -SPVDTPSIFHSFFDHHKAVNHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNF  183

Query  628   FNSWAELSRGFHQPSTT-------PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FN+W+++ +   Q           PIH RWFP+N +  P++L P     E +   +   L
Sbjct  184   FNAWSKIFQAEPQGQENDVPILHQPIHNRWFPNNCSP-PINL-PFKHHDEFINRFEAPLL  241

Query  787   AERVFHLSKVNIARLKEKANSE--MGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              ER+FH S  +IA+LK KANSE    T+ ISS QS  A +WR++ RAR+L   +  +  L
Sbjct  242   RERIFHFSAESIAKLKAKANSESKSNTTKISSFQSLSALVWRSIIRARSLPYEQRTNFTL  301

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R+RM   LP  Y+GN+V  ++     G++L   LGW AW++   V +H+ ++EV +
Sbjct  302   SANNRSRMEPPLPHEYFGNSVNSLSAETTVGELLKNDLGWAAWKLHLAVTRHN-DKEVMQ  360

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                ++ + P       P     + ISSSPRF++YG++FG GK V VRSG  NK DGKVT 
Sbjct  361   SIQEWFQCPVIRKICQPLEPYLVLISSSPRFNMYGSEFGMGKAVAVRSGYANKFDGKVTS  420

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             F G E  GS+D+E+ + PH +  LE+D +F+   ++
Sbjct  421   FPGREGGGSIDLEICLLPHIMTSLESDMDFMNAVSV  456



>ref|XP_007136696.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
 gb|ESW08690.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
Length=459

 Score =   311 bits (798),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 188/457 (41%), Positives = 270/457 (59%), Gaps = 20/457 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAA-RSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             +S+CF+ A  +  +SN +     LTPWD+  L    IQKGLL+  P P   Q  F  NL+
Sbjct  10    VSECFIKAKHSTQKSNQI---CHLTPWDIAMLSAHYIQKGLLYKKPEPLVNQHDFIENLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PL+GR  T   ++    +V+VDC NN+GV+F+ A    +T++ IL
Sbjct  67    EKLKHSLSLTLSHFYPLSGRLVTHKTKDPPFYAVFVDCTNNSGVKFIHATLD-MTISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP I++SLF  +  LN DG   PL+ +Q+TELLDG F+ C++NH +GDGTS+WN
Sbjct  126   --SPLDVPPIVQSLFDHDRALNHDGHTMPLLSIQVTELLDGVFLGCSMNHCIGDGTSYWN  183

Query  625   FFNSWAEL--SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             FFN+W+E+  ++G       S  PIH RWFP N    P++L P     E +   +   + 
Sbjct  184   FFNTWSEIFQAQGHEHDVPISHPPIHNRWFP-NDCVPPINL-PFKHHEEFISRYEAPLMR  241

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER+FH S  +IA+LK KANSE  T+ ISS QS  A +WR +TRAR L  ++     L   
Sbjct  242   ERIFHFSAESIAKLKAKANSECNTTKISSFQSLSALVWRCITRARRLGPDQKTSCKLSTN  301

Query  970   MRARMGLP--EGYWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              R RM  P  E Y+GN++  +   + ++G++LG GLGW AW++   V  H+ +  V    
Sbjct  302   NRRRMEPPLAEEYFGNSIHTLGAGTARSGELLGNGLGWAAWKLHLAVVNHN-DRVVLGWV  360

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              +++E P             + + SSPRF++YG +FG GK + VRSG  NK DGKVT + 
Sbjct  361   REWLECPLIYQLGRYFDPYCVMMGSSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSYP  420

Query  1321  GCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIPGN  1428
             G E  GSVD+E+ + P  +  LE+D EF++  + P N
Sbjct  421   GHEGGGSVDLEVCLSPLVMTALESDQEFMDSASSPSN  457



>ref|XP_009409404.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Musa 
acuminata subsp. malaccensis]
Length=468

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/448 (40%), Positives = 255/448 (57%), Gaps = 21/448 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S C V      R+     R  L  WDL       IQKG LF   +     +   ++++ 
Sbjct  11    VSTCIVKPPPRPRT-----RCHLAVWDLSMFNASYIQKGHLF---STHLLSRLTIADVVD  62

Query  271   HLKTSLSSTLDFFPPLAGRFAT--VMNEEDNTCSVYV--DCNNAGVEFVEAKASGVTVAA  438
              LKTSLS+ L  F PLAGR  T   ++E+ N   +YV  DC+  G E     A G+TVA 
Sbjct  63    RLKTSLSTALLHFYPLAGRLVTEEAVDEQGNVTGIYVSIDCDGQGAELTHVVADGITVAD  122

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             +L  S+ +VP  +RS F L+G++N DG  +PL+ VQ+TEL DG+F+ C+ NH +GDGTS+
Sbjct  123   VLAPSS-DVPSFVRSFFRLDGVINYDGHSEPLLAVQLTELADGFFVGCSFNHVVGDGTSY  181

Query  619   WNFFNSWAELSR---GFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             W FFN+WAE++R      + S  P+H+RWF D +   P+ LP          P Q     
Sbjct  182   WQFFNAWAEIARADGAAAEMSHPPVHDRWFIDGSGGLPIKLPFTRPDEFIDRPTQPPLYR  241

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER+FHLS  +IARLK +AN E GTS ISS QS  + LWR +TRAR L + +  H  +   
Sbjct  242   ERIFHLSAESIARLKARANLECGTSSISSFQSVASLLWRCITRARGLPAEQTTHCRVATQ  301

Query  970   MRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
              RAR+  P    Y+GN+++ +  +  AG++L  GLGW A  I +TV  H+ +  +R+   
Sbjct  302   NRARLQPPMSPDYFGNSIYPLPAAATAGELLAHGLGWAARLIHETVAGHT-DTAIREKVE  360

Query  1144  KFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG  1323
              ++ +P      +    + + + SSPRFDVYG +FG GK V VRSG  +K DGKVT + G
Sbjct  361   AWMAAPVVYKMNMFDKFSVM-MGSSPRFDVYGCNFGLGKAVAVRSGTAHKFDGKVTFYPG  419

Query  1324  CE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              E  GS+D+E+ + P  +   E D EF+
Sbjct  420   WEGGGSMDLEICLEPPFMSAFEADEEFM  447



>ref|XP_007136703.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
 gb|ESW08697.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
Length=463

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 188/461 (41%), Positives = 266/461 (58%), Gaps = 30/461 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV       +N  ++   LTPWD+  L +  IQKGLLF  P     QQ+F  NL+ 
Sbjct  9     ISECFVKPH--PYNNFPNQICNLTPWDIAMLSVHYIQKGLLFSKPATLVDQQYFMENLLK  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PL+GR  T   ++  + +V VDCNN+ G  F+ A    VT++ +L 
Sbjct  67    KLKHSLSLTLSHFYPLSGRLVTHKTQQPPSYTVSVDCNNSDGARFIYATLD-VTISDLL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++ P +  S F  +  LN DG   PL+ +Q+TEL+DG FI C++NHSLGDGTS+WNF
Sbjct  125   -SPVDTPSVFHSFFDHHKALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSLGDGTSYWNF  183

Query  628   FNSWAELSRGFHQP---------STTPIHERWFPDNTTTCPVHLP-----PMIESSERLP  765
             FN+W+++ +   Q          S  PIH RWFP+N    P+ LP       IE SE+  
Sbjct  184   FNTWSQIFQAQSQAERCEYDVPISRQPIHNRWFPNNCRP-PISLPFKHHEEFIERSEK--  240

Query  766   PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
                   L ERVFH S  +IA+LK KANSE  T+ ISS QS  A +WR++TRAR+  S++ 
Sbjct  241   ---TTLLRERVFHFSAESIAKLKAKANSESNTTQISSFQSLSALVWRSITRARSPPSDQI  297

Query  946   VHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                 L    R+RM   LPE Y+GN +  ++     G++L   LGW AW++   V   S+ 
Sbjct  298   TICRLAANSRSRMEPPLPEEYFGNCIHAVSAETTKGELLENDLGWAAWKLHMAVANLSN-  356

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
               V +   +++ESP             + + SSPRF++YG++FG GK V  RSG  NK D
Sbjct  357   RVVLQYLQEWLESPLIYQMGRFFDPYCVMMGSSPRFNMYGSEFGMGKAVAARSGHANKFD  416

Query  1300  GKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GKV+ + G E  GS+D+E+ + PH++  LE+D EF+   ++
Sbjct  417   GKVSSYPGREGGGSIDLEVCLLPHSMSALESDKEFMNAVSV  457



>ref|XP_010933132.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=452

 Score =   309 bits (792),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 187/451 (41%), Positives = 264/451 (59%), Gaps = 25/451 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVS-----RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN  255
             ISK  V  + + + N  +     R + LTPWDL+ L I  IQKG+L   P          
Sbjct  12    ISKSAVLPSSSIKQNSEATAQRPRVIHLTPWDLRLLSIEYIQKGVLLPQPP-----NASA  66

Query  256   SNLIHHLKTSLSSTLDFFPPLAGRFATV--MNEEDNTCSVYVDCNNAGVEFVEAKASGVT  429
              +++  L +SLS  LD F PLAGR  T    N    + S+++DCN+  VE + A A+ VT
Sbjct  67    DSILPRLLSSLSLALDHFFPLAGRLTTKEHQNISPPSLSIFIDCNDQAVELIHAAAAKVT  126

Query  430   VAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDG  609
             V+ IL  S + VP ++RS F L G +  DG   PL+ VQ+TEL DG F+ C+ NH++ DG
Sbjct  127   VSDIL--SPLYVPTVVRSFFPLAGAVCHDGHLLPLLAVQVTELADGVFVGCSANHAVVDG  184

Query  610   TSFWNFFNSWAELSR-GFHQPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRA  780
             +SFW+F NSW+E+SR G  Q S  P+  RWF D  +  P+ LP     E   R   P+  
Sbjct  185   SSFWHFLNSWSEISRTGSSQISRPPVLHRWFLDPVSP-PILLPFSSHQEFIRRYITPR--  241

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              + E + H SK +I +LK KAN EM T+ +SSLQ+ +AH+WR+V RAR L  +++    L
Sbjct  242   -IDEAIIHFSKQSIQKLKAKANLEMKTNQLSSLQALLAHVWRSVLRARRLEHDQETSYSL  300

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
              IG R R+   LP  Y+GN+    T  + AG+V+ +GLGWVAWQ+ + V  H+    V+ 
Sbjct  301   AIGDRWRIEPPLPANYFGNSSLRATAKLLAGEVVDRGLGWVAWQLNRAVAAHT-TTVVKS  359

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                 + ++P  +  +   + N L   SSPRFDVYG DFGWG+P+ VRSG  NK DG V +
Sbjct  360   WLESWQQNPIFSYFDCLETRN-LAAGSSPRFDVYGNDFGWGRPLAVRSGIANKRDGNVMV  418

Query  1315  FGGCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
             + G E+GS+D+E+ + P  L  L  D EF+E
Sbjct  419   YEGNEDGSMDLEICLSPQALASLLEDKEFME  449



>ref|XP_008778923.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=478

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 263/464 (57%), Gaps = 48/464 (10%)
 Frame = +1

Query  124   ARSNGVSRRVELTPWDLQFLQIGPIQKGLLF----------------------------H  219
             ++S GV   + LTPWDL+ L +  IQKG+LF                             
Sbjct  20    SQSRGV---IHLTPWDLKMLSVDYIQKGILFLKPPPPPPPPPAAAADDDDAAKTRSDEQR  76

Query  220   NPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVE  399
                  ++++  +  +I  L +S +  LD F PLAGR AT  +EE N+ S+++DCN+ G E
Sbjct  77    EEDGGKEEEDSSPVIISDLLSSFARALDHFFPLAGRLATAKHEETNSLSIFLDCNDEGAE  136

Query  400   FVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDG-YFI  576
             F+ A A+ VT + +L  + + V  +++S F LNG+L  DG+  PL+ VQ+TEL DG  FI
Sbjct  137   FIHASAATVTASDVL--APLYVHPVVQSFFPLNGVLGCDGLSTPLLAVQVTELADGGIFI  194

Query  577   ACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS--TTPIHERWFPDNTTTCPVHLP--PMI  744
              C+LNH++ DG+SFW+FFNSWA LSR  HQ S    P  +RWF D+    P+ LP    +
Sbjct  195   GCSLNHAVADGSSFWHFFNSWAHLSRDRHQVSIPNPPTIDRWFLDSCPP-PIRLPFADRL  253

Query  745   ESSERLP-PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRA  921
             +S +R+  PP R    E   H S  +IA+LK +AN+EMGT  ISSLQ+ + HLWR+V RA
Sbjct  254   DSIQRISFPPVR----ECALHFSARSIAKLKARANTEMGTDRISSLQALLGHLWRSVARA  309

Query  922   RNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKK  1095
             R L   ++    + +G R+R+G  LP  Y GNA+        AG++   G GW AW + +
Sbjct  310   RRLDPTQETTYSVLVGCRSRLGPSLPATYLGNAIMIARAKSTAGELSEHGPGWAAWLLNR  369

Query  1096  TVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVR  1275
              V     E   R     + + P+    +  +  + L   SSPRFD+YG DFGWG+P  VR
Sbjct  370   AVAS-CGEAATRDWLESWAKEPSLVRMDHFNHCD-LVTGSSPRFDIYGNDFGWGRPAAVR  427

Query  1276  SGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
             SG GNK+DGK T++ G + GS+ +E+ + P  L  L  D EF++
Sbjct  428   SGVGNKVDGKATIYPGPDPGSMALEVCLSPQALSSLLQDQEFMQ  471



>ref|XP_007136702.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
 gb|ESW08696.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
Length=462

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 270/464 (58%), Gaps = 36/464 (8%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CFV        N VS ++  LTPWD+  L    IQKGLLF+ P     QQ+F  NL+
Sbjct  8     ISECFVKPHPF---NQVSSQICHLTPWDIAMLSTHYIQKGLLFNKPATLVDQQYFMENLL  64

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PL+GR  T   +   + +V VDCNN+ G  F+ A A  VT++ +L
Sbjct  65    EKLKHSLSLTLFHFYPLSGRLVTHKTQHPPSYTVSVDCNNSDGARFIYA-ALDVTISDLL  123

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++ P +  S F  +  LN DG   PL+ +Q+TEL+DG FI C++NHSLGDGTS+WN
Sbjct  124   --SPVDTPSVFHSFFDHHKALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSLGDGTSYWN  181

Query  625   FFNSWAELSRGFHQP---------STTPIHERWFPDNTTTCPVHLP-----PMIESSERL  762
             FFN+W+++ +   Q          S  P+H RWFP+N +  P+ LP       I   E  
Sbjct  182   FFNTWSQIFQAQSQAESHEYDVPISHQPLHNRWFPNNCSP-PISLPFKHHDEFIGRPEET  240

Query  763   PPPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNE  942
             P P+     ER+FH S  +IA LK KANSE  T+ ISS QS  A +WR++TRAR+  S++
Sbjct  241   PLPR-----ERIFHFSAESIAALKAKANSESNTTRISSFQSLSALVWRSITRARSPPSDQ  295

Query  943   DVHLILGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSH  1116
                  L    R+RM   LPE Y+GN +  ++     G++L  GLGW AW++ K V  + +
Sbjct  296   ITICRLAANNRSRMEPPLPEEYFGNCIHAVSAETTTGELLENGLGWAAWKLHKAV-TNLN  354

Query  1117  EEEVRKMYMKFVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGN  1290
             +  V +    ++ESP     G      S  +G  SSPRF++YG++FG GK V  RSG  N
Sbjct  355   DRVVLEFLEGWLESPLIVQMGRFFDPYSVLMG--SSPRFNMYGSEFGMGKAVAARSGYAN  412

Query  1291  KLDGKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             K DGKV+ + G E  GS+D+E+ + PHT+  LE+D EF+   ++
Sbjct  413   KFDGKVSSYPGREGGGSIDLEVCLLPHTMSALESDKEFMNAVSV  456



>ref|XP_010927209.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=450

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/430 (41%), Positives = 253/430 (59%), Gaps = 28/430 (7%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             R + LTPWDL+ L +  IQKG+L   P TP          +I  L +SLS  LD F PLA
Sbjct  37    RLIHLTPWDLRLLSVDYIQKGILLPKPPTP----------VIPRLISSLSLVLDHFYPLA  86

Query  322   GRFATVMNEEDN-TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             GR AT+ ++    + SV ++CN+ G + + A A+ +T A IL    I  P I++S F LN
Sbjct  87    GRLATINHDTTPPSLSVAIECNDEGAQLIHAAATDITTADILTPRFI--PSIIKSFFPLN  144

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-GFHQPST  675
             G +N DG   PL+ VQ+TEL DG F+ C LNH + DGTSFW+F NSW+E+SR G  Q S 
Sbjct  145   GAINHDGHSLPLLAVQVTELADGVFVGCALNHVVADGTSFWHFLNSWSEISRTGVPQISR  204

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
              P+ +RWF ++ +  P+HL P+ +  + +     + L+E  FH S   IA+LK +AN EM
Sbjct  205   PPMLDRWFQESCSP-PIHL-PVYKREDFIKVCPSSHLSEAFFHFSAQTIAKLKLRANMEM  262

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFI-  1026
              T  ISSLQ+ +A +WR+V RA+ L  NE     + +  R R+   LPE Y+G+    + 
Sbjct  263   STDRISSLQALLAFVWRSVLRAQRLPPNEKTSYRVTVNYRPRLDPPLPEEYFGSTAMGVP  322

Query  1027  TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI---PSSSN  1197
             T +  AG VL +GLGW A  + + V   +++     M   ++ES   N   +    +   
Sbjct  323   TSTASAGAVLDRGLGWAASLLNQMVASQTND-----MIRNWLESWTRNPTFLCVKEAKVG  377

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
             T+   SSPRFDVYG DFGWG+P+ VRSG  NKL+GK+++F G EEGS  +++ +    + 
Sbjct  378   TVVTGSSPRFDVYGNDFGWGRPIAVRSGAANKLNGKISVFPGSEEGSTALDVCLSSQAMR  437

Query  1378  GLENDAEFLE  1407
              L  D EF+E
Sbjct  438   LLLQDKEFME  447



>ref|XP_007136697.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
 gb|ESW08691.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
Length=461

 Score =   308 bits (788),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 265/455 (58%), Gaps = 23/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAAR-SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             +S+CF+   G A+ S G+     LTPWD+  L +  IQKGLLF  P     +Q F  NL+
Sbjct  9     VSECFIKPLGPAQDSIGI---CNLTPWDIAMLSMHYIQKGLLFRKPATLVDRQDFIENLL  65

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PLAG   T  N+  ++C+++VD NN  G  F+ A    +T+  IL
Sbjct  66    KKLKHSLSLTLFHFYPLAGHLVT--NKGPSSCTIFVDGNNKDGARFIYATLD-LTIFDIL  122

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP I+ S F  +  +N DG   PL+ +++TELLDG FI C++NH++GDGTS+WN
Sbjct  123   --SPVDVPPIVHSFFDHHKAVNHDGHTMPLLSIKVTELLDGVFIGCSMNHAIGDGTSYWN  180

Query  625   FFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FFN+W+E+     Q        S  PIH RWFPD     P+   P     E +   +   
Sbjct  181   FFNTWSEIFLAQAQGHEYGVSISRHPIHNRWFPDGCG--PLINLPFKHHDEFISRFEAPK  238

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             + ER+FH S  +IA+LK +ANS+  T+ ISS QS  AH+WR +TRAR+L  +E     L 
Sbjct  239   MRERIFHFSAESIAKLKARANSDSKTTKISSFQSLSAHVWRCITRARHLPHDEITSCKLA  298

Query  964   IGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  RARM   LP  Y+GN +  ++    AG++L   LGW AW++   V   + +  VR  
Sbjct  299   INNRARMEPPLPYEYFGNLIGVVSAGTTAGELLENDLGWAAWKVHLAVANQN-DRVVRDA  357

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               ++++ P      +   S ++ +SSSPRFD+YG +FG G+ V V SG  NK DG VT +
Sbjct  358   VKEWLQRPVVYQLGVHFDSCSVTMSSSPRFDMYGNEFGMGRAVAVLSGYANKFDGSVTSY  417

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GS+D+ELS+ P  +  LE+D EF++  ++
Sbjct  418   PGSEGGGSIDLELSLSPKAMTLLESDEEFMQAVSV  452



>ref|XP_003528298.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|KHN22331.1| Putative acetyltransferase [Glycine soja]
Length=457

 Score =   307 bits (787),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 182/454 (40%), Positives = 263/454 (58%), Gaps = 19/454 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV   G    +  ++   LT WD+  L +  IQKGLLF  PTP   +  F  NL+ 
Sbjct  9     ISECFVKPHGLTEMS--NQTCHLTHWDIAMLSMHYIQKGLLFKKPTPLVDRHDFIGNLLG  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAGR  T   +   + +V VDC N+ G  F+ A    +T++ IL 
Sbjct  67    KLKHSLSLTLSHFYPLAGRLVTHQTQNPPSYTVSVDCKNSDGARFIYATLD-MTISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S +++P +++SLF  +  LN DG   PL+ +Q+TEL+DG FI C++NHS+GDGTS+WNF
Sbjct  125   -SPVDIPLVVQSLFDHHKALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNF  183

Query  628   FNSWAELSRGFHQPSTT-------PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FN+W+ + +   Q   T       PIH RWFP N    P++L P     E +   +   +
Sbjct  184   FNTWSHIFQAQAQGHETDLPISHRPIHSRWFP-NDCAPPINL-PFKHHDEFISRFEAPLM  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVF  S  +IA+LK KAN E  T+ ISS QS  AH+WR++TRA +L   +     L  
Sbjct  242   RERVFQFSAESIAKLKAKANMESNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTA  301

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R RM   LP+ Y+GN+V  ++     G++L   LGW AW++   V  H+++  ++ + 
Sbjct  302   NSRTRMEPPLPQEYFGNSVNRVSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSL-  360

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              ++++SP             + ISSSPRF++YG +FG GK V  RSG  NK DGKVT + 
Sbjct  361   KEWLQSPLIYQIGQAMDPYVVLISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYP  420

Query  1321  GCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             G E  GS+D+E+ + PH +  LE+D EF+   ++
Sbjct  421   GREGGGSIDLEVGLLPHIMSALESDREFMNAVSV  454



>ref|XP_010558666.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Tarenaya 
hassleriana]
Length=466

 Score =   307 bits (787),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 264/458 (58%), Gaps = 32/458 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   V      RS  V  ++ LTPWDL FL+    Q+GLLF  P P        +++I 
Sbjct  25    ISTSIVRPENNDRSGRV--KIHLTPWDLFFLRAEYPQRGLLFPKPDP-------ETDIIS  75

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
              LK SLS+ L+ F PLAGR   V NE DNT S Y+DC+ +G +FV A A  V+V  +L+ 
Sbjct  76    PLKASLSAALEIFYPLAGRLVKVENE-DNTESFYIDCDGSGAKFVHAVAKTVSVGDVLEP  134

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
             ++  VP ++R  F  NG  + +G+ + L+ VQ+TE+ DG FI    NH + DG+SFW FF
Sbjct  135   ADGLVPDLIRHFFPANGTRSYEGVSESLLAVQVTEMEDGVFIGFGYNHMVADGSSFWKFF  194

Query  631   NSWAELS-RGF---HQPSTTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQ----RAF  783
             N+W+E+  +G    H+ S  PI  + WF D     P+H+P     SE  PP +       
Sbjct  195   NTWSEICLKGLHSDHRKSLPPILLKGWFLDGIDP-PIHIP----ISETKPPTRGISSSPT  249

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSI--ISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
             L E+VF  +K NI++LK KAN+E+G++   ISSLQ+   H+WR++ R   L+ +++V   
Sbjct  250   LQEKVFRFTKENISQLKAKANNEIGSNAEKISSLQAISGHMWRSIIRNSGLNRDQEVQCN  309

Query  958   LGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EE  1125
             L   MR R+  P     +GN V F T     G+++   L W A QI K V   ++E    
Sbjct  310   LLANMRQRLNPPLETECFGNVVCFGTTRTTVGELMDHDLCWAALQINKMVGSITNENLRN  369

Query  1126  VRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGK  1305
               + ++K VE P   G  IP  SN L ++SSPRF+VYG DFGWGKP+ VR+G GN  DGK
Sbjct  370   FAEKWVKNVEFPNIGGGGIP--SNPLLVASSPRFNVYGNDFGWGKPISVRAGPGNTSDGK  427

Query  1306  VTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
               ++ G +E S+DI+L +  + L  L  DAEFLE  T+
Sbjct  428   AIVYPGTQEASIDIQLCLSSNVLAKLLTDAEFLESVTV  465



>ref|XP_006659753.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Oryza 
brachyantha]
Length=465

 Score =   307 bits (787),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 256/444 (58%), Gaps = 44/444 (10%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+ + +  IQKG+L   P           + + HL +S +  L  F PLAGR 
Sbjct  36    MHLTPWDLRMMAVECIQKGVLLPRPP------AGGQHHVEHLASSFARALARFYPLAGRL  89

Query  331   AT----------VMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILR  480
             A             + E  + S+ + CN+ G EFV A A GVTVA I   +++ VP+++ 
Sbjct  90    AVEEIDDDDGGGGASRELRSISISLCCNDKGAEFVHAVAPGVTVADI--TASVYVPRVVW  147

Query  481   SLFTLNGILNRDGI--CKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR  654
             S F LNG++       C+P++  Q+TEL DG F+A +L+H + DG +FW+ F +W+E+SR
Sbjct  148   SFFPLNGMVGAAAAVDCRPVLAAQVTELADGVFVAMSLSHGVADGGTFWHLFRTWSEMSR  207

Query  655   GFHQPSTTPIHERWFPDNTTTCPVHLP-------PMIESSERLPPPQRAFLAERVFHLSK  813
             G    + +P+ ERWF D   +CPV +P        MI  +E  PP Q  F     FH + 
Sbjct  208   GCELSTPSPVLERWFVD---SCPVPIPLPFATPEDMIRQAE-YPPVQECF-----FHFTA  258

Query  814   VNIARLKEKANSEM---GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
              ++ +LK KAN EM    T+ ISSLQS +AHLWRAV RAR L   ++    L +G RAR+
Sbjct  259   ESVKKLKAKANDEMAGEATATISSLQSLLAHLWRAVCRARRLSPEQETRYALPVGCRARV  318

Query  985   -GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
              GL +GY GNAV  +     AG+V+ KGLGW AW + + V     E  VR     + E P
Sbjct  319   KGLAQGYLGNAVAPVAAKAAAGEVMDKGLGWTAWLLNRAV-ASVDEASVRGTLAAWPEKP  377

Query  1162  AH-NGAEI-PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-E  1332
             +    A++   +   +G S+SPRFDVYG DFGWG+PV VRSGGGNKLDGK+T++ G +  
Sbjct  378   SFLRMADLQKQAGGGMGTSNSPRFDVYGNDFGWGRPVGVRSGGGNKLDGKMTVYEGRDGG  437

Query  1333  GSVDIELSIHPHTLLGLENDAEFL  1404
             GS+ +E+ + P  L  L  D EF+
Sbjct  438   GSMALEVCLAPEALARLVADEEFM  461



>ref|XP_007136701.1| hypothetical protein PHAVU_009G066600g [Phaseolus vulgaris]
 gb|ESW08695.1| hypothetical protein PHAVU_009G066600g [Phaseolus vulgaris]
Length=465

 Score =   307 bits (786),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 186/456 (41%), Positives = 263/456 (58%), Gaps = 22/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CFV      R   VS ++  LTPWD+  L    IQKGLLF  P+    Q  F   L+
Sbjct  9     ISECFVKPH---RPTQVSNQICNLTPWDIAMLCAHYIQKGLLFKKPSTLVHQHHFIDKLL  65

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
              +L+ SLS TL  F PLAGR  T   ++  + +V++DC N+ G  F+ A    +T++ IL
Sbjct  66    ENLRHSLSLTLSDFYPLAGRLVTRKTQDPPSYAVFIDCENSDGARFIYATLD-ITISHIL  124

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S I+VP IL S F  +  +N DG   PL+ +Q+TEL+DG FI C++NH++ DGTS+WN
Sbjct  125   --SPIDVPPILHSFFDHHKAVNHDGHTMPLLSIQVTELVDGVFIGCSMNHAIADGTSYWN  182

Query  625   FFNSWAELSRGFHQP---------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             FFN+W+ + +   Q          S   IH RWFP N  + P++L P     E +   + 
Sbjct  183   FFNTWSRIFQAHVQAQGHEYEVSTSHQLIHNRWFP-NDCSPPINL-PFKHHDEFITRFEA  240

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
              FL ERVFH S  +IA+LK KANSE  T+ ISS QS  A +WR +TRAR+   ++     
Sbjct  241   PFLRERVFHFSADSIAKLKAKANSECNTTKISSFQSLSALVWRCITRARSPRYDQRTSCK  300

Query  958   LGIGMRARMG-LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
             L    R+RM  LPE Y+GN++  ++     G++L  GLGW AW++  TV  H+ E  V +
Sbjct  301   LATNNRSRMEPLPEEYFGNSIHLVSAETTTGELLENGLGWAAWKLHLTVANHN-ETVVLQ  359

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                ++++SP             + + SSPRF+VYG +FG GK V  RSG  NK DGKVT 
Sbjct  360   FLKEWLQSPLIYELGRFFDPYCVSMGSSPRFNVYGNEFGMGKAVAARSGYANKFDGKVTS  419

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + G E  GS+D+E+ + P  +  LE+D EF+   +I
Sbjct  420   YPGREGGGSIDLEVCLSPDNMSMLESDEEFMNATSI  455



>ref|XP_006385480.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
 gb|ERP63277.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
Length=348

 Score =   303 bits (776),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 213/326 (65%), Gaps = 17/326 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             R+ELT  DL+ L +  IQKGLLF  P          ++LI HLKTSLS TLD F PLAGR
Sbjct  23    RIELTQCDLKLLLVDAIQKGLLFLKPK----SLEDQNSLIQHLKTSLSRTLDCFNPLAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V   +DNT S ++DCNNAG +FV A A GVT+A IL    + VP IL S F LNG L
Sbjct  79    LAAV-EHDDNTVSFFIDCNNAGAQFVHAAADGVTMADILQP--VYVPPILHSFFPLNGFL  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             N + + KPL+ VQ+TEL+DG F+ CT+NHS  DGTSFWNFFNSW+E+ RG    S TP+ 
Sbjct  136   NYEAVSKPLLAVQVTELVDGIFVGCTMNHSAVDGTSFWNFFNSWSEIHRGLDHVSKTPVL  195

Query  688   ERW-FPDNTTTCPVHLPPMI---ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             ERW   + + + P+ LP  I    S   +P P    L ERVFH +K  IA LK KAN+E 
Sbjct  196   ERWSLLNGSISPPIRLPLSIIKNNSDSIIPSP----LQERVFHFTKGKIAMLKAKANAEA  251

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T+ ISSLQS +AH+WRA TRAR +  +++V L + IG+RAR+   LP+ Y GNA+    
Sbjct  252   ATTSISSLQSLLAHIWRATTRARLVEHDKEVDLRIFIGLRARLQPPLPQSYCGNAIVSGI  311

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEK  1107
              +++  D+L +GLG+VA +I K++ K
Sbjct  312   VTLRTRDILEQGLGFVALEINKSIYK  337



>ref|XP_003605002.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87199.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=436

 Score =   306 bits (783),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 179/429 (42%), Positives = 254/429 (59%), Gaps = 22/429 (5%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             ++ ++LTPWDL+FL      KGLL+H+P          +N I  L+ SLSS L FF PL+
Sbjct  19    NQTIDLTPWDLRFLLGTTNPKGLLYHHPV--------EANQIQRLRHSLSSALAFFQPLS  70

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             GR   +    DNT S  V CNNAGV F+ A A    VA IL+ +   VP I+ S F L G
Sbjct  71    GRLK-ITEHNDNTVSCSVICNNAGVLFIHAAAENTCVADILEPTY--VPPIVDSFFALTG  127

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG--FHQPST  675
             + + +G  KPL+ VQ+TEL+DG FI C+ NH + DG S W+F NSWAE+SR    HQ S 
Sbjct  128   VESYEGTSKPLLAVQVTELVDGIFIGCSFNHVVVDGESVWHFINSWAEISRSCCHHQISK  187

Query  676   TPIHERWFPDNTTTCPVHLPPMI--ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANS  849
              P  ERWFP N    P+  P +   E S      ++  L+ R+FH +K  I +LK K N 
Sbjct  188   PPTLERWFP-NGVQQPIRFPFVYGDELSFSSSNEEKLCLSNRIFHFTKEKIVQLKSKIND  246

Query  850   EMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVFF  1023
             E+GT  ISSLQ  + HLW +V R+      E+V  I+ IG+R R+   LPE Y+GNA+  
Sbjct  247   EIGTIKISSLQVLLTHLWCSVMRSIKFDPQEEVFNIVVIGVRPRLVPPLPEYYFGNALIS  306

Query  1024  ITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
                 +K G+++ + GL   A ++ K +  H+ +E+++  Y  ++ +P+       + +N 
Sbjct  307   CMVKMKVGELVEEGGLCKGACEMNKLIVSHT-DEKLKNHYESWLRNPSFARYPNMAKNNF  365

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
             + ISSSP FDVYG DFGWGKPV VRS  G K +G +T+F G EEGS+D+++ +    L  
Sbjct  366   IAISSSPWFDVYGNDFGWGKPVAVRS--GYKGNGLITVFAGIEEGSIDLQVCLSHEILEA  423

Query  1381  LENDAEFLE  1407
             + ND +F++
Sbjct  424   MGNDPQFMD  432



>ref|XP_003603061.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=448

 Score =   306 bits (784),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 264/448 (59%), Gaps = 23/448 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+        +  ++   LT WD+    +  IQKGLLF  P  QQ       NL+ 
Sbjct  9     VSECFIKPLHPIPES--NQNCYLTTWDIAMSSMNYIQKGLLFKKPNNQQHFI---HNLLE  63

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVAAIL  444
              LK SLS  L  F PL+GR  T  +++  T +++VDC  NN+G  F+ A     TV+ I+
Sbjct  64    KLKHSLSLALFHFYPLSGRLVTQKSQDPPTYNIFVDCSNNNSGARFIHATLDA-TVSDIM  122

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               + I+VP +++SLF LN  +N DG   PL+ +Q+TEL+DG FI C++NH +GDGTS+WN
Sbjct  123   --TPIDVPSVVKSLFDLNKAINHDGHTMPLLSIQVTELVDGVFIGCSMNHYIGDGTSYWN  180

Query  625   FFNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLA  789
             FFN+W+E+ +G       S  P H RWFP+      ++LP     E   R  PP+   L 
Sbjct  181   FFNTWSEIFQGQGHDVRISRQPSHIRWFPEGYGPL-INLPFKHHDEIITRYEPPK---LR  236

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER FH +  +IA+LK KAN E  T+ ISS QS  AH+WR +TRAR+L +++    +L + 
Sbjct  237   ERFFHFTAESIAKLKAKANMESNTNKISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVN  296

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
              R RM   LP+ Y+G +V  ++     G++L   LGW AW++   V  H  + E+RKM  
Sbjct  297   NRPRMKPPLPKEYFGTSVDTVSVKTTVGELLENDLGWAAWKVHSAVANHV-DLEIRKMVK  355

Query  1144  KFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG  1323
             K++ESP     +    + ++ + SSPRF++YG +FG GKPV V SG  NK DG VT + G
Sbjct  356   KWLESPMILSLKHHFDAGSVAMISSPRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEG  415

Query  1324  CE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              E  GS+D+E+S+ P+ +  LE D  F+
Sbjct  416   HEGGGSMDLEISLSPNVMRALELDQNFM  443



>gb|AES73312.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=449

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 264/448 (59%), Gaps = 23/448 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+        +  ++   LT WD+    +  IQKGLLF  P  QQ       NL+ 
Sbjct  10    VSECFIKPLHPIPES--NQNCYLTTWDIAMSSMNYIQKGLLFKKPNNQQHFI---HNLLE  64

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVAAIL  444
              LK SLS  L  F PL+GR  T  +++  T +++VDC  NN+G  F+ A     TV+ I+
Sbjct  65    KLKHSLSLALFHFYPLSGRLVTQKSQDPPTYNIFVDCSNNNSGARFIHATLDA-TVSDIM  123

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               + I+VP +++SLF LN  +N DG   PL+ +Q+TEL+DG FI C++NH +GDGTS+WN
Sbjct  124   --TPIDVPSVVKSLFDLNKAINHDGHTMPLLSIQVTELVDGVFIGCSMNHYIGDGTSYWN  181

Query  625   FFNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLA  789
             FFN+W+E+ +G       S  P H RWFP+      ++LP     E   R  PP+   L 
Sbjct  182   FFNTWSEIFQGQGHDVRISRQPSHIRWFPEGYGPL-INLPFKHHDEIITRYEPPK---LR  237

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER FH +  +IA+LK KAN E  T+ ISS QS  AH+WR +TRAR+L +++    +L + 
Sbjct  238   ERFFHFTAESIAKLKAKANMESNTNKISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVN  297

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
              R RM   LP+ Y+G +V  ++     G++L   LGW AW++   V  H  + E+RKM  
Sbjct  298   NRPRMKPPLPKEYFGTSVDTVSVKTTVGELLENDLGWAAWKVHSAVANHV-DLEIRKMVK  356

Query  1144  KFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG  1323
             K++ESP     +    + ++ + SSPRF++YG +FG GKPV V SG  NK DG VT + G
Sbjct  357   KWLESPMILSLKHHFDAGSVAMISSPRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEG  416

Query  1324  CE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              E  GS+D+E+S+ P+ +  LE D  F+
Sbjct  417   HEGGGSMDLEISLSPNVMRALELDQNFM  444



>ref|XP_003605008.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87205.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/433 (42%), Positives = 259/433 (60%), Gaps = 29/433 (7%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL++L +   +KGLL+ +P          +N I  L+ SLSS L FF PLAGR 
Sbjct  22    IHLTPWDLRYLLVLTNKKGLLYRHPVV--------ANQIQRLRHSLSSALAFFQPLAGRL  73

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
               +    DNT S  V CNNAGV FV A A    VA IL+ +   VP I+  LF L+ + +
Sbjct  74    K-ITEHRDNTVSCSVICNNAGVLFVHAAAENTCVADILEPTY--VPPIVDLLFALSEVRS  130

Query  511   RDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG--FHQPSTTPI  684
              +G  KPL+ VQ+TEL+DG FI C+ NH + DG S W+F NSWAE+SR    HQ S  P 
Sbjct  131   YEGTSKPLLAVQVTELVDGIFIGCSFNHVVVDGKSVWHFINSWAEISRSCCHHQISKPPT  190

Query  685   HERWFPDNTTTCPVHLPPMIES----SERLP----PPQRAFLAERVFHLSKVNIARLKEK  840
              ERWFP N    P+  P  +E     S+RL       ++  L+ R+FH +K  I +LK K
Sbjct  191   LERWFP-NGVQRPIRFPFTLEQQNDHSDRLSFSSFNEEKYCLSNRLFHFTKEKILQLKSK  249

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNA  1014
              N E+GT+ ISSLQ+ + H+W  VTR +     E+V   + IG+R R+   LPE Y+GNA
Sbjct  250   INEEIGTTKISSLQALLTHVWCYVTRFKQFDPQEEVFNRVVIGVRPRLVPPLPEDYFGNA  309

Query  1015  VFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA-HNGAEIPS  1188
             +      +KAG++L + GL   A ++ K +  H+ +E+++  Y  ++ +P+    A+   
Sbjct  310   LISCMVKMKAGELLEEGGLCKGALEMNKLIASHT-DEKLKNHYESWLRNPSFFRLAKNMV  368

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
              +N + ISSSP FDVYG DFGWGKP+ VRS  G K++G +T+F G EEGS+D+++ +   
Sbjct  369   KNNFISISSSPWFDVYGNDFGWGKPLAVRS--GYKINGLITVFAGIEEGSIDLQVCLPRE  426

Query  1369  TLLGLENDAEFLE  1407
              L G+ ND  F++
Sbjct  427   ILEGMGNDPNFMD  439



>emb|CDP11973.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 266/451 (59%), Gaps = 18/451 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+            + + L+ WDL       IQKGLLF  P P   ++    +L+ 
Sbjct  9     ISQCFIKPKNTPEE--AKQPIYLSQWDLAMACANYIQKGLLFAKP-PAFDRENQMEDLLE  65

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SL+  LD F PLAGR AT+  E     S+YVDCNN+ G  FV A  +  T+  IL 
Sbjct  66    KLKDSLALALDHFYPLAGRLATLKQENPPIYSIYVDCNNSPGARFVHASLNS-TIDDIL-  123

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++VP+I++S F  +  +N DG  +PL+ +Q+TEL+DG F+ C+ NH + DGTS+W+F
Sbjct  124   -SPVDVPKIVQSFFDHDRAINHDGHTRPLLTIQVTELIDGIFMGCSANHMIVDGTSYWHF  182

Query  628   FNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERV  798
             FN+W+E+     Q    S  PIH+RWF +     P+   P     + +   +   + ERV
Sbjct  183   FNTWSEIFNAKGQKIAISRPPIHKRWFLEGHG--PILSLPFTHHDQFVRRHEAPQMRERV  240

Query  799   FHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRA  978
             FH S  ++A+LK KAN+E  T+ ISSLQ+  AH+WR +TR RNL  +++   ++ I  R 
Sbjct  241   FHFSSESLAKLKAKANAESDTTKISSLQALAAHVWRCITRTRNLPPDQETSCMMAINNRT  300

Query  979   RMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+   +P+ Y GN +  +  +  AG++L +GLGW + ++   V  H+ +E VR     ++
Sbjct  301   RLCPPVPQEYVGNCIQAVRATAAAGELLDRGLGWSSSKLHLAVHNHT-DEIVRNWVESWL  359

Query  1153  ESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             +SP  +  AE     + L + SSPRF++YG++FG GK V +RSG  NK DGKV+ F G E
Sbjct  360   QSPVIYQAAEFIDPCSVL-MGSSPRFNMYGSEFGLGKAVAIRSGYANKFDGKVSSFPGVE  418

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
               GS+D+E+ + PH++  LE+D EF+   T+
Sbjct  419   GGGSMDLEICLRPHSMSLLESDEEFMGAVTV  449



>ref|XP_010924632.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=449

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 251/429 (59%), Gaps = 27/429 (6%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             R + LTPW+L+ L +  IQKG+L   P TP          +I  L +SLS  LD F PLA
Sbjct  37    RLIHLTPWELRLLSVDYIQKGILLPKPPTP----------VIPRLISSLSLVLDHFYPLA  86

Query  322   GRFATVMNEEDN-TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             GR AT+ ++    + SV ++CN+ G + + A A+ +T A IL    I  P I++S F LN
Sbjct  87    GRLATINHDTTPPSLSVAIECNDEGAQLIHAAATDITTADILTPRFI--PGIIKSFFPLN  144

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR-GFHQPST  675
             G +N DG   PL+ VQ+TEL+DG F+ C LNH + DGTSFW+F NSW+E+SR G  Q S 
Sbjct  145   GAINHDGHSLPLLAVQVTELVDGVFVGCALNHVVADGTSFWHFLNSWSEISRTGVPQISR  204

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
              PI  RWF ++ +  P+HL P+ +  + +     + L+E  F      IA+LK +AN EM
Sbjct  205   PPILNRWFHESCSP-PIHL-PVYKREDFIKIYPSSQLSEAFFRFPAQTIAKLKLRANMEM  262

Query  856   GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFIT  1029
              T  ISSLQ+ +A +WR+V RA+ L  +E     + +  R R+   LP GY+GN V  + 
Sbjct  263   STDRISSLQALLAFVWRSVLRAQKLPPSEKTTYRIAVNYRPRLDPPLPGGYFGNTVMGVP  322

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLG-  1206
              +  AG+VL +GLGW A  + + V   S+      M   ++ES   N   +      +G 
Sbjct  323   TTASAGEVLDRGLGWAASLLNQMVGSQSN-----NMIRNWLESWTRNPIFLYFKETRVGT  377

Query  1207  --ISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
                 SSPRFDVYG DFGWG+P+ VRSGG NK+DG +++F G EEGS+ +++ +    +  
Sbjct  378   VVTGSSPRFDVYGNDFGWGRPIAVRSGGSNKVDGTISVFPGSEEGSMALDVCLSSQAMSV  437

Query  1381  LENDAEFLE  1407
             L  D EF+E
Sbjct  438   LLEDKEFME  446



>ref|XP_009115699.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Brassica rapa]
Length=450

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/436 (39%), Positives = 256/436 (59%), Gaps = 26/436 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  LQ+   Q+GLLF  P         + +LI  LK+SLS+ L+ + P AGR
Sbjct  25    KIHLTPFDLSLLQVDCPQRGLLFPQPD-------QDFHLISRLKSSLSAALEIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V N EDNT S ++DC+ +G  F+ A+A  ++V+ IL Q +  VP  ++  F  +G+ 
Sbjct  78    LAKVENLEDNTVSFHIDCDGSGARFLHAEAKSLSVSDIL-QPHGEVPDFIKHFFPADGLK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP-I  684
             N DG+ +PL+ VQ+TE+ DG F+    NH + DG S WNF ++W+ +          P +
Sbjct  137   NSDGLTEPLLAVQVTEMKDGVFLGYYYNHMVADGVSMWNFLHTWSMICSSGSSSGQQPLV  196

Query  685   HERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA-----ERVFHLSKVNIARLKEKANS  849
              +RWF +  +  P+H+P  +  +E+ PPP R   +     +RVFHL+K NI+ LK KANS
Sbjct  197   LKRWFLEGVSY-PIHIP--VSEAEKPPPPSRELSSVPVTQDRVFHLTKKNISDLKAKANS  253

Query  850   EMGTSI--ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAV  1017
             ++G+S   ISSLQ+  AH+WR++ R   L    + H  + + +R R+  P  +  +GN V
Sbjct  254   QVGSSDKNISSLQAVSAHMWRSIIRHSGLTGEGETHCKVVVDLRQRVNPPLEKDCFGNMV  313

Query  1018  FFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN---GAEIPS  1188
             +    +    ++LG+GLGW A QI K V   ++E    K + +   S   N   G     
Sbjct  314   YITPATTTVEELLGRGLGWAALQISKLVSSQTNEN--CKAFAEDWVSNVRNLKTGVGSRM  371

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
             + +T+ +SSSPRFDVY  DFGWGKPV VR+G GN + GK+ LF G +EGS DI+ ++   
Sbjct  372   AGDTVLVSSSPRFDVYRNDFGWGKPVAVRAGPGNSISGKLVLFPGIDEGSFDIQATLWCD  431

Query  1369  TLLGLENDAEFLEYFT  1416
              L+ L  D EFLE+ T
Sbjct  432   VLVSLLADVEFLEHVT  447



>ref|XP_010110811.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28183.1| putative acetyltransferase [Morus notabilis]
Length=455

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 183/447 (41%), Positives = 262/447 (59%), Gaps = 16/447 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+        +     + LTPWDL  L +  IQKGLLF  P    + + F  +L+ 
Sbjct  10    ISECFIKPHYTPEDS--KNHLYLTPWDLAMLSVHYIQKGLLFAKPPHTNKDENFMESLLD  67

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS  L  F PLAGR  TV  E  N+ SV+VDCN++ G +F+ A   G+TV+ IL 
Sbjct  68    RLKQSLSVALVHFYPLAGRLKTVKTENPNSYSVHVDCNDSPGAKFIYATL-GMTVSDIL-  125

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I+VP I++S F  +  +N DG    L+ +Q+TEL+DG FI C++NH + DGTSFWNF
Sbjct  126   -SPIDVPPIVQSFFDHDKAVNHDGHTTSLVTIQVTELVDGVFIGCSMNHIIADGTSFWNF  184

Query  628   FNSWAELSRGFH----QPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             +N W+E+ R       Q S  PI +RWFP+     P+   P    +E +   +   L ER
Sbjct  185   WNMWSEIFRAKDNNDLQISRPPIFKRWFPEGHG--PILSLPYRHPNEFIGSFEAPKLRER  242

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             VFH S  ++A+LK  AN E  TS ISSLQS  A +WR++TR RNL  ++     +    R
Sbjct  243   VFHFSAESLAKLKASANLEYNTSKISSLQSLSALVWRSITRVRNLPPDQVTSCRISANNR  302

Query  976   ARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
             AR+  P  E Y+GNAV+ I     AG++L   LGW AW++ + V  H+ ++ +R +   +
Sbjct  303   ARLDPPISENYFGNAVYIIRGFTTAGELLQHDLGWAAWKLHEAVVNHN-DKSIRGLLDAW  361

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             ++SP           +++ + SSPRF+ YG +FG GK + +RSG  NK DG V  + G E
Sbjct  362   LKSPCVYQLRTLFDPHSVIMGSSPRFNKYGNEFGMGKALALRSGYANKFDGCVYCYPGHE  421

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFLE  1407
               GS+D+E+S+ P T+  LE+D EF+E
Sbjct  422   GGGSIDLEMSLSPETMRALESDEEFME  448



>ref|XP_006360905.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=406

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 175/453 (39%), Positives = 251/453 (55%), Gaps = 64/453 (14%)
 Frame = +1

Query  91    ISKCFVGAAGAARSN-GVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             ++K  V +    RS   + +++ELTPWDLQ                              
Sbjct  1     MTKLEVVSTCVIRSQKSIEKKIELTPWDLQ------------------------------  30

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKA-SGVTVAAIL  444
                       L  +P    +     +++D+T S +VDC+N G EF    A   + VA IL
Sbjct  31    ----------LRSYPKRISK----NSDDDDTLSFFVDCSNEGAEFTHVTAVPDLNVADIL  76

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
             +Q+   VP+I++  F LNG+ N +G+ KPL+ VQ+TEL+DG FI CT+NH + DGTSFW+
Sbjct  77    EQTY--VPKIVKYFFPLNGVRNYEGVSKPLLAVQVTELVDGIFIGCTINHCVADGTSFWH  134

Query  625   FFNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             FFN W+E++R  +     +  P+ +RWFP+   + P+H+       +    P    L ER
Sbjct  135   FFNCWSEITRNSNSKLIVNKPPVLDRWFPEFVAS-PIHVQKHDVHEDEYDVP---LLEER  190

Query  796   VFHLSKVNIARLKEKANSEMGTS-----IISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
             VFH SK NIA LK KANS+ G        ISSLQ+ +AHLW++V R RN   N    L++
Sbjct  191   VFHFSKENIAHLKAKANSKYGNDDQNIICISSLQALLAHLWQSVIRCRNADENFSFKLLI  250

Query  961   GIGMRARMGLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
             G   R +  LP+GY+GNAV F+  +  A ++L    GW A Q+ K V   +H EEV   Y
Sbjct  251   GARPRLQPPLPQGYFGNAVHFVNITTTAREILEHDSGWAALQMNKVVSTQTH-EEVMNFY  309

Query  1141  MKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +V++P     +E+   SN+L  SSSP F+VY +DFGWG+PV VRSG GNK DGK+T+F
Sbjct  310   QSWVKNPKIVKKSEV--VSNSLIASSSPHFNVYDSDFGWGRPVAVRSGAGNKHDGKITIF  367

Query  1318  GGCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
              G E+ S+DI+  + P TL  +  D +F+   T
Sbjct  368   CGAEQASIDIQACLTPQTLHAMGYDTKFMAAVT  400



>ref|XP_008787703.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=445

 Score =   304 bits (778),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 184/458 (40%), Positives = 260/458 (57%), Gaps = 42/458 (9%)
 Frame = +1

Query  91    ISKCFVGAAG----AARSNGVSRR---VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqf  249
             IS C V  +     AAR  G  +R   + LTPWDL+ L I  IQKG+L            
Sbjct  14    ISSCVVRPSSHNKEAAREQGWRQRQRLIHLTPWDLRLLSIDYIQKGIL------------  61

Query  250   fNSNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDN-TCSVYVDCNNAGVEFVEAKASGV  426
                  I  L +SLS  LD F PLAGR  T+ ++    + SV ++CN+ GVEF+ A A  +
Sbjct  62    -----IPGLISSLSLVLDHFYPLAGRLTTINHDTTPPSLSVAIECNDEGVEFIHAAAPSI  116

Query  427   TVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGD  606
             T A IL    I  P I +S F LNG +N DG   PL+ V++TEL DG FI C LNH++ D
Sbjct  117   TTADILTPRFI--PSITQSFFPLNGAINHDGHSLPLLAVRVTELADGIFIGCALNHAVAD  174

Query  607   GTSFWNFFNSWAELSRG---FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             GTSFW+F NSW+E+SR      Q S  P+  RWF D+ +  P+HL P+ +  + +     
Sbjct  175   GTSFWHFLNSWSEISRTGCRVPQISRPPMLNRWFHDSCSP-PIHL-PVYKREDFIKIYPS  232

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
             + L+E  F  S   IA+LK +AN EM T  ISSLQ+ +A +WR+V RA+ L  NE     
Sbjct  233   SQLSEAFFQFSAQTIAKLKLRANMEMNTDRISSLQALLALVWRSVLRAQRLPPNEKTSYR  292

Query  958   LGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVR  1131
             + +  R R+   LP GY+GN +  +  +  AG+VL +GLGW A  + + V   +++    
Sbjct  293   VTVNYRPRLEPPLPGGYFGNTIIGVPTTASAGEVLHRGLGWAASLLNQMVASQTND----  348

Query  1132  KMYMKFVESPAHNGAEI---PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDG  1302
              +   ++ES + N   +    +   T+   SSPRFDV G DFGWG+P+ VRSGG NK+DG
Sbjct  349   -IIQNWLESWSQNPTFLYFKETKVGTIVTGSSPRFDVNGNDFGWGRPIAVRSGGSNKVDG  407

Query  1303  KVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
              +++F G EEGS+ +++ +  H +  L  D EF+E  T
Sbjct  408   TISVFPGSEEGSMALDVCLSSHAMNLLLEDKEFMENVT  445



>ref|XP_003604999.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87196.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=442

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 176/437 (40%), Positives = 253/437 (58%), Gaps = 28/437 (6%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             + + LTPWDL+FL +   +KGLL+H+P          +  I  L+ SLSS L FF PLAG
Sbjct  20    QTIHLTPWDLRFLLVSTNKKGLLYHHPVV--------ATQIQRLRHSLSSALSFFQPLAG  71

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R   +    DN  S  V CNNAGV F+ A A  + VA IL+   + VP I+ S F   G 
Sbjct  72    RLE-ITEHRDNIVSCSVICNNAGVLFIHAVAENIRVADILEP--VYVPLIVDSFFAFIGD  128

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF--HQPSTT  678
              N +G  KPL+ VQITEL+DG FI C+ NH + DG S W+F NSWAE+SRG    Q S  
Sbjct  129   KNYEGTSKPLLAVQITELVDGIFIGCSFNHVVVDGKSVWHFINSWAEISRGCCGDQISKP  188

Query  679   PIHERWFPDNTTTCPVHLPPMIES--------SERLPPPQRAFLAERVFHLSKVNIARLK  834
             P  ERWFP N    P+  P   E         S      ++  L+ R+FH +K  I +LK
Sbjct  189   PTLERWFP-NGIQLPIRFPFTTEQQNNHCDELSFSSSNEEKLCLSNRLFHFTKEKIIQLK  247

Query  835   EKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVH--LILGIGMRARMGLPEGYWG  1008
              K N E+GT  I+SLQ+ + HLW +V R++     E+V+  +++G+G R    LPE Y+G
Sbjct  248   SKINEEVGTIKITSLQALLTHLWCSVVRSKQFDLQEEVYNLVVIGVGPRFVPPLPEDYFG  307

Query  1009  NAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP  1185
             N++      +K G++L + GL   A ++ K +  H+ +E+++  Y  ++ +P+       
Sbjct  308   NSIISCIVKMKVGELLDEGGLYKGACEMNKLIASHT-DEKLKNHYESWLRNPSFVRVASM  366

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
             S++N + ISSSP FDVYG DFGWGKP+ VRS  G K++G V +F G EEGS+D+++ +  
Sbjct  367   SNNNFISISSSPWFDVYGNDFGWGKPIAVRS--GYKINGIVNVFAGIEEGSIDLQVCLPY  424

Query  1366  HTLLGLENDAEFLEYFT  1416
               L  + +D  F++  T
Sbjct  425   KVLEAMGSDPHFMDVVT  441



>ref|NP_201516.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 dbj|BAB10949.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAL36423.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAM51419.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAM61217.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AED98307.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=448

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 173/434 (40%), Positives = 256/434 (59%), Gaps = 22/434 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLLF  P P        +++I  LK+SLS  L  F P AGR
Sbjct  26    KIHLTPWDLFFLRSEYPQRGLLFPQPDP-------ETHIISQLKSSLSVALKIFYPFAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                V NE+  T S YVDC+ +GV+F+ A A  V+V+ +L+  + NVP+ L   F  NG+ 
Sbjct  79    LVKVENEDAGTASFYVDCDGSGVKFIHASAKSVSVSDVLEPVDSNVPEFLNRFFPANGVR  138

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGF---HQPST  675
             + +GI + L+  Q+TEL DG FI    NH + DG+SFW+FFN+W+E+   GF   H+   
Sbjct  139   SCEGISESLIAFQVTELKDGVFIGFGYNHIVADGSSFWSFFNTWSEICFNGFDADHRRKF  198

Query  676   TPIHER-WFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANS  849
              P+  R WF D     P+ +P P  E+  R+     + L E++F ++  NI+ LK KAN 
Sbjct  199   PPLLLRGWFLDGIEY-PIRIPLPETETPNRV-VVTSSLLQEKIFRVTSRNISELKAKANG  256

Query  850   EMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAV  1017
             E+ +    ISSLQ+  A++WR++ R   L+  E +H  L + MR R+  P  +  +GN V
Sbjct  257   EVDSDDRKISSLQAVSAYMWRSIIRNSGLNPEEVIHCKLLVDMRGRLNPPLEKECFGNVV  316

Query  1018  FFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSN  1197
              F T +    ++L  GLGW A QI KTV   ++ EE R+    +V+ P+   A+  + SN
Sbjct  317   GFATVTTTVAEMLHNGLGWAALQINKTVGSQTN-EEFREFAENWVKKPSILNAK--AFSN  373

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
             ++ I+SSPRF+VYG DFGWGKP+ VR+G GN  DGK+  + G EEG+++ +  +    L 
Sbjct  374   SITIASSPRFNVYGNDFGWGKPIAVRAGPGNTTDGKLIAYPGIEEGNIEFQTCLSSSVLE  433

Query  1378  GLENDAEFLEYFTI  1419
              L  D EFL++  +
Sbjct  434   KLSTDEEFLKHVCV  447



>ref|XP_003523954.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47844.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=460

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 267/455 (59%), Gaps = 21/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CFV   G  +   VS ++  LT WD+  L +  IQKGLLF  PTP   Q  F  NL+
Sbjct  10    ISECFVKPHGLTQ---VSNQICHLTQWDIVMLSMHYIQKGLLFKKPTPLVDQHDFIENLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PLAGRF T   ++  + +V VD  N+ G  F+ A    +T++ IL
Sbjct  67    EKLKHSLSLTLSHFYPLAGRFVTHKTQDPPSYAVSVDSKNSDGARFIYATLD-MTISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP +++SLF  +  +N DG   PL+ +Q+TEL+DG F+ C++NH++GDGTS+WN
Sbjct  126   --SPVDVPLVVQSLFDHHKAVNHDGHSMPLLSIQVTELVDGVFLGCSMNHAVGDGTSYWN  183

Query  625   FFNSWAEL----SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FFN+W+++    ++G       S  PI  RWFP N    P++L P     E +   +   
Sbjct  184   FFNTWSQIFQSQAKGHETDVPISHQPILSRWFP-NDCAPPINL-PFKHHDEFISRFEAPL  241

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             + ERVFH S  +IA+LK KAN E  T+ ISS QS  A +WR++TRA +L   +     L 
Sbjct  242   MRERVFHFSAESIAKLKAKANMESDTTKISSFQSLSALVWRSITRACSLPYEQRTSCRLT  301

Query  964   IGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R RM   LP+ Y+GN+V  ++     G++L   LGW AW++   V  H+ +  V + 
Sbjct  302   ANNRTRMEPPLPQEYFGNSVSRVSAETTVGELLENNLGWAAWKLHLAVTNHN-DRVVLQS  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               ++++SP       P     + ISSSPRF++YG +FG GK V VRSG  NK DGKVT +
Sbjct  361   LKEWLQSPLIYQLGQPMDPYVVLISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GS+D+E+ + PH +  LE+D EF+   ++
Sbjct  421   PGREGGGSIDLEVGLLPHIMSALESDEEFMNVVSV  455



>emb|CDP11972.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 262/451 (58%), Gaps = 17/451 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+            + + L+ WDL  + +  IQKGLLF  P P   ++    +L+ 
Sbjct  9     ISQCFIKPKNTPEE--AKQPIYLSQWDLAMVCVNYIQKGLLFAKP-PAFDRENQMEDLLE  65

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SL+  LD F PLAGR AT+  E     S+YVDCNN+ G   V A  +  T+  IL 
Sbjct  66    KLKDSLALALDHFYPLAGRLATLKQENPAIYSIYVDCNNSPGASLVHASLNS-TIDDIL-  123

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I+VP+I++S F  +  +N DG  +PL+ +Q+TEL DG FI C++NH + DGT+FW+F
Sbjct  124   -SPIDVPEIVQSFFDHDRAINHDGHTRPLLTIQVTELTDGIFIGCSINHMIVDGTAFWHF  182

Query  628   FNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERV  798
             FN+W+E+     Q    S  PIH+ WFP+     P+   P     + +   +   + ERV
Sbjct  183   FNTWSEIFSAKGQKTAISRPPIHKHWFPEGHG--PILSLPFTHHDQFVRRHEAPQMRERV  240

Query  799   FHLSKVNIARLKEKANSEMG-TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             FH S  ++A+LK KAN+E   T+ ISSLQ+  AH+WR +TR RN   +++    L I  R
Sbjct  241   FHFSSESLAKLKAKANAESSHTTKISSLQALSAHVWRCITRTRNFSPDQETSCRLAINNR  300

Query  976   ARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
              R+   +P+ Y GN +  +  +  AG++L +GLGW AW++   V  H+ +E VR     +
Sbjct  301   TRLHPPVPQEYVGNCIQTVRAAAAAGELLDRGLGWSAWKLHLAVHNHT-DEIVRDWVESW  359

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             ++S             ++ + SSPRF++YG +FG GK V +RSG  NK DGKV+L+ G E
Sbjct  360   LQSRFIYQLAQFFDPCSIMMGSSPRFNMYGNEFGLGKAVAIRSGYANKFDGKVSLYPGIE  419

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
               GS+D+E+ + PH +  LE+D EF+E  T+
Sbjct  420   GGGSMDLEICLLPHYMSLLESDEEFMETVTL  450



>gb|KHN04489.1| Putative acetyltransferase, partial [Glycine soja]
Length=481

 Score =   303 bits (775),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 266/455 (58%), Gaps = 21/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CFV   G  +   VS ++  LT WD+  L +  IQKGLLF  PTP   Q  F  NL+
Sbjct  31    ISECFVKPHGLTQ---VSNQICHLTQWDIVMLSMHYIQKGLLFKKPTPLVDQHDFIENLL  87

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PLAGRF T   ++  + +V VD  N+ G  F+ A    +T++ IL
Sbjct  88    EKLKHSLSLTLSHFYPLAGRFVTHKTQDPPSYAVSVDSKNSDGARFIYATLD-MTISDIL  146

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP +++SLF  +  +N DG   PL+ +Q+TEL+DG F+ C++NH++GDGTS+WN
Sbjct  147   --SPVDVPLVVQSLFDHHKAVNHDGHSMPLLSIQVTELVDGVFLGCSMNHAVGDGTSYWN  204

Query  625   FFNSWAEL----SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FFN+W+++    ++G       S  PI  RWFP N    P++L P     E +   +   
Sbjct  205   FFNTWSQIFQSQAKGHETDVPISHQPILSRWFP-NDCAPPINL-PFKHHDEFISRFEAPL  262

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             + ERVFH S  +IA+LK KAN E  T+ ISS QS  A +WR +TRA +L   +     L 
Sbjct  263   MRERVFHFSAESIAKLKAKANMESDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLT  322

Query  964   IGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R RM   LP+ Y+GN+V  ++     G++L   LGW AW++   V  H+ +  V + 
Sbjct  323   ANNRTRMEPPLPQEYFGNSVSRVSAETTVGELLENNLGWAAWKLHLAVTNHN-DRVVLQS  381

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               ++++SP       P     + ISSSPRF++YG +FG GK V VRSG  NK DGKVT +
Sbjct  382   LKEWLQSPLIYQLGQPMDPYVVLISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSY  441

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GS+D+E+ + PH +  LE+D EF+   ++
Sbjct  442   PGREGGGSIDLEVGLLPHIMSALESDEEFMNVVSV  476



>ref|XP_007149064.1| hypothetical protein PHAVU_005G037900g [Phaseolus vulgaris]
 gb|ESW21058.1| hypothetical protein PHAVU_005G037900g [Phaseolus vulgaris]
Length=464

 Score =   302 bits (773),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 186/454 (41%), Positives = 266/454 (59%), Gaps = 20/454 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV       +N  ++   LTPWD+  L +  IQKGLLF  P   + QQ F  NL+ 
Sbjct  9     ISECFVKPHPC--NNFPNQIYNLTPWDIAMLSVSYIQKGLLFSKPATLENQQHFMENLLE  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PL+GR  T   +   + +V VDC+N+ G  F+ A A   T++ +L 
Sbjct  67    KLKHSLSLTLSHFYPLSGRLVTHKTQHPPSYTVSVDCSNSDGARFIHA-ALDATISDLL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++ P I  S F  +  LN DG   PL+ +Q+TELLDG FI C++NHS+ DGTSFWNF
Sbjct  125   -SPLDTPSIFHSFFDHHKALNHDGHTMPLLSIQVTELLDGVFIGCSMNHSIADGTSFWNF  183

Query  628   FNSWAELSRGFHQPST----TPI-HE--RWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FN+W+++ +   Q  +     PI H+  R FP+N+   P+ L P     E +   +   L
Sbjct  184   FNTWSQIFQAQSQAESHEHDAPISHQPLRLFPNNSGP-PISL-PFKHHDEFIKRFEAPLL  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFH S  +IA+LK KANSE  T+ ISS QS  A +WR++TRAR+  S +     L  
Sbjct  242   RERVFHFSAESIAKLKAKANSEANTTRISSFQSLSAFVWRSITRARSPPSEQKTSCRLMA  301

Query  967   GMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              +R+RM  P  E Y+GN +  +      G++L  GLGW AW++   V   +  E V +  
Sbjct  302   NIRSRMEPPLAEEYFGNCIHVLRAETTTGELLENGLGWAAWKLHVAVTNLN--EVVLEFL  359

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
              +++ESP        S S ++  +SSPRF++YG++FG GK V VRSG  NK DGK+T + 
Sbjct  360   ERWLESPLIIQTGRFSDSCSVLTASSPRFNMYGSEFGMGKAVAVRSGCANKFDGKLTSYA  419

Query  1321  GCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             G E  GS+D+E+ + PHT+  LE+D +F+   ++
Sbjct  420   GREGGGSIDLEVCLLPHTMSALESDKDFMNAVSV  453



>gb|ABC47861.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=436

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 176/437 (40%), Positives = 255/437 (58%), Gaps = 17/437 (4%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             ++   LT WD+  L +  IQKGLLF  PTP   +  F  NL+  LK SLS TL  F PLA
Sbjct  3     NQTCHLTHWDIAMLSMHYIQKGLLFKKPTPLVDRHDFIGNLLGKLKHSLSLTLSHFYPLA  62

Query  322   GRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             GR  T   +   + +V VDC N+ G  F+ A    +T++ IL  S +++P +++SLF  +
Sbjct  63    GRLVTHQTQNPPSYTVSVDCKNSDGARFIYATLD-MTISDIL--SPVDIPLVVQSLFDHH  119

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT  678
               LN DG   PL+ +Q+TEL+DG FI C++NHS+GDGTS+WNFFN+W+ + +   Q   T
Sbjct  120   KALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNTWSHIFQAQAQGHET  179

Query  679   -------PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKE  837
                    PIH RWFP N    P++L P     E +   +   + ERVF  S  +IA+LK 
Sbjct  180   DLPISHRPIHSRWFP-NDCAPPINL-PFKHHDEFISRFEAPLMRERVFQFSAESIAKLKA  237

Query  838   KANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGN  1011
             KAN E  T+ ISS QS  AH+WR++TRA +L   +     L    R RM   LP+ Y+GN
Sbjct  238   KANMESNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTANSRTRMEPPLPQEYFGN  297

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS  1191
             +V  ++     G++L   LGW AW++   V  H+++  ++ +  ++++SP          
Sbjct  298   SVNRVSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSL-KEWLQSPLIYQIGQAMD  356

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPH  1368
                + ISSSPRF++YG +FG GK V  RSG  NK DGKVT + G E  GS+D+E+ + PH
Sbjct  357   PYVVLISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGSIDLEVGLLPH  416

Query  1369  TLLGLENDAEFLEYFTI  1419
              +  LE+D EF+   ++
Sbjct  417   IMSALESDREFMNAVSV  433



>ref|XP_003622067.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES78285.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=439

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/434 (40%), Positives = 251/434 (58%), Gaps = 31/434 (7%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             + + LTPWDL+ L I   +KGL +H+P          SN I  L+ SLSSTL FF PLAG
Sbjct  20    QTIHLTPWDLRSLLIPTNKKGLFYHHPVV--------SNQIQRLRHSLSSTLAFFQPLAG  71

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R   +   +D T S  V CNNAGV FV A++    VA IL+ +   VP I+ S F L  +
Sbjct  72    RLK-ITEYQDKTVSCSVICNNAGVLFVHARSENTCVADILEPTY--VPPIVDSFFALTDV  128

Query  505   LNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF--HQPSTT  678
              + +G  KPL+ VQ+TEL+DG FI C+ NH++ DG S W+F NSWAE+SR    HQ S  
Sbjct  129   RSYEGTSKPLLAVQVTELIDGIFIGCSFNHAVIDGKSVWHFINSWAEISRSCCHHQISKP  188

Query  679   PIHERWFPDNTTTCPVHLPPMIESSERLP--------PPQRAFLAERVFHLSKVNIARLK  834
             P  ERWFPD     P+  P  +E  +             ++   + R+FH +K  I +LK
Sbjct  189   PTLERWFPDGVQR-PIRFPFTLEQQKNHSDGLSFLSLDDEKLCFSNRIFHFTKEKIVQLK  247

Query  835   EKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDV--HLILGIGMRARMGLPEGYWG  1008
              K N E+GT  ISSLQ+ + HLW  V  ++ +   E+V   +++G+G R    LPE Y+G
Sbjct  248   LKINEEIGTIKISSLQAPLTHLWCCVMCSKKIDPQEEVVNRIVIGVGPRLVPPLPEYYFG  307

Query  1009  NAVFFITESIKAGDVLGK-GLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP  1185
             NAV      + AG++L + GL   A ++ K +  H+ +E+++  Y  ++ +P+ +     
Sbjct  308   NAVISCMVKMTAGELLKEGGLCKGACEMNKLIALHT-DEKLKNHYESWLRNPSFSNM---  363

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
                N + ISSSP FDVYG DFGWGKPV  R  GG K +G +T+F G EEGS+D+++ +  
Sbjct  364   PKKNFIAISSSPWFDVYGNDFGWGKPVAGR--GGYKANGLITVFAGIEEGSIDLQVCLPY  421

Query  1366  HTLLGLENDAEFLE  1407
               L  + ND +F++
Sbjct  422   EILEAMGNDPQFMD  435



>ref|XP_003523950.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47848.1| N-hydroxycinnamoyl/benzoyltransferase 6 [Glycine max]
Length=461

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 262/450 (58%), Gaps = 21/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPT-PqqqqqffNSNL  264
             +S+CF+       SN  S ++  LTPWD+  L    IQKGLLF  P+ P      F  NL
Sbjct  10    VSECFIKPQ---HSNHESNQICYLTPWDIAMLSAHYIQKGLLFKKPSSPLVSHNNFIENL  66

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS TL  F PLAGR  T    +    +V+VDCNN+ G  F+ A    +T++ I
Sbjct  67    LQKLKHSLSLTLFHFYPLAGRLVTHQTHDPPFYAVFVDCNNSDGARFIHATLD-MTISDI  125

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP I++SLF  +  +N DG   PL+ VQ+TE +DG FI C++NH+LGDGTS+W
Sbjct  126   L--SPVDVPPIVQSLFDHHKAVNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYW  183

Query  622   NFFNSWAEL--SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             NFFN+W+++   +G       S  PIH RWFP+     P+   P     + +   +   L
Sbjct  184   NFFNTWSQIFQVQGHEHDVPISHPPIHNRWFPEGCG--PLINLPFKHHDDFINRYETPLL  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ER+FH S  +IA+LK KANSE  T+ ISS QS  A +WR +TRAR L  ++     L  
Sbjct  242   RERIFHFSAESIAKLKAKANSECNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  967   GMRARMG--LPEGYWGNAVFFITE-SIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
               R RM   LP+ Y+GN+++ +   +  +G +L  G+GW AW++ K+V  H+ +  V + 
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHN-DRAVLET  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +++ESP             + + SSPRF++YG +FG GK V +RSG  NK DGKVT +
Sbjct  361   LKEWLESPLIYDLGRYFDPYCVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              G E  GSVD+E+ + P  +  LE+D EF+
Sbjct  421   PGHEGGGSVDLEVCLSPAVMSALESDEEFM  450



>gb|ACU18586.1| unknown [Glycine max]
Length=461

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 262/450 (58%), Gaps = 21/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPT-PqqqqqffNSNL  264
             +S+CF+       SN  S ++  LTPWD+  L    IQKGLLF  P+ P      F  NL
Sbjct  10    VSECFIKPQ---HSNHESNQICYLTPWDIAMLSAHYIQKGLLFKKPSSPLVSHNNFIENL  66

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS TL  F PLAGR  T    +    +V+VDCNN+ G  F+ A    +T++ I
Sbjct  67    LQKLKHSLSLTLFHFYPLAGRLVTHQTHDPPFYAVFVDCNNSDGARFIHATLD-MTISDI  125

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP I++SLF  +  +N DG   PL+ VQ+TE +DG FI C++NH+LGDGTS+W
Sbjct  126   L--SPVDVPPIVQSLFDHHKAVNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYW  183

Query  622   NFFNSWAEL--SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             NFFN+W+++   +G       S  PIH RWFP+     P+   P     + +   +   L
Sbjct  184   NFFNTWSQIFQVQGHEHDVPISHPPIHNRWFPEGCG--PLINLPFKHHDDFINRYETPLL  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ER+FH S  +IA+LK KANSE  T+ ISS QS  A +WR +TRAR L  ++     L  
Sbjct  242   RERIFHFSAESIAKLKAKANSECNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  967   GMRARMG--LPEGYWGNAVFFITE-SIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
               R RM   LP+ Y+GN+++ +   +  +G +L  G+GW AW++ K+V  H+ +  V + 
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHN-DRAVLET  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +++ESP             + + SSPRF++YG +FG GK V +RSG  NK DGKVT +
Sbjct  361   LKEWLESPLIYDLGRYFDLYCVMMGSSPRFNMYGKEFGMGKAVALRSGYANKFDGKVTSY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              G E  GSVD+E+ + P  +  LE+D EF+
Sbjct  421   PGHEGGGSVDLEVCLSPAVMSALESDEEFM  450



>ref|XP_006385479.1| hypothetical protein POPTR_0003s05570g [Populus trichocarpa]
 gb|ERP63276.1| hypothetical protein POPTR_0003s05570g [Populus trichocarpa]
Length=329

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 213/327 (65%), Gaps = 11/327 (3%)
 Frame = +1

Query  457   INVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNS  636
             + VP IL S F LNGI N + + KPL+ VQ+TEL+DG F+ CT+NH+  DG+SFWNFFNS
Sbjct  8     VYVPPILHSFFPLNGISNYEAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGSSFWNFFNS  67

Query  637   WAELSRGFHQPSTTPIHERW-FPDNTTTCPVHLPPMIESSER---LPPPQRAFLAERVFH  804
             W+E+ RG    S TP+ ERW   + + + P+ LP  I  +     +P P    L ERVFH
Sbjct  68    WSEIHRGLDHISKTPVLERWSLLNGSISPPIRLPLSIIKNNLDSFIPSP----LQERVFH  123

Query  805   LSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
              +K  IA LK KAN+E  T+ ISSLQS +AH+WRA TRAR    ++++ L + IG+RAR+
Sbjct  124   FAKGKIAMLKAKANAEAATTSISSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARL  183

Query  985   G--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
                LPE Y GNA+     +++  ++L +GLG+VA +I K V  ++ + +V       +++
Sbjct  184   QPPLPESYCGNAIVPGIVTLRTREILEQGLGFVALEINKVVSSYT-KNKVTDALASLLKN  242

Query  1159  PAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGS  1338
             P+          ++L ISSSPR +VYG DFGWG+PV VRSG GNK DGK+TLF G EEGS
Sbjct  243   PSPLTKADFGRIHSLSISSSPRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGS  302

Query  1339  VDIELSIHPHTLLGLENDAEFLEYFTI  1419
             +D+E S+ P TL  L ND EF++  TI
Sbjct  303   MDVEFSLLPETLKALGNDLEFMDAVTI  329



>gb|KHN04491.1| Putative acetyltransferase [Glycine soja]
Length=461

 Score =   300 bits (767),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 262/450 (58%), Gaps = 21/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPT-PqqqqqffNSNL  264
             +S+CF+       SN  S ++  LTPWD+  L    IQKGLLF  P+ P      F  NL
Sbjct  10    VSECFIKPQ---HSNHESNQICYLTPWDIAMLSAHYIQKGLLFKKPSSPLVSHNNFIENL  66

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS TL  F PLAGR  T    +    +V+VDCNN+ G  F+ A    +T++ I
Sbjct  67    LEKLKHSLSLTLFHFYPLAGRLVTHQTHDPPFYAVFVDCNNSDGARFIHATLD-MTISDI  125

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP I++SLF  +  +N DG   PL+ VQ+TE +DG FI C++NH+LGDGTS+W
Sbjct  126   L--SPVDVPPIVQSLFDHHKAVNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYW  183

Query  622   NFFNSWAEL--SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             NFFN+W+++   +G       S  PIH RWFP+     P+   P     + +   +   L
Sbjct  184   NFFNTWSQIFQVQGHEHDVPISHPPIHNRWFPEGCG--PLINLPFKHHDDFINRYETPLL  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ER+FH S  +IA+LK KANSE  T+ ISS QS  A +WR +TRAR L  ++     L  
Sbjct  242   RERIFHFSAESIAKLKAKANSECNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  967   GMRARMG--LPEGYWGNAVFFITE-SIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
               R RM   LP+ Y+GN+++ +   +  +G +L  G+GW AW++ K+V  H+ +  V + 
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHN-DRAVLET  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +++ESP             + + SSPRF++YG +FG GK V +RSG  NK DGKVT +
Sbjct  361   LKEWLESPLIYDLGRYFDPYCVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              G E  GSVD+E+ + P  +  LE+D EF+
Sbjct  421   PGHEGGGSVDLEVCLSPAVMSALESDEEFM  450



>ref|XP_008452574.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=467

 Score =   299 bits (766),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 179/471 (38%), Positives = 271/471 (58%), Gaps = 32/471 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLF-------HNPTPqqqqqf  249
             IS+CFV      + + +     L P DL  L    IQKGLLF       H P P      
Sbjct  11    ISECFVKPICLPQQSNLP--YHLIPGDLAMLSAHYIQKGLLFRKPSHLNHYPHPFML---  65

Query  250   fNSNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGV  426
                +L+H L+ SLS  L  F PL+GR +T+ N++ ++ S+YVDC N+ G +F+ A A  +
Sbjct  66    ---HLLHRLQNSLSIALFHFYPLSGRLSTIKNDQQSSVSIYVDCVNSPGAKFIHA-ALDI  121

Query  427   TVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGD  606
             T++ +L  S ++VP +++S F L+  +N DG   PL+ +Q+TELLDG FIAC+ NH++GD
Sbjct  122   TISDVL--SPVDVPLLVQSFFDLHKAVNYDGHTMPLLSIQVTELLDGVFIACSFNHAIGD  179

Query  607   GTSFWNFFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLP  765
             GTS+WNFFN W+E+ +            S  PI +RWFPD     P+   P     + + 
Sbjct  180   GTSYWNFFNMWSEIFQATSSDGDEIISISRPPILKRWFPDGIG--PIISLPFTHPDQFIS  237

Query  766   PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNED  945
               +   L ER+FH S  +IA+LK KAN+E     ISS QS  A +WR++TRAR +  N+ 
Sbjct  238   RFEAPELRERIFHFSAESIAKLKAKANAECKAKEISSFQSLSALVWRSITRARRVPENQI  297

Query  946   VHLILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                 +    R ++   L E Y+GN V  +    KAG+++ +GLGW AW++ + V ++++ 
Sbjct  298   SSCSMAANNRGKLDPKLSENYFGNVVTSVKAEAKAGELVERGLGWAAWKLHEVVVQNTN-  356

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
             E++RK   K++ESP          + ++ + SSPRF+ YG +FG GK V +RSG  NK D
Sbjct  357   EKLRKALDKWIESPFTFQLGRFFDAYSVLMGSSPRFNKYGNEFGMGKAVALRSGYANKFD  416

Query  1300  GKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIPGN**INNSM  1449
             GKV+ + G E  GS+D+E+ + P  +  LE+D EF+   + P +   NN +
Sbjct  417   GKVSAYPGYEGGGSIDLEICLLPQNMANLESDLEFINSISSPPHLSFNNDL  467



>ref|XP_003523662.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=460

 Score =   299 bits (765),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 263/455 (58%), Gaps = 21/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CFV   G  +   VS ++  LT WD+  L    IQKGLLF  PTP   Q  F  NL+
Sbjct  10    ISECFVKPHGLTQ---VSNQICHLTQWDIVMLSKHYIQKGLLFKKPTPLVDQHDFIENLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PLAGR  T  +++  + +V VD  N+ G  F+ A    +T++ IL
Sbjct  67    EKLKHSLSLTLSHFYPLAGRLVTQKSQDPPSYAVSVDSKNSDGARFIYATLD-MTISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP +++SLF  +  +N DG   PL+ +Q+TE++DG F+ C++NH++GDGTS+WN
Sbjct  126   --SPVDVPLVVQSLFDHHKAVNHDGHTMPLLSIQVTEIVDGVFLGCSMNHAVGDGTSYWN  183

Query  625   FFNSWAELSRGFHQPSTT-------PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FFN+W+++ +   +   T       PI  RWFP N    P++L P     E +   +   
Sbjct  184   FFNTWSQIFQAHAKGHDTDVPISHQPILSRWFP-NDCAPPINL-PFKHHDEFISRIEAPL  241

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             + ERVFH S  +IARLK KAN E  T+ ISS QS  A +WR +TRA +L   +     L 
Sbjct  242   MRERVFHFSAESIARLKAKANMESDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLT  301

Query  964   IGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R RM   LP+ Y+GN+V  +      G++L   LGW AW++   V  H+ ++ V + 
Sbjct  302   ANNRTRMEPPLPQQYFGNSVSRLNAQTTVGELLENNLGWAAWKLHLAVTNHN-DKVVLQS  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               K+++ P       P     + ISSSPRF++YG +FG GK V VRSG  NK  GKVT +
Sbjct  361   LKKWLQCPLIYQIGQPMDPYDVLISSSPRFNMYGNEFGMGKAVAVRSGYANKFHGKVTSY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GS+D+E+ + PH +  LE+D EF++  ++
Sbjct  421   PGREGGGSIDLEVGLLPHIMSALESDEEFMKVVSV  455



>ref|XP_009103449.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Brassica 
rapa]
Length=445

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/437 (40%), Positives = 256/437 (59%), Gaps = 28/437 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLLF  P P        +++I+ LK+SLS  L  F P AGR
Sbjct  23    KIHLTPWDLFFLRSEYPQRGLLFPKPDP-------ETDIIYQLKSSLSVALSIFYPFAGR  75

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                  NE D T S  VDC+ +GV+F+ A A  V+V+ +L+  N  VP+ L  LF  NG+ 
Sbjct  76    LVKTENENDETASFLVDCDGSGVKFIHASAKTVSVSDVLEPVNGIVPEFLNRLFPANGVK  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTP-  681
             + +G+ + L+  Q+TEL DG FIA   NH + DG+SFW+FFN+W+E+ S G  +   +P 
Sbjct  136   SCEGVSESLIAFQVTELRDGVFIAFGYNHMVADGSSFWSFFNTWSEICSTGVDRDKKSPP  195

Query  682   -IHERWFPDNTTTCPVHLPPMIES--SERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              +   WF D     P+ + P+ E+           + L E+VF  ++ NI+ LK KAN E
Sbjct  196   LLLRGWFLDGIDH-PIRI-PISETVIPSPPVASSSSLLREKVFRFTRRNISELKSKANGE  253

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             + +    ISSLQ+  AH+WR++ R  +L+  E V+  L + MR R+  P  +  +GN V 
Sbjct  254   VSSDDRRISSLQAVSAHMWRSIIRNSDLNPEEVVYCKLLMDMRRRLNPPLDKECFGNVVG  313

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS----  1188
             F T    AG+++  GLGW A QI KTV     +E  R     +V+ P     +IP+    
Sbjct  314   FPTAMTTAGEMVSNGLGWAALQINKTVGAQ-RDEGFRVFAGNWVKEP-----KIPNHVAV  367

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
             SSN++ ++SSP F+VYG DFGWGKP+ VR+G GN  DGK+ ++ G EEG+++I+  +  H
Sbjct  368   SSNSVIVASSPWFNVYGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIEEGNIEIQTCLSSH  427

Query  1369  TLLGLENDAEFLEYFTI  1419
              L  L  DAEFLE+  +
Sbjct  428   VLEKLSADAEFLEHACV  444



>gb|KFK28407.1| hypothetical protein AALP_AA8G510900 [Arabis alpina]
Length=448

 Score =   297 bits (760),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/436 (39%), Positives = 252/436 (58%), Gaps = 31/436 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLL+  P P        + +I  LK+SLS  L  F P AGR
Sbjct  25    KIHLTPWDLFFLRSEYPQRGLLYPKPDP-------ETQIISRLKSSLSVALKIFYPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + NE+D T S YVDC+ +GV+F+ A A  V+V+ IL   N  VP  L   F +NG+ 
Sbjct  78    LVKIENEDDKTASFYVDCDGSGVKFIYASAKTVSVSDILKPVNGTVPGFLTGFFPVNGVR  137

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGFHQPSTTP-  681
             + +G+ + L+  Q+TEL+DG FI    NH + DG+SFWNFFN+W+E+   G ++    P 
Sbjct  138   SCEGLTESLIAFQVTELIDGVFIGFGYNHMIADGSSFWNFFNTWSEICLTGSNRKEFPPL  197

Query  682   IHERWFPDNTTTCPVHLPPMIESSERLPPP---QRAFLAERVFHLSKVNIARLKEKANSE  852
             +  RWF  N    P+ +P      E  P P     + L E++F  +  NI+ LK KAN E
Sbjct  198   VLRRWFL-NGIDSPIRIP--FSEIETPPSPIVDTSSLLQEKIFRFTSGNISELKAKANGE  254

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             + +    ISSLQ+  A +WR++ +  +L S E +H  L + MR R+  P  +  +GN V 
Sbjct  255   VNSDDRRISSLQAISAFMWRSIVKNSDLDSEEVIHCKLLMDMRRRLNPPLEKECFGNVVC  314

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP-----  1185
             F T +I  G+++  GLGWV  Q+ KTV   ++ E+ R     +V+ P      IP     
Sbjct  315   FATATITVGEMVKNGLGWVGLQLNKTVGSKTN-EDFRVFAENWVKKPI-----IPILPNR  368

Query  1186  -SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
              + SN++ ++SSP F+VYG DFGWGKP+ VR+G GN  +GK+  + G E+G+++I+  + 
Sbjct  369   VAVSNSVIVASSPWFNVYGNDFGWGKPIAVRAGPGNVTEGKLIAYPGIEQGNIEIQTCLS  428

Query  1363  PHTLLGLENDAEFLEY  1410
              H +  L ND EFL++
Sbjct  429   SHVMEKLSNDVEFLKH  444



>ref|XP_004501558.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=446

 Score =   297 bits (760),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/451 (38%), Positives = 250/451 (55%), Gaps = 29/451 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+      + +  ++   LT WD+    +  IQKGLLF  PTP           I 
Sbjct  9     VSECFIKPIHPIKES--NQICYLTGWDIAMSSMHYIQKGLLFTKPTP--------QKFIE  58

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVAAIL  444
              LK SLS  L  F PL+GR  T  ++  ++ ++++DC  NN G  F+ A    V+++ IL
Sbjct  59    KLKHSLSIALFHFYPLSGRLVTHKSQHPHSYTIFIDCSNNNPGARFIYATLD-VSISHIL  117

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP  + S F LN   N DG   PL+ +Q+TEL+DG FI C++NH +GDGTSFWN
Sbjct  118   --SPVDVPPFVDSFFDLNKATNHDGHTLPLLSIQVTELIDGVFIGCSMNHCIGDGTSFWN  175

Query  625   FFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFH  804
             FFN W+E+ +  +       H RWFP N    P +L P     E +   +     +R FH
Sbjct  176   FFNVWSEIFQHENDVHVHVSHNRWFP-NGYGPPTNL-PFKHHEEFINKYESPNFRDRFFH  233

Query  805   LSKVN---------IARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
              +K           IA+LK+KAN E  T+ ISS Q+  AH+WR VTRAR L  ++     
Sbjct  234   FTKXXXXXXXXXECIAKLKQKANKEYKTTKISSFQALSAHVWRCVTRARGLRDDQKTSCK  293

Query  958   LGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVR  1131
             L I  R RM   LP+ Y+GN+V  ++      +++   LGW AW++  +V  H  + EVR
Sbjct  294   LAINNRLRMEPPLPKEYFGNSVDVVSTETSVKELVENDLGWAAWKVHMSVVNHD-DREVR  352

Query  1132  KMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVT  1311
             +M  K++E P            ++ +SSSPRF++YG +FG GK V V SG  NK DG V+
Sbjct  353   EMIQKWLEDPVVYQLGRHFDPYSITVSSSPRFNMYGNEFGMGKAVAVLSGYANKFDGNVS  412

Query  1312  LFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
              + G E G++D+ L++ PH ++ LE+D  FL
Sbjct  413   SYEGYEPGTIDLALTLTPHAMMALESDPHFL  443



>ref|XP_004291090.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   297 bits (761),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/455 (39%), Positives = 263/455 (58%), Gaps = 18/455 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+    A+  +   +   L P+DL  L    IQKGLLF  P        F   L+ 
Sbjct  9     ISECFIQPHSASEES--KKPFYLAPFDLAMLSAHYIQKGLLFTKPPEANNNPNFLQTLLA  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS  L  F PLAGR  T   ++ +   VYVDC+N+ G +F+ A    ++++ IL 
Sbjct  67    KLKHSLSLALVHFYPLAGRLVTKKEQDPHLYLVYVDCSNSPGAKFIHASLD-MSISHIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S  +VP +++S F  +  +N DG    L+ VQ+TEL+DG FI  ++NH+LGDGTS+W+F
Sbjct  125   -SPTDVPLVVQSFFDHDRAVNHDGHTTSLLTVQVTELVDGVFIGMSMNHALGDGTSYWHF  183

Query  628   FNSWAELSRG------FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             FN+W+E+ R         + S  P+ ERWFP      P+   P     E +   +   L 
Sbjct  184   FNTWSEIFRAEENNITLSEISRPPVLERWFP--YGLGPIFSLPYTNPDEFIERFEAPELR  241

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER+FH S  +IA++K KANSE  TS ISS Q+  A LWR++TRAR    N++    L   
Sbjct  242   ERIFHFSSESIAKIKSKANSECRTSKISSFQALSALLWRSLTRARGFAPNQETSCRLAAN  301

Query  970   MRARMGLP--EGYWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              RAR+  P    Y+GN++  + ++ +KAG++L  GLGW AW++ +TV  H+ ++ +R+  
Sbjct  302   NRARINPPLSPNYFGNSIHPVKSQPVKAGELLENGLGWAAWKLHETVVNHN-DKWIRQSI  360

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
               +++SPA          +++ + S PRFD+YG +FG GK V +RSG  NK  GKVT + 
Sbjct  361   DAWLKSPAVYQLSRTFDPHSIMMGSGPRFDMYGNEFGMGKAVALRSGYANKFIGKVTSYS  420

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIPG  1425
             G E GS+D+E+ + P  +  LE+D EF+E  ++P 
Sbjct  421   GREAGSIDLEVCLPPAAMRALESDVEFMEAASVPS  455



>ref|XP_008452578.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=459

 Score =   297 bits (761),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 190/457 (42%), Positives = 261/457 (57%), Gaps = 31/457 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS CF+     +          L P +L FL    IQKGLLFH P  Q         L+H
Sbjct  14    ISNCFIKPEHLSPETK-QLPYHLGPSELAFLSFHYIQKGLLFHKPPDQGDHFMVP--LLH  70

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAILD  447
              LK SLS+ L  F PL+GR AT  N       VYVDC ++ G +F+ A A  +TV+ IL 
Sbjct  71    RLKNSLSTALFHFYPLSGRLATTTNN-----GVYVDCVDSPGAKFIHA-ALDITVSDIL-  123

Query  448   QSNINVPQ-ILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
              S ++VP  +++SLF LN  +N DG   PL+ +Q+TELLDG FIA + NHSLGDGTSFWN
Sbjct  124   -SPLHVPSSLIQSLFDLNKAVNYDGRTLPLLSIQVTELLDGVFIASSFNHSLGDGTSFWN  182

Query  625   FFNSWAELSRGFHQP------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FFN W+E+ +           S  PI ERWFPD      ++LPP +  +E   P  R   
Sbjct  183   FFNMWSEIFQAHGDGDEVISISRPPILERWFPDGYGPT-INLPPFVHLNEFEAPELR---  238

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
               R FH S  +IA LK KAN+E  T  ISS QS  A +W+A+TRAR +  ++     + +
Sbjct  239   -RRFFHFSAESIANLKAKANAECKTKEISSFQSLSALVWKAITRARCIKQDQITSCRMAV  297

Query  967   GMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R R+   LPE Y GN +  +    KAGD++ +GLGW A ++ + V   ++ E++R+  
Sbjct  298   NYRGRLKPALPENYLGNMITSVKADAKAGDLVERGLGWGAQKLHEAVTNITN-EKIRESL  356

Query  1141  MKFVESPA-HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
              K+V+ P  H  + + +  N L +SSSPRF++YG  FG GK + VRSG  N ++GKVT +
Sbjct  357   EKWVQCPCTHQLSSVSNPYNVL-MSSSPRFNMYGNKFGMGKAMGVRSGYANTMEGKVTAY  415

Query  1318  GG--CEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
              G   E GSVD+E+ + P T+  LE D EF+   + P
Sbjct  416   PGNEGEGGSVDLEICLQPQTMANLEFDLEFMNAISSP  452



>ref|XP_004141386.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=468

 Score =   296 bits (759),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 178/457 (39%), Positives = 267/457 (58%), Gaps = 21/457 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NL  264
             IS+CFV      + +  ++   L P DL  L    IQKGLLF  P+    Q       +L
Sbjct  11    ISECFVKPKFLPQQS--NQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFMLHL  68

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAI  441
             +H L+ SLS  L  F PL+GR +TV N++ ++ S+YVDC N+ G +F+ A A  +T++ +
Sbjct  69    LHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHA-ALDITISDV  127

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP +++S F  +  +N DG   PL+ VQ+TELLDG FIAC+ NH++GDGTS+W
Sbjct  128   L--SPVDVPLLVQSFFDHHKAVNYDGHTMPLLSVQVTELLDGVFIACSFNHAIGDGTSYW  185

Query  622   NFFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN W+E+ +            S  PI +RWFPD     P+   P     + +   +  
Sbjct  186   NFFNMWSEIFQATSSDGDEIISISQPPILKRWFPDGIG--PIINLPFTHPDQFISRFEAP  243

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KANSE     ISS QS  A +WR++TRAR +  N+     +
Sbjct  244   ELRERIFHFSAESIAKLKAKANSECKAKEISSFQSLSALVWRSITRARRVPENQISSCSM  303

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R R+   L E Y+GN V  +    KAG+++ +G+GW AW++ + V ++++ E++RK
Sbjct  304   AANNRGRLDPKLSENYFGNVVTSVKAEAKAGELVERGVGWAAWKLHEAVVQNTN-EKLRK  362

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                K++ESP            ++ + SSPRF+ YG +FG GK V +RSG  NK DGKV+ 
Sbjct  363   ALDKWMESPFTFQLGRFFDQYSVLMGSSPRFNKYGNEFGMGKAVALRSGYANKFDGKVSA  422

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + G E  GS+D+E+ + P  +  LE+D EF++  + P
Sbjct  423   YPGYEGGGSIDLEICLLPQNMANLESDLEFIKSISSP  459



>ref|XP_006659752.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Oryza 
brachyantha]
Length=462

 Score =   296 bits (759),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 252/441 (57%), Gaps = 29/441 (7%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             LTP DL+ + +  IQKG+L   P           +++ HL TS +  L  F PLAGR A 
Sbjct  34    LTPLDLRMITVDYIQKGVLLPRPP------GRGEHVVEHLATSFARALARFYPLAGRLAV  87

Query  337   VMNEEDN---TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
               +       + S+ + CN  G EFV A A GV  A +    +++VP+++ S F LNGIL
Sbjct  88    AGDASATGVPSISISLCCNGEGAEFVHAAAPGVAAADV--TGSLHVPRVVWSFFPLNGIL  145

Query  508   NRDGIC--KPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP----  669
             + D     +P++  Q+TEL DG F+A +LNH + DG SFW+FF++W+E+SR         
Sbjct  146   SVDAASDSRPVLAAQVTELADGMFVALSLNHGVADGFSFWHFFHTWSEISRSGDDAEREL  205

Query  670   -STTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKA  843
              +  P+ +RWF   +   PV +P P  +  + +  P    + E   HLS  ++  LKEKA
Sbjct  206   STPPPVFDRWFAYGS---PVPIPLPFAKLDDMIRRPVYTPVDECFLHLSAESVRALKEKA  262

Query  844   NSEMG---TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPEGYWGN  1011
             N+EM    T+ ISSLQS +AH+WRAV RAR +    + H  + +G RAR+  +P+ Y GN
Sbjct  263   NAEMAGAATATISSLQSVLAHVWRAVCRARRVAPELEAHYGISVGWRARLKEVPQEYMGN  322

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN--GAEIP  1185
              V   +     G++LGKGLGW AWQ+ + V   + E  VR+M   + E P+     A   
Sbjct  323   TVAGASAKATVGEILGKGLGWTAWQLNRAVAS-TDEGSVRRMVAAWPEKPSFMMVNALQR  381

Query  1186  SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHP  1365
               +  LGIS SPRFDVYG DFGWG+PV VRSGGGNKLDGK+T++ G   GS+ +E+ + P
Sbjct  382   RPAGALGISGSPRFDVYGNDFGWGRPVGVRSGGGNKLDGKMTVYEGRGGGSMALEICLEP  441

Query  1366  HTLLGLENDAEFLEYFTIPGN  1428
               L  L  D EF+   T P +
Sbjct  442   AALARLVADEEFMGAVTAPAH  462



>gb|AES73322.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=457

 Score =   296 bits (758),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 175/455 (38%), Positives = 258/455 (57%), Gaps = 24/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+        +   +   L PWD+  L    IQK LLF  PT          + I 
Sbjct  10    VSECFIKPYPPIEDS--KQICYLAPWDIVMLSANYIQKALLFKKPT----SSLNQQHFID  63

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PL+GR  T  +E+ ++ +V+VDC N+ G +F+ A    +T+  IL 
Sbjct  64    KLKHSLSLTLFHFYPLSGRLVTKKSEDPHSYTVFVDCKNSLGAKFIHATLD-ITINDIL-  121

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I+VP I+ S F  +  +N DG    L+ +Q+TELLDG FI C++NH++GDGT++WNF
Sbjct  122   -SPIDVPPIVHSFFDHHRAVNHDGHTMSLLSIQVTELLDGVFIGCSMNHAVGDGTAYWNF  180

Query  628   FNSWAELSR-----GFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FN+ +E+ +       H P   S  PIH RWFP+     P+   P     E +   +   
Sbjct  181   FNTLSEIFQKVVDVDVHIPVPISHQPIHNRWFPEGYG--PIINLPFKHHDEFIHRYEAPI  238

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             L ER+FH S   IA+LK KAN E  T+ ISS QS  A +WR++TR R LH ++     L 
Sbjct  239   LRERIFHFSAEFIAKLKAKANKECETTKISSFQSLSALVWRSITRVRRLHHDQRTTCKLA  298

Query  964   IGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  R RM   LP+ Y+GN+V+ ++     G++L  GLG  +W+I   + K+ H   VR++
Sbjct  299   INNRTRMEPSLPKEYFGNSVYAVSTETTKGELLENGLGLASWKIHLAIAKYDH-RVVRQL  357

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +++ SP     ++     ++ + SSPRF++YG++FG GK + VRSG  NK DGKVT +
Sbjct  358   VEEWLRSPIVVRMDMLVDPYSVMMGSSPRFNMYGSEFGMGKALGVRSGYANKFDGKVTSY  417

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GSVD+E+ + P  +  LE D EF+   ++
Sbjct  418   PGQEGGGSVDLEVCLSPEKMTLLETDEEFMNSVSV  452



>ref|XP_002865024.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41283.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 167/433 (39%), Positives = 249/433 (58%), Gaps = 20/433 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ L+PWDL FL+    Q+GLLF  P          + +I  LK+SLS  L  F P AGR
Sbjct  26    KIHLSPWDLFFLRSEYPQRGLLFPQPD-------SETRIISQLKSSLSVALKIFYPFAGR  78

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + NE+D T S YVDC+ +GV+FV A A  V+V+ +L+  + NVP+ L   +  N + 
Sbjct  79    LVKIENEDDGTASFYVDCDGSGVKFVHASAKTVSVSDVLEPVDGNVPEFLNRFYPANSVT  138

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGF---HQPST  675
             + +GI   L+  Q+TEL DG FI    NH + DG+SFW+FFN+W+E+   GF   H+   
Sbjct  139   SFEGISDSLIAFQVTELKDGVFIGFGYNHMVADGSSFWSFFNTWSEICFNGFDSDHRRKF  198

Query  676   TPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              P+  R WF D     P+ +P     +        + + E++F ++  NI+ LK KAN E
Sbjct  199   PPLLLRGWFLDGIEY-PIRIPISETETPNRVVVTSSLIQEKIFRVTSRNISELKAKANGE  257

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             + ++   ISSLQ+  A +WR++ R   L+  E +H  L + MR R+  P  +  +GN V 
Sbjct  258   VSSNDRKISSLQAVSAFMWRSIIRNSGLNPEEVIHCKLLVDMRRRLNPPLEKECFGNMVG  317

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
             F T +    ++L  GLGW A QI KTV   ++ EE R+    +V+ P+   A+  + SN 
Sbjct  318   FATVTTTVAEMLNNGLGWAALQINKTVGSQTN-EEFREFAENWVKKPSILNAK--AFSNC  374

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
             + I+SSPRF+VYG DFGWGKP+ VR+G GN  +GK+  + G EEG+++ +  +    L  
Sbjct  375   ITIASSPRFNVYGNDFGWGKPIAVRAGPGNTTNGKLIAYPGIEEGNIEFQTCLSSSVLEK  434

Query  1381  LENDAEFLEYFTI  1419
             L  DAEFL+Y  +
Sbjct  435   LSTDAEFLKYVCV  447



>ref|XP_006393913.1| hypothetical protein EUTSA_v10004238mg [Eutrema salsugineum]
 gb|ESQ31199.1| hypothetical protein EUTSA_v10004238mg [Eutrema salsugineum]
Length=438

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/442 (39%), Positives = 256/442 (58%), Gaps = 28/442 (6%)
 Frame = +1

Query  127   RSNGVSRRVE--LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTL  300
             R + VS RV+  LTPWDL FL     Q+GLLF  P P        + +I  LK+SL++ L
Sbjct  13    RPDEVSDRVKIHLTPWDLFFLGSEYPQRGLLFPQPDP-------ETQIISQLKSSLAAAL  65

Query  301   DFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILR  480
               F P AGR   + NE D T S  +DC+ +GV+FV A A  V+V+ +L+ +  NVP  L 
Sbjct  66    KIFYPFAGRLTKIKNE-DETVSFCIDCDGSGVKFVHASAKTVSVSDVLEPAGGNVPDFLD  124

Query  481   SLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF  660
               F  NG+ + +GI + L+  Q+T+L DG FI    NH + DG+SFWNFFN+W+++    
Sbjct  125   RFFPANGVKSCEGISESLIAFQVTKLKDGVFIGFGYNHMVADGSSFWNFFNTWSQICS--  182

Query  661   HQPSTTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQR----AFLAERVFHLSKVNIA  825
                + +P+  R WF D      +  P  I  SE +  P R    + L E+VF  +  NI+
Sbjct  183   TGKNFSPLLLRGWFLDG-----IEYPIRIPISETVSSPIRVVPSSLLQEKVFRFTSRNIS  237

Query  826   RLKEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--  993
              LK KAN E+      ISSLQ+  AH+WR++ +  +L+  E +H  L + MR R+  P  
Sbjct  238   ELKSKANGEVSPDDRKISSLQAISAHMWRSIIKNSDLNPEEVIHCKLLMDMRRRLNPPLE  297

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
             +  +GN V F T +  AG++L  GLGW A QI KTV   ++ EE R     +V+ P    
Sbjct  298   KECFGNVVGFATATTTAGEMLSNGLGWAALQINKTVGSQTN-EEFRVFAENWVKKPIIPN  356

Query  1174  AEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIEL  1353
               +  SSN++ ++SSP F+V+G DFGWGKP+ VR+G GN  DGK+ ++ G ++G+++I+ 
Sbjct  357   -HVAVSSNSIIVASSPWFNVFGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIDQGNIEIQT  415

Query  1354  SIHPHTLLGLENDAEFLEYFTI  1419
              +  H L  L  DAEFL++  +
Sbjct  416   CLSSHVLEKLSTDAEFLKHVCV  437



>gb|KGN55211.1| hypothetical protein Csa_4G640970 [Cucumis sativus]
Length=468

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/457 (39%), Positives = 266/457 (58%), Gaps = 21/457 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NL  264
             IS+CFV      + +  ++   L P DL  L    IQKGLLF  P+    Q       +L
Sbjct  11    ISECFVKPKFLPQQS--NQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFMLHL  68

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAI  441
             +H L+ SLS  L  F PL+GR +TV N++ ++ S+YVDC N+ G +F+ A A  +T++ +
Sbjct  69    LHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHA-ALDITISDV  127

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP +++S F  +  +N DG   PL+ VQ+TELLDG FIAC+ NH++GDGTS+W
Sbjct  128   L--SPVDVPLLVQSFFDHHKAVNYDGHTMPLLSVQVTELLDGVFIACSFNHAIGDGTSYW  185

Query  622   NFFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN W+E+ +            S  PI +RWFPD     P+   P     + +   +  
Sbjct  186   NFFNMWSEIFQATSSDGDEIISISQPPILKRWFPDGIG--PIINLPFTHPDQFISRFEAP  243

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KANSE     ISS QS  A +WR++TRAR +  N+     +
Sbjct  244   ELRERIFHFSAESIAKLKAKANSECKAKEISSFQSLSALVWRSITRARRVPENQISSCSM  303

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R R+   L E Y+GN V  +    KAG+++ +G+GW AW++ + V ++++ E++RK
Sbjct  304   AANNRGRLDPKLSENYFGNVVTSVKAEAKAGELVERGVGWAAWKLHEAVVQNTN-EKLRK  362

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                K++ESP            ++ + SSPRF+ YG +FG GK V +RSG  NK DGKV+ 
Sbjct  363   ALDKWMESPFTFQLGRFFDQYSVLMGSSPRFNKYGNEFGMGKAVALRSGYANKFDGKVSA  422

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + G E  GS+D+E+ + P  +  LE+D EF+   + P
Sbjct  423   YPGYEGGGSIDLEICLLPQNMANLESDLEFINSISSP  459



>ref|XP_002444907.1| hypothetical protein SORBIDRAFT_07g001180 [Sorghum bicolor]
 gb|EES14402.1| hypothetical protein SORBIDRAFT_07g001180 [Sorghum bicolor]
Length=481

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/449 (39%), Positives = 250/449 (56%), Gaps = 30/449 (7%)
 Frame = +1

Query  142   SRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLA  321
             S  + LTPWD++ + +  IQKG+L   P P       +++L++ L++S +  L  F P A
Sbjct  38    SEVIHLTPWDIRLISVDYIQKGILL--PKPPSSVGGDDNDLVNALQSSFARALRLFYPFA  95

Query  322   GRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             GR A+    +D T SV++ C   G EFV A A  V VA I+  S++  P ++   F L+ 
Sbjct  96    GRLASEERGDDGTVSVFLRCTGEGAEFVHAVAPEVAVADIV--SSLYTPPVVWEFFPLSL  153

Query  502   ILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPST  675
             +L  D   +  P++ V++T L DG FI  TLNHS+GDGT+FW+FFN+W+E++R      +
Sbjct  154   VLGADAAIEGLPVLAVKVTVLADGVFIGMTLNHSVGDGTAFWHFFNTWSEINRAAAGVGS  213

Query  676   T-----------PIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVN  819
             +           P+ ERWF +   TCPV +P P  +    +   +R  + E  F     +
Sbjct  214   SADLQDDLSTPPPVFERWFLE---TCPVPIPMPFRKLEHIVRRFERTAVKECFFTFPAAS  270

Query  820   IARLKEKANSEMGTSI-----ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
             + +LK +AN EM         ISSLQ+ +AH WRAV RAR L   +     + +G R R+
Sbjct  271   VKKLKARANDEMAAGGATAATISSLQAVLAHFWRAVCRARRLTPEQSTFYSVVVGCRGRV  330

Query  985   -GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
              G+P GY GNA+ F      AG++  KGLGW AW + + V     E  +R+   ++V  P
Sbjct  331   NGIPLGYLGNALVFGKAEATAGEIEEKGLGWTAWLLNRAVASFD-EATMRESLERWVRRP  389

Query  1162  AHNGAEIPSSSNT-LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE-G  1335
                  +  SS+ T L   SSPRFDV+G DFGWGKP+ VRSG GNK DGK T+F G E  G
Sbjct  390   DFTYMDNLSSAGTALVTGSSPRFDVFGNDFGWGKPLAVRSGSGNKADGKATVFEGPERGG  449

Query  1336  SVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             S+ +E+ I P  L  L  D EF++  T P
Sbjct  450   SISLEVCIAPDALERLVADQEFMDAVTTP  478



>ref|XP_004972479.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=468

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 181/440 (41%), Positives = 244/440 (55%), Gaps = 38/440 (9%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             LTPWDL+ + +  IQKG+L   P    Q     ++L+  L +S +S LD F PLAGR  T
Sbjct  36    LTPWDLRMIAVDYIQKGVLLPKP----QTGGEAAHLVDSLASSFASALDRFYPLAGRL-T  90

Query  337   VMNEEDNTCS-----VYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             V    D         V + CN  G EFV A A  VTV  I   + + +P+++ SLF LNG
Sbjct  91    VAEATDGGVPRPGIVVSLCCNGEGAEFVHAVAPEVTVRDI--TAPVYIPRVVWSLFPLNG  148

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR------GFH  663
              L  D +  P++  Q+TEL DG F+A +LNH + DG +FW+FF++W+E+SR      G  
Sbjct  149   ALGTD-VSLPVLAAQVTELADGVFVAMSLNHGVADGATFWHFFSTWSEISRSGSSDAGGE  207

Query  664   QPSTTPIHERWFPDNTTTCPVHLP----PMIESSERLPPPQRAFLAERVFHLSKVNIARL  831
               +  P+ ERWF + T++ P+ LP      I      PP Q  F     F+ S  ++ +L
Sbjct  208   LSTPPPVLERWFLE-TSSVPITLPFGKLEDIVRRPEYPPVQECF-----FNFSAESVRKL  261

Query  832   KEKANSEMG-----TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLP  993
             K +AN+EM      TS ISSLQS +AH WRAV RAR L    +    L +G R RM G+P
Sbjct  262   KARANAEMAGTATATSTISSLQSLLAHTWRAVCRARELAPERETTYTLLVGCRGRMKGIP  321

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
               Y GN V F      AG+V+ KGLGW AW + + V     E  VR     + + P    
Sbjct  322   RDYVGNTVAFAVARCTAGEVVEKGLGWAAWLMNRAVASF-DEATVRDDLASWPQDPRFLY  380

Query  1174  AEIP-SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG-CEEGSVDI  1347
              + P  ++ T+   SSPRFDVYG DFGWG+PV VRSG GNK DGKVT++ G    GS+ +
Sbjct  381   VKPPREAAATIITGSSPRFDVYGNDFGWGRPVAVRSGAGNKTDGKVTVYAGRGGAGSMAL  440

Query  1348  ELSIHPHTLLGLENDAEFLE  1407
             E+ + P  L  L  D EF+E
Sbjct  441   EVCLEPEVLARLVADEEFME  460



>ref|NP_001143242.1| uncharacterized protein LOC100275767 [Zea mays]
 gb|ACG30097.1| hypothetical protein [Zea mays]
 gb|AFW61422.1| hypothetical protein ZEAMMB73_089688 [Zea mays]
Length=480

 Score =   295 bits (756),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 177/447 (40%), Positives = 247/447 (55%), Gaps = 21/447 (5%)
 Frame = +1

Query  106   VGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTS  285
             V   G  R    +  + L PWDL+ L I  IQKG+L   P P  +    + +L++ L++S
Sbjct  28    VNGNGCNRPKEETEVIHLAPWDLRLLSIDYIQKGILL--PKPPSEGDDNDLHLVNALRSS  85

Query  286   LSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINV  465
              +  L  F P AGR  +    +D T SV++ C   G EFV A A  V  A I+  S++  
Sbjct  86    FARALRIFYPFAGRLTSEERADDGTVSVFLRCTGEGAEFVHAVAPEVAAADIV--SSLYT  143

Query  466   PQILRSLFTLNGILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSW  639
             P ++   + L  +L  D   +  P++  Q+T L D  FI  TLNHS+GDGT+FW+FFN+W
Sbjct  144   PPVVWKFYPLALVLGADAAIERLPVLAAQVTVLADSVFIGMTLNHSVGDGTAFWHFFNTW  203

Query  640   AELSR----GFHQPSTTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFH  804
             +E++R    G    +  P+  RWFP+    CPV +P P     + +   +R  + E  F 
Sbjct  204   SEINRATGGGADLSTPPPVFGRWFPE---ACPVPIPLPFRRLEDIVRRFERTEVKECFFT  260

Query  805   LSKVNIARLKEKANSEMG---TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
              S  ++ +LK +AN EM    T+ ISSLQS +AHLWRAV RAR L         + +G R
Sbjct  261   FSAASVRKLKARANDEMAGSATATISSLQSVLAHLWRAVCRARRLPPEHGTFYSVVVGCR  320

Query  976   ARM-GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
              R+ G+P GY GNA+ F      AG++  KGLGW AW + + V     E  VR+   ++V
Sbjct  321   GRVDGVPPGYVGNAMVFGRAEATAGEIEEKGLGWTAWLLNRAVASFD-EAAVRESLERWV  379

Query  1153  ESPAHNGAEIPSSSNT-LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
               P     +  SS+ T L   SSPRFDV+G DFGWGKP+ VRSG GNK DGK T+F G E
Sbjct  380   GEPDFTYMDNLSSAGTALVTGSSPRFDVFGNDFGWGKPLAVRSGSGNKADGKATVFEGPE  439

Query  1330  E-GSVDIELSIHPHTLLGLENDAEFLE  1407
               GS+ +E+ I P  L  L  D EF++
Sbjct  440   RGGSISLEVCIAPDALQRLVADHEFMD  466



>ref|XP_004163245.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=468

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 177/457 (39%), Positives = 266/457 (58%), Gaps = 21/457 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNS--NL  264
             IS+CFV      + +  ++   L P DL  L    IQKGLLF  P+    Q       +L
Sbjct  11    ISECFVKPKFLPQQS--NQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFMLHL  68

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAI  441
             +H L+ SLS  L  F PL+GR +TV N++ ++ S+YVDC N+ G +F+ A A  +T++ +
Sbjct  69    LHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHA-ALDITISDV  127

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S ++VP +++S F  +  +N DG   PL+ +Q+TELLDG FIAC+ NH++GDGTS+W
Sbjct  128   L--SPVDVPLLVQSFFDHHKAVNYDGHTMPLLSIQVTELLDGVFIACSFNHAIGDGTSYW  185

Query  622   NFFNSWAELSRGFHQP-------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN W+E+ +            S  PI +RWFPD     P+   P     + +   +  
Sbjct  186   NFFNMWSEIFQATSSDGDEIISISQPPILKRWFPDGIG--PIINLPFTHPDQFISRFEAP  243

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KANSE     ISS QS  A +WR++TRAR +  N+     +
Sbjct  244   ELRERIFHFSAESIAKLKAKANSECKAKEISSFQSLSALVWRSITRARRVPENQISSCSM  303

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R R+   L E Y+GN V  +    KAG+++ +G+GW AW++ + V ++++ E++RK
Sbjct  304   AANNRGRLDPKLSENYFGNVVTSVKAEAKAGELVERGVGWAAWKLHEAVVQNTN-EKLRK  362

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                K++ESP            ++ + SSPRF+ YG +FG GK V +RSG  NK DGKV+ 
Sbjct  363   ALDKWMESPFTFQLGRFFDPYSVLMGSSPRFNKYGNEFGMGKAVALRSGYANKFDGKVSA  422

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + G E  GS+D+E+ + P  +  LE+D EF+   + P
Sbjct  423   YPGYEGGGSIDLEICLLPQNMANLESDLEFINSISSP  459



>ref|XP_002284916.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Vitis 
vinifera]
Length=454

 Score =   294 bits (753),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 177/452 (39%), Positives = 265/452 (59%), Gaps = 17/452 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+       S        LTPWDL  L +  IQKGLLF  P      Q F + L+ 
Sbjct  9     ISECFIKPKFT--SEETKEPCYLTPWDLAMLSVNYIQKGLLFSKPPDVDDPQNFMATLLD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SL+ TLD F PLAGR AT   +   +  V+VDCNN+ G +F+ A A+ +T++ IL 
Sbjct  67    RLKDSLALTLDHFYPLAGRLATKKEDSPPSYVVFVDCNNSPGAKFIHA-AADMTISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I VPQ+++S F  + ++N DG    L+ +Q+TEL+DG FI C++NHS+ DGTSFW+F
Sbjct  125   -SPIYVPQVIQSFFDHDRVINHDGHTLSLLSIQVTELVDGIFIGCSINHSMVDGTSFWHF  183

Query  628   FNSWAEL--SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAE  792
             FN+W+E+  ++  + P   S  PI +RWFPD     P+   P     E +   +   L E
Sbjct  184   FNAWSEVFTAQEKNSPITLSRPPILKRWFPDGYG--PIINLPFTHHDEFISRFEAPVLRE  241

Query  793   RVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             R+FH S  +IA+LK KAN++  ++ ISS Q+  A +WR++TRAR     +     L IG 
Sbjct  242   RIFHFSSESIAKLKAKANAQCNSNKISSFQALSALVWRSITRARCFPHEQVTSCRLAIGN  301

Query  973   RARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
             R R+   LPE Y+GN++  +     AG++L   LGW AW + + V  H+ ++ VR     
Sbjct  302   RTRLDPPLPENYFGNSIQTVRGIATAGELLEHDLGWAAWLLHQAVVGHT-DKAVRGWLES  360

Query  1147  FVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGC  1326
             + +S       +    N++ + SSPRF+ YG +FG GK + VRSG  +K DG V+ + G 
Sbjct  361   WFQSHFIYQLGLFFDPNSVMMGSSPRFNKYGIEFGLGKGLAVRSGYAHKFDGTVSCYPGR  420

Query  1327  E-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             E  GS+D+E+ + P+++  LE++ EF+E  ++
Sbjct  421   EGGGSIDLEVCLPPNSMSALESNQEFMEAVSL  452



>gb|AES73315.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=455

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 178/452 (39%), Positives = 256/452 (57%), Gaps = 24/452 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVE-LTPWDLQFLQIGPIQKGLLFHNPT--PqqqqqffNSN  261
             +S+CF+           S+++  LT WD+    +  IQKGLLF  PT  P  QQ F  S 
Sbjct  10    VSECFIKPLHPIED---SKQISYLTGWDIAMSSMHYIQKGLLFKKPTTSPNNQQDFIES-  65

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVA  435
             L+  LK SLS  L  F PL+GR  T   +   + +++VDC  NN G  F+ A A  VT++
Sbjct  66    LLKKLKYSLSHALFHFYPLSGRLVTHKTQHPPSYTIFVDCSNNNPGARFIYATAD-VTIS  124

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              IL  S ++VP I+ S F LN  +N DG   PL+ +Q+TEL+DG FI C+LNH +GDGTS
Sbjct  125   DIL--SPVDVPPIVESFFDLNKAINHDGHTMPLLSIQVTELVDGVFIGCSLNHCIGDGTS  182

Query  616   FWNFFNSWAEL--SRGFHQPSTTPI-----HERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             FWNFFN W+E+  S+     +  PI     H RWF       P+ L P     E +   +
Sbjct  183   FWNFFNIWSEIFQSQSCENENDVPISRLPFHYRWFLQGYGP-PISL-PFKHHEEFISRYE  240

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                  +R FH +  +I +LK KAN E  T+ ISS Q+  AH+WR VTRAR L +++    
Sbjct  241   SPNFRDRFFHFTPESIVKLKAKANKEFNTTKISSFQALSAHVWRCVTRARGLTNDQKTSC  300

Query  955   ILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              L I  R R+   LP+ Y+GN V  ++  +   ++L   LGW AW++   V  H  +++V
Sbjct  301   KLAINNRLRLEPPLPQEYFGNTVDVVSAEMTVDELLQNNLGWAAWKVNVAVVNHD-DKQV  359

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             RKM  +++ESP            ++ +SSSPRF++YG +FG GK + V SG  NK DG V
Sbjct  360   RKMLKEWLESPVVYQLGRHFDPQSITVSSSPRFNMYGNEFGMGKAMAVLSGYANKFDGNV  419

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
             + + G E GS+D+ L++ P+ +  LE D +F+
Sbjct  420   SSYQGYEHGSIDLALTLTPNAMRALELDEQFV  451



>ref|XP_003603064.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=454

 Score =   293 bits (751),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 178/452 (39%), Positives = 256/452 (57%), Gaps = 24/452 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVE-LTPWDLQFLQIGPIQKGLLFHNPT--PqqqqqffNSN  261
             +S+CF+           S+++  LT WD+    +  IQKGLLF  PT  P  QQ F  S 
Sbjct  9     VSECFIKPLHPIED---SKQISYLTGWDIAMSSMHYIQKGLLFKKPTTSPNNQQDFIES-  64

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVA  435
             L+  LK SLS  L  F PL+GR  T   +   + +++VDC  NN G  F+ A A  VT++
Sbjct  65    LLKKLKYSLSHALFHFYPLSGRLVTHKTQHPPSYTIFVDCSNNNPGARFIYATAD-VTIS  123

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              IL  S ++VP I+ S F LN  +N DG   PL+ +Q+TEL+DG FI C+LNH +GDGTS
Sbjct  124   DIL--SPVDVPPIVESFFDLNKAINHDGHTMPLLSIQVTELVDGVFIGCSLNHCIGDGTS  181

Query  616   FWNFFNSWAEL--SRGFHQPSTTPI-----HERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             FWNFFN W+E+  S+     +  PI     H RWF       P+ L P     E +   +
Sbjct  182   FWNFFNIWSEIFQSQSCENENDVPISRLPFHYRWFLQGYGP-PISL-PFKHHEEFISRYE  239

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                  +R FH +  +I +LK KAN E  T+ ISS Q+  AH+WR VTRAR L +++    
Sbjct  240   SPNFRDRFFHFTPESIVKLKAKANKEFNTTKISSFQALSAHVWRCVTRARGLTNDQKTSC  299

Query  955   ILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              L I  R R+   LP+ Y+GN V  ++  +   ++L   LGW AW++   V  H  +++V
Sbjct  300   KLAINNRLRLEPPLPQEYFGNTVDVVSAEMTVDELLQNNLGWAAWKVNVAVVNHD-DKQV  358

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             RKM  +++ESP            ++ +SSSPRF++YG +FG GK + V SG  NK DG V
Sbjct  359   RKMLKEWLESPVVYQLGRHFDPQSITVSSSPRFNMYGNEFGMGKAMAVLSGYANKFDGNV  418

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
             + + G E GS+D+ L++ P+ +  LE D +F+
Sbjct  419   SSYQGYEHGSIDLALTLTPNAMRALELDEQFV  450



>ref|XP_003603072.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73323.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=457

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 173/447 (39%), Positives = 253/447 (57%), Gaps = 17/447 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN-SNLI  267
             +S+CF+        +  ++   L PWD+  L    IQKGLLF  PT     +     NL+
Sbjct  9     VSECFIKPCPPIEDS--NQICYLGPWDISMLSAYYIQKGLLFKKPTSSSLNKQHFIENLV  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PL+GR  T  +E+ +  +V+VDC N+ G +F+ A    +T+  IL
Sbjct  67    EKLKHSLSLTLFHFHPLSGRLVTKKSEDPHFYTVFVDCKNSLGAKFIHATLD-ITINDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP I+ S F  +  +N DG    L+ +Q+TELLD  FI C++NH +GDGT +WN
Sbjct  126   --SPVDVPPIVHSFFDHHRAVNHDGHTMSLLSIQVTELLDSVFIGCSMNHCIGDGTGYWN  183

Query  625   FFNSWAEL-SRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAE  792
             FFNS++E+     H P   S  PIH RWFP+     P+   P     E +   +   L E
Sbjct  184   FFNSFSEIFQNDVHVPVPISHKPIHNRWFPEGYG--PIISLPFKHHDEFIHRYETPILRE  241

Query  793   RVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             R+FH S  +IA+LK KAN E  T+ ISS QS  A +WR++TRAR L   +     L +  
Sbjct  242   RIFHFSAESIAKLKAKANKESDTNKISSFQSLSALVWRSLTRARQLQQGQRTTCKLAVNN  301

Query  973   RARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
             R RM   LP+ Y+GN+++ +      G++L   LGW AW+I   +  +  ++ VR    +
Sbjct  302   RTRMEPPLPKEYFGNSIYAVRAETTVGELLENDLGWAAWKIHLAIANYD-DKVVRNSVEE  360

Query  1147  FVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGC  1326
             ++ SP     ++     T+ + SSPRF++YG +FG GK + VRSG  NK DGKVT + G 
Sbjct  361   WLRSPFVYRMDLFFDPYTVMMGSSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSYPGQ  420

Query  1327  E-EGSVDIELSIHPHTLLGLENDAEFL  1404
             E  GS+D+E+ + P  ++ LE D EF+
Sbjct  421   EGGGSIDLEVCLSPEKMMVLETDQEFM  447



>dbj|BAJ97438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 178/438 (41%), Positives = 238/438 (54%), Gaps = 28/438 (6%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+ + +  IQKGLL   P            L+  L +SL+  L  +  LAGR 
Sbjct  36    IHLTPWDLRLISVDYIQKGLLLPAPP------AGGDRLVSTLASSLAHALGRYYHLAGRL  89

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
             A V    D T SV + C   G E V A A GV VA I+ +S      ++R+LF LNG+L 
Sbjct  90    A-VEERRDGTVSVRLRCTGEGAELVHATAPGVAVADIV-RSVYTPSTVVRALFPLNGVLG  147

Query  511   RDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS----  672
              D      P++  Q TEL DG FIA +LNHS+GDG  FW F N+W+ ++RG    S    
Sbjct  148   ADAAVDSLPVLSAQFTELADGVFIAVSLNHSVGDGFVFWEFVNAWSGINRGGRATSDLSD  207

Query  673   -TTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKA  843
              +  +H RWF D  +  P+ LP   +        PP    + E  F  S  ++  LK +A
Sbjct  208   ISARVHRRWFID-ASPVPIPLPFSKLQHVVRWFEPPT---VQECFFTFSAASVKELKARA  263

Query  844   NSEMG---TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLPEGYWGN  1011
             N EM    T+ ISSLQ+ +AHLWRAV+RAR L   ++    L +G R R+ G+P GY GN
Sbjct  264   NDEMAGTATATISSLQALLAHLWRAVSRARRLPPGQETSYSLAVGCRGRVSGIPPGYMGN  323

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG-AEIPS  1188
             A+   T S  AG++LGKGLGW AWQ+ + V     EE VR     +   P       + S
Sbjct  324   ALVPGTASCTAGEILGKGLGWTAWQLNRAVASFD-EEAVRGWLESWTREPQFRYFGSLMS  382

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE-GSVDIELSIHP  1365
                 L   SSPRFDV+G DFGWG P  VRSGG +K+DGK T++ G E  GS+ +E+ I P
Sbjct  383   GGAALMTGSSPRFDVFGNDFGWGGPAAVRSGGASKMDGKATVYEGPERGGSMSLEVCIAP  442

Query  1366  HTLLGLENDAEFLEYFTI  1419
               +  L  D EF++  T+
Sbjct  443   DAMERLVADDEFMDAVTM  460



>ref|XP_006280460.1| hypothetical protein CARUB_v10026392mg [Capsella rubella]
 gb|EOA13358.1| hypothetical protein CARUB_v10026392mg [Capsella rubella]
Length=449

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 165/437 (38%), Positives = 250/437 (57%), Gaps = 28/437 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLLF  P P        +  +  LK+SLS  L+ F P AGR
Sbjct  27    KIHLTPWDLFFLRSEYPQRGLLFPQPDP-------ETQFVSRLKSSLSVALNIFYPFAGR  79

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                V N++D T S +VDC+ +G +F+ A A  V+V+ +L+  + +VP  L+  F  NG+ 
Sbjct  80    LVKVENQDDGTASFHVDCDGSGAKFIHASAKSVSVSDVLEPLDGHVPDFLKRFFPANGVT  139

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGF---HQPST  675
             + +GI   L+  Q+TEL DG FI    NH + DG+SFW+FFNSW+E+   GF   H+   
Sbjct  140   SCEGISDSLIAFQVTELKDGVFIGFGYNHIVADGSSFWSFFNSWSEICFNGFDPHHRRKF  199

Query  676   TPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQ----RAFLAERVFHLSKVNIARLKEK  840
              P+  R WF D      +  P  I +SE   P +     + + E++F  +  N++ LK K
Sbjct  200   PPLLLRGWFLDG-----IEYPIRIPTSETDTPNRVVVTSSLIQEKIFRFTSGNVSELKAK  254

Query  841   ANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWG  1008
             AN E+      ISSLQ+  A++WR++ R   L   E +H  L + MR R+  P  +  +G
Sbjct  255   ANGEVSVDDRKISSLQAVSAYMWRSIIRNSELSPEEVIHCKLLVDMRQRLDPPLKKECFG  314

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS  1188
             N V F T +    ++L  GLGW A QI  +V   ++ E+VR+    +V+ P+     + +
Sbjct  315   NMVGFATATTTVAEMLNNGLGWAALQINTSVGSQTN-EKVREFAADWVKRPSI--MNVKA  371

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPH  1368
              SN++ I+SSPRF+VYG DFGWGKP+ VR+G GN  DGK+  + G E+G+++I+  +   
Sbjct  372   LSNSIVIASSPRFNVYGNDFGWGKPIAVRAGPGNTCDGKLIAYPGTEQGNIEIQTCLSST  431

Query  1369  TLLGLENDAEFLEYFTI  1419
              L  L  D EFL++  +
Sbjct  432   VLEKLSTDVEFLKHVCV  448



>gb|KEH31451.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=431

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 216/355 (61%), Gaps = 14/355 (4%)
 Frame = +1

Query  358   TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILNRDGICKPLM  537
             +CS+   CNN G  F+ AKA   +V+ IL      VP I+ S F LNGI N +   +P++
Sbjct  80    SCSII--CNNLGALFIHAKAENTSVSDILKPDY--VPSIVHSFFPLNGIKNYEATSQPIL  135

Query  538   GVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIHERWFPDNTTT  717
              VQ+TEL +G FIA T+NH + DG SFW+F NSW+E+S+G H+ S  P  +RWFP+N   
Sbjct  136   AVQVTELSNGIFIAFTVNHVVLDGKSFWHFVNSWSEISKGSHKISKLPSFQRWFPNNVEL  195

Query  718   CPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGTS----IISSLQS  885
              P+  P     S+   P Q   L ER+FH +K  IA LK KAN E  T      ISSLQ+
Sbjct  196   -PIRFPFTKTESQCRKPRQN--LPERIFHFTKEKIAELKSKANEETKTENVQIKISSLQA  252

Query  886   YMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLG  1059
              + H+WR V R + L   ED   +L IG+R RM   L EGY+GNA  F   ++K G++L 
Sbjct  253   LLTHVWRCVVRCKKLDPEEDFRYVLSIGVRPRMIPPLDEGYFGNAAIFGGVTMKVGEILE  312

Query  1060  KGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYG  1239
              G+G VA ++ K +   S +E++R  Y  ++  P        + SN+L  SSS RFDVYG
Sbjct  313   CGIGKVALEMNKMIMLRS-DEKIRDDYECWLRMPKLFEVGNLAGSNSLATSSSQRFDVYG  371

Query  1240  ADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFL  1404
              DFGWGKPV VRSGG NK +GK+T++ G EEGS+DIE+ +    L  L NDAEFL
Sbjct  372   NDFGWGKPVGVRSGGSNKSNGKITVYAGAEEGSIDIEVCLSFEILEALGNDAEFL  426



>ref|XP_003523951.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47846.1| N-hydroxycinnamoyl/benzoyltransferase 4 [Glycine max]
Length=469

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/448 (41%), Positives = 258/448 (58%), Gaps = 19/448 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRV-ELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNL  264
             IS+CFV        N VS ++  LT WD+  L    IQKGLLF  P T    Q  F  NL
Sbjct  9     ISECFVKPQ---LPNQVSNQICNLTHWDIAMLSTNYIQKGLLFKKPATTLVDQHHFMENL  65

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS TL  F PLAGR  T    +  + SV VDC N+ G  F+ A  S +T++ I
Sbjct  66    LEKLKHSLSLTLFHFYPLAGRLVTHQTHDPPSYSVSVDCKNSDGARFIYA-TSDITISDI  124

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  + I+VP IL S F  +  +N DG    L+ +Q+TEL+D  FI C++NH +GDGTS+W
Sbjct  125   L--APIDVPPILHSFFDHHKAVNHDGHTMSLLSIQVTELVDAVFIGCSMNHVVGDGTSYW  182

Query  622   NFFNSWAEL----SRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             NFFN+W+++    S         PIH RWFP +    P++L P I   E +   +   L 
Sbjct  183   NFFNTWSQIFQSQSHALGHEYDVPIHNRWFPKDCAP-PINL-PFIHHDEIISRYEAPKLR  240

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER+FH S  +IA+LK KANSE  T+ ISS QS  A +WR+VTRAR+  +++     L   
Sbjct  241   ERIFHFSAESIAKLKAKANSESNTTKISSFQSLSALVWRSVTRARSPPNDQRTTCRLAAN  300

Query  970   MRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYM  1143
              R+RM   LP+ Y+GN+V  ++     G++L  G+GW AW++   V  +++   ++ + +
Sbjct  301   NRSRMEPPLPQEYFGNSVHVVSAETTTGELLENGIGWAAWKLHMAVANYNNGVVLQSLKV  360

Query  1144  KFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG  1323
              ++ESP             + + SSPRF+VYG +FG GK V  RSG  NK +GKVT + G
Sbjct  361   -WLESPFVIQMGRFFDPYCVMMGSSPRFNVYGNEFGMGKAVAARSGYANKFEGKVTSYPG  419

Query  1324  CE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              E  GS+D+E+ + P  +  LE+D EF+
Sbjct  420   REGGGSIDLEVCLSPENMTALESDEEFM  447



>emb|CAN78155.1| hypothetical protein VITISV_032623 [Vitis vinifera]
Length=602

 Score =   296 bits (759),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/452 (39%), Positives = 265/452 (59%), Gaps = 17/452 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+       S   +    LTPWDL  L +  IQKGLLF  P      Q F + L+ 
Sbjct  88    ISECFIKPKFT--SEETNEPCYLTPWDLAMLSVNYIQKGLLFSKPPDVDDPQNFMATLLD  145

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SL+ TLD F PLAGR AT   +   +  V+VDCNN+ G++F+ A A+ +T++ IL 
Sbjct  146   KLKDSLALTLDHFYPLAGRLATKKEDSSPSYVVFVDCNNSPGLKFIHA-AADMTISDIL-  203

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I VPQ+++S F  + ++N DG    L+ +QITEL+DG FI C++NHS+ DGTSFW+F
Sbjct  204   -SPIYVPQVIQSFFDHDRVINHDGRTLSLLSIQITELVDGIFIGCSINHSMVDGTSFWHF  262

Query  628   FNSWAELSRGFHQPSTT-----PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAE  792
             FN+W+E+     + S+      PI +RWFPD     P+   P     E +   +   L E
Sbjct  263   FNAWSEVFTAQGKNSSITLSRPPILKRWFPDGYG--PIINLPFTHHDEFISRFEAPVLRE  320

Query  793   RVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             R+FH S  +IA+LK KAN++  ++ ISS Q+  A +WR++TRAR     +     L  G 
Sbjct  321   RIFHFSSESIAKLKAKANAQCNSNKISSFQALSALVWRSITRARCFPHEQVTSCRLATGN  380

Query  973   RARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
             R R+   LPE Y+GN++  +     AG++L   LGW AW + + V  H+ ++ VR     
Sbjct  381   RTRLDPPLPENYFGNSIQTVRGIATAGELLEHDLGWAAWLLHQAVVGHT-DKAVRGWLES  439

Query  1147  FVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGC  1326
             + +S       +    N++ + SSPRF+ YG +FG GK + VRSG  +K DGKV+ + G 
Sbjct  440   WFQSHFIYQLGLFFDPNSVMMGSSPRFNKYGIEFGLGKGLAVRSGYAHKFDGKVSCYPGR  499

Query  1327  E-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             E  GS+D+E+ + P+++  LE++ EF+E  ++
Sbjct  500   EGGGSIDLEVCLPPNSMSALESNQEFMEAVSL  531



>ref|XP_004141387.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=460

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 183/437 (42%), Positives = 252/437 (58%), Gaps = 31/437 (7%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             L P +L FL I  I KGLLFH P            L+H LK SLS+ L  F PL+GR AT
Sbjct  35    LGPSELVFLSIHYIYKGLLFHKPPDHGVHFMVP--LLHRLKNSLSTALFHFYPLSGRLAT  92

Query  337   VMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNGILN  510
               N       VYVDC N+ G +F+ A A  +TV+ IL  S ++VP  +++SLF LN I+N
Sbjct  93    ATNN-----GVYVDCVNSPGAKFIHA-ALDITVSDIL--SPLHVPSSLIQSLFDLNKIVN  144

Query  511   RDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP-------  669
              DG   PL+ +Q+TELLDG FIAC+ NHSLGDGTSFWNFFN W+E+ +            
Sbjct  145   YDGHTLPLLSIQVTELLDGVFIACSFNHSLGDGTSFWNFFNMWSEIFQAQGDGDGDGDGV  204

Query  670   ---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEK  840
                S  PI ERWFPD      ++LPP ++  E+   P+   L  R FH S   IA LK K
Sbjct  205   ISISRPPILERWFPDGYGPT-INLPPFVQ-LEQFEAPE---LRRRFFHFSAELIANLKAK  259

Query  841   ANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNA  1014
             AN+E  T  ISS QS  A +W+A+TRAR +  ++     + +  R R+   LPE Y GN 
Sbjct  260   ANAECKTKEISSFQSLSALVWKAITRARCIKQDQSTRCHMAVNYRGRLKPALPENYLGNM  319

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             +  +    +AG+++  GLGW AW++ + V   ++ E +R+   K+++ P        S+ 
Sbjct  320   ITSVKVDAEAGELVETGLGWGAWKLHEAVTNITN-EMIRESLEKWIQCPFTLRWSSVSNP  378

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHT  1371
               + I+SS RF++YG  FG GK + V SG GN +DGKV  + G E  GSVD+E+ + P T
Sbjct  379   CIVLITSSSRFNMYGTKFGMGKAMGVLSGYGNTIDGKVVAYPGYEGGGSVDLEICLQPQT  438

Query  1372  LLGLENDAEFLEYFTIP  1422
             +  LE+D EF+   + P
Sbjct  439   MANLESDLEFMNAISSP  455



>ref|XP_010927437.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=455

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 177/462 (38%), Positives = 250/462 (54%), Gaps = 59/462 (13%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqf--------------------fNSNLIH  270
             + LTPWDL+ L +  IQKG+LF  P                             +S +I 
Sbjct  8     IHLTPWDLKLLSVDYIQKGILFLEPPAAAAAAAAAAAYNAKTLSDKQREEDGGKDSFIIS  67

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEED-NTCSVYVDCNNAGVEFVEAKASGVTVAAILD  447
              L +S +  LD F PLAGR  T  + ED  + S+++DCN+ G EF+ A A  VTV+ +L 
Sbjct  68    GLLSSFARALDHFFPLAGRLVTAKHHEDTKSLSIFLDCNDEGAEFIHAFADNVTVSDVL-  126

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDG-YFIACTLNHSLGDGTSFWN  624
              + + +P +++S F LNG+L+ DG   PL+ VQ+TEL DG  F+ C+L+H++ DGTSFW+
Sbjct  127   -TPLYIPPVVQSFFPLNGVLSCDGHSMPLLAVQVTELADGGIFVGCSLSHAVADGTSFWH  185

Query  625   FFNSWAELSRGFHQPS--TTPIHERWFPDNTTTCPVHLPPMIESSERLP-----------  765
             FFNSW+ L R  HQ S    P  +RWF D   +CP   PP+     RLP           
Sbjct  186   FFNSWSHLGRDHHQVSIPNPPTIDRWFLD---SCP---PPI-----RLPFADPQDFIRWI  234

Query  766   --PPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSN  939
               PP R    E   H S   IA +K +AN+EMGT  ISSLQ+ +  LWR+VTRAR L   
Sbjct  235   PYPPVR----ECALHFSARTIANIKSRANTEMGTDRISSLQALLGFLWRSVTRARRLDPA  290

Query  940   EDVHLILGIGMRARMG---LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKH  1110
             ++    + +G R+R+G   LP  Y GNA+  +     AG++   G GW A+ + + V   
Sbjct  291   QETTYFVLVGCRSRLGPSSLPATYLGNALTIVQAKSTAGELSEHGPGWAAFLLNRAVASS  350

Query  1111  SHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGN  1290
             S    +R     +   P+          + L   SSPRF++Y  DFGWG+PV VRSG GN
Sbjct  351   SGSM-LRDELEMWTREPSFTYMNQFKPCD-LITGSSPRFNIYDNDFGWGRPVAVRSGPGN  408

Query  1291  KLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
             K+DGK T++ G + GS+ +E+ + P  L  L  D EF++  T
Sbjct  409   KVDGKATIYPGPDPGSMALEVCLSPQALSSLIQDEEFMQVVT  450



>ref|XP_002876021.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52280.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   291 bits (744),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 160/435 (37%), Positives = 244/435 (56%), Gaps = 33/435 (8%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL FL +   Q+GLLF  P P        ++ I  LKTSLSS LD + P AGR
Sbjct  24    KIHLTPFDLNFLYVDYTQRGLLFPKPDP-------ETHFISRLKTSLSSALDIYFPFAGR  76

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              + V N ED+T S Y++CN +G  F+ A A  ++V+ +L Q + +VP   R  + +NG+ 
Sbjct  77    LSKVENHEDDTVSFYINCNGSGATFIHAVAESISVSDLL-QPDGSVPDFSRIFYPMNGVK  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             + DG+ +PL+G+Q+TE+ DG FI    NH + DG S WNFF +W+++       +  P+ 
Sbjct  136   SIDGVSEPLLGLQVTEMRDGVFIGFGYNHMVADGASIWNFFKTWSKICSNGQPENLQPLA  195

Query  688   ER-WFPDNTTTCPVHLPPMIESSERLPPPQRAF---LAERVFHLSKVNIARLKEKANSEM  855
              + WF D     P+H+P    S    PPP         ERVFH +K NI+ LK K NSE+
Sbjct  196   LKGWFVDGMD-FPIHIP---VSETETPPPSNELSPTFKERVFHFTKKNISDLKAKVNSEI  251

Query  856   GTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVFF  1023
             G+S   +SSLQ+  AH+WR++ R   L+  E     + + +R R+  P  +  +G+ ++ 
Sbjct  252   GSSDHKVSSLQAVSAHMWRSIIRHNGLNQEEKTRCFVAVDLRQRLNPPLEKECFGHVIYN  311

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEE-------VRKMYMKFVESPAHNGAEI  1182
                +   G++ G+GLGW   QI   +   ++E+        VR M ++       +G   
Sbjct  312   AIATTTVGELQGQGLGWAFLQINNMLRSLTNEDYRIWAENWVRNMKIQ------KSGLGS  365

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
               + +++ +SSSP F+VY  DFGWGKP+ VR+G  N + GK+ LF G EEG +D+   + 
Sbjct  366   KMTRDSVIVSSSPWFEVYDNDFGWGKPIAVRAGPSNSISGKLVLFRGIEEGCIDVHAFLL  425

Query  1363  PHTLLGLENDAEFLE  1407
                L+ L  D EFLE
Sbjct  426   SDVLVKLLADVEFLE  440



>ref|XP_010426570.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=449

 Score =   291 bits (744),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 168/443 (38%), Positives = 254/443 (57%), Gaps = 25/443 (6%)
 Frame = +1

Query  130   SNGVSR-RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDF  306
             SN   R ++ LTP+D   LQ    Q+GLLF  P P         NLI  LK SLS  LD 
Sbjct  18    SNQTGRTKIHLTPFDFSLLQFSSPQRGLLFPKPDPSF-------NLISQLKASLSLALDI  70

Query  307   FPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSL  486
             + P AGR     N EDNT S++VDC+++G  F+ A+A  V+V+ IL Q + +VP +L   
Sbjct  71    YFPFAGRLVKTENLEDNTVSLFVDCDDSGARFLHAEAKSVSVSDIL-QPDGSVPCVLDDF  129

Query  487   FTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFH  663
             F  NG+ N DG  +P++ VQ+TE+ DG FI  + NH +GDG S W+FF++W+++ S G  
Sbjct  130   FPRNGLKNCDGAPEPVLVVQVTEMKDGVFIGYSYNHLVGDGVSMWDFFHTWSKICSSGGS  189

Query  664   QPSTTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQRAF-----LAERVFHLSKVNIA  825
             +    P+  + WF +     P+H+P  +  +ER PPP R           + H +K NI+
Sbjct  190   EFKRKPLVLKGWFLEGIGY-PIHIP--VSMTERPPPPSRESSLVHSTKHWMLHFTKKNIS  246

Query  826   RLKEKANSEMGTS-IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPE  996
              LK KANSE+ +  +ISSLQ+  AH+WR++ R   L    +  L L + +R R+   L +
Sbjct  247   DLKAKANSEVSSDLVISSLQAVSAHMWRSIIRHSGLSQERETQLELVVDLRQRINPSLEK  306

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EEVRKMYMKFVESPAHN  1170
               +GN V+  T      ++L +GLGW A +I+K V    +E  +     +++ V++    
Sbjct  307   DCFGNMVYLATAVTTVEELLDRGLGWAALEIRKLVSSQMNENCKSFADDWVRNVKN-LKL  365

Query  1171  GAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIE  1350
             G +     +T+ I+SSPRF++Y  DFGWGKP+  RSG  +  +GK+TLF G  EGS+D++
Sbjct  366   GTDSKVDGDTIVIASSPRFEMYNKDFGWGKPIAARSGPSSSFNGKLTLFPGINEGSIDVQ  425

Query  1351  LSIHPHTLLGLENDAEFLEYFTI  1419
              ++    L+ L  D EFLE+  +
Sbjct  426   ATLRSDVLVNLLADMEFLEHVRL  448



>ref|XP_009777111.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=299

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 196/326 (60%), Gaps = 51/326 (16%)
 Frame = +1

Query  463   VPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWA  642
             VP I+ SLF LN + N + + KPL+G+Q+TEL+DGYFI CT++HS+GDGT FWNFFNSW+
Sbjct  18    VPPIVHSLFPLNKMRNIECVTKPLLGIQVTELVDGYFIGCTMSHSVGDGTCFWNFFNSWS  77

Query  643   ELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSE-----RLPPPQRAFLAERVFHL  807
             E+S G    S  P+ +RWFP+N    P+HLP  +E  E      LPP     L ER+FHL
Sbjct  78    EISNGSEFISRFPVLKRWFPENIKP-PIHLPLKLEDQELYECMELPP-----LKERIFHL  131

Query  808   SKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG  987
             SK NI +LK KANSEMGT                                     R R+ 
Sbjct  132   SKENIGKLKAKANSEMGT-------------------------------------RPRLN  154

Query  988   LP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
              P  EGYWGNA +F    I AG++L KGLGW A QI K V   ++ + V K+Y ++VE P
Sbjct  155   PPLAEGYWGNAAYFKPVKITAGELLEKGLGWAALQINKIVASQNN-DVVVKLYKEWVEKP  213

Query  1162  AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSV  1341
                       +N L ISSSP+F VY  DFGWGKPV VRSG  NK DGKVTLF G EEG+V
Sbjct  214   VLFTKSSLFVANRLTISSSPKFSVYSTDFGWGKPVAVRSGMANKGDGKVTLFPGAEEGNV  273

Query  1342  DIELSIHPHTLLGLENDAEFLEYFTI  1419
             DIE+ + P TLL +END EF+E  T+
Sbjct  274   DIEVCLLPKTLLAMENDEEFMEAVTV  299



>ref|NP_001060826.1| Os08g0111300 [Oryza sativa Japonica Group]
 dbj|BAD09498.1| putative AER [Oryza sativa Japonica Group]
 dbj|BAD09544.1| putative AER [Oryza sativa Japonica Group]
 dbj|BAF22740.1| Os08g0111300 [Oryza sativa Japonica Group]
 gb|EAZ41283.1| hypothetical protein OsJ_25790 [Oryza sativa Japonica Group]
 dbj|BAG99077.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   291 bits (746),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 244/450 (54%), Gaps = 37/450 (8%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+FL I  IQKG+L   P            L   L +S +  L  F P AGR 
Sbjct  43    IHLTPWDLRFLSIDYIQKGVLLPKPP------LSGDRLADALASSFARALALFYPFAGRL  96

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
                   +D T +V + C   G EFV A A GV V+ ++  S++  P  + S ++ N +L 
Sbjct  97    VAEERADDGTVTVALRCTGEGAEFVHAAAPGVAVSDVV--SSLYTPPEVWSFYSYNLVLG  154

Query  511   RDGIC--KPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG---------  657
              D     +P++  Q+TEL DG F+  +LNHS+GDGT+FW F N+W+E++R          
Sbjct  155   ADAATESRPVLSTQVTELADGVFVGMSLNHSVGDGTTFWKFMNAWSEINRRAGGAMSDDL  214

Query  658   -FHQPST-TPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIA  825
                + ST  P+  RWF + T+  P+ +P   +     RL  P+   + E  F  S  +  
Sbjct  215   MIREISTPAPVFRRWFVE-TSPVPIPMPVGKLQHIVRRLERPE---VQECFFTFSATSAR  270

Query  826   RLKEKANSEM---GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLP  993
             +LK KAN EM    TS ISSLQ+ +AHLWR V RAR L   +     + +G R R+ G+P
Sbjct  271   KLKAKANDEMSGAATSTISSLQAVLAHLWRGVCRARRLPPEQVTFYTVMVGCRGRVNGIP  330

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
              GY GNA+ F      AG++  KGLGW AWQ+ + V     E  +R+   ++V  P    
Sbjct  331   AGYVGNALMFGKAEATAGEIEEKGLGWTAWQLNRAVASF-DEAGMRESLERWVREPEFTY  389

Query  1174  AEIPSSSNTLGIS----SSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGS  1338
                  S +  G++    SSPRFDV+G DFGWG+PV VRSG GNK+DGK T+F G +  GS
Sbjct  390   MSKLQSGDAGGVALITGSSPRFDVFGNDFGWGRPVAVRSGAGNKIDGKATVFEGPDGAGS  449

Query  1339  VDIELSIHPHTLLGLENDAEFLEYFTIPGN  1428
             + +E+ I P  L  L  D EF++  T+P +
Sbjct  450   MSLEVCIAPDALRRLVADEEFMDAVTLPSS  479



>ref|XP_004163247.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=458

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 183/435 (42%), Positives = 252/435 (58%), Gaps = 29/435 (7%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             L P +L FL I  I KGLLFH P            L+H LK SLS+ L  F PL+GR AT
Sbjct  35    LGPSELVFLSIHYIYKGLLFHKPPDHGVHFMVP--LLHRLKNSLSTALFHFYPLSGRLAT  92

Query  337   VMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNGILN  510
               N       VYVDC N+ G +F+ A A  +TV+ IL  S ++VP  +++SLF LN I+N
Sbjct  93    ATNN-----GVYVDCVNSPGAKFIHA-ALDITVSDIL--SPLHVPSSLIQSLFDLNKIVN  144

Query  511   RDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--------GFHQ  666
              DG   PL+ +Q+TELLDG FIAC+ NHSLGDGTSF NFFN W+E+ +        G   
Sbjct  145   YDGHTLPLLSIQVTELLDGVFIACSFNHSLGDGTSFCNFFNMWSEIFQAQGDGDGDGVIS  204

Query  667   PSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKAN  846
              S  PI ERWFPD      ++LPP ++  E+   P+   L  R FH S   IA LK KAN
Sbjct  205   ISRPPILERWFPDGYGPT-INLPPFVQ-LEQFEAPE---LRRRFFHFSAELIANLKAKAN  259

Query  847   SEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM--GLPEGYWGNAVF  1020
             +E  T  ISS QS  A +W+A+TRAR +  ++     + +  R R+   LPE Y GN + 
Sbjct  260   AECKTKEISSFQSLSALVWKAITRARCIKQDQSTRCHMAVNYRGRLKPALPENYLGNMIT  319

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
              +    +AG+++  GLGW AW++ + V   ++ E +R+   K+++ P        S+   
Sbjct  320   SVKVDAEAGELVETGLGWGAWKLHEAVTNITN-EMIRESLEKWIQCPFTLRWSSVSNPCI  378

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHTLL  1377
             + I+SS RF++YG  FG GK + V SG GN +DGKV  + G E  GSVD+E+ + P T+ 
Sbjct  379   VLITSSSRFNMYGTKFGMGKAMGVLSGYGNTIDGKVVAYPGYEGGGSVDLEICLQPQTMA  438

Query  1378  GLENDAEFLEYFTIP  1422
              LE+D EF+   + P
Sbjct  439   NLESDLEFMNAISSP  453



>emb|CDY01434.1| BnaA07g12070D [Brassica napus]
Length=445

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/436 (39%), Positives = 254/436 (58%), Gaps = 26/436 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLLF  P P        +++I  LK+SLS  L  F P AGR
Sbjct  23    KIHLTPWDLFFLRSDYPQRGLLFPKPDP-------ETDIISQLKSSLSVALSIFYPFAGR  75

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                  NE D T S  VDC+ +GV+F+ A A  V+++ +L+  N  VP+ L  LF  NG+ 
Sbjct  76    LVKTENENDETASFLVDCDGSGVKFIHASAKTVSLSDVLEPVNGIVPEFLNRLFPANGVK  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTP-  681
             + +G+ + L+  Q+TEL DG FIA   NH + DG+SFW+FFN+W+E+ S G  +   +P 
Sbjct  136   SCEGVSESLIAFQVTELRDGVFIAFGYNHMVADGSSFWSFFNTWSEICSTGVDRDKKSPP  195

Query  682   -IHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
              +   WF D     P+ +P     S         + L E++F  ++ NI+ LK KAN E+
Sbjct  196   LLLRGWFLDGIDH-PIRIPISETVSPSPPVTSSSSLLREKLFRFTRRNISELKSKANGEV  254

Query  856   GTSI--ISSLQSYMAHLWRAVTRARNLHSNED-VHLILGIGMRARMGLP--EGYWGNAVF  1020
              +    ISSLQ+  AH+WR++ +  +L+  E+ V+  L + MR R+  P  +  +GN V 
Sbjct  255   SSDDRRISSLQAVSAHMWRSIIKNSDLNPEEEVVYCKLLMDMRRRLNPPLDKECFGNVVG  314

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP---SS  1191
             F T +  AG+++  GLGW A QI KTV   + +E  R     +V+ P     +IP   + 
Sbjct  315   FATATTTAGEMVSNGLGWAALQINKTVGAQT-DEGFRVFAGNWVKEP-----KIPNHVAV  368

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
             S ++ ++SSP F+VYG DFGWGKP+ VR+G GN  DGK+ ++ G EEG+++I+  +  H 
Sbjct  369   SKSVIVASSPWFNVYGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIEEGNIEIQTCLSSHV  428

Query  1372  LLGLENDAEFLEYFTI  1419
             L  L  DAEFLE+  +
Sbjct  429   LEKLSADAEFLEHACV  444



>ref|XP_003603067.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73318.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=456

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 174/445 (39%), Positives = 252/445 (57%), Gaps = 16/445 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S CF+      + +  ++   LT WD+  L    IQKGLLF  PT    QQ F  NL+ 
Sbjct  9     VSACFIKPYPPIKDS--NQICYLTHWDIAMLSTHYIQKGLLFKKPTSSLNQQHFIENLVD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  + PL+GR  T  +E+ ++ +V+VDC N+ G  F+ A    +T+  IL 
Sbjct  67    KLKHSLSLTLFHYYPLSGRLVTKKSEDPHSYTVFVDCKNSRGARFIHATLD-ITINDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++VP I++S F  +  ++ DG    L+ +Q+TELLDG FI C++NH +GDGT +WNF
Sbjct  125   -SPVDVPPIVQSFFDHDKAVSHDGHTMSLLTIQVTELLDGVFIGCSMNHCIGDGTGYWNF  183

Query  628   FNSWAELSRG----FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             FNS++E+ +         S  PIH RWFP      P+   P     E +   + + L ER
Sbjct  184   FNSFSEIFQNDIHVLVPISHQPIHNRWFPQGYG--PIINLPFKHHEEFVHRYETSILRER  241

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             +FH S  +I +LK KAN E  T  ISS QS  A +WR++TRAR L   +     L    R
Sbjct  242   IFHFSAESIMKLKAKANEESNTRKISSFQSLSALVWRSITRARQLQHGQRTTCKLATNNR  301

Query  976   ARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
              RM   LP+ Y+GN++  ++     G++L   LGW AW+I   V  H  ++ VR+   ++
Sbjct  302   TRMEPPLPKEYFGNSLHAVSAETTVGELLENDLGWAAWKIHLAVVNHD-DKVVRRSVEEW  360

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
               SP     ++     T+ + SSPRF++YG +FG GK + VRSG  NK DGKVT + G E
Sbjct  361   FRSPFVYRTDLFFDPYTVMMGSSPRFNMYGNEFGMGKVLAVRSGYANKFDGKVTSYPGQE  420

Query  1330  -EGSVDIELSIHPHTLLGLENDAEF  1401
               GS+D+E+ + P  ++ LE D EF
Sbjct  421   GGGSIDLEVCLSPEKMMALEADEEF  445



>ref|XP_008452576.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=462

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 177/454 (39%), Positives = 254/454 (56%), Gaps = 31/454 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqq-qffNSNLI  267
             IS CF+        +  ++   L P DL  L +   QKGLLFH P         F   L+
Sbjct  11    ISHCFITHEYLPPQS--NQPFYLGPSDLLVLSVHYNQKGLLFHKPPEAFNHGDHFMVTLL  68

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAAIL  444
             H LK+SLS+TL  F PL GR AT  N       +YVDC N+ G +F+ A    +T + IL
Sbjct  69    HRLKSSLSATLFHFYPLTGRLATTTNG-----IIYVDCINSPGAKFIHAALDNITASDIL  123

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S ++VP +++SLF LN ++N DG   PL+ +Q+TELLD  FIAC+ NH LGDGTSFWN
Sbjct  124   --SPLHVPSLVQSLFDLNKVVNYDGQTLPLLSIQVTELLDAVFIACSFNHCLGDGTSFWN  181

Query  625   FFNSWAELSRGFHQPSTT-----------PIHERWFPDNTTTCPVHLPPMIESSERLPPP  771
             FFN W+E+   F  PS+            PI ERWFPD     P+   P  + S+ +   
Sbjct  182   FFNMWSEI---FQAPSSEDGHAIISISQPPILERWFPDGYD--PIINLPFTDPSQFISRF  236

Query  772   QRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVH  951
             +   L  R FH S  +IA LK KAN E  T  ISS Q+  A +WRA+TRAR +  ++   
Sbjct  237   EAPELRRRFFHFSAKSIADLKAKANEECDTKDISSFQTLTALVWRAITRARRIPLDQSTC  296

Query  952   LILGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEE  1125
              ++    R R+   L E Y GN +  +    K G+++ + LGW AW++ + V+  ++ E+
Sbjct  297   CMMSANYRRRLKPALRENYLGNMITSVKADAKVGELVERRLGWGAWKLHEAVKNLTY-EK  355

Query  1126  VRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGK  1305
             +R+   ++++ P         + N + +    RF+VYG++FG GK V VRSG GN  DGK
Sbjct  356   IRESLEEWIKCPYTYQWGSILNPNIIKMGGWSRFNVYGSEFGMGKAVGVRSGYGNTFDGK  415

Query  1306  VTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             V ++ GCE  GS+D+E+ + P  +  LE+D EF+
Sbjct  416   VIVYPGCEGGGSIDLEICLLPQNMANLESDLEFM  449



>ref|XP_003571295.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=465

 Score =   290 bits (742),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 171/446 (38%), Positives = 241/446 (54%), Gaps = 39/446 (9%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDLQ + +  IQKG+L             +S+ +  L +S +  L  F P AGR 
Sbjct  31    IHLTPWDLQMVTVEHIQKGILLPK------HPQGHSHAVERLASSFALALGRFYPFAGRL  84

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
                  ++D   ++ + C+  G EFV A A GVTVA I   S + VP ++ S F L+G+L 
Sbjct  85    TVEELQQDGGIAMSLRCSGEGAEFVHAVAPGVTVADI--TSPVYVPPVVWSFFPLDGVLG  142

Query  511   RDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR----------  654
              D      P++ VQ TEL DG F+A +LNH + DGT+FW+FFN+W+E+SR          
Sbjct  143   LDAAVASLPVLAVQATELDDGVFLAMSLNHGVADGTTFWHFFNTWSEISRRSGNHDAAAI  202

Query  655   GFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA---FLAERVFHLSKVNIA  825
             G    S  P+ +RWFP+    CP+ +P   +  E +   QRA    + E  F  S  ++ 
Sbjct  203   GCEIASPLPLLQRWFPEG---CPIPIPLPFDKPEDIVGEQRAKYPSVQECFFRFSAESVK  259

Query  826   RLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLPE  996
              LK KAN+EM    + ISSLQ+  AH+WRAV RAR L  ++DV  I+ +G R R+  +P 
Sbjct  260   ELKAKANAEMAGAPATISSLQALFAHMWRAVCRARRLARDQDVTYIILVGCRGRLESMPS  319

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG-  1173
              Y GNAV  I     AG++L KGLGW  W + + V   +      +        P + G 
Sbjct  320   AYMGNAVSLIMARSTAGEILDKGLGWAGWLLNRAVASFNMASATAET----ASWPRNPGF  375

Query  1174  ----AEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGS  1338
                 A +      L   SSPRFD+YG DFGWG PV VRSG  NK+DGK+T++ G E  GS
Sbjct  376   VRPLASVLDGQPKLSTGSSPRFDIYGNDFGWGSPVTVRSGSANKVDGKMTVYEGGEGAGS  435

Query  1339  VDIELSIHPHTLLGLENDAEFLEYFT  1416
             + +E+ + P  L  L  D EF++  +
Sbjct  436   MALEVCLAPEALARLVADQEFMDVVS  461



>ref|XP_010515389.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=448

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 164/434 (38%), Positives = 250/434 (58%), Gaps = 23/434 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+D   LQ    Q+GLLF  P P         +LI  LK+SLS  LD + P AGR
Sbjct  25    KIHLTPFDFSLLQFSSPQRGLLFPKPDPSF-------HLISQLKSSLSLALDIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                  N EDNT S++VDC+++G  F+ A+A  V+V+ IL Q + +VP  L   F  NG+ 
Sbjct  78    LVKTENLEDNTVSLFVDCDDSGARFLHAEAKSVSVSDIL-QPDGSVPCFLDDFFPRNGLK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTPI  684
             N DG  +PL+ VQ+TE+ DG FI  + NH + DG S W+FF++W+++ S G        +
Sbjct  137   NCDGAPEPLLVVQVTEMNDGVFIGYSYNHMVADGVSMWDFFHTWSKICSSGSCFDHKPLV  196

Query  685   HERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER----VFHLSKVNIARLKEKANSE  852
              +RWF +     P+H+P  +  +ER P  + +   +     + H +K NI+ LK KANSE
Sbjct  197   LKRWFLEGIDY-PIHIP--VSMTERPPTSRESSSVDTTKHWMLHFTKKNISDLKAKANSE  253

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +G+S  +ISS Q+  AH+WR++ R   +    +    L + +R R+  P  +  +GN V+
Sbjct  254   VGSSDMVISSFQAVSAHMWRSIIRHSGISQERETQCKLVVDIRQRINPPLEKDCFGNMVY  313

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS--SS  1194
               +      ++L +GLGW A +I+K V   ++E   R     +V++  +    I S    
Sbjct  314   LASAVTTVEELLDRGLGWAALEIRKLVSSQTNEN-CRSFAEDWVKNVKNLKLGIGSKVDG  372

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTL  1374
             +T+ I+SSPRF+VY  DFGWGKP+  RSG  + L+GK+TLF G  EGS+D++ ++    L
Sbjct  373   DTIAIASSPRFEVYNKDFGWGKPIAARSGPSSSLNGKLTLFPGINEGSIDVQATLRSDIL  432

Query  1375  LGLENDAEFLEYFT  1416
             + L  D EFLE+ T
Sbjct  433   VNLLADVEFLEHVT  446



>ref|XP_003525889.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=456

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 179/451 (40%), Positives = 257/451 (57%), Gaps = 21/451 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLI  267
             +S+CFV      + +  ++   LTPWD+  L +  IQKGLLF  P T    Q  F  NL+
Sbjct  10    VSECFVKPHCPGQES--NQICNLTPWDIAMLSVHYIQKGLLFKKPPTTLVDQHDFIENLL  67

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN--AGVEFVEAKASGVTVAAI  441
               LK SLS TL  F PLAGR  T   ++  + +V VDCNN   G  F+ A    +T++ I
Sbjct  68    EKLKHSLSLTLFHFYPLAGRLVTQKTQDPPSYAVLVDCNNNSDGARFIYATLD-MTISDI  126

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             +  S I+VP I+ SLF  +  +N DG   PL+ +Q+T+L+D  FI C++NH +GDGTS+W
Sbjct  127   I--SPIDVPPIVHSLFDHHKAVNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYW  184

Query  622   NFFNSWAELSRG------FHQP-STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN+W+E+ +       +  P S  PIH RWFP+     P+   P     E +   +  
Sbjct  185   NFFNTWSEIFQAQAEGHEYDVPISHNPIHNRWFPE--LYGPLINLPFKNHDEFISRFESP  242

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KAN E  T+ ISS QS  A +WR++TRAR++   +     L
Sbjct  243   KLRERIFHFSAESIAKLKAKANKECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKL  302

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R+RM   LP+ Y+GN++  ++      ++L  GLGW AW++   V  H+    V  
Sbjct  303   ATDNRSRMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHN-ASAVLD  361

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                +++ESP             + + SSPRF++YG +FG GK V VRSG  NK DGKVT 
Sbjct  362   FLKEWLESPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTS  421

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             + G E  GS+D+E+ + P T+  LE+D EF+
Sbjct  422   YPGHEGGGSIDLEVCLSPDTMSALESDDEFM  452



>ref|XP_010438408.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=451

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/433 (38%), Positives = 243/433 (56%), Gaps = 19/433 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL     QKGLLF  P+         +N+I  LK+SLS  L  F P AGR
Sbjct  28    KIHLTPWDLIFLGSEYAQKGLLFPQPS------DPETNIIPRLKSSLSIALKIFYPFAGR  81

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N++D T S YVDCN +GV FV A AS V+V  +L+  +  VP+ L+  F  NG+ 
Sbjct  82    LVKIENDDDGTSSFYVDCNGSGVRFVHASASSVSVTDVLEPVDGTVPEFLKRFFPCNGVK  141

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGFHQPSTTP-  681
             + +GI   L+ +Q+TEL DG FI    +H + DGTS WNF N W+E+   G     T P 
Sbjct  142   SLEGISDSLIAIQVTELKDGVFIGVGYSHLVTDGTSIWNFSNIWSEICFNGSDHRRTFPP  201

Query  682   -IHERWFPDNTTTCPVHLPPMI--ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              +H  WF D     P+ +P  +  E+ + +       L E++F  +  NI+ LK KAN E
Sbjct  202   LVHRGWFLDGIEY-PIRMPASLTPETPDVVSTSSSILLQEKIFRFTSENISELKAKANDE  260

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +      ISSLQ+  A++WR++ R   L S E +   L + +R R+  P  +   GN V 
Sbjct  261   VSPDDRKISSLQAVSAYMWRSIVRNSGLSSEEVICCRLIVDLRRRLDPPLEKDCCGNMVG  320

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
                 +   G++   GLGW A +I K+V   ++ EE R     +V++P+    ++ + +NT
Sbjct  321   TAITTTTVGEMFNNGLGWAALKINKSVXSQTN-EEFRNFAADWVKNPSLR--DVNTLTNT  377

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
               ++SSPRF+VYG DFGWGKP+  R+G G   DGK+  + G E+G+++I+  +    L  
Sbjct  378   TAVTSSPRFNVYGNDFGWGKPIAARAGPGITYDGKLVAYPGIEQGNIEIQACLSSSVLAK  437

Query  1381  LENDAEFLEYFTI  1419
             L +DAEFL++  +
Sbjct  438   LSSDAEFLKHACV  450



>gb|ABC47860.1| N-hydroxycinnamoyl/benzoyltransferase 1 [Glycine max]
Length=455

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 179/451 (40%), Positives = 257/451 (57%), Gaps = 21/451 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLI  267
             +S+CFV      + +  ++   LTPWD+  L +  IQKGLLF  P T    Q  F  NL+
Sbjct  9     VSECFVKPHCPGQES--NQICNLTPWDIAMLSVHYIQKGLLFKKPPTTLVDQHDFIENLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN--AGVEFVEAKASGVTVAAI  441
               LK SLS TL  F PLAGR  T   ++  + +V VDCNN   G  F+ A    +T++ I
Sbjct  67    EKLKHSLSLTLFHFYPLAGRLVTQKTQDPPSYAVLVDCNNNSDGARFIYATLD-MTISDI  125

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             +  S I+VP I+ SLF  +  +N DG   PL+ +Q+T+L+D  FI C++NH +GDGTS+W
Sbjct  126   I--SPIDVPPIVHSLFDHHKAVNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYW  183

Query  622   NFFNSWAELSRG------FHQP-STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN+W+E+ +       +  P S  PIH RWFP+     P+   P     E +   +  
Sbjct  184   NFFNTWSEIFQAQAEGHEYDVPISHNPIHNRWFPE--LYGPLINLPFKNHDEFISRFESP  241

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KAN E  T+ ISS QS  A +WR++TRAR++   +     L
Sbjct  242   KLRERIFHFSAESIAKLKAKANKECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKL  301

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R+RM   LP+ Y+GN++  ++      ++L  GLGW AW++   V  H+    V  
Sbjct  302   ATDNRSRMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHN-ASAVLD  360

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                +++ESP             + + SSPRF++YG +FG GK V VRSG  NK DGKVT 
Sbjct  361   FLKEWLESPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTS  420

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             + G E  GS+D+E+ + P T+  LE+D EF+
Sbjct  421   YPGHEGGGSIDLEVCLSPDTMSALESDDEFM  451



>ref|XP_004501559.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=460

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 178/447 (40%), Positives = 253/447 (57%), Gaps = 18/447 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAA-RSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             +S+CF+        SN +     LT WD+    +  IQKGLLF  PTP   QQ F +NL+
Sbjct  9     VSECFIKPINPIHESNHICY---LTTWDIAMSSMHYIQKGLLFKKPTPPNNQQNFINNLL  65

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC--NNAGVEFVEAKASGVTVAAI  441
               LK SLS  L  F PL+G   T   ++    +++VDC  NN+G +F+ A  + +TV+ I
Sbjct  66    EKLKHSLSIALFHFYPLSGHLVTHKTQDPPAYNIFVDCSNNNSGAKFIYATLN-MTVSDI  124

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  + I+VP I+ S F LN I+N DG   PL+ +QITELLDG FI C++NH + DGTS+W
Sbjct  125   L--TPIHVPPIVESFFDLNKIVNHDGHTMPLLSIQITELLDGVFIGCSMNHHIADGTSYW  182

Query  622   NFFNSWAELSRGFHQ---PSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAE  792
             NFFN+W+E+ +        S  P H RWFP+     P+   P     E +   ++  L E
Sbjct  183   NFFNTWSEIFQAEDHGVPISHQPFHNRWFPNGYG--PLINLPFKHHDEFISRFEKPELRE  240

Query  793   RVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             R FH +  +IA+LK KAN E  T+ ISS QS  AH+WR VTRAR L  +      L I  
Sbjct  241   RFFHFTTESIAKLKAKANIESNTNKISSFQSLSAHVWRCVTRARGLAKDRKTSCQLAINN  300

Query  973   RARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
             R RM   LPE Y+G+ +  ++     G+++   LGW AW++   V ++  + +VRK+  +
Sbjct  301   RPRMEPQLPEEYFGSCINTVSAEASVGELVENDLGWAAWKVHVAVVEYD-DIKVRKIVKE  359

Query  1147  FVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGC  1326
             ++E P     +      ++ + SSPRF++YG +FG GK V V SG  NK DG VT + G 
Sbjct  360   WLECPVIFQVKRHFDPLSVAMISSPRFNMYGNEFGMGKAVAVLSGYANKCDGNVTAYEGR  419

Query  1327  E-EGSVDIELSIHPHTLLGLENDAEFL  1404
             E  GS D+E+ +    +  LE D  FL
Sbjct  420   EGGGSSDLEICLSHDAMTNLELDETFL  446



>ref|XP_003571308.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=465

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 176/439 (40%), Positives = 243/439 (55%), Gaps = 29/439 (7%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+ L I  IQ G+L   P            L+  L +SL+  L+ +   AGR 
Sbjct  40    IHLTPWDLRLLTIDYIQFGILLPKPP------TGGDRLVDGLASSLARALERYYHFAGRL  93

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQ-ILRSLFTLNGIL  507
             AT  + ED T ++ + C N G E V A A GV V  I+   ++ +P  ++ + F LNG+L
Sbjct  94    ATNEHGEDATVTISLRCTNEGAELVHASAPGVAVTDII--GSVYIPSSVVWAFFPLNGVL  151

Query  508   NRDGICKPL--MGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT-  678
               D   KPL  + VQ+TEL DG F+  +LNH + DGT FW FFN+W+E+SRG ++   + 
Sbjct  152   GVDAAIKPLPVLAVQVTELADGVFVGMSLNHGVADGTVFWEFFNTWSEISRGDNKDMISR  211

Query  679   --PIHERWFP-DNTTTCPVHLPPMIESSER--LPPPQRAFLAERVFHLSKVNIARLKEKA  843
               P+H+RWF   N    P+ L  +  + +R  LP  Q AF     F  S  +I +LK +A
Sbjct  212   PAPVHQRWFVGTNPVPIPLPLSKLQHAIQRFELPLVQEAF-----FTFSAASIKKLKARA  266

Query  844   NSEM---GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLPEGYWGN  1011
             N EM     + ISSLQ+ +AHLWRAV RAR L   ++    L  G R R+ G+  GY GN
Sbjct  267   NEEMAGGAAATISSLQALLAHLWRAVCRARRLLPEQETSYTLIFGCRGRVDGILPGYVGN  326

Query  1012  AVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN-GAEIPS  1188
             AV        AGD+L KGLGW AWQ+ + V+    E  VR+   ++   P       + +
Sbjct  327   AVLPRKTRCVAGDILDKGLGWTAWQLNRAVDLFD-EASVREFLDRWPREPTFAFVGNVSA  385

Query  1189  SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE-GSVDIELSIHP  1365
                 L    SPRFD++G DFGWGKPV VRSGGG K DG   +F G E+ GS+ +EL + P
Sbjct  386   GGTGLTTGGSPRFDMFGNDFGWGKPVAVRSGGGFKTDGNADVFEGPEKGGSMSLELCLVP  445

Query  1366  HTLLGLENDAEFLEYFTIP  1422
               L  L  D EF++  ++P
Sbjct  446   DVLGRLVADDEFMDAVSVP  464



>ref|XP_004163246.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=460

 Score =   289 bits (739),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 179/453 (40%), Positives = 257/453 (57%), Gaps = 30/453 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN---SN  261
             IS CF+        +  ++   L P +L  L +   QKGLLFH P PQ      +     
Sbjct  11    ISHCFITHENLPPQS--NQPFYLGPSELLLLSVHYNQKGLLFHKP-PQAAFNHGDLFMVT  67

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAA  438
             L+H LKTSLS+TL  F PL GR AT  N       +YVDC N+ G +F+ A A  +TV+ 
Sbjct  68    LLHRLKTSLSATLFHFYPLTGRLATTTN------GIYVDCINSPGAKFIHA-ALDITVSD  120

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S ++VP +++S F LN  LN DG   PL+ +Q+TELLDG FIAC+ NH LGDGTS 
Sbjct  121   IL--SPLHVPSLVQSFFDLNKALNYDGQTLPLLSIQVTELLDGVFIACSFNHCLGDGTSI  178

Query  619   WNFFNSWAEL--------SRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             WNFFN+W+++        S G +  S  PI +RWFPD     PV   P  + S+ +   +
Sbjct  179   WNFFNTWSDVFQAPSSEDSYGINSISQPPILDRWFPDGYD--PVINIPFTDPSQFISRFE  236

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                L  R FH S  +IA LK KAN E  T  ISS Q+  A +WRA+TRAR +  ++    
Sbjct  237   VPELRRRFFHFSAKSIADLKAKANKECNTKDISSFQTLTALVWRAITRARRIPLDQSTCC  296

Query  955   ILGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             ++    R R+   LPE Y GN +  +    K G+++ +GLGW A ++ + V+  ++ E++
Sbjct  297   VMSANYRGRLKPALPENYLGNMITSVKADAKVGELVERGLGWGARKLHEAVKNLTY-EKI  355

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+   ++++ P         + N + +    +F+VYG++FG GK V VRSG GN  DGKV
Sbjct  356   RESLEEWIKCPYTYQWGSILNPNIIKMGGWSKFNVYGSEFGMGKAVGVRSGYGNTFDGKV  415

Query  1309  TLFGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              ++ GCE  GSVD+E+ + P  +  LE+D E +
Sbjct  416   IVYPGCEGGGSVDLEICLLPQNMANLESDLELM  448



>ref|XP_006404046.1| hypothetical protein EUTSA_v10010370mg [Eutrema salsugineum]
 gb|ESQ45499.1| hypothetical protein EUTSA_v10010370mg [Eutrema salsugineum]
Length=449

 Score =   288 bits (737),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 166/438 (38%), Positives = 251/438 (57%), Gaps = 31/438 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  LQI   Q+GLLF  P P       + NLI  LK SLS  L+ + P AGR
Sbjct  25    KIHLTPYDLSLLQIDYAQRGLLFPKPDP-------DFNLITRLKASLSLALEIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V N EDNT S ++DC+ +G  F  A+A  V+V+ +L+    +VP  ++  F      
Sbjct  78    LAKVENLEDNTVSFFIDCDGSGARFHHAEAKSVSVSDVLEPHG-SVPDFMKQFFPAKDFK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL----SRGFHQPST  675
             N DG+ +PL+ +Q+TE+ DG FI    NH + DG S W+F ++W+++    S   HQP  
Sbjct  137   NCDGVTEPLLALQVTEMKDGVFIGYCYNHLVADGVSMWSFLHTWSKICSSGSGSEHQPL-  195

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA-----ERVFHLSKVNIARLKEK  840
               + + WF +     P+H+P  +  +ER PPP R   +     +RVFH +K NI+ LK K
Sbjct  196   --VLKGWFLERIDY-PIHIP--VSEAER-PPPSRELSSVPVTKDRVFHFTKKNISDLKAK  249

Query  841   ANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWG  1008
             AN E+G+S   ISSLQ   AH+WR++ R   L    +    + + +R R+  P  +  +G
Sbjct  250   ANDEVGSSDLKISSLQVVSAHMWRSIIRHSGLSREGETRCKVVVDLRQRINPPLEKECFG  309

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EEVRKMYMKFVESPAHNGAEI  1182
             N V+         ++L +GLGW A QI K V   ++E  +   + +++ V++   +G   
Sbjct  310   NMVYIAPAIATVEELLDRGLGWAALQINKLVNSQTNENCKTFAEDWVRNVKN-LKSGVGS  368

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
              ++ NT+ +SSSPRF VY  DFGWGKP+ VR+G GN + GK+ LF G +EGS+D++ ++ 
Sbjct  369   RTAGNTVVVSSSPRFQVYNKDFGWGKPIAVRAGPGNSISGKLVLFPGIDEGSIDVQATLW  428

Query  1363  PHTLLGLENDAEFLEYFT  1416
                L+ L  D +FLE  T
Sbjct  429   CDVLVNLLVDVDFLENVT  446



>emb|CDY12811.1| BnaC07g16220D [Brassica napus]
Length=473

 Score =   289 bits (739),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 170/434 (39%), Positives = 251/434 (58%), Gaps = 26/434 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+GLLF  P P        +++I  LK+SLS  L FF P AGR
Sbjct  55    KIHLTPWDLFFLRSEYPQRGLLFPKPDP-------ETDIISQLKSSLSLALKFFYPFAGR  107

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                V  E D   S  VDC+ +GV+F+ A A  V+V+ +L+  N  VP+ L   F  NG+ 
Sbjct  108   L--VKTEHDKAASFLVDCDGSGVKFIHASAKTVSVSDVLEPVNGIVPEFLPRFFPANGVK  165

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTP-  681
             + +G  + L+  Q+TEL DG FIA   NH + DG+SFW+FFN+W+E+ S G  +    P 
Sbjct  166   SCEGTSESLIAFQVTELRDGVFIAFGYNHMVADGSSFWSFFNTWSEICSTGVDRNKKFPP  225

Query  682   -IHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMG  858
              +   WF D     P+ +P         P    + L E++F  ++ NI+ LK KAN E+ 
Sbjct  226   LLLRGWFLDGIDH-PIRIPISETVPPSSPVASSSLLQEKLFRFTRRNISELKSKANGEVS  284

Query  859   TS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVFFI  1026
             +    ISSLQ+  AH+WR++ +  +L+  E V+  L + MR R+  P  +  +GN V F 
Sbjct  285   SDDRKISSLQAIAAHMWRSIIKNSDLNPEEVVYCKLLMDMRRRLNPPLDKECFGNVVGFA  344

Query  1027  TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIP---SSSN  1197
             T +  AG+++  GLGW A QI KTV   + +E  R     +V+ P     +IP   + SN
Sbjct  345   TATTTAGEMVSNGLGWAALQINKTVGSQT-DEGFRMFAGNWVKEP-----KIPNHVAVSN  398

Query  1198  TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLL  1377
             ++ ++SSP F+VYG DFGWGKP+ VR+G GN  DGK+ ++ G EEG+++I+  +  H L 
Sbjct  399   SVIVASSPWFNVYGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIEEGNIEIQTCLSSHVLK  458

Query  1378  GLENDAEFLEYFTI  1419
              +  DAEFLE+  +
Sbjct  459   KISADAEFLEHACV  472



>gb|ACU20865.1| unknown [Glycine max]
Length=459

 Score =   288 bits (738),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 180/456 (39%), Positives = 260/456 (57%), Gaps = 23/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+        +  ++   L PWD+  L    IQKGLLF  P     QQ F  NL+ 
Sbjct  9     ISECFIKPHRPIEES--NQICYLAPWDIILLSYHYIQKGLLFKKPPTLVDQQNFIENLLE  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAGR  T   ++  + + +VDC N+ G  F+ A    +T++ IL 
Sbjct  67    KLKHSLSFTLSHFYPLAGRLVTHTTQDPPSYAFFVDCKNSDGARFIYASLD-MTISDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              + ++VP IL S F  +  +N DG   PL+ +Q+TEL+D  FI C++NH+LGDGTS+WNF
Sbjct  125   -APVDVPPILHSFFDHHKAVNHDGHTMPLLSIQVTELVDAVFIGCSMNHTLGDGTSYWNF  183

Query  628   FNSWAELSR------GFHQP-STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FN+W+++ +      G++ P S  PI  RWFP +     V+L P     E +   +  FL
Sbjct  184   FNTWSQIFQSQAQGHGYNVPISHPPILNRWFPSDCDPS-VNL-PFKHHDEFICNFEAPFL  241

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFH S  +IA+LK KANSE  T+ ISS QS  A +WR++T AR++   +     + I
Sbjct  242   RERVFHFSAESIAKLKAKANSESNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAI  301

Query  967   GMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R+RM   +PE Y+GN V  ++      ++L   LGW AW +   V  H+ ++ V +  
Sbjct  302   NNRSRMEPPMPEEYFGNLVQVVSAETTTRELLENDLGWAAWLLHVAVTNHN-DKVVLQSL  360

Query  1141  MKFVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
               +++SP     G      S  +G  SSPRF+ YG +FG GK V +RSG  NK DGKVT 
Sbjct  361   QGWLQSPFIPQIGRLFDPYSVLMG--SSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTS  418

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + G E  GS+D+E+ + PH +  LE+D EF+   ++
Sbjct  419   YPGREGGGSIDLEVCLLPHIMRALESDKEFMNAVSV  454



>gb|KHN22332.1| Putative acetyltransferase [Glycine soja]
Length=456

 Score =   288 bits (737),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 179/451 (40%), Positives = 256/451 (57%), Gaps = 21/451 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNP-TPqqqqqffNSNLI  267
             +S+CFV      + +  ++   LTPWD+  L +  IQKGLLF  P T    Q  F  NL+
Sbjct  10    VSECFVKPHCPGQES--NQICNLTPWDIAMLSVHYIQKGLLFKKPPTTLVDQHDFIENLL  67

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN--AGVEFVEAKASGVTVAAI  441
               LK SLS TL  F PLAGR  T   ++  + +V VDCNN   G  F+ A    +T++ I
Sbjct  68    EKLKHSLSLTLFHFYPLAGRLVTQKTQDPPSYAVLVDCNNNSDGARFIYATLD-MTISDI  126

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             +  S I+VP I+ SLF  +  +N DG   PL+ +Q+T+L+D  FI C++NH +GDGTS+W
Sbjct  127   I--SPIDVPPIVHSLFDHHKAVNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYW  184

Query  622   NFFNSWAELSRG------FHQP-STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRA  780
             NFFN+W+E+ +       +  P S  PIH RWFP+     P+   P     E +   +  
Sbjct  185   NFFNTWSEIFQAQAEGHEYDVPISHNPIHNRWFPE--LYGPLINLPFKNHDEFISRFESP  242

Query  781   FLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              L ER+FH S  +IA+LK KAN E  T+ ISS QS  A +WR++TRAR++   +     L
Sbjct  243   KLRERIFHFSAESIAKLKAKANKECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKL  302

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                 R+RM   LP+ Y+GN++  ++      ++L  GLGW AW++   V  H+    V  
Sbjct  303   ATDNRSRMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHN-ASAVLD  361

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
                 ++ESP             + + SSPRF++YG +FG GK V VRSG  NK DGKVT 
Sbjct  362   FLKVWLESPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTS  421

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             + G E  GS+D+E+ + P T+  LE+D EF+
Sbjct  422   YPGHEGGGSIDLEVCLSPDTMSALESDDEFM  452



>ref|XP_004141265.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55212.1| hypothetical protein Csa_4G640980 [Cucumis sativus]
Length=460

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 179/453 (40%), Positives = 257/453 (57%), Gaps = 30/453 (7%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN---SN  261
             IS CF+        +  ++   L P +L  L +   QKGLLFH P PQ      +     
Sbjct  11    ISHCFITHENLPPQS--NQPFYLGPSELLLLSVHYNQKGLLFHKP-PQAAFNHGDLFMVT  67

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVAA  438
             L+H LKTSLS+TL  F PL GR AT  N       +YVDC N+ G +F+ A A  +TV+ 
Sbjct  68    LLHRLKTSLSATLFHFYPLTGRLATTTN------GIYVDCINSPGAKFIHA-ALDITVSD  120

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S ++VP +++S F LN  LN DG   PL+ +Q+TELLDG FIAC+ NH LGDGTS 
Sbjct  121   IL--SPLHVPSLVQSFFDLNKALNYDGQTLPLLSIQVTELLDGVFIACSFNHCLGDGTSI  178

Query  619   WNFFNSWAEL--------SRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             WNFFN+W+++        S G +  S  PI +RWFPD     PV   P  + S+ +   +
Sbjct  179   WNFFNTWSDVFQAPSSEDSYGINSISQPPILDRWFPDGYD--PVINIPFTDPSQFISRFE  236

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                L  R FH S  +IA LK KAN E  T  ISS Q+  A +WRA+TRAR +  ++    
Sbjct  237   VPELRRRFFHFSAKSIADLKAKANKECNTKDISSFQTLTALVWRAITRARRIPLDQSTCC  296

Query  955   ILGIGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             ++    R R+   LPE Y GN +  +    K G+++ +GLGW A ++ + V+  ++ E++
Sbjct  297   VMSANYRGRLKPALPENYLGNMITSVKVDAKVGELVERGLGWGARKLHEAVKNLTY-EKI  355

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+   ++++ P         + N + +    +F+VYG++FG GK V VRSG GN  DGKV
Sbjct  356   RESLEEWIKCPYTYQWGSILNPNIIKMGGWSKFNVYGSEFGMGKAVGVRSGYGNTFDGKV  415

Query  1309  TLFGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              ++ GCE  GSVD+E+ + P  +  LE+D E +
Sbjct  416   IVYPGCEGGGSVDLEICLLPQNMANLESDLELM  448



>ref|XP_010447938.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=451

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/430 (38%), Positives = 242/430 (56%), Gaps = 19/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL     QKGLLF  P+         +N+I  LK+SLS  L  F P AGR
Sbjct  28    KIHLTPWDLYFLGSEYAQKGLLFPKPS------DPETNIIPRLKSSLSIALKIFYPFAGR  81

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N++D T S YVDCN +GV FV A A+ V+V+ +L+  +  VP+ L+  F  NG+ 
Sbjct  82    LVKIENDDDGTSSFYVDCNGSGVRFVHASANSVSVSDVLEPVDGTVPEFLKRFFPCNGVK  141

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGFHQPSTTP-  681
             + +GI   L+ +Q+TEL DG FI    +H + DGTS WNF N W+E+   G     T P 
Sbjct  142   SLEGISDSLIAIQVTELKDGVFIGVGYSHLVTDGTSIWNFSNIWSEICFNGSDHRRTFPP  201

Query  682   -IHERWFPDNTTTCPVHLPPMI--ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              +H  WF D     P+ +P  +  E+   +       L E++F  +  NI+ LK KAN E
Sbjct  202   LVHHGWFLDGIEY-PIRMPASLTPETPNVVGTSSSILLQEKIFRFTSENISELKAKANDE  260

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +      ISSLQ+  A++WR++ R  +L S E +   L + +R R+  P  +   GN V 
Sbjct  261   VSPDDRKISSLQAVSAYMWRSIVRNSDLSSEEVICFRLIVDLRRRLDPPLEKDCCGNMVG  320

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
                     G++   GLGW A +I KTV   ++ EE R     +V++P+    ++ + +NT
Sbjct  321   TALTRTTVGEMFNNGLGWAALKINKTVASQTN-EEFRNFAADWVKNPSLR--DVNTLTNT  377

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
               ++SSPRF+VYG DFGWGKP+  R+G G   DGK+  + G E+G+++I+  +    L  
Sbjct  378   TAVTSSPRFNVYGNDFGWGKPIAARAGPGITYDGKLIAYPGIEQGNIEIQACLSSSVLAK  437

Query  1381  LENDAEFLEY  1410
             L +DAEFL++
Sbjct  438   LSSDAEFLKH  447



>ref|XP_004972476.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=468

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 178/440 (40%), Positives = 242/440 (55%), Gaps = 38/440 (9%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             LTPWDL+ + +  IQKG+L   P    Q     ++L+  L +S +  LD F PLAGR  T
Sbjct  36    LTPWDLRMIAVDYIQKGVLLPKP----QTGGEAAHLVDSLASSFARALDRFYPLAGRL-T  90

Query  337   VMNEEDNTCS-----VYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNG  501
             V    D         V + CN  G EFV A A  VTV  I   + + +P ++ SLF LNG
Sbjct  91    VAEATDGGVPGPGIVVSLCCNGEGAEFVHAVAPEVTVGDI--TAPVYIPSVVWSLFPLNG  148

Query  502   ILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR------GFH  663
              L  D +  P++  Q+TEL DG F+A +LNH + DGT+FW+FF++W+E+SR      G  
Sbjct  149   ALGTD-VSLPVLAAQVTELADGVFVAMSLNHGVADGTTFWHFFSTWSEISRSGSSDAGGE  207

Query  664   QPSTTPIHERWFPDNTTTCPVHLP----PMIESSERLPPPQRAFLAERVFHLSKVNIARL  831
               +  P+ ERWF + T++ P+ LP      I      PP Q  F     F+ S  ++ +L
Sbjct  208   LSTPPPVLERWFLE-TSSVPITLPFGKLEDIVRRPEYPPVQECF-----FNFSAESVRKL  261

Query  832   KEKANSEMG-----TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLP  993
             K +AN+EM      TS ISSLQS +AH WRAV RAR L    +    L +G R R+ G+P
Sbjct  262   KARANAEMAGTATATSTISSLQSLLAHTWRAVCRARELAPERETTYFLLVGCRGRVKGIP  321

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
               Y GN+V        AG+V+ KGLGW AW + + V     E  VR     + + P    
Sbjct  322   RDYVGNSVASAVARWTAGEVVEKGLGWAAWLLNRAVASF-DEATVRDNLASWPQDPKFLY  380

Query  1174  AEIP-SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG-CEEGSVDI  1347
              + P  ++  +   SSPRFDVYG DFGWG+PV VRSG GNK DGKVT++ G    GS+ +
Sbjct  381   VKPPGEAAAAIMTGSSPRFDVYGNDFGWGRPVAVRSGAGNKTDGKVTVYAGRGGAGSMAL  440

Query  1348  ELSIHPHTLLGLENDAEFLE  1407
             E+ + P  L  L  D EF+E
Sbjct  441   EVCLEPEVLARLVADEEFME  460



>ref|XP_004141385.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 ref|XP_004169665.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55209.1| hypothetical protein Csa_4G639960 [Cucumis sativus]
Length=464

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 254/446 (57%), Gaps = 16/446 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqq-ffNSNLI  267
             IS+CF+        +   +   L+PWDL  L +  IQKGL++  P         F  +L+
Sbjct  15    ISQCFIKPHTIPEES--KQPYYLSPWDLLMLSVQYIQKGLIYSKPPAALNDDGQFIEDLL  72

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS  L  F PLAGRFAT+   ++ +C VYVDCNN+ G +F+ A+   +T++ IL
Sbjct  73    RKLKHSLSIALVHFYPLAGRFATISYVDEGSCLVYVDCNNSPGAKFIHARLD-MTISDIL  131

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP I++ LF  +   N DG    L+ +QITELLDG FI C++NHSL DG+S+WN
Sbjct  132   --SPTDVPVIVQRLFDHDRATNHDGHSTSLLSIQITELLDGVFIGCSINHSLVDGSSYWN  189

Query  625   FFNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             FFN W+E+ +        S  P+ +RWFPD     P+   P     + +   +   L ER
Sbjct  190   FFNMWSEIFQAEDDNFSISRPPVLQRWFPD--AHGPILKLPFTNLDQFITKFEAPQLRER  247

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             +FH S  ++A LK +AN+E  T+ ISS QS  A +WR++TRAR L  ++     L I  R
Sbjct  248   MFHFSPASLAVLKARANTEYKTNKISSFQSLSALVWRSITRARGLSPDQTTGCRLAINNR  307

Query  976   ARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
              R+   LPE Y+GN++  I  +    ++L   LGW AW++ + V  H + E+VR    K+
Sbjct  308   TRLNPPLPENYFGNSIQAIRTAATVKELLENNLGWAAWKLHEAVVNHDN-EKVRDHVNKW  366

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             VESP     E      ++ + SSPRF+ YG  FG GK + +RSG  +K DGKV+ + G E
Sbjct  367   VESPFVYRMEKLFDPLSVMMGSSPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSE  426

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFL  1404
               GS+ +EL + P  +  LE D EF+
Sbjct  427   GGGSIVLELCLRPEFMSVLEADEEFM  452



>ref|XP_006292899.1| hypothetical protein CARUB_v10019164mg [Capsella rubella]
 gb|EOA25797.1| hypothetical protein CARUB_v10019164mg [Capsella rubella]
Length=448

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/462 (36%), Positives = 253/462 (55%), Gaps = 40/462 (9%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS   V     +RS     ++ LTP+DL  LQ    Q+GLLF  P P       N +LI 
Sbjct  7     ISSSIVRPVNNSRSGRA--KIHLTPFDLTQLQYDYPQRGLLFPKPDP-------NFDLIS  57

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
              LK SLS  L+ + P AGR   V N EDN+ S Y+DC+ +G  F+ A+A  ++V+  L Q
Sbjct  58    RLKASLSVALETYFPFAGRLVKVENLEDNSASFYIDCDGSGSRFLHAEAKSISVSDFL-Q  116

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
              + +VP  ++  F  +   + DG+ +PL+ +Q+TE+ DG FI    NH + DG S WNFF
Sbjct  117   PDGSVPNFIKLFFPADDFKSCDGVLEPLLALQVTEMKDGVFIGFCYNHLVADGASMWNFF  176

Query  631   NSWAELSRG-----FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR----AF  783
             ++W+++         HQP    I + WF D     P+H+P  +  +ER  P +     A 
Sbjct  177   HTWSKICSSGSVSSDHQPL---ILKGWFLDGINY-PIHIP--VSETERSQPSRELSSVAS  230

Query  784   LAERVFHLSKVNIARLKEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
               +RVFH +K NI+ LK KANSE+ +S   ISS+Q+  AH+WR++ R   L    + H  
Sbjct  231   TKDRVFHFTKKNISDLKAKANSEVDSSDLKISSIQAVSAHMWRSIIRHSGLSRERETHCK  290

Query  958   LGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVR  1131
             + + +R R+  P  +  +GN  +  +      ++L +GLGW A QI K V+  ++E    
Sbjct  291   VAVDLRQRLNPPLEKDCFGNMAYLSSAIATVEELLDRGLGWAALQINKVVKSQTNEN---  347

Query  1132  KMYMKFVESPAHNGAEIP------SSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNK  1293
                  F E    N   +       +  +T+ ++SSPRF+VY  DFGWGKP+  R+G GN 
Sbjct  348   --CKTFAEDWIRNVKNLKVGVGGRTDGDTIVVASSPRFEVYNNDFGWGKPIAARAGPGNS  405

Query  1294  LDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + GK+  F G EEG++D++ ++  H L+ L  D EF+E+ TI
Sbjct  406   ISGKLVFFPGIEEGTIDVQATLWSHVLVNLLADVEFVEHVTI  447



>ref|XP_004291089.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 181/449 (40%), Positives = 262/449 (58%), Gaps = 23/449 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+    A+  +   +   LTP DL  L    IQKGLLF  P P+ +   F   L+ 
Sbjct  9     ISECFIQPHLASEES--KQPFYLTPSDLPMLSFHYIQKGLLFTKP-PEARNPCFVHTLLA  65

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS  L  F PLAGR  T   ++ +   VYVDC+N+ G +F+ A    ++++ IL 
Sbjct  66    KLKHSLSLALVHFYPLAGRLVTKKEQDPHLYLVYVDCSNSPGAKFIHASLE-MSISDIL-  123

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S  +VP +++S F  +  +N DG    L+  Q+TEL+DG FI  ++NHSL DGTS+WNF
Sbjct  124   -SPTDVPLVVQSFFDHDRAVNHDGHSTSLLTAQVTELVDGVFIGLSMNHSLVDGTSYWNF  182

Query  628   FNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSE---RLPPPQRAFLA  789
             FN+W+E+ +  +     S  P+ +RW P+     P+   P  E SE   R  PP+   L 
Sbjct  183   FNTWSEIFQAQNNNITLSNPPVMDRWIPEGLD--PIISLPYTEPSEFIDRFEPPK---LR  237

Query  790   ERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             ER+FH S  ++A+LK KANSE  TS IS+ Q+  A LWR +TRAR L  +++    L   
Sbjct  238   ERMFHFSSESLAKLKAKANSECNTSKISTFQALSALLWRTITRARVLPPDQETRCKLAAN  297

Query  970   MRARMGLP--EGYWGNAVFFIT-ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
              RAR+  P    Y+GN+V+ IT E IKAG++L  GLGW A ++ + V   +H+  ++   
Sbjct  298   NRARLDPPLAPNYFGNSVYPITSEPIKAGELLDHGLGWAALKVHRAVVTLNHQA-LKGFL  356

Query  1141  MKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
               +++SPA          + + + SSPRFD+Y  +FG GK V +RSG  NK  GKV+ F 
Sbjct  357   DHWLKSPAVFSPRFFDPFSVM-MGSSPRFDMYRNEFGMGKAVALRSGYANKFSGKVSAFQ  415

Query  1321  GCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
             G E GS+D+E+ + P T+  LE+D EF+E
Sbjct  416   GRESGSIDLEVCLPPETMGALESDDEFME  444



>ref|XP_010426573.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=447

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 255/438 (58%), Gaps = 31/438 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  LQ    Q+GLLF  P P       + +LI  LKTSLS  L+ + P AGR
Sbjct  24    KIHLTPFDLTHLQYDYPQRGLLFPKPDP-------DFHLISRLKTSLSLALETYFPFAGR  76

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                V N EDN+ S ++DC+ +G  F+ A+A  V+V+  L Q + +VP  ++  F  + I 
Sbjct  77    LVKVENPEDNSVSFFIDCDGSGARFLHAEAKSVSVSDFL-QPDGSVPSFIQHFFPADDIK  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL----SRGFHQPST  675
             + DG+ +PL+ +Q+TE+ DG FI    NH + DG S W+FF++W+++    S   HQP  
Sbjct  136   SSDGVSEPLLALQVTEVKDGVFIGFCYNHMVADGASMWSFFHTWSKICSSGSGSDHQPL-  194

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR-----AFLAERVFHLSKVNIARLKEK  840
               I + WF D     P+H+  ++  +ER P P+R     A   +RVFH +K NI+ LK K
Sbjct  195   --ILKGWFLDGIDY-PIHI--LVSETER-PQPRRELSPVAVTKDRVFHFTKKNISDLKAK  248

Query  841   ANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLPEGY--WG  1008
             AN+E+G+S   ISS+Q+  AH+WR++ +   L   +  H  + + +R R+  P G   +G
Sbjct  249   ANTELGSSELKISSVQAVSAHMWRSIIKHGGLSREKQTHCKVAVDLRQRLNPPLGKECFG  308

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EEVRKMYMKFVESPAHNGAEI  1182
             N  +  +      ++L +GLGW A QI K V+  ++E  +     ++K V++    G   
Sbjct  309   NMAYLSSAIATVEELLDRGLGWAALQINKVVKSQTNENCKTFAADWIKNVKN-LKLGVGG  367

Query  1183  PSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
               + +T+ I+SSPRF+VY  DFGWGKP+  R+G GN + GK+  F G +EGS+D++ ++ 
Sbjct  368   RVAGDTIVIASSPRFEVYNNDFGWGKPIAARAGPGNSISGKLVFFPGIDEGSIDVQATLW  427

Query  1363  PHTLLGLENDAEFLEYFT  1416
                L+ L  D EF+EY T
Sbjct  428   SDVLVNLLADVEFVEYVT  445



>emb|CDP06257.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 178/446 (40%), Positives = 250/446 (56%), Gaps = 17/446 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+C V      + +   +R+   PWDL    I   QKGLLF  P P    +    + + 
Sbjct  10    VSECLVQPKYVPQDS--EQRIYFAPWDLSLASIHYNQKGLLFAKP-PAFDSEGKMKDFLQ  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN-AGVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAGR AT+  E     S+YVDC N  G +FV A    +T+   L 
Sbjct  67    KLKESLSLTLVHFYPLAGRLATLKQENPPIYSIYVDCTNLPGAKFVHASVD-LTIDDFL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              + I +P+I+ S F   G +N DG    LM +Q+TEL DG FI  + NH L DGTSFW+F
Sbjct  125   -TPIYMPKIVHSFFDHVGAVNHDGHSMSLMSIQVTELKDGIFIGWSTNHLLVDGTSFWHF  183

Query  628   FNSWAELSRGFHQPSTT---PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERV  798
              N+W+E+     Q  T    PI +RWFP+   + PV   P     E +   Q   L ER 
Sbjct  184   INTWSEVFNAKGQIPTISRPPILKRWFPEGHRS-PVIGLPFTHHDEFISRFQTPELLERY  242

Query  799   FHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRA  978
             FH S  ++A+LK KAN+E  ++ IS+ Q+  A LWR +TRARN+ S++       +  R 
Sbjct  243   FHFSAESLAKLKAKANAECNSTTISTFQALSALLWRCITRARNMPSDQQTSAGTSVNSRL  302

Query  979   RMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+  P  E Y+GN V  +  +   G++L  GLGW AW++ + V   + +  +R+    +V
Sbjct  303   RINPPLSEEYFGNCVQVVAVTTTCGELLTNGLGWAAWKLHELVINQT-DRSIREWVESWV  361

Query  1153  ESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-  1329
             +SP      I   SN + I SSPRF+VYG++FG GK + VRSG  NK DGK+TLF G E 
Sbjct  362   KSPF--IVWIGRFSNRIQIGSSPRFNVYGSEFGLGKALAVRSGFANKPDGKITLFPGREG  419

Query  1330  EGSVDIELSIHPHTLLGLENDAEFLE  1407
              GS+D+E+ + P ++  LE+D EF+E
Sbjct  420   GGSMDVEVCLPPQSMSFLESDQEFME  445



>ref|XP_010692375.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=457

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 170/455 (37%), Positives = 266/455 (58%), Gaps = 27/455 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRR-VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLI  267
             IS+CF+        + +S++   ++P DL  L    IQKGLLF  P+   ++    +  +
Sbjct  10    ISECFIKPKLV---DSISKQPYYVSPGDLAMLSAHYIQKGLLFTKPSVTDEEFDIET-FL  65

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN-AGVEFVEAKASGVTVAAIL  444
               LK SLS TL +F P AG+ AT ++E+ +T  + +DC   +G  F+ A    +T+  IL
Sbjct  66    EKLKDSLSRTLVYFYPFAGQLATQIDEDQHTSLISIDCEKGSGARFIHATLD-MTIEDIL  124

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP++++S F  +  +N DG  +PL+ VQ+TEL+DG FI C++NH + DGTS+WN
Sbjct  125   --SPTDVPEVVKSFFDHHKAVNHDGHTRPLLSVQVTELVDGIFIGCSMNHVVADGTSYWN  182

Query  625   FFNSWAELSRGFHQP---STTPIHERWFPDN---TTTCPVHLPPMIESSERLPPPQRAFL  786
             F+N W+E+ R  H P   S  PIH+RWFP+      T P   P    S    PP     L
Sbjct  183   FWNIWSEIHRQ-HSPISESKLPIHKRWFPEGHGPRITIPFTHPDEYISRYEAPP-----L  236

Query  787   AERVFHLSKVNIARLKEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLIL  960
              E++FH S  +I++LK KAN ++  +   ISSLQ+  A +WR++TRAR+L  ++     +
Sbjct  237   REKMFHFSSKSISKLKAKANMQVKETNKEISSLQALSALVWRSITRARHLGGDQKTLCSM  296

Query  961   GIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRK  1134
                +R R+   LP+ Y+GN+++    +  A +VL   LGW A +++K V + + ++ V+ 
Sbjct  297   DANLRQRLDPPLPQSYFGNSIWVAKAAATADEVLEHSLGWTAEKLQKAVLELT-DKRVQS  355

Query  1135  MYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
             ++  +++SP     +     N++ I SSPRFD+YG DFG GKPV  RSG  NK  GKVT 
Sbjct  356   VFNAWMKSPFVYQIDTFFEPNSIVIGSSPRFDMYGNDFGIGKPVAARSGNANKFPGKVTA  415

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
             + G + E S+D+E+ + P  +  LE+D EF+   T
Sbjct  416   YPGSDGERSIDLEICLPPDVMSSLESDKEFIALAT  450



>ref|XP_003603071.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=919

 Score =   297 bits (761),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 175/455 (38%), Positives = 258/455 (57%), Gaps = 24/455 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+CF+        +   +   L PWD+  L    IQK LLF  PT          + I 
Sbjct  10    VSECFIKPYPPIEDS--KQICYLAPWDIVMLSANYIQKALLFKKPT----SSLNQQHFID  63

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PL+GR  T  +E+ ++ +V+VDC N+ G +F+ A    +T+  IL 
Sbjct  64    KLKHSLSLTLFHFYPLSGRLVTKKSEDPHSYTVFVDCKNSLGAKFIHATLD-ITINDIL-  121

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S I+VP I+ S F  +  +N DG    L+ +Q+TELLDG FI C++NH++GDGT++WNF
Sbjct  122   -SPIDVPPIVHSFFDHHRAVNHDGHTMSLLSIQVTELLDGVFIGCSMNHAVGDGTAYWNF  180

Query  628   FNSWAELSR-----GFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAF  783
             FN+ +E+ +       H P   S  PIH RWFP+     P+   P     E +   +   
Sbjct  181   FNTLSEIFQKVVDVDVHIPVPISHQPIHNRWFPEGYG--PIINLPFKHHDEFIHRYEAPI  238

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             L ER+FH S   IA+LK KAN E  T+ ISS QS  A +WR++TR R LH ++     L 
Sbjct  239   LRERIFHFSAEFIAKLKAKANKECETTKISSFQSLSALVWRSITRVRRLHHDQRTTCKLA  298

Query  964   IGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  R RM   LP+ Y+GN+V+ ++     G++L  GLG  +W+I   + K+ H   VR++
Sbjct  299   INNRTRMEPSLPKEYFGNSVYAVSTETTKGELLENGLGLASWKIHLAIAKYDH-RVVRQL  357

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +++ SP     ++     ++ + SSPRF++YG++FG GK + VRSG  NK DGKVT +
Sbjct  358   VEEWLRSPIVVRMDMLVDPYSVMMGSSPRFNMYGSEFGMGKALGVRSGYANKFDGKVTSY  417

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
              G E  GSVD+E+ + P  +  LE D EF+   ++
Sbjct  418   PGQEGGGSVDLEVCLSPEKMTLLETDEEFMNSVSV  452



>gb|EAZ05362.1| hypothetical protein OsI_27565 [Oryza sativa Indica Group]
Length=464

 Score =   286 bits (732),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 174/442 (39%), Positives = 241/442 (55%), Gaps = 34/442 (8%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             LTP DLQ + +  +QKG++   P           +++ HL +S +  L  F PLAGR A 
Sbjct  32    LTPLDLQMITVDYVQKGVVLPKPP------GGGEHVVEHLVSSFARALARFYPLAGRLAI  85

Query  337   VMNEEDN---TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                       T S+ + CN  G EFV A A GVTVA I D  ++ VP+++ S F LNG+L
Sbjct  86    AETASPGGVPTISISLRCNGEGAEFVHAVAPGVTVADIAD--SLYVPRVVWSFFPLNGML  143

Query  508   NRDGIC--KPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR------GFH  663
               D     +P++  Q+TEL DG F+A +LNH + DG +FW+ F +W+E+SR         
Sbjct  144   GTDAAVESRPVLAAQVTELADGMFVAMSLNHGVADGFTFWHLFRTWSEISRRSDDSADLE  203

Query  664   QPSTTPIHERWFPDNTTTCPVHLP-PMIESSERLP---PPQRAFLAERVFHLSKVNIARL  831
               +  P+ +RWF D     P+ LP   +E   R P   P +  FL     H S  ++  L
Sbjct  204   LSTPPPVFDRWFVDGIP-MPIPLPFAKLEDMVRRPVYTPVEECFL-----HFSAESVRTL  257

Query  832   KEKANSEMGTS----IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPE  996
             KEKAN+EM  +     ISSLQS +AH WRAV RAR L    +    L +G+RAR+  +P+
Sbjct  258   KEKANAEMAAAAATATISSLQSVLAHTWRAVCRARRLAPEMETSYGLSVGLRARVKEVPQ  317

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGA  1176
              Y GN V        AG++L KGLGW AW + + V     E  VR+M   + E P+    
Sbjct  318   EYMGNTVVGAVAKATAGELLDKGLGWAAWLLNRAVAASGDEASVRRMVAAWPEKPSFMMV  377

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELS  1356
                 ++  + IS SPRFDV G DFGWG+PV VRSG GNK+DGK+T++ G   GS+ +E+ 
Sbjct  378   ADLQNAGVMVISGSPRFDVLGNDFGWGRPVGVRSGAGNKVDGKMTVYEGRGGGSMAVEIC  437

Query  1357  IHPHTLLGLENDAEFLEYFTIP  1422
             + P  L  L  D EF+   T P
Sbjct  438   LAPEALARLVADEEFMSAVTAP  459



>gb|EAZ05363.1| hypothetical protein OsI_27566 [Oryza sativa Indica Group]
Length=477

 Score =   286 bits (733),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 243/450 (54%), Gaps = 37/450 (8%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+FL I  IQKG+L   P            L   L +S +  L  F P AGR 
Sbjct  41    IHLTPWDLRFLSIDYIQKGVLLPKPP------LSGDRLADALASSFARALALFYPFAGRL  94

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
                   +D T +V + C   G EFV A A GV V+ ++  S++  P  + S ++ N +L 
Sbjct  95    VAEERADDGTVTVALRCTGEGAEFVHAAAPGVAVSDVV--SSLYTPPEVWSFYSYNLVLG  152

Query  511   RDGIC--KPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRG---------  657
              D     +P++  Q+TEL DG F+  +LNHS+GDGT+FW F N+W+E++R          
Sbjct  153   ADAATESRPVLSTQVTELADGVFLGMSLNHSVGDGTTFWKFMNAWSEINRRAGGAMSDDL  212

Query  658   -FHQPST-TPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHLSKVNIA  825
                + ST  P+  RWF + T+  P+ +P   +     RL  P+   + E  F  S  +  
Sbjct  213   MIREISTPAPVFRRWFVE-TSPVPIPMPVGKLQHIVRRLERPE---VQECFFTFSATSAR  268

Query  826   RLKEKANSEM---GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GLP  993
             +LK KAN EM    T+ ISSLQ+ +AHLWR V RAR L   +     + +G R R+ G+P
Sbjct  269   KLKAKANDEMSGAATATISSLQAVLAHLWRGVCRARRLPPEQVTFYTVMVGCRGRVNGIP  328

Query  994   EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNG  1173
               Y GNA+ F      AG++  KGLGW AWQ+ + V     E  +R+   ++V  P    
Sbjct  329   AWYVGNALMFGKAEATAGEIEEKGLGWTAWQLNRAVASFD-EAGMRESLERWVREPEFTY  387

Query  1174  AEIPSSSNTLGIS----SSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGS  1338
                  S +  G++    SSPRFDV+G DFGWG+PV VRSG GNK+DGK T+F G +  GS
Sbjct  388   MSKLQSGDAGGVALITGSSPRFDVFGNDFGWGRPVAVRSGAGNKIDGKATVFEGPDGAGS  447

Query  1339  VDIELSIHPHTLLGLENDAEFLEYFTIPGN  1428
             + +E+ I P  L  L  D EF++  T+P +
Sbjct  448   MSLEVCIAPDALRRLVADEEFMDAVTLPSS  477



>ref|XP_003523952.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|ABC47845.1| N-hydroxycinnamoyl/benzoyltransferase 3 [Glycine max]
Length=486

 Score =   286 bits (733),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 259/456 (57%), Gaps = 23/456 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+        +  ++   L PWD+  L    IQKGLLF  P     QQ F  NL+ 
Sbjct  36    ISECFIKPHRPIEES--NQICYLAPWDIILLSYHYIQKGLLFKKPPTLVDQQNFIENLLE  93

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAGR  T   ++  + + +VDC N+ G  F+ A    +T++ IL 
Sbjct  94    KLKHSLSFTLSHFYPLAGRLVTHTTQDPPSYAFFVDCKNSDGARFIYASLD-MTISDIL-  151

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              + ++VP IL S F  +  +N DG   PL+ +Q+TEL+D  FI C++NH+LGDGTS+WNF
Sbjct  152   -TPVDVPPILHSFFDHHKAVNHDGHTMPLLSIQVTELVDAVFIGCSMNHTLGDGTSYWNF  210

Query  628   FNSWAELSRG------FHQP-STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             FN+W+++ +       ++ P S  PI  RWFP +     V+L P     E +   +  FL
Sbjct  211   FNTWSQIFQSQAQGHEYNVPISHPPILNRWFPSDCDPS-VNL-PFKHHDEFICNFEAPFL  268

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ERVFH S  +IA+LK KANSE  T+ ISS QS  A +WR++T AR++   +     + I
Sbjct  269   RERVFHFSAESIAKLKAKANSESNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAI  328

Query  967   GMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R+RM   +PE Y+GN V  ++      ++L   LGW AW +   V  H+ ++ V +  
Sbjct  329   NNRSRMEPPMPEEYFGNLVQVVSAETTTRELLENDLGWAAWLLHVAVTNHN-DKVVLQSL  387

Query  1141  MKFVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
               +++SP     G      S  +G  SSPRF+ YG +FG GK V +RSG  NK DGKVT 
Sbjct  388   QGWLQSPFIPQIGRLFDPYSVLMG--SSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTS  445

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + G E  GS+D+E+ + PH +  LE+D EF+   ++
Sbjct  446   YPGREGGGSIDLEVCLLPHIMRALESDKEFMNAVSV  481



>ref|XP_010426574.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=451

 Score =   285 bits (730),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 166/445 (37%), Positives = 247/445 (56%), Gaps = 42/445 (9%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  LQ    Q+GLLF  P P       + NLI  LKTSLS  LD + P AGR
Sbjct  25    KIHLTPYDLSLLQFDYAQRGLLFPKPDP-------DFNLISRLKTSLSLALDIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                  N ED T S Y+DC+ +G  F+ A+A  V+V+  L Q + +VP   +  F  +   
Sbjct  78    LVKTENLEDETVSFYIDCDGSGARFLHAEAESVSVSDFL-QPDGSVPDFTKHFFPADDFK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR---GF-HQPST  675
             + DG+  PL+ +Q+TE+ DG FI+   NH + DG S W FF++W+ +     GF H+P  
Sbjct  137   SVDGVTVPLLVIQVTEMKDGVFISYCYNHMVADGVSVWGFFHTWSMICSTGSGFNHKPL-  195

Query  676   TPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA------ERVFHLSKVNIARLKE  837
               + + WF +     P+H+P  +  SER PPP R  L+      E +FH ++ NI+ LK 
Sbjct  196   --VLKGWFLEGIDY-PIHIP--VSESER-PPPSREVLSSVPITKEWIFHFTEENISDLKA  249

Query  838   KANSEMGTS----IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EG  999
             KANSE+ +S    I+SSLQ+  AH+WR++ R   +   ++ +  L + +R R+  P  + 
Sbjct  250   KANSEVDSSDDLGIVSSLQAVSAHMWRSIIRHSCVCREQETYCKLVVDLRQRVTPPLEKD  309

Query  1000  YWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAE  1179
              +GN V+  + +    ++L +GLGW A QI K V   ++E         F E    N   
Sbjct  310   SFGNMVYITSATATVEELLDRGLGWAALQINKLVRSQTNEN-----CKSFAEDWVRNVKN  364

Query  1180  IPS------SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSV  1341
             + S        +T+ I+SSPRF+VY  DFGWGKP+ VR+G  N + GK+ LF G  EGS+
Sbjct  365   VKSGLGSRVDGDTIVIASSPRFEVYNKDFGWGKPIAVRAGPSNSISGKLNLFTGINEGSI  424

Query  1342  DIELSIHPHTLLGLENDAEFLEYFT  1416
             D++ ++    +  L  D EFLE+ T
Sbjct  425   DVQANLWSDVITNLLADVEFLEHVT  449



>gb|KHN29658.1| Putative acetyltransferase [Glycine soja]
Length=424

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 170/425 (40%), Positives = 247/425 (58%), Gaps = 17/425 (4%)
 Frame = +1

Query  178   FLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFATVMNEEDN  357
              L +  IQKGLLF  PTP   Q  F  NL+  LK SLS TL  F PLAGR  T  +++  
Sbjct  1     MLSMHYIQKGLLFKKPTPLVDQHDFIENLLEKLKHSLSLTLSHFYPLAGRLVTQKSQDPP  60

Query  358   TCSVYVDCNNA-GVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILNRDGICKPL  534
             + +V VD  N+ G  F+ A    +T++ IL  S ++VP +++SLF  +  +N DG   PL
Sbjct  61    SYAVSVDSKNSDGARFIYATLD-MTISDIL--SPVDVPLVVQSLFDHHKAVNHDGHTMPL  117

Query  535   MGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTT-------PIHER  693
             + +Q+TE++DG F+ C++NH++GDGTS+WNFFN+W+++ +   +   T       PI  R
Sbjct  118   LSIQVTEIVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQAHAKGHDTDVPISHQPILSR  177

Query  694   WFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGTSIIS  873
             WFP N    P++L P     E +   +   + ERVFH S  +IARLK KAN E  T+ IS
Sbjct  178   WFP-NDCAPPINL-PFKHHDEFISRIEAPLMRERVFHFSAESIARLKAKANMESDTTKIS  235

Query  874   SLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFITESIKAG  1047
             S QS  A +WR +TRA +L   +     L    R RM   LP+ Y+GN+V  +      G
Sbjct  236   SFQSLSALVWRCITRACSLPYEQRTSCRLTANNRTRMEPPLPQQYFGNSVSRLNAQTTVG  295

Query  1048  DVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRF  1227
             ++L   LGW AW++   V  H+ ++ V +   K+++ P       P     + ISSSPRF
Sbjct  296   ELLENNLGWAAWKLHLAVTNHN-DKVVLQSLKKWLQCPLIYQIGQPMDPYDVLISSSPRF  354

Query  1228  DVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             ++YG +FG GK V VRSG  NK  GKVT + G E  GS+D+E+ + PH +  LE+D EF+
Sbjct  355   NMYGNEFGMGKAVAVRSGYANKFHGKVTSYPGREGGGSIDLEVGLLPHIMSALESDEEFM  414

Query  1405  EYFTI  1419
             +  ++
Sbjct  415   KVVSV  419



>ref|NP_001060827.1| Os08g0111800 [Oryza sativa Japonica Group]
 dbj|BAD09504.1| putative AER [Oryza sativa Japonica Group]
 dbj|BAF22741.1| Os08g0111800 [Oryza sativa Japonica Group]
 gb|EAZ41284.1| hypothetical protein OsJ_25791 [Oryza sativa Japonica Group]
Length=464

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 174/442 (39%), Positives = 241/442 (55%), Gaps = 34/442 (8%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             LTP DLQ + +  +QKG++   P           +++ HL +S +  L  F PLAGR A 
Sbjct  32    LTPLDLQMITVDYVQKGVVLPKPP------GGVEHVVEHLVSSFARALARFYPLAGRLAI  85

Query  337   VMNEEDN---TCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                       T S+ + CN  G EFV A A GVTVA I D  ++ VP+++ S F LNG+L
Sbjct  86    AETASPGGVPTISISLRCNGEGAEFVHAVAPGVTVADIAD--SLYVPRVVWSFFPLNGML  143

Query  508   NRDGIC--KPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR------GFH  663
               D     +P++  Q+TEL DG F+A +LNH + DG +FW+ F +W+E+SR         
Sbjct  144   GTDAAVESRPVLAAQVTELADGMFVAMSLNHGVADGFTFWHLFRTWSEISRRSDDSADLE  203

Query  664   QPSTTPIHERWFPDNTTTCPVHLP-PMIESSERLP---PPQRAFLAERVFHLSKVNIARL  831
               +  P+ +RWF D     P+ LP   +E   R P   P +  FL     H S  ++  L
Sbjct  204   LSTPPPVFDRWFVDGIP-MPIPLPFAKLEDMVRRPVYTPVEECFL-----HFSAESVRTL  257

Query  832   KEKANSEMGTS----IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG-LPE  996
             KEKAN+EM  +     ISSLQS +AH WRAV RAR L    +    L +G+RAR+  +P+
Sbjct  258   KEKANAEMAAAAATATISSLQSVLAHTWRAVCRARRLAPEMETSYGLSVGLRARVKEVPQ  317

Query  997   GYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGA  1176
              Y GN V        AG++L KGLGW AW + + V     E  VR+M   + E P+    
Sbjct  318   EYMGNTVVGAVAKATAGELLDKGLGWAAWLLNRAVAASGDEASVRRMVAAWPEKPSFMMV  377

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELS  1356
                 ++  + IS SPRFDV G DFGWG+PV VRSG GNK+DGK+T++ G   GS+ +E+ 
Sbjct  378   ADLQNAGVMVISGSPRFDVLGNDFGWGRPVGVRSGAGNKVDGKMTVYEGRGGGSMAVEIC  437

Query  1357  IHPHTLLGLENDAEFLEYFTIP  1422
             + P  L  L  D EF+   T P
Sbjct  438   LAPEALARLVADEEFMSAVTAP  459



>gb|EEE67923.1| hypothetical protein OsJ_25794 [Oryza sativa Japonica Group]
Length=456

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 174/445 (39%), Positives = 242/445 (54%), Gaps = 37/445 (8%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             V LTPWDL  L    IQKG+L   P           +L+ HL +S +  L  F P AGR 
Sbjct  28    VHLTPWDLPLLTAEYIQKGVLLPKPP------TGGEHLVKHLASSFARALGRFYPFAGRL  81

Query  331   ATVMNEE----DNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             A    E+     ++ SV++ CN+ G EFV A A  V VA I   +++ +P+++ S F L 
Sbjct  82    AVAEVEDGASPPSSISVFLRCNDEGAEFVHATAPDVAVADI--AASLYIPRVVWSFFPLT  139

Query  499   GILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQ--  666
             G+L         P++  Q+TEL DG FIA +LNH +GDGT+FW F N+W+E+SR   +  
Sbjct  140   GLLPAVAAADSLPVLAAQVTELSDGVFIAMSLNHVVGDGTNFWEFMNTWSEISRSRSKLD  199

Query  667   --PSTTPIHERWFPDNTTTCPVHLP-------PMIESSERLPPPQRAFLAERVFHLSKVN  819
               PS   + +RWF D   TCPV +P        +I   +  PPP    L E  F  S  +
Sbjct  200   ISPSPPLVVKRWFLD---TCPVPIPLPFAKLEHIIPRRDHPPPP----LQECFFAFSAES  252

Query  820   IARLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GL  990
             I +LK KAN E+    + ISSLQ+ +AH+WR+V+RA  L   ++   +L IG R R+ G+
Sbjct  253   IRKLKAKANGEIAGAAATISSLQALLAHVWRSVSRAHGLTPRQETAYVLVIGCRGRVSGI  312

Query  991   PEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN  1170
               GY GNAV      + AG+V+ +GLGW AWQ+ + V     E  +R     +  +P   
Sbjct  313   SPGYVGNAVVPGAVRLTAGEVMERGLGWTAWQLNRFVASLD-EAAMRGAIAPWPRAPEFA  371

Query  1171  GAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF-GGCEEGSVDI  1347
                  +    +   SSPRFDV+G DFGWG+P  VRSGG NK DGKVT++ G    GS+ +
Sbjct  372   NFAKAAGGTAVHTGSSPRFDVFGNDFGWGRPASVRSGGANKFDGKVTVYEGPGGAGSMSL  431

Query  1348  ELSIHPHTLLGLENDAEFLEYFTIP  1422
             E+ + P  L  L  D EF+   T P
Sbjct  432   EVCLAPAALGKLVADEEFMGAVTTP  456



>ref|XP_010252439.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nelumbo 
nucifera]
Length=474

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 179/455 (39%), Positives = 253/455 (56%), Gaps = 27/455 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN---  261
             IS+C +        +   +   L PWD+  L +  IQ GLLF  PTP    Q  + +   
Sbjct  10    ISRCIIKPKCLPEES--KQIYHLNPWDISLLSVHYIQAGLLFPKPTPVSINQEDHRHGIP  67

Query  262   -LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVA  435
              +I  LK SLS TL  F PL GRF T  +   ++ S+ VDC +A G EF+ A A  + +A
Sbjct  68    AIIDQLKDSLSRTLVHFIPLTGRFITQKSNNPHSYSISVDCRDAPGAEFIHAVAD-LKIA  126

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              +L  S I+VP I+ S F  NG++N DG   PL+ VQ+TELLDG F+ C+ NH++GDG S
Sbjct  127   DVL--SPIDVPPIVHSFFAFNGVVNHDGHTMPLLAVQVTELLDGIFMGCSFNHAIGDGAS  184

Query  616   FWNFFNSWAELSR---GFHQPSTTP-IHERWFPDNTTTCPVHLPPMIESSERL----PPP  771
             FW+F N+W+EL R      + S  P I ERWFP+     P+   P  + SE +     PP
Sbjct  185   FWHFINTWSELCREKVKDKRISLPPIILERWFPNGHG--PIVNLPFSDHSEFIIEGYNPP  242

Query  772   QRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVH  951
             +   L ER FH S   +ARLK KAN+E   + ISSLQ+  A LWRA T+AR L  N+  +
Sbjct  243   K---LRERFFHFSAQTMARLKAKANAECNITTISSLQALSALLWRATTQARRLDVNQTTN  299

Query  952   LILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEE  1125
                 I  R R+  P    Y+G A+  ++ +   G++L +GLGW A  + + V +H+ +  
Sbjct  300   CTFVISNRPRLNPPLSPNYFGTAIQAVSGTTTVGELLSRGLGWAALILHQAVARHT-DSV  358

Query  1126  VRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGK  1305
             VR+     + +P            ++ ++SSPRFD+YG DFGWG+P+ VR G  NK  G 
Sbjct  359   VREQMEANMVAPFIYYLRESFDPCSVMVASSPRFDMYGNDFGWGEPMAVRCGPANKFGGM  418

Query  1306  VTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLE  1407
             V    G E  GSVD+E+ + P  +  LE+  EF+E
Sbjct  419   VFAHPGKEGGGSVDLEVCLPPEEMGALESIEEFME  453



>ref|XP_003566996.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=463

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 182/457 (40%), Positives = 252/457 (55%), Gaps = 38/457 (8%)
 Frame = +1

Query  127   RSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDF  306
             RS      + LTPWDL  L I  IQKGLL   P           +L+  L +SL+  LD 
Sbjct  19    RSPRAPEDIHLTPWDLCLLTIDYIQKGLLLPKPADPV------DDLVDALASSLALALDR  72

Query  307   FPPLAGRFAT----VMNEEDNTCSVYV--DCNNAGVEFVEAKASGVTVAAILDQSNINVP  468
             F PLAGR        + ++D   S+ V   C   G E V A A G     I+   +++ P
Sbjct  73    FYPLAGRLVVDHHHQVPDDDGKMSITVLLRCAGQGAELVHATAPGAAAMDIV--GSVHTP  130

Query  469   Q-ILRSLFTLNGILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSW  639
               ++ +LF LN ++  D   +  PL+  Q+TEL DG F+  ++NHS GDGT+FW FFN+W
Sbjct  131   SSLVWALFPLNQVVGADAAVESLPLLSAQVTELADGVFVGVSMNHSAGDGTAFWEFFNAW  190

Query  640   AELSR-GFHQPSTTPIHE-RWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAERVFHL  807
             +E++R G    S  P+ + RWF   T+  P+ +P   +    +R   P  A +AE  F  
Sbjct  191   SEINRRGNEMSSRRPVQQQRWF-TGTSPVPIAMPFSKLQHVVQRFQRP--AAVAECFFTF  247

Query  808   SKVNIARLKEKANSEM------GTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIG  969
             S  +I +LK +AN E+      G  IISSLQ+ +AHLWRAV RAR     ++    + +G
Sbjct  248   SGASIKKLKARANDEIEMAGGAGAIIISSLQALLAHLWRAVCRARLARPEQETSYSMLVG  307

Query  970   MRARM-GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
              R R+ G+PE Y GNAV F      AG+++G GLGW A Q+ + V     E  VR+   +
Sbjct  308   CRGRVTGIPEDYMGNAVTFGKARSTAGEIMGNGLGWAALQLNRVVASFD-EASVREWLGR  366

Query  1147  FVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFG  1320
             +   P   +NG E+ S    L   SSPRFDV+G DFGWGKPV VRSG GNK+DGK T+F 
Sbjct  367   WAADPRFVYNG-EVSSGGTALATGSSPRFDVFGNDFGWGKPVAVRSGSGNKIDGKATVFQ  425

Query  1321  GCE---EGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             G E   EGS+ +E+ + P  L  L ND EF++  ++P
Sbjct  426   GPEEQGEGSMSLEVCVAPDVLDRLVNDLEFMDAVSVP  462



>emb|CDY47454.1| BnaC09g31030D [Brassica napus]
Length=458

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/439 (38%), Positives = 249/439 (57%), Gaps = 36/439 (8%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+ L+F  P P        ++LI  LK+SLS+ L  F P AGR
Sbjct  25    KIHLTPWDLSFLRTEYAQRALIFPQPNP-------GTHLISQLKSSLSAALKIFYPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + NE+D T S  +DC+ +GV+FV A A  V+V  +L+ +N  VP      F  NG+ 
Sbjct  78    LVKIDNEDDGTKSFIIDCDGSGVKFVHASAKTVSVRDVLEPANGTVPDYWSEFFPANGVQ  137

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTPI  684
             + +G+ KPL+  Q+TEL DG FI    NH + DGTSFW+FF +W E+ S GF + S  P+
Sbjct  138   SWEGVSKPLIAFQVTELKDGVFIGYGYNHLVADGTSFWSFFKTWTEIFSTGFDRKSFPPL  197

Query  685   HE-RWFPDNTTTCPVHLPPMIESSERLP-------PPQRAFLAERVFHLSKVNIARLKEK  840
                 WF D      +  P  I  SE +P        P    L +++F  +  +I++LK K
Sbjct  198   PLCGWFLDG-----IDYPIQIPISETVPSSHAGLVAPSLPHLEKKIFRFTSAHISKLKAK  252

Query  841   ANSEM---GTSI-ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGY  1002
             AN E+   G  + ISS Q+ + H+W+++ R  +L+  E +H  L + +R R+  P  +  
Sbjct  253   ANDEVVGYGEDLKISSFQAVLGHMWQSIIRNSDLNPEEVIHCKLAMDIRQRLNPPVKKNC  312

Query  1003  WGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEI  1182
             +GN +     +    ++L  GLGWVA Q+ KTV   ++ EE+RK    +V+SP     +I
Sbjct  313   FGNMIGLAATTTTTREMLDNGLGWVALQLNKTVRSQTN-EELRKFADNWVKSP-----KI  366

Query  1183  PS---SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIEL  1353
             P+   ++N+L ++ SPRF+V+G DFGWGKP+  R G G    GK+  + G E+GS++I  
Sbjct  367   PNRLVANNSLVVAGSPRFNVFGNDFGWGKPIAFRGGPGIAGHGKILAYPGTEKGSMEIHT  426

Query  1354  SIHPHTLLGLENDAEFLEY  1410
             S+  H L  L  D EFL++
Sbjct  427   SLWSHVLDKLLADQEFLQH  445



>gb|KDO84111.1| hypothetical protein CISIN_1g044173mg [Citrus sinensis]
Length=455

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 174/451 (39%), Positives = 257/451 (57%), Gaps = 20/451 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPT-PqqqqqffN--SN  261
             +S+CFV       S  + +   LTPWDL  L +  IQKGLLF  P  P       +    
Sbjct  9     MSECFVQPE--YFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASVDQVDFIKT  66

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAA  438
             L+  LK SLS TL  F PLAGR  T   +   +  V+VDCNN+ G +F+ A    + ++ 
Sbjct  67    LLDRLKHSLSLTLVHFYPLAGRLVTRQTDSPPSYVVFVDCNNSPGAKFIHASLD-MAISD  125

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S   VP +++S F  +  LN DG  +PL+ +Q+TEL+DG FI C++NH LGDGTSF
Sbjct  126   IL--SPTYVPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSF  183

Query  619   WNFFNSWAELSRG---FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             WNFFN+++E+ +        S  P+ +RWFPD     P+   P     E +   +   L 
Sbjct  184   WNFFNAFSEIFQAQGKMDSISRPPVVKRWFPDGRD--PIINLPFTHRDEFIRRYEAPQLL  241

Query  790   ERVFHLSKVNIARLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             ER+FH +  +IARLK KAN+E G  T+ ISS Q+  A +WR++TR RNL  ++     + 
Sbjct  242   ERIFHFTGESIARLKAKANAEAGNNTNKISSFQALSALVWRSITRTRNLPPDQTTSCRMA  301

Query  964   IGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R R+   LP  Y+GN++  +      G++LG  LGW AW++ +TV   + ++ VR+ 
Sbjct  302   ADNRPRLEPPLPREYFGNSINPLRGVTTVGELLGHDLGWAAWKLHQTVVNQT-DKAVREW  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
                + +SP     +      ++ + SSPRF+ YG +FG G+ V +RSG  +K DGKV+ +
Sbjct  361   LDAWWKSPFMYHLDRLFDPFSIMMGSSPRFNKYGNEFGLGQAVALRSGYAHKFDGKVSAY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLE  1407
              G E  GS+D+E+ + PH++  LE D EF+E
Sbjct  421   PGHEGGGSIDLEICLPPHSMTALEADEEFME  451



>emb|CDY39539.1| BnaC07g07070D [Brassica napus]
Length=452

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 165/441 (37%), Positives = 253/441 (57%), Gaps = 30/441 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL+ L +   Q+GLLFH P P        ++LI  LKTSLS+ LD + P +GR
Sbjct  24    KIHLTPFDLKLLYVDYPQRGLLFHKPDP-------ETHLISRLKTSLSTALDIYFPFSGR  76

Query  328   FATVMNEEDNTCSVYVDCN---NAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
                  N EDNT S Y+DC+   ++G +FV A++  ++V+ IL Q + +VP  +   F   
Sbjct  77    LVKEENLEDNTVSFYIDCDEHGSSGAKFVHAESKSLSVSDIL-QLHGSVPDFMSHFFPSV  135

Query  499   GILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--GFHQPS  672
              + + +G+ +PL+ +Q+TE+ DG FI+   NH + DG S W+FFN W+++      +Q +
Sbjct  136   DVKSINGLTEPLLALQVTEVKDGVFISFGYNHMVADGASIWSFFNIWSKICSDDSDNQKN  195

Query  673   TTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQ-----RAFLAERVFHLSKVNIARLK  834
               P+  R WF D  +  P+ +P    S   +P P+     R    ERVFH +K N++ LK
Sbjct  196   HNPLKLRGWFLDGIS-FPIRVPA---SETAVPSPRQETSLRPTSNERVFHFTKRNLSNLK  251

Query  835   EKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGY  1002
              KAN+E G+S  +ISSLQ+  AHLWR+  R   +  +E+ H  L + MR R+  P  +  
Sbjct  252   AKANNEAGSSDLVISSLQALSAHLWRSTVRHSGMSRDEETHCKLTVDMRQRLNPPLEKEC  311

Query  1003  WGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEE--EVRKMYMKFVESPAHNGA  1176
             +GN +     ++   ++L   +GW A QI K V   + E+     K +++ V+     G 
Sbjct  312   FGNLILLGVATVTVRELLDNQMGWAALQISKMVRSQTDEKFKTFAKNWVRDVKI-LEKGC  370

Query  1177  EIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELS  1356
               P   +++ +SSSP FDVYG DFGWGKP+  R+G GN +  K+ LF G +EGS+D+  +
Sbjct  371   GSPKVFDSVVMSSSPWFDVYGNDFGWGKPIAARAGPGNSMRAKLVLFQGFKEGSIDVHAT  430

Query  1357  IHPHTLLGLENDAEFLEYFTI  1419
             +  H L+ L  D EFLE  TI
Sbjct  431   LCSHVLVKLLADVEFLENVTI  451



>ref|NP_001130851.1| hypothetical protein [Zea mays]
 gb|ACF79219.1| unknown [Zea mays]
 gb|AFW74306.1| hypothetical protein ZEAMMB73_388623 [Zea mays]
Length=487

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 175/446 (39%), Positives = 242/446 (54%), Gaps = 33/446 (7%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + +TPWDL+ + +  IQKGLL   P P          L+  L +S +  L  F PLAGR 
Sbjct  41    MHMTPWDLRMITVDYIQKGLLL--PKPPAAGGAHAHRLVDGLASSFARALARFYPLAGRL  98

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILD--QSNINVPQILR-SLFTLNG  501
             A           V + C+  G EFV A+A  VTV+ I+        VP  L  SLF LNG
Sbjct  99    AVDAATGGPGVVVSLRCSGEGAEFVHAEAPDVTVSDIITPPAGRYYVPSALVWSLFPLNG  158

Query  502   ILNRDGICK-----PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQ  666
             +L  D         PL+  Q+TEL DG F+A +LNH++GDGT+FW+ FN+W+E+SR   +
Sbjct  159   LLGTDAALDDDSRAPLLSAQVTELADGVFVAMSLNHAVGDGTTFWHLFNTWSEISRAGGE  218

Query  667   ------PSTTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIA  825
                    +  P+ +RWF D   TCPV +  P+ +  + +  P+   + E  F     ++ 
Sbjct  219   GREAELSTPRPVLDRWFLD---TCPVPIALPLRKLEDIVRQPEYPPVRECFFDFPAESVR  275

Query  826   RLKEKANSEMGTS--------IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRAR  981
             +LK KAN+EM           ++SSLQS +AHLWRAV RAR+L    +   +L +G RAR
Sbjct  276   KLKAKANAEMAAGGGTAPAAVVLSSLQSLLAHLWRAVCRARDLAPGAETAYLLLVGCRAR  335

Query  982   M-GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
             + G+P+ Y GNAV        AG+VLG GLGW A  + + V     E  VR     +   
Sbjct  336   VRGVPQAYVGNAVTLAVAKSTAGEVLGGGLGWAALLLNRAVASFD-EAGVRAELAAWARD  394

Query  1159  P--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF-GGCE  1329
             P  A+        + T+   SSPRFDVYG DFGWG+P+ VRSG GNK+DGKVT++ G   
Sbjct  395   PRFAYVEPRGYGGAATVATGSSPRFDVYGNDFGWGRPMSVRSGAGNKMDGKVTVYEGRGG  454

Query  1330  EGSVDIELSIHPHTLLGLENDAEFLE  1407
              GS+ +E+ + P  L  L  D EF+E
Sbjct  455   AGSMALEVCLAPQALARLVADDEFME  480



>ref|XP_008452575.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=455

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 171/454 (38%), Positives = 254/454 (56%), Gaps = 23/454 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN--SNL  264
             IS+CF+        +       L+PWDL  L +  IQKGLL+  P P           +L
Sbjct  11    ISECFIKPHSTPEQS--KHPYYLSPWDLAMLSMHYIQKGLLYAKPLPTLDDDCSGFIDDL  68

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS  L  F PLAGR  T+  E++ +C VYVDCN++ G +F+ A+   +T++ +
Sbjct  69    LRKLKHSLSIALVHFYPLAGRLVTIPYEDEGSCLVYVDCNDSLGAKFIHARVD-MTISDV  127

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L   +  VP I+ S F  +  +N DG  +PL+ +Q+TEL DG FI C++NHS+ DGTS+W
Sbjct  128   LSPGD--VPLIVESFFDHDRAVNHDGHSRPLLSIQVTELHDGVFIGCSINHSIVDGTSYW  185

Query  622   NFFNSWAELSRGFHQP---STTPIHERWFPDNTTTCPVHLPPMIESSE---RLPPPQRAF  783
             +FFN W+E+          S  PI +RWFP+     P+   P     +   R   PQ   
Sbjct  186   HFFNMWSEIFEAEDDNVSISRPPILQRWFPEGHG--PILKLPFTHPDQFINRFEAPQ---  240

Query  784   LAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             L+++ FH S  ++A LK++AN+E  T+ ISS QS  A +WR++TR R L  ++ +  I+ 
Sbjct  241   LSKKHFHFSSESVAVLKKRANTEYKTNKISSFQSLSALVWRSITRVRGLPPDQTIGCIMA  300

Query  964   IGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
             I  R+R+  P  E Y+GN++  I       ++LG  LGW AW++ + V  H  +  VR  
Sbjct  301   INNRSRLDPPLSENYFGNSIHTIKGVATVKELLGNNLGWAAWKLHEAVVNHK-DSIVRDF  359

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               K+VESP+           ++ I SSPRF+ YG  FG GK V +RSG  +K DG VT +
Sbjct  360   VKKWVESPSIYRIAGMFDPLSVMIGSSPRFNKYGNVFGMGKAVGIRSGYAHKFDGIVTCY  419

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
              G E  GS+++E+ +  H +  LE D EF++  T
Sbjct  420   PGYEGGGSIELEICLPLHFMAALETDGEFMDATT  453



>ref|NP_001060828.1| Os08g0112200 [Oryza sativa Japonica Group]
 dbj|BAF22742.1| Os08g0112200 [Oryza sativa Japonica Group]
Length=472

 Score =   285 bits (728),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 174/445 (39%), Positives = 242/445 (54%), Gaps = 37/445 (8%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             V LTPWDL  L    IQKG+L   P           +L+ HL +S +  L  F P AGR 
Sbjct  44    VHLTPWDLPLLTAEYIQKGVLLPKPP------TGGEHLVKHLASSFARALGRFYPFAGRL  97

Query  331   ATVMNEE----DNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             A    E+     ++ SV++ CN+ G EFV A A  V VA I   +++ +P+++ S F L 
Sbjct  98    AVAEVEDGASPPSSISVFLRCNDEGAEFVHATAPDVAVADI--AASLYIPRVVWSFFPLT  155

Query  499   GILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQ--  666
             G+L         P++  Q+TEL DG FIA +LNH +GDGT+FW F N+W+E+SR   +  
Sbjct  156   GLLPAVAAADSLPVLAAQVTELSDGVFIAMSLNHVVGDGTNFWEFMNTWSEISRSRSKLD  215

Query  667   --PSTTPIHERWFPDNTTTCPVHLP-------PMIESSERLPPPQRAFLAERVFHLSKVN  819
               PS   + +RWF D   TCPV +P        +I   +  PPP    L E  F  S  +
Sbjct  216   ISPSPPLVVKRWFLD---TCPVPIPLPFAKLEHIIPRRDHPPPP----LQECFFAFSAES  268

Query  820   IARLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-GL  990
             I +LK KAN E+    + ISSLQ+ +AH+WR+V+RA  L   ++   +L IG R R+ G+
Sbjct  269   IRKLKAKANGEIAGAAATISSLQALLAHVWRSVSRAHGLTPRQETAYVLVIGCRGRVSGI  328

Query  991   PEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN  1170
               GY GNAV      + AG+V+ +GLGW AWQ+ + V     E  +R     +  +P   
Sbjct  329   SPGYVGNAVVPGAVRLTAGEVMERGLGWTAWQLNRFVASLD-EAAMRGAIAPWPRAPEFA  387

Query  1171  GAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF-GGCEEGSVDI  1347
                  +    +   SSPRFDV+G DFGWG+P  VRSGG NK DGKVT++ G    GS+ +
Sbjct  388   NFAKAAGGTAVHTGSSPRFDVFGNDFGWGRPASVRSGGANKFDGKVTVYEGPGGAGSMSL  447

Query  1348  ELSIHPHTLLGLENDAEFLEYFTIP  1422
             E+ + P  L  L  D EF+   T P
Sbjct  448   EVCLAPAALGKLVADEEFMGAVTTP  472



>ref|XP_008452572.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=462

 Score =   284 bits (726),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 172/446 (39%), Positives = 255/446 (57%), Gaps = 16/446 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqq-ffNSNLI  267
             IS+CF+        +   +   L+PWDL  L +  IQKGLL+  P      +  F  +L+
Sbjct  13    ISQCFIKPHTFPEES--KQPYYLSPWDLLMLSVQYIQKGLLYSKPPAALNDEGQFIEDLL  70

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS  L  F PLAGR AT+  +++ +C VYVDCNN+ G +F+ A+ + +T++ IL
Sbjct  71    KKLKHSLSIALVHFYPLAGRLATISYQDEGSCLVYVDCNNSPGAKFIHARLN-MTISDIL  129

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP I++  F  +   N DG    L+ +Q+TELLDG FI C++NHSL DG+S+W+
Sbjct  130   --SPTDVPVIVQYFFDHDRAANHDGHSTSLLSIQVTELLDGVFIGCSINHSLVDGSSYWH  187

Query  625   FFNSWAELSRG---FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             F N W+E+ +     +  S  PI +RWFPD     P+   P     + +   +   L ER
Sbjct  188   FLNMWSEIFQAEDENYSISRPPILQRWFPDGHG--PILKLPFTNPDQFITKFEAPQLRER  245

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             +FH +  ++A LK +AN+E  T+ ISS QS  A +WR++TRAR L  ++     L +  R
Sbjct  246   MFHFTSASLAVLKARANTEYKTNKISSFQSLSALVWRSITRARGLSPDQTTSCRLAVNNR  305

Query  976   ARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
              R+   LPE Y+GN++  I       ++L   LGW AW++ + V  H  +E+VR    K+
Sbjct  306   LRLNPPLPENYFGNSIQAIRGVAIVKELLENNLGWAAWKLHEAVVNHD-DEKVRDHVNKW  364

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             VESP     E      ++ + SSPRF+ YG  FG GK + +RSG  +K DGKV+ + G E
Sbjct  365   VESPFVYHIEQLFDPLSVMMGSSPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSE  424

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFL  1404
               GS+D+EL + P  +  LE D EF+
Sbjct  425   GGGSIDLELCLRPEFMSVLEADEEFM  450



>ref|XP_006307509.1| hypothetical protein CARUB_v10009133mg [Capsella rubella]
 gb|EOA40407.1| hypothetical protein CARUB_v10009133mg [Capsella rubella]
Length=446

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 165/435 (38%), Positives = 244/435 (56%), Gaps = 22/435 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FLQ    Q+GLLF  P P        +N I  L +SLS  L  F P AGR
Sbjct  22    KIHLTPWDLFFLQSEYSQRGLLFTQPDP-------ETNFISRLTSSLSVALKIFYPFAGR  74

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N++D T S +VDCN +GV FV A A+ V+V+ +L      +P++L+  +  NG+ 
Sbjct  75    LVKIENQDDGTSSFHVDCNGSGVRFVHASATSVSVSDVLHPVGGILPELLKDFYPANGVK  134

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS---RGFHQPSTT  678
             + +GI   L+ VQ+TEL DG FIA   +H + DGTS WNF N+W+E+      F +    
Sbjct  135   SYEGITDSLIAVQVTELKDGVFIAVGYSHIVTDGTSIWNFLNTWSEICFNMYDFDRSKEF  194

Query  679   P--IHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAF-LAERVFHLSKVNIARLKEKAN  846
             P  +H  WF D     P+ +P  M+E+ + +     +  L E++F  +   IA LK KAN
Sbjct  195   PPLVHRGWFLDGIEY-PIRIPNSMMETPKVVDDTTSSLILQEKIFRFTSKIIAELKAKAN  253

Query  847   SEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNA  1014
             SE+  +   ISSLQ+  A++W +V R   L   E V   L + +R R+  P  +   GN 
Sbjct  254   SEVSANDRKISSLQAVSAYIWLSVIRNSGLSPEEVVCCELLVDLRRRLDPPLEKECCGNM  313

Query  1015  VFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSS  1194
             V   T +    +++  GLGW A QI K+V   ++ E  R+   K+V+ P+    +I +  
Sbjct  314   VGITTTATTVKEIVSNGLGWAALQINKSVGAQTN-EVFREFAEKYVKKPSM--LDINALR  370

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTL  1374
             NT+ ++SSPRF+VYG DFGWGKP+ VR G GN  DG +    G E+G +D+++ +    L
Sbjct  371   NTIVVTSSPRFNVYGNDFGWGKPITVRGGPGNTHDGALLANPGIEQGDIDMQMCLSSSVL  430

Query  1375  LGLENDAEFLEYFTI  1419
               L  DAEFL++  +
Sbjct  431   EKLSTDAEFLKHVCV  445



>ref|XP_007226559.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
 gb|EMJ27758.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
Length=459

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 178/458 (39%), Positives = 269/458 (59%), Gaps = 23/458 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LI  267
             IS+CFV    A+  +   +   LTP DL  L +  IQKGLLF  P   + +Q   +N L+
Sbjct  9     ISECFVQPHHASEES--KQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLEQEDFTNSLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               +K SLS  L  F PLAGRF T  NE+     VYVDCNN+ G +F+ A    ++++ IL
Sbjct  67    ERVKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFIYATLD-MSISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP +++S F  +  +N DG    L+ +Q+TEL+DG FI  ++NH LGDGTS+W+
Sbjct  126   --SPTDVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWH  183

Query  625   FFNSWAEL----SRGFH-----QPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             FFN W+E+    ++G H     + S  P+ +RWFPD     P+   P   S E +   + 
Sbjct  184   FFNIWSEIFQAQAQGDHNNFVPKISRPPVLKRWFPDGHG--PIINLPFKHSDEFIGRYEA  241

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
               L ER+FH S  +IA+LK KAN+E  T+ ISS +S  A +WR++TRAR L  ++     
Sbjct  242   PKLRERMFHFSSESIAKLKAKANAESNTTKISSFKSLSALMWRSITRARGLPRDQGTSCR  301

Query  958   LGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             L    R R+  P    Y+GN++  I +E + AG++L  GLGW AW++ + V  H+ ++ +
Sbjct  302   LAANNRGRLEPPLSGDYFGNSIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHN-DKLI  360

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    +++SPA          + + + SSPRF++YG  FG GK + +RSG  +K  GKV
Sbjct  361   REHVDGWLKSPAVYQVSFFDPLSVM-MGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKV  419

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + + G EEGS+D+E+ + P  +  LE D+EF+E  ++P
Sbjct  420   SSYEGREEGSIDLEVCLPPDAMSALECDSEFMEAASVP  457



>ref|XP_008648377.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Zea 
mays]
 gb|ACG27491.1| hypothetical protein [Zea mays]
 gb|AFW74303.1| hypothetical protein ZEAMMB73_573058 [Zea mays]
Length=489

 Score =   285 bits (728),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 242/448 (54%), Gaps = 33/448 (7%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             +TPWDL+ + +  IQKGLL   P P          L+  L +S +  L  F PLAGR A 
Sbjct  43    MTPWDLRMITVDYIQKGLLL--PKPPAAGGAHAHRLVDGLASSFARALARFYPLAGRLAV  100

Query  337   VMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAI--LDQSNINVPQILR-SLFTLNGIL  507
                       V + C+  G EFV A+A  VTV+ I  L   +  VP  L  SLF LNG+L
Sbjct  101   DAATGGPGVVVSLRCSGEGAEFVHAEAPEVTVSDIITLPAGHYYVPSALVWSLFPLNGLL  160

Query  508   NRDGICK-----PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQP-  669
               D         PL+  Q+TEL DG F+A +LNH++GDGT+FW+ FN+W+E+SR   +  
Sbjct  161   GTDAALDDDSRAPLLSAQVTELADGVFVAMSLNHAVGDGTTFWHLFNTWSEISRAGGEGR  220

Query  670   -----STTPIHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVNIARL  831
                  +  P+ +RWF D   TCPV +  P+ +  + +  P+   + E  F     ++ +L
Sbjct  221   EAELCTPRPVLDRWFLD---TCPVPIALPLRKLEDIVRQPEYPPVRECFFDFPAESVRKL  277

Query  832   KEKANSEMGTS--------IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM-  984
             K KAN+E+           ++SSLQS  AHLWRAV RAR L    +   +L +G RAR+ 
Sbjct  278   KAKANAEIAAGGGTAPAAVVLSSLQSLFAHLWRAVCRARELAPGAETAYLLPVGCRARVR  337

Query  985   GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP-  1161
             G+P+ Y GNAV        AG+VLG GLGW A  + + V     E  VR     +   P 
Sbjct  338   GVPQAYVGNAVTLAVAKSTAGEVLGGGLGWAALLLNRAVASFD-EAGVRAELAAWARDPR  396

Query  1162  -AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF-GGCEEG  1335
              A+        + T+   SSPRFDVYG DFGWG+P+ VRSG GNK+DGKVT++ G    G
Sbjct  397   FAYVEPRGYGGAATVATGSSPRFDVYGNDFGWGRPLAVRSGAGNKMDGKVTVYEGRGGAG  456

Query  1336  SVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             S+ +E+ + P  L  L  D EF+E  T+
Sbjct  457   SMALEVCLEPQALARLVADDEFMEAVTV  484



>ref|XP_010110810.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28182.1| putative acetyltransferase [Morus notabilis]
Length=454

 Score =   283 bits (724),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 252/447 (56%), Gaps = 17/447 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+        +     + LTPWDL  L +  IQKGLLF  P   + + F  S L+ 
Sbjct  10    ISECFIKPHYTPEDS--ENPLYLTPWDLAMLSVHYIQKGLLFAKPHTNKDENFMGS-LLD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS  L  F PLAGR  TV  E  ++ SV+VDCN+  G +F+ A    +TV+ IL 
Sbjct  67    RLKQSLSVALVHFYPLAGRLKTVKTENPHSYSVHVDCNDGPGAKFIYATLD-MTVSDIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S ++VP I++  F  +  +N DG    L+ +Q+TEL+DG FI C++NH + DG SFWNF
Sbjct  125   -SPVDVPPIVQLFFDHDRAVNHDGHTTSLVTIQVTELVDGVFIGCSMNHVIADGASFWNF  183

Query  628   FNSWAELSRGF----HQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAER  795
             +N W+E+ R       Q S  PI +RWFP+     P+   P     E +   +   L ER
Sbjct  184   WNMWSEIFRAKDNKNKQISRPPIFKRWFPEGHG--PILSLPYKHPDEFIGRFEAPKLRER  241

Query  796   VFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMR  975
             VFH S  +IA+LK +AN E  T  ISS QS  A +WR++ R RNL  ++     L    R
Sbjct  242   VFHFSVESIAKLKARANLEYNTRKISSFQSLSALVWRSIIRVRNLPPDQVTSCRLAANNR  301

Query  976   ARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
             AR+  P  E Y+GN ++ I     AG++L   LGW AW++ + V  H+ ++ +R +   +
Sbjct  302   ARLDPPISENYFGNVIYPIRGFTTAGELLQNDLGWAAWKLHEAVVNHN-DKSIRGLLDAW  360

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE  1329
             + SP            ++ + SSPRFD YG +FG G+ + +RSG  +K DGKV+ + G E
Sbjct  361   LRSPTVYQIGKLFDPYSVMMGSSPRFDKYGNEFGMGRALALRSGYAHKFDGKVSCYPGHE  420

Query  1330  -EGSVDIELSIHPHTLLGLENDAEFLE  1407
               GS+D+E  + P T+  LE+D EF+E
Sbjct  421   GGGSIDLETCLPPETMRALESDKEFME  447



>ref|XP_007017180.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY14405.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   283 bits (723),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 174/447 (39%), Positives = 262/447 (59%), Gaps = 19/447 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV     ++ +   +   LT WDL  L +  IQKGLLF  P P+   Q    N++ 
Sbjct  9     ISECFVKPPHVSQES--KQPFYLTTWDLAMLSVQYIQKGLLFAKPPPEDCPQDLIKNILD  66

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
              LK SLS +L  F PLAGR AT   E      V+VDCNN+ G +F+ A A   TV+ IL 
Sbjct  67    RLKKSLSLSLVHFYPLAGRLATRREENPPAYFVFVDCNNSPGAKFIHA-AVDATVSHIL-  124

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S   VP +++S F  +  +N DG  +PL+ +Q+TEL+DG FI C++NH++GDG++FW+F
Sbjct  125   -SPTYVPLVVQSFFDHDRAINHDGHTRPLLSIQVTELVDGVFIGCSMNHAIGDGSTFWHF  183

Query  628   FNSWAEL--SRGFH-QPSTTPIHERWFPDNTTTCPVHLP--PMIESSERLPPPQRAFLAE  792
             FN  +E+  ++G + + S  P+ +RWFP+      ++LP     E   R   PQ   L E
Sbjct  184   FNILSEIFQAQGDNVKISRQPVLKRWFPEGHGPL-INLPFTHQDELIRRFEAPQ---LLE  239

Query  793   RVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             R+FH S  +IA+LK +ANSE  TS ISS QS  A +W ++T+AR   +++     L I  
Sbjct  240   RIFHFSAESIAKLKARANSEYNTSKISSFQSLSAFVWMSITKARRFPNDQLTSCRLAINN  299

Query  973   RARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMK  1146
             R+R+  P    Y+GN++  +     AG+++ + LGW AWQ+   V  H+ ++ VR     
Sbjct  300   RSRLDPPLSPDYFGNSIQTVRAVTTAGELVEQNLGWAAWQLHLAVVNHT-DKSVRGFVND  358

Query  1147  FVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGC  1326
             ++ SP            ++ + SSPRF+ YG +FG GK + +RSG  +K DGKV+ + G 
Sbjct  359   WLRSPFIYQLGQFFDPQSVMMGSSPRFNKYGNEFGLGKALALRSGYAHKFDGKVSSYPGR  418

Query  1327  E-EGSVDIELSIHPHTLLGLENDAEFL  1404
             E  GS+D+E+ +  H++  LE+DAEF+
Sbjct  419   EGGGSIDLEVCLPAHSMNALESDAEFM  445



>ref|XP_006473294.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=455

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 174/451 (39%), Positives = 257/451 (57%), Gaps = 20/451 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPT-PqqqqqffN--SN  261
             +S+CFV       S  + +   LTPWDL  L +  IQKGLLF  P  P       +    
Sbjct  9     MSECFVQPE--YFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASVDQVDFIKT  66

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAA  438
             L+  LK SLS TL  F PLAGR  T   +   +  V+VDCNN+ G +F+ A    + ++ 
Sbjct  67    LLDRLKHSLSLTLVHFYPLAGRLVTRQTDSPPSYVVFVDCNNSPGAKFIHASLD-MAISD  125

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S   VP +++S F  +  LN DG  +PL+ +Q+TEL+DG FI C++NH LGDGTSF
Sbjct  126   IL--SPTYVPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSF  183

Query  619   WNFFNSWAELSRG---FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA  789
             WNFFN+++E+ +        S  P+ +RWFPD     P+   P     E +   +   L 
Sbjct  184   WNFFNAFSEIFQAQGKMASISRPPVIKRWFPDGRD--PIINLPFTHRDEFIRRYEAPQLL  241

Query  790   ERVFHLSKVNIARLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
             ER+FH +  +IARLK KAN+E G  T+ ISS Q+  A +WR++TR RNL  ++     + 
Sbjct  242   ERIFHFTGESIARLKAKANAEAGNNTNKISSFQALSALVWRSITRIRNLPPDQTTGCRMA  301

Query  964   IGMRARM--GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R R+   LP  Y+GN++  +      G++LG  LGW AW++ +TV   + ++ VR+ 
Sbjct  302   ADNRPRLEPPLPREYFGNSINPLRGVTTVGELLGHDLGWAAWKLHQTVVNQT-DKAVREW  360

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
                + +SP     +      ++ + SSPRF+ YG +FG G+ V +RSG  +K DGKV+ +
Sbjct  361   LDAWWKSPFMYHLDRLFDPFSIMMGSSPRFNKYGNEFGLGQAVALRSGYAHKFDGKVSAY  420

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLE  1407
              G E  GS+D+E+ + PH++  LE D EF+E
Sbjct  421   PGHEGGGSIDLEICLPPHSMTALEADEEFME  451



>ref|XP_008220248.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
 ref|XP_008220249.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
Length=459

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 179/458 (39%), Positives = 264/458 (58%), Gaps = 23/458 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LI  267
             IS+CFV    A+  +   +   LTP DL  L +  IQKGLLF  P   +  Q   +N L+
Sbjct  9     ISECFVQPHHASEES--KQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQEDFTNSLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS  L  F PLAGRF T  NE+     VYVDCNN+ G +F+ A    ++++ IL
Sbjct  67    ERLKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFIYATLD-MSISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP +++S F  +  +N DG    L+ +Q+TEL+DG FI  ++NH LGDGTS+W+
Sbjct  126   --SPTDVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWH  183

Query  625   FFNSWAEL----SRGFHQP-----STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             FFN W+E+    ++G H       S  P+ +RWFPD     P+   P   S E +   + 
Sbjct  184   FFNIWSEIFQAQAQGDHNNFVPNISRPPVLKRWFPDGHG--PIINLPFKHSDEFIGRYEA  241

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
               L ER+FH S  +IA+LK KAN+E  T+ ISS QS  A +WR++TR R L  ++     
Sbjct  242   PKLRERMFHFSSESIAKLKAKANAESNTTKISSFQSLSALMWRSITRVRGLPQDQGTSCR  301

Query  958   LGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             L    R R+  P    Y+GN++  I +E + AG++L  GLGW AW++ + V  H++ + +
Sbjct  302   LAANNRGRLEPPLSGDYFGNSIHPIRSEIVPAGELLDHGLGWAAWKLHEAVVNHNN-KWI  360

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    ++ SPA          + + + SSPRF++YG  FG GK + +RSG  +K  GKV
Sbjct  361   REHVDGWLNSPAVYQVSFFDPLSVM-MGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKV  419

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + + G EEGS+D+E+ + P  +  LE D EF+E  ++P
Sbjct  420   SSYEGREEGSIDLEVCLPPDAMSALECDTEFMEAASVP  457



>ref|XP_010441191.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=499

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/444 (38%), Positives = 248/444 (56%), Gaps = 35/444 (8%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +++ LTPWDL FL+    Q+GLLF  P P       +++ I  LK+SLS  L+ F P AG
Sbjct  67    KKIHLTPWDLFFLRAEYAQRGLLFPQPDP-------DTHFISRLKSSLSVALNIFYPFAG  119

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R   + N+ D T S +VDC+ +GV+FV A A  V+V+ +L+ ++ +VP+ L+  +  NG+
Sbjct  120   RLVKIENQHDGTASFHVDCDGSGVKFVHASAKTVSVSDVLEPADGHVPEFLKRFYPANGV  179

Query  505   LNRDG--ICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL--SRGFHQPS  672
              + D   I   L+  Q+TEL DG FI    NH + DG SFW+FFN+W+E+      H+  
Sbjct  180   RSCDCEEISDSLIAFQVTELKDGVFIGYGYNHIVADGISFWSFFNTWSEICFDSDHHRRK  239

Query  673   TTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQRAF---------LAERVFHLSKVNI  822
               P+  R WF D      +  P  I  SE   PP R           L E++F  +  N+
Sbjct  240   FPPLVLRGWFLDG-----IEYPIRIPISETETPPNRGVVNVVGTSSSLQEKIFRFTSRNV  294

Query  823   ARLKEKANSEMGTS--IISSLQSYMAHLWRAVTR-ARNLHSNEDVHLILGIGMRARMGLP  993
             + LK KAN E+      ISSLQ+  A++WRA+ R +  L   E +   L + MR R+  P
Sbjct  295   SELKAKANGEVSADDRRISSLQAVSAYMWRAIIRNSCELSREEVICFKLLVDMRPRLNPP  354

Query  994   --EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAH  1167
               +  +GN V   T +   G+++  GLGW A  I KT+   ++EE  RK    +V+ P+ 
Sbjct  355   LDKECFGNTVGLATATTTVGEMVNNGLGWAALLINKTLGSQTNEE-FRKFAQNWVKEPSL  413

Query  1168  NGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDI  1347
               A   SSSN + ++SSPRF+VYG DFGWGKP+ VR+G GN  DGK+  + G E+G ++I
Sbjct  414   LKA---SSSNYIVVASSPRFNVYGNDFGWGKPIAVRAGPGNTHDGKLIAYPGVEQGDMEI  470

Query  1348  ELSIHPHTLLGLENDAEFLEYFTI  1419
                +    L  L  DA+FL++  +
Sbjct  471   HTCLSSAVLEKLSTDADFLKHVCV  494



>ref|XP_010503697.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=447

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 163/441 (37%), Positives = 251/441 (57%), Gaps = 25/441 (6%)
 Frame = +1

Query  130   SNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             S     ++ LTP+DL  LQ    Q+GLLF  P P         +LI  +KTSLS  L+ +
Sbjct  18    SQSSREKIHLTPFDLTHLQYDYPQRGLLFPKPDPAF-------HLISRVKTSLSLALEIY  70

Query  310   PPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLF  489
              P AGR   V N EDN+ S Y+DC+ +G  F+ A+A  V+V+  L Q + +VP  ++  F
Sbjct  71    FPFAGRLVKVENPEDNSVSFYIDCDGSGARFLHAEAKSVSVSDFL-QPDGSVPGFIKHFF  129

Query  490   TLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQ  666
               +   + DG+ +PL+ +Q+TE+ DG FI    NH + DG S W+FF++W+++ S G   
Sbjct  130   PADDFKSSDGVLEPLLALQVTEMKDGVFIGFCYNHMVADGASMWSFFHTWSKICSSGSGS  189

Query  667   PSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA-----ERVFHLSKVNIARL  831
                  I + WF D     P+H+P  +  +ER P   R   +     +RVFH +K NI+ L
Sbjct  190   DHKPLILKGWFLDGIDY-PIHIP--VSETER-PQLNRELSSVPITKDRVFHFTKKNISDL  245

Query  832   KEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EG  999
             K KANSE+G+S   ISS+Q+  AH+WR++ R   L   ++ H  + + +R R+  P  + 
Sbjct  246   KAKANSELGSSELKISSVQAVSAHMWRSIIRHGGLSREKETHCKVAVDLRQRLNPPLEKE  305

Query  1000  YWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EEVRKMYMKFVESPAHNG  1173
              +GN  +  +       +L +GLGW A QI K V+  ++E  +     ++K V++    G
Sbjct  306   CFGNMAYLPSAIATVEQLLDRGLGWAALQINKVVKSQTNENCKIFAADWIKNVKN-LKLG  364

Query  1174  AEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIEL  1353
                  + +T+ I+SSPRF+VY  DFGWGKP+ VR+G GN + GK+  F G +EGS+D++ 
Sbjct  365   VGGRVAGDTIVIASSPRFEVYNNDFGWGKPIAVRAGPGNSISGKLVCFPGIDEGSIDVQA  424

Query  1354  SIHPHTLLGLENDAEFLEYFT  1416
             ++    L+ L  D EF+EY T
Sbjct  425   TLWSDVLVNLLADVEFVEYVT  445



>ref|XP_004972478.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=491

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 243/447 (54%), Gaps = 38/447 (9%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             + LTPWDL+ + I  IQKG+L   P            L++ L++S S  L+ F P AGR 
Sbjct  41    IHLTPWDLRLISIDYIQKGILLPKPP------VSGDVLVNALESSFSRALERFYPFAGRL  94

Query  331   ATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFT--LNGI  504
             A+     D T SV++ C + G EFV A A  V VA I+  S++  P  + + ++   + +
Sbjct  95    AS-EERGDGTMSVFLRCTSEGAEFVHAVAPEVAVADIV--SSLYTPPAVWAFYSNSFDQV  151

Query  505   LNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSR--------  654
             L  D   K  PL+ VQ+TEL DG FI  TLNHS GDGT+FW+F N+W+E+ R        
Sbjct  152   LGADAAIKSLPLVSVQVTELADGVFIGMTLNHSAGDGTAFWHFLNTWSEIHRRAGGGVGV  211

Query  655   ---GFHQPSTTP-IHERWFPDNTTTCPVHLP-PMIESSERLPPPQRAFLAERVFHLSKVN  819
                     ST P + +RWF     TCPV +P P  +    +   +R  + E  F  S  +
Sbjct  212   SDDDLRDLSTPPPVLQRWF---VETCPVPIPMPFSKLEHIVKKFERTAVQECFFTFSAAS  268

Query  820   IARLKEKANSEMG-----TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
             + +LK +AN+E+       + ISSLQ+ +AHLWRAV RAR L   +     + +G R R+
Sbjct  269   VKKLKAQANAEIAGTDTAAATISSLQAVLAHLWRAVCRARRLPREQVTFYSVVVGCRGRV  328

Query  985   -GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
              G+P GY GNA+ F      AG++  KGLGW AW + + V     E  +R+    +V  P
Sbjct  329   NGIPPGYVGNAMVFGKAVATAGEIDDKGLGWTAWLLNRAVASFD-EASMRESLESWVRDP  387

Query  1162  AHN-GAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE-G  1335
                    + S+   L   SSPRFDV+G DFGWGKPV +RSG GNK DGK T+F G E  G
Sbjct  388   DFTYMGNLSSAGTALVTGSSPRFDVFGNDFGWGKPVAIRSGAGNKADGKATVFEGPERGG  447

Query  1336  SVDIELSIHPHTLLGLENDAEFLEYFT  1416
             S+ +E+ I P  L  L  D EF++  T
Sbjct  448   SISLEVCIAPDALKRLVADEEFMDAVT  474



>ref|XP_009102495.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brassica 
rapa]
Length=452

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 170/449 (38%), Positives = 252/449 (56%), Gaps = 35/449 (8%)
 Frame = +1

Query  133   NGVSR-RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFF  309
             N  SR ++ LTP+DL+ L +   Q+GLLFH P P        ++LI  LKTSLS+ LD +
Sbjct  18    NQSSRTKIHLTPFDLKLLYVDYPQRGLLFHKPDP-------ETHLISRLKTSLSTALDIY  70

Query  310   PPLAGRFATVMNEEDNTCSVYVDCN---NAGVEFVEAKASGVTVAAILDQSNINVPQILR  480
              P +GR     N EDNT   Y+DC+   ++G +F+ A++  ++V+ IL Q + +VP  + 
Sbjct  71    FPFSGRLVKEENLEDNTMLFYIDCDERGSSGAKFIHAESKSLSVSDIL-QPDGSVPDFMS  129

Query  481   SLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGF  660
               F    + + +G+ +PL+ +Q+TE+ DG FI+   NH + DG S W+FFN+W+++    
Sbjct  130   HFFPSVDVKSINGLTEPLLALQVTEIKDGVFISFGYNHMVADGASIWSFFNTWSKICSDD  189

Query  661   HQ--PSTTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQRAFLA------ERVFHLSK  813
                  +  P+  R WF D      +  P  + +SE + P  R   +      ERVFH +K
Sbjct  190   SDNLKNHNPLKLRGWFLDG-----ISFPICVPASETVVPSPRQETSLRPTSNERVFHFTK  244

Query  814   VNIARLKEKANSEMGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG  987
              N++ LK KAN+E G+S  IISSLQ+  AHLWR++ R   +   E+ H  L + MR R+ 
Sbjct  245   RNLSNLKAKANNEAGSSDLIISSLQALSAHLWRSIIRHSGMSGEEETHCKLTVDMRQRLN  304

Query  988   LP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP  1161
              P  +  +GN +     ++  G++L   +GW A QI K V   S  +E  K + K     
Sbjct  305   PPLEKECFGNLILLGVATVTVGELLDNQMGWAASQINKMVR--SQTDEKFKTFAKNCVRD  362

Query  1162  A---HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEE  1332
                   G   P   +++ +SSSP FDVYG DFGWGKP+  R+G GN + GK+ LF G EE
Sbjct  363   VKILEKGCGNPKVFDSVVMSSSPWFDVYGNDFGWGKPIAARAGPGNSMRGKLVLFQGVEE  422

Query  1333  GSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GS+D+  ++  H LL L  D EFLE  TI
Sbjct  423   GSIDVHATLCSHLLLKLLADVEFLENVTI  451



>ref|XP_007221613.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
 gb|EMJ22812.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
Length=453

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 266/458 (58%), Gaps = 29/458 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LI  267
             IS+CFV    A+  +   +   LTP DL  L +  IQKGLLF  P   +  Q   +N L+
Sbjct  9     ISECFVQPHHASEES--KQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQEDFTNSLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS  L  F PLAGRF T  NE+     VYVDCNN+ G +F+ A    ++++ IL
Sbjct  67    ERLKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFINATLD-MSISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  + P +++S F  +  +N DG    L+ +Q+TEL+DG FI  ++NH LGDGTS+W+
Sbjct  126   --SPTDAPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWH  183

Query  625   FFNSWAEL----SRGFH-----QPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             FFN W+E+    ++G H     + S  P+ +RWFPD     P+   P   S E +   + 
Sbjct  184   FFNIWSEIFQAQAQGDHNNFVPKISRPPVLKRWFPDGHG--PIINLPFKHSDEFIGRYEA  241

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
               L ER+FH S  +IA+LK KAN+E  T+ ISS QS  A +WR++TRAR L  ++     
Sbjct  242   PKLRERMFHFSSESIAKLKAKANAESNTTKISSFQSLSALMWRSITRARGLPRDQ-----  296

Query  958   LGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              G   R R+  P    Y+GN++  I +E + AG++L  GLGW AW++ + V  H+ ++ +
Sbjct  297   -GTNCRGRLEPPLSGDYFGNSIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHN-DKLI  354

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    +++SPA          + + + SSPRF++YG  FG GK +  RSG  NK  GKV
Sbjct  355   REHVDGWLKSPAVYQLSFFDPFSVM-MGSSPRFNMYGNQFGMGKALAPRSGYANKFSGKV  413

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + + G EEGS+D+E+ + P  +  LE D+EF+E  ++P
Sbjct  414   SSYEGREEGSIDLEVCLPPDAMSALECDSEFMEAASLP  451



>ref|XP_010064180.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66385.1| hypothetical protein EUGRSUZ_F00202 [Eucalyptus grandis]
Length=465

 Score =   282 bits (721),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 253/458 (55%), Gaps = 22/458 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS CF+  +     +G +R + L PWDL  L +  IQKGLLF  P    +  F     IH
Sbjct  14    ISDCFIKPSQLP--DGSNRPLHLPPWDLAMLSVHYIQKGLLFPLPPRCLKAGFDRPAFIH  71

Query  271   ----HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVA  435
                  LK SLSS L  F PLAGRFAT+   +    +V+VDC N+ G  F+ A    +TVA
Sbjct  72    SFLEKLKRSLSSALFHFYPLAGRFATLKQTDPPFYTVFVDCANSPGARFIHATLD-MTVA  130

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              IL  S   VP +++S F  +  ++ DG    L+ VQ+TEL DG FI  ++NH++ DGTS
Sbjct  131   DIL--SPTYVPDVVQSFFDHDRAIDHDGHTLSLLSVQVTELADGVFIGLSMNHAIADGTS  188

Query  616   FWNFFNSWAELSRGFH-------QPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             FW FFNSW+E+ +          Q S  P+  RWFP+N    P+ LP   + S  L   +
Sbjct  189   FWLFFNSWSEIFQAQEKGAVDVVQLSRPPVLTRWFPENHPG-PLSLPYTDDPSSFLARFE  247

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                L ERVFH S   IA LK +AN + GT+ ISS QS  A +WR +TRAR+   N+    
Sbjct  248   SPELRERVFHFSADAIAELKAEANRQCGTTNISSFQSLTALIWRCITRARHFPPNQVTGC  307

Query  955   ILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              +    RAR+   L   Y+GN++ F+      G++LG GLGW A  +   V  HS+  ++
Sbjct  308   RMAANNRARLDPQLSPEYFGNSINFLRTVATVGELLGSGLGWAAQLLHAAVAGHSN-AKL  366

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    +++ P     +      ++ + SSPRFD YG++FG GK V +RSG  NK DGK 
Sbjct  367   REWNEDWIKRPQVYNPDKTFDRYSVMMGSSPRFDKYGSEFGLGKAVALRSGYANKWDGKA  426

Query  1309  TLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + + G E  GSVD+E+ + P T+  LE D EF+   T+
Sbjct  427   SGYPGREGGGSVDLEICLPPVTMALLEADPEFMAAVTV  464



>emb|CDP06258.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 250/446 (56%), Gaps = 17/446 (4%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +S+C V      + +   +R+ L PWDL+   +   Q GLLF  P P    +    + + 
Sbjct  14    VSECLVQPKHIPQDS--EQRIYLAPWDLRLASLHYNQNGLLFAKP-PAFDSEGKMKDYLQ  70

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNN-AGVEFVEAKASGVTVAAILD  447
              LK SLS TL  F PLAGR AT+  E     S+YVDC N  G +FV A    +T+  IL 
Sbjct  71    KLKESLSLTLVHFYPLAGRLATLKQENPPIYSIYVDCTNLPGAKFVHASVD-LTIDDIL-  128

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              + I +P+I+ S F   G +N DG    L+ +Q+TEL DG FI  + NH L DGTSFW+F
Sbjct  129   -TPIYMPKIVYSFFDHVGAVNHDGHSMSLISIQVTELKDGIFIGWSTNHLLVDGTSFWHF  187

Query  628   FNSWAELSRGFHQPSTT---PIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERV  798
              N+W+E+     Q ST    PI +RWFP+   + PV   P     E +   Q   L ER 
Sbjct  188   INTWSEVFNAKGQISTISRPPILKRWFPEGHRS-PVFSLPFAHHDEFISRFQTPELLERY  246

Query  799   FHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRA  978
             FH S  ++A+LK KAN+E  ++ IS+ Q+  A LWR +TRARN+ S++       +  R 
Sbjct  247   FHFSAESLAKLKAKANAECNSTNISTFQALSALLWRCITRARNMPSDQQTSAGTAVNSRL  306

Query  979   RMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFV  1152
             R+  P  E Y+GN +  +  +   G++L  GLGW AW++   V   + +  +R+    +V
Sbjct  307   RINPPLSEEYFGNCIQGVAVTTTCGELLTNGLGWAAWKLHDLVINQT-DRSIREWVESWV  365

Query  1153  ESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-  1329
             +SP      I   SN + I +SPRF++YG +FG GK + VRSG  NKLDGK+TLF G E 
Sbjct  366   KSPF--IVWIGRFSNRIQIGNSPRFNIYGNEFGLGKALAVRSGFANKLDGKITLFPGREG  423

Query  1330  EGSVDIELSIHPHTLLGLENDAEFLE  1407
              GS+D+E  +   T+  LE+D EF+E
Sbjct  424   GGSMDVEACLPQQTMSFLESDQEFME  449



>ref|XP_006291132.1| hypothetical protein CARUB_v10017245mg [Capsella rubella]
 gb|EOA24030.1| hypothetical protein CARUB_v10017245mg [Capsella rubella]
Length=448

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/436 (37%), Positives = 250/436 (57%), Gaps = 25/436 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  LQ    Q+GLLF  P P       + NLI  LKTSLS  LD + P AGR
Sbjct  25    KIHLTPFDLSLLQFDYPQRGLLFPKPDP-------DFNLISRLKTSLSLALDIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                  N ED+T S Y+DC+ +G  F+ A+A+ V+V+ +L Q + +VP   +  F  +   
Sbjct  78    LVKTENLEDDTASFYIDCDGSGARFLHAEANSVSVSDLL-QPDGSVPDFAKHFFPADDFK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP-I  684
             + DG+  PL+ VQ+TE+ DG FI+   NH + DG S W+F ++W+++       +  P +
Sbjct  137   SCDGVTVPLLVVQVTEMKDGVFISYCYNHVVADGVSMWDFLHTWSKICSTGSGFNPKPLV  196

Query  685   HERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLA-----ERVFHLSKVNIARLKEKANS  849
              + WF +     P+H+P  +  +ER PPP R   +     E +FH +K NI+ LK KANS
Sbjct  197   LKGWFLEGIDY-PIHIP--VSETER-PPPSRELSSVPTTKEWIFHFTKENISNLKSKANS  252

Query  850   EMGTSI--ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAV  1017
             E+ ++   ISSLQ+  AH+WR++ R   +   +  H  L + +R R+  P  +  +GN V
Sbjct  253   EVASNDQGISSLQAVSAHMWRSIIRHSGVSREQKTHCKLVVDVRQRVNPPLEKDCFGNMV  312

Query  1018  FFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSN  1197
             +    +    ++L +GLGW A +I+  V   +  E  +    ++V +  +  A I S  +
Sbjct  313   YLAPATTTVEELLDRGLGWAALKIRNLVSSQT-SENCKFFAEEWVRNVNNLRAGIGSKVD  371

Query  1198  --TLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
               T+ I+SSPRF+VY  DFGWGKP+ +R+G  N + GK+TLF G  EGS+D++ ++    
Sbjct  372   GGTIVIASSPRFEVYNKDFGWGKPIAIRAGPSNSISGKLTLFQGISEGSIDVQANLWSDV  431

Query  1372  LLGLENDAEFLEYFTI  1419
             ++ L  D EFLE+ T+
Sbjct  432   IVKLLADVEFLEHVTV  447



>ref|XP_008220251.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=459

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 180/458 (39%), Positives = 264/458 (58%), Gaps = 23/458 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LI  267
             IS+CFV    A+  +   +   LTP DL  L +  IQKGLLF  P   +  Q   +N L+
Sbjct  9     ISECFVQPHHASEES--KQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQEGFTNSLL  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS  L  F PLAGRF T  NE+     VYVDCNN+ G +F+ A    ++++ IL
Sbjct  67    ERLKHSLSIALVRFYPLAGRFVTKKNEDPPLYLVYVDCNNSPGAKFIYATMD-MSISDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               S  +VP +++S F  +  +N DG    L+ +Q+TEL+DG FI  ++NH LGDGTS+W+
Sbjct  126   --SPTDVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWH  183

Query  625   FFNSWAEL----SRGFHQP-----STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQR  777
             FFN W+E+    ++G H       S  P+ +RWFPD     P+   P   S E +   + 
Sbjct  184   FFNIWSEIFQAQAQGDHNNFVPNISRPPVLKRWFPDGHG--PIINLPFKHSDEFIGRYEA  241

Query  778   AFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLI  957
               L ER+FH S  +IA+LK KAN+E  T+ ISS QS  A +WR++T AR L  ++     
Sbjct  242   PKLRERMFHFSSESIAKLKAKANAESNTTKISSFQSLSALMWRSITHARGLPQDQGTSCR  301

Query  958   LGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
             L    R R+  P    Y+GN++  I +E + AG++L  GLGW AW++ + V  H+ ++ +
Sbjct  302   LAANNRGRLEPPLSGDYFGNSIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHN-DKLI  360

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    +++SPA          + + + SSPRF++YG  FG GK +  RSG  NK  GKV
Sbjct  361   REHVDGWLKSPAVYQLSFFDPFSVM-MGSSPRFNLYGNQFGMGKALAPRSGYANKFSGKV  419

Query  1309  TLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             + + G EEGS+D+E+ + P  +  LE D EF+E  ++P
Sbjct  420   SSYEGREEGSIDLEVCLPPDAMSVLECDREFMEAASVP  457



>ref|XP_010677336.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=460

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 178/450 (40%), Positives = 255/450 (57%), Gaps = 23/450 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+      +     +   L+P DL  L    IQKGLLF  P+    QQF     + 
Sbjct  11    ISECFIKPKYEVKE--AKQPYYLSPMDLAMLSAHYIQKGLLFTKPSNLDNQQFSIHKFLQ  68

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILD  447
             +LK SLS TL  F PLAG+ A+ ++++ + C ++VDCN   G  F+ A   G+T++ IL 
Sbjct  69    NLKDSLSLTLVHFYPLAGQLASEVDKDQHKCLIFVDCNKGPGARFIHATL-GMTISNIL-  126

Query  448   QSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNF  627
              S  +VP +++S F     +N DG  K L+ +Q+TELLDG FIAC++NHSLGDGTS+WNF
Sbjct  127   -SPTDVPLVVQSFFDHEKNVNHDGHFKSLLTIQVTELLDGIFIACSMNHSLGDGTSYWNF  185

Query  628   FNSWAELSRGFHQ----PSTTPIHERWFPDNTTTCPVHLPPMIESSE---RLPPPQRAFL  786
             +N W+++  G        S  P H+RWFP+     P  L P  E  E   R   PQ   L
Sbjct  186   WNIWSKIHLGLCDEGVPSSRIPFHKRWFPEGYG--PPFLLPFTEPDEFISRFTAPQ---L  240

Query  787   AERVFHLSKVNIARLKEKANSEMGT-SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILG  963
              ER+FH S  +IARLK KAN+E+ T + ISS Q+  A  WRA+ RA  L      +  L 
Sbjct  241   RERIFHFSSESIARLKAKANAELNTINEISSFQALSALCWRAIVRANCLSFERFTNCRLA  300

Query  964   IGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKM  1137
                R R+  P    Y+GN +  +  +   G++L   LGW A  + +TV  H+ ++ +RK 
Sbjct  301   ANNRHRLNPPLLHEYFGNCISALETTTTVGELLDHNLGWAASLLHQTVINHN-DKVLRKF  359

Query  1138  YMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
                +++SP     +      ++ + SSPRFD+YG +FG GK V +RSG  NK  GKVT +
Sbjct  360   ISGWLKSPIVFQLDKVFDCYSVMMGSSPRFDMYGNEFGLGKAVALRSGYANKFVGKVTSY  419

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
              G E  GSVD+E+ + P ++  LE+D EF+
Sbjct  420   EGYEGGGSVDLEICLPPDSMKALESDEEFM  449



>ref|XP_010445080.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=450

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 159/433 (37%), Positives = 240/433 (55%), Gaps = 20/433 (5%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL     QKGLLF  P P        +N+I  LK+SLS  L  F P AGR
Sbjct  28    KIHLTPWDLLFLGSEYSQKGLLFPQPDP-------ETNVISRLKSSLSIALKIFYPFAGR  80

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N++D T S Y+DCN +GV FV A AS ++V  +L+  +  VP+ L+  F  NG+ 
Sbjct  81    LVKIENDDDGTSSCYIDCNGSGVRFVHASASSISVTDVLEPVDGTVPEFLKRFFPCNGVK  140

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL--SRGFHQPSTTP  681
             + +GI   L+ +Q+TEL DG FI    +H + DGT  WNF N W+E+  +   H+    P
Sbjct  141   SLEGISDSLIAIQVTELKDGVFIGVGYSHLVTDGTLIWNFSNIWSEICFNGSDHRRKFPP  200

Query  682   -IHERWFPDNTTTCPVHLPPMI--ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              +H  WF D     P+ +P  +  E+           L E++F  +  NI+ LK KAN E
Sbjct  201   LVHRGWFLDGIEY-PIRMPASVTTETPNLDGTSSSILLQEKIFRFTSENISELKAKANGE  259

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +      ISSLQ+  A++WR++ R   L   E +   L + +R R+  P  +   GN V 
Sbjct  260   VSPDDRKISSLQAVSAYMWRSIVRNSGLSPEEVICCGLMVDLRRRLDPPLEKDCCGNMVG  319

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
                 +   G++   GLGW A +I K+V   ++ EE R+    +V++P+    ++ + +NT
Sbjct  320   TAITTTTVGEMFNNGLGWAALKINKSVASQTN-EEFREFAADWVKNPSL--LDVNTLTNT  376

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
             + ++SSPRF+VYG DFGWGKP+  R+G G   DGK+  + G E G+++I+  +    L  
Sbjct  377   IAVTSSPRFNVYGNDFGWGKPIAARAGTGITHDGKLVAYPGIEPGNIEIQTCLSSSVLAK  436

Query  1381  LENDAEFLEYFTI  1419
             L  DAEFL++  +
Sbjct  437   LSTDAEFLKHACV  449



>ref|XP_010444690.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=459

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 178/465 (38%), Positives = 257/465 (55%), Gaps = 37/465 (8%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             ISK  V    +        ++ LTPWDL FL+    Q+GLLF  P P       +++ I 
Sbjct  9     ISKSIVRPDESYNEESDRVKIHLTPWDLFFLRAEYAQRGLLFPQPDP-------DTHFIS  61

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
              LK+SLS  L+ F P AGR   + N+ D T S +VDC+ +GV FV A A  V+++ +L+ 
Sbjct  62    RLKSSLSVALNIFYPFAGRLVKIENQHDGTASFHVDCDGSGVRFVHASAKSVSLSDVLEP  121

Query  451   SNINVPQILRSLFTLNGILNRD--GICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
             ++ +VP+ L+  F  NG+ + D  GI   L+  Q+TEL DG FI    NH + DGTSFW+
Sbjct  122   ADGHVPEFLKRFFPANGVTSCDCEGISDSLIAFQVTELKDGVFIGFGYNHIVADGTSFWS  181

Query  625   FFNSWAELS--RGF---HQPSTTPIHER-WFPDNTTTCPVHLPPMIESSERLPPPQRAF-  783
             FFN+W+E+    GF   H+    P+  R WF D      +  P  I  SE   PP R   
Sbjct  182   FFNTWSEICFHGGFDSDHRRKFPPLVLRGWFLDG-----IEYPIRIPISETETPPNRVVV  236

Query  784   ------LAERVFHLSKVNIARLKEKANSEMGTSI--ISSLQSYMAHLWRAVTRARNLHSN  939
                   L E++F  +  N++ LKEKAN E+      ISSLQ+  A++WRA+ R   L   
Sbjct  237   LGTSSSLQEKIFRFTSRNVSELKEKANGEVSADDRRISSLQAVSAYMWRAIIRNSELSPE  296

Query  940   EDVHLILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHS  1113
             E +   L + MR R+  P  +  +GN V F T +    ++L  GLGW A QI KTV   +
Sbjct  297   EVICFKLLVDMRQRLNPPLEKECFGNMVGFATATTTVREMLNNGLGWAALQINKTVGSQT  356

Query  1114  HEEEVRKMYMKFVESPA---HNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGG  1284
             +E   R+    +V+ P+    NG E  +SSN++ ++SSPRF+VYG DFGWGKP+ VR+G 
Sbjct  357   NEM-FREFAANWVKKPSIILMNGNE--ASSNSVVVASSPRFNVYGNDFGWGKPIAVRAGP  413

Query  1285  GNKLDGKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             GN   GK+  + G ++G ++I   +    L  L  DAEFL++  +
Sbjct  414   GNTRHGKLIAYPGVDQGDIEIHTYLSSAVLEKLSTDAEFLKHLCV  458



>ref|XP_010677339.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=452

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 171/426 (40%), Positives = 249/426 (58%), Gaps = 18/426 (4%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             L P DL  L +  IQKGLLF  P+    Q F     + +LK SLS TL  F PLAG+ AT
Sbjct  30    LPPLDLAMLSVHYIQKGLLFTKPSILNDQPFSIHTFLKNLKDSLSLTLVHFYPLAGQLAT  89

Query  337   VMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILNR  513
              ++E+ + C V+VDCN   G  F+ A    +T++ +L  S  +VP +++S F  +  +N 
Sbjct  90    QIDEDQHKCLVFVDCNKGPGARFIHATLD-MTISDLL--SPTDVPLVVQSFFDHDKSVNH  146

Query  514   DGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQ----PSTTP  681
             DG  K L+ +Q+TELLDG FI C++NH+LGDGTSFW+F+N W+ +  G        S  P
Sbjct  147   DGHFKSLLTIQVTELLDGIFIGCSMNHALGDGTSFWHFWNIWSMIHLGIRDEVVPSSRIP  206

Query  682   IHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGT  861
             IH RWFP+   +  V L P  E +E +   +   L ER+FH S  ++ARLK +AN ++ T
Sbjct  207   IHNRWFPEGHGS--VFLLPFTEPNEFISRYEAPQLRERIFHFSSESMARLKARANEDINT  264

Query  862   S-IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFFITE  1032
             +  ISS Q+  A  WRA+ R   L +++     L    R R+   LP+ Y+GN +  +  
Sbjct  265   TNKISSFQALSALCWRAIVRTNRLSNDQSTACRLAANNRQRLDPPLPQAYFGNCITALKT  324

Query  1033  SIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP-AHNGAEIPSSSNTLGI  1209
             +   G++L   LGW A  +  TV  HS ++ VR    ++++SP  ++  ++   S  +G 
Sbjct  325   TTTVGELLDHNLGWAASLLHHTVVNHS-DKVVRGFVDEWLKSPFIYHLDKLFDCSVMMG-  382

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHTLLGLE  1386
              SSPRFD+YG +FG GK V +RSG  NK  GKVT + GCE  GSVD+E+ + P  +  LE
Sbjct  383   -SSPRFDMYGNEFGIGKAVALRSGYANKFVGKVTSYEGCEGGGSVDLEICLPPDFMKALE  441

Query  1387  NDAEFL  1404
             +D EF+
Sbjct  442   SDEEFM  447



>ref|XP_008393786.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   281 bits (718),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 264/456 (58%), Gaps = 29/456 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN--SNL  264
             IS+CFV    A + +   +   L P DL  L +  IQKGLLF  P P+ ++   N   +L
Sbjct  9     ISECFVQPHHAPQXS--KQPFYLAPGDLAMLSVHYIQKGLLFPKP-PEAKRDPKNFIDSL  65

Query  265   IHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAI  441
             +  LK SLS  L  F PLAGRF T  +E+  +  VYVDCNN+ G +F+ A    ++V+ I
Sbjct  66    LERLKQSLSVALVHFYPLAGRFVTEKSEDPASYVVYVDCNNSPGAKFIYATLE-MSVSDI  124

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S  +VP +++S F  +  +N DG    L+ +Q+TEL+DG FI  ++NHSLGDGTSFW
Sbjct  125   L--SPTDVPLVVQSFFDHDRAVNHDGHTMSLLSIQVTELVDGIFIGLSMNHSLGDGTSFW  182

Query  622   NFFNSWAELSRGFHQP---------STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
              FFN W+E+ +   Q          S  P+ +RWFPD     P+   P   S E +   +
Sbjct  183   LFFNVWSEIFQAQAQEGHDHFVANISRPPVLKRWFPDGHG--PIINLPFKHSDEFIGRFE  240

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                L ER+FH S  +IA+LK KAN+E  T+ ISS QS  A LWR +TRAR L  ++    
Sbjct  241   APPLRERMFHFSSESIAKLKAKANAESDTTKISSFQSLSALLWRTITRARCLAPDQGTSC  300

Query  955   ILGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEE  1125
              L    R R+  P    Y+GN+++ + +E++ AG++L  G+GW AW++ + V  H  ++ 
Sbjct  301   RLAANNRGRIDPPLSGDYFGNSIYPVKSETVAAGELLEHGIGWAAWKLHEAVVNHD-DKV  359

Query  1126  VRKMYMKFVESPAHNGAEIPSSSNTLGI--SSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
             +R     +++SP+     + S  + L +   SSPRF++YG +FG GK + +RSG  +K  
Sbjct  360   IRGQVDAWLKSPS---VYLVSYFDPLSVMMGSSPRFNMYGNEFGMGKALALRSGYAHKFS  416

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLE  1407
             GKV+ + G EE S+D+E+ + P  +  LE D EF+E
Sbjct  417   GKVSAYEGREERSIDLEVCLPPDAMSALECDKEFME  452



>ref|XP_009101733.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brassica 
rapa]
Length=449

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 247/438 (56%), Gaps = 31/438 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  L I   Q+GLLF  P P       + +LI  LK SLS  L+ + P AGR
Sbjct  25    KIHLTPFDLTNLHIDYPQRGLLFPKPNP-------DFHLISRLKASLSLALEIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V N EDNT S +VDC+ +G  F  A+A  ++V+ +L Q + +VP I++  F  +   
Sbjct  78    LAKVENLEDNTVSFFVDCDGSGARFHHAEAKTISVSDLL-QPDGSVPDIMKQFFPADDFK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP-I  684
             N DG+ +PL+ +Q+TE+ DG+F+    NH + DG S W F N+W+++          P +
Sbjct  137   NCDGVTEPLLVIQVTEMKDGFFVGYCYNHLVADGVSMWGFINTWSKICSSGSSSGHKPLV  196

Query  685   HERWFPDNTTTCPVHLPPMIESSERLPPPQR----AFLAERVFHLSKVNIARLKEKANSE  852
              +RWF +     P+H+P  +  +ER PP +         +RVFH +K NI+ LK KANSE
Sbjct  197   LKRWFLEGIDY-PIHIP--VSEAERAPPSRELSSVPVTKDRVFHFTKKNISDLKSKANSE  253

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +G+S   ISSLQ+  AH+WR++ R   L    + H  + + +R R+  P  +  +GN ++
Sbjct  254   VGSSDITISSLQAVTAHMWRSIIRYSGLSGEGETHCKVVVDVRRRVDPPLEKDCFGNMIY  313

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS---  1191
                      ++L +GLGW A QI K V   + E        KF E    N   + +    
Sbjct  314   IQPAIATVEELLDRGLGWGALQINKLVNSQTSEN-----CKKFAEDWVRNVKNLKTGVGS  368

Query  1192  ---SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
                 +++ + SSPRF+VY  DFGWGKPV VR+G GN ++GK+ LF G +EGS+D++ ++ 
Sbjct  369   RMVGDSVLVGSSPRFEVYINDFGWGKPVAVRAGPGNNINGKLVLFPGIDEGSIDVQTTLW  428

Query  1363  PHTLLGLENDAEFLEYFT  1416
                L+ L  D EFLE+ T
Sbjct  429   SDVLVNLLADVEFLEHVT  446



>ref|XP_002316230.1| transferase family protein [Populus trichocarpa]
 gb|EEF02401.1| transferase family protein [Populus trichocarpa]
Length=441

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 171/454 (38%), Positives = 251/454 (55%), Gaps = 35/454 (8%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             +SKC V            + ++L+  DL  L    IQKG LF +P           +LI 
Sbjct  10    VSKCTV----FPDQKSTLQDLKLSVSDLPMLSCHYIQKGGLFTSPPTLSI-----DSLIS  60

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQ  450
             HLK SLS TL  FPPLAGRF T     D+   +Y+ CN+AGV+F+ A A+ +++  IL  
Sbjct  61    HLKQSLSQTLSHFPPLAGRFNT-----DSNGHIYITCNDAGVDFIHATATDISIQDIL--  113

Query  451   SNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFF  630
               ++VP  +R  F     ++  G  KP++ VQ+TEL DG FI C++NHS+ DGTSFWNFF
Sbjct  114   YPLHVPDCIRGFFAFESTVSYQGHYKPILAVQVTELADGVFIGCSMNHSVTDGTSFWNFF  173

Query  631   NSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLS  810
             N++AE+SRG  + S  P   R    N+      +  + +   R+   +   L+ER+F  S
Sbjct  174   NTFAEVSRGIKKISRKPDFSR----NSILISEAVLKVPQGGPRVTFNENEPLSERIFSFS  229

Query  811   KVNIARLKEKANSE--------MGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
             +  I +LK + N++            +ISS QS  A LWRAVTRAR L+ ++     + +
Sbjct  230   REAILKLKSEVNNKKWSQNSDNANVDVISSFQSLSALLWRAVTRARKLNPSKTTTFRMAV  289

Query  967   GMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R R+   L   Y+GNA+  I     A DVL + L W A Q+ K V  H ++  VR+  
Sbjct  290   NCRHRLNPKLDPLYFGNAIQSIPTYASAEDVLSRDLRWCAEQLNKNVAAH-NDGTVRRFV  348

Query  1141  MKFVESP-AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF  1317
               +  +P       +  +S T+G  SSPRF +Y  DFGWG+P+ VRSG  NK DGK++ F
Sbjct  349   QDWESNPRCFPLGNLDGASMTMG--SSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAF  406

Query  1318  GGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFT  1416
              G E  G+VD+E+ + P T+ G+E+D EF+++ +
Sbjct  407   PGREGNGTVDLEVVLAPETMAGIESDHEFMQFVS  440



>emb|CDX83118.1| BnaA01g21180D [Brassica napus]
Length=449

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 247/438 (56%), Gaps = 31/438 (7%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  L I   Q+GLLF  P P       + +LI  LK SLS  L+ + P AGR
Sbjct  25    KIHLTPFDLTNLHIDYPQRGLLFPKPNP-------DFHLISRLKASLSLALEIYFPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
              A V N EDNT S +VDC+ +G  F  A+A  ++V+ +L Q + +VP I++  F  +   
Sbjct  78    LAKVENLEDNTVSFFVDCDGSGARFHHAEAKTISVSDLL-QPDGSVPDIMKQFFPADDFK  136

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP-I  684
             N DG+ +PL+ +Q+TE+ DG+F+    NH + DG S W F N+W+++          P +
Sbjct  137   NCDGVTEPLLVIQVTEMKDGFFVGYCYNHLVADGVSMWGFINTWSKICSSGSSSGHKPLV  196

Query  685   HERWFPDNTTTCPVHLPPMIESSERLPPPQR----AFLAERVFHLSKVNIARLKEKANSE  852
              +RWF +     P+H+P  +  +ER PP +         +RVFH +K NI+ LK KANSE
Sbjct  197   LKRWFLEGIDY-PIHIP--VSEAERAPPSRELSSVPVTKDRVFHFTKKNISDLKSKANSE  253

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +G+S   ISSLQ+  AH+WR++ R   L    + H  + + +R R+  P  +  +GN ++
Sbjct  254   VGSSDITISSLQAVTAHMWRSIIRYSGLSGEGETHCKVVVDVRRRVDPPLEKDCFGNMIY  313

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSS---  1191
                      ++L +GLGW A QI K V   + E        KF E    N   + +    
Sbjct  314   IQPAIATVEELLDRGLGWGALQINKLVNSQTSEN-----CKKFAEDWVRNVKNLKTGVGS  368

Query  1192  ---SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
                 +++ + SSPRF+VY  DFGWGKP+ VR+G GN ++GK+ LF G +EGS+D++ ++ 
Sbjct  369   RMVGDSVLVGSSPRFEVYINDFGWGKPIAVRAGPGNNINGKLVLFPGIDEGSIDVQTTLW  428

Query  1363  PHTLLGLENDAEFLEYFT  1416
                L+ L  D EFLE+ T
Sbjct  429   SDVLVNLLADVEFLEHVT  446



>ref|XP_008452577.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Cucumis melo]
Length=451

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 181/462 (39%), Positives = 249/462 (54%), Gaps = 47/462 (10%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CFV        +       L+P DL  L    IQKGLLFH P             +H
Sbjct  6     ISECFVKPKSEWLPSESKHPYHLSPLDLPNLFSQYIQKGLLFHKPPHXFFMPI----FLH  61

Query  271   HLKTSLSSTLDFFPPLAGRFATVMNEED--NTCSVYVDC-NNAGVEFVEAKASGVTVAAI  441
              LK S S+ L  F PL+GR  T+ N      + S+YVDC N+ G +F+ A A  VT++  
Sbjct  62    RLKNSFSTALLHFYPLSGRLVTITNHHHFHPSISIYVDCVNSPGAKFIHA-ALDVTISDF  120

Query  442   LDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFW  621
             L  S I+VP ++ SLF  +  +N DG    L+ +Q+TELLDG FI C+LNH++GDGTS+W
Sbjct  121   L--SPIDVPSVVYSLFDHHKAVNYDGHSLSLLSLQVTELLDGIFIGCSLNHAIGDGTSYW  178

Query  622   NFFNSWAELSRGFHQPSTT-------PIHERWFPDN---TTTCPVHLPPMIESSERLPPP  771
             NFF   +E+   F  PS         P+ +RWFPD        P +LP    +  + P  
Sbjct  179   NFFTMLSEI---FQSPSPKHISILRPPVLKRWFPDGDGPIVNLPFNLPDKFMNRFKGPK-  234

Query  772   QRAFLAERVFHLSKVNIARLKEKANSEMGTS-IISSLQSYMAHLWRAVTRARNLHSNEDV  948
                   ER+FH S  +IA+LK KAN+E G    ISSLQS  A +WR++TRAR +   +  
Sbjct  235   ----FRERIFHFSAESIAKLKAKANAECGARGTISSLQSLTAFVWRSITRARRISEEQPT  290

Query  949   HLILGIGMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEE  1122
             H I+    RA++  P  E Y+GN + ++    KA +++GK LGW AW++        H+ 
Sbjct  291   HCIMVANNRAKLEPPLSENYFGNVMKYLKVDAKAEELVGKDLGWAAWKL--------HDV  342

Query  1123  EVRKMYMKFVESPAHNGAEIPS-------SSNTLGISSSPRFDVYGADFGWGKPVQVRSG  1281
              V     KF E+       I           NT+ + SSPRF+ YG +FG GK V +RSG
Sbjct  343   VVNNTCKKFRETIEERLQSIDKIQVGRIFEPNTVLMGSSPRFNKYGIEFGMGKAVALRSG  402

Query  1282  GGNKLDGKVTLFGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
               NK DGKVT + G E  GSVD+E+ + P T+  LE+D EF+
Sbjct  403   YSNKWDGKVTTYPGYEGGGSVDLEICLLPQTMANLESDFEFM  444



>ref|XP_009121271.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brassica 
rapa]
Length=470

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/442 (37%), Positives = 249/442 (56%), Gaps = 34/442 (8%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL+    Q+ L+F  P P        +++I  LK+SLS+ L  F P AGR
Sbjct  25    KIHLTPWDLSFLRTEYAQRALIFPQPNP-------GTHMISQLKSSLSAALKIFYPFAGR  77

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N +D T S ++DC+ +GV+FV A A  V+V  +L+ +N  VP   R  F  NG+ 
Sbjct  78    LVKIDNLDDGTKSFFIDCDGSGVKFVHASAKTVSVRDVLEPANGTVPDYWREFFPANGVQ  137

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL-SRGFHQPSTTPI  684
             + +G+ KPL+  Q+TEL DG FI    NH + DGTSFW+FF +W E+ S GF      P+
Sbjct  138   SWEGVSKPLIAFQVTELKDGVFIGYGYNHLVADGTSFWSFFKTWTEIFSTGFDPKMFPPL  197

Query  685   HE-RWFPDNTTTCPVHLPPMIESSERLPPPQRAF-----LAERVFHLSKVNIARLKEKAN  846
                 WF D      +  P  I  SE +P           L +++F  +  +I++LK KAN
Sbjct  198   PLCGWFLDG-----IDYPIRIPISETVPSSHAGLVSLPHLEKKIFRFTSAHISKLKAKAN  252

Query  847   SEM---GTSI-ISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWG  1008
              E+   G  + ISS Q+ + H+W+++ R  +L+  E +H  + + +R R+  P  +  +G
Sbjct  253   DEVVGYGEDLKISSFQAVLGHMWQSIIRNSDLNPEEVIHCKVAMDIRQRLNPPVEKKCFG  312

Query  1009  NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPS  1188
             N +   T +   G++L  GLGW A Q+ KTV   ++ EE+RK    +V+SP     +IP+
Sbjct  313   NMIGLATATTTTGEMLHNGLGWAALQLNKTVRSQTN-EELRKFAENWVKSP-----KIPN  366

Query  1189  ---SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSI  1359
                ++N+L ++ SPRF+V+G DFGWGKP+  R G G    GK+  + G E+GS++I  S+
Sbjct  367   RLVANNSLVVAGSPRFNVFGNDFGWGKPIAFRGGPGIAGHGKILAYPGTEKGSMEIHTSL  426

Query  1360  HPHTLLGLENDAEFLEYFTIPG  1425
               H L  L  D EFL++    G
Sbjct  427   WSHVLEKLLADQEFLQHVLCSG  448



>ref|XP_008378023.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 178/461 (39%), Positives = 254/461 (55%), Gaps = 25/461 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN---SN  261
             IS+CF+     +  +   + + L P DL  L +  IQKGLLF  P     ++      ++
Sbjct  9     ISECFIIPHHVSEES--QQPLYLAPTDLAMLSVHYIQKGLLFAKPPEAMDRRHKAEFVNS  66

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAA  438
             L+  LK SLS  L  F PLAGRFAT   E      VY DC+N+ G  F+ A    V+V  
Sbjct  67    LLDKLKHSLSLALVHFYPLAGRFATKKEENPPLYLVYXDCSNSPGARFIYATLD-VSVLD  125

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S  +VP +++S F  +  +N DG    L+ VQ+TEL+DG FI  ++NH L DGTSF
Sbjct  126   IL--SPTDVPLVVQSFFDHDRAVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLCDGTSF  183

Query  619   WNFFNSWAELSRGFHQP----------STTPIHERWFPDNTTTCPVHLPPMIESSERLPP  768
             W+FFN+W+EL +   Q           S  P+ +RWFPD     P+   P     E +  
Sbjct  184   WHFFNTWSELFQAITQXAHDNTIVPGISRPPVLKRWFPDGHG--PIISLPYTNPDEFIGR  241

Query  769   PQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDV  948
              +   L ER+FH S  +IA+LK KANSE   + ISS QS  A LWR++TRAR L  N+  
Sbjct  242   FEAPELRERMFHFSSESIAKLKAKANSESNATKISSFQSLSALLWRSITRARRLPPNQST  301

Query  949   HLILGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                L    RAR+  P    Y+GN++  I +E++ AG++L   LGW AW++ + V K   +
Sbjct  302   RCRLAANNRARLDPPLSGDYFGNSIHPINSEAVTAGELLQHSLGWAAWKLHEAVVKLD-D  360

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
              E+R     ++ SP             + + SSPRF++YG +FG GK V +RSG  NK  
Sbjct  361   REIRGFVDAWLXSPTVYLLGQXFDPYMVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFG  420

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             GKV+ + G E GS+D+E+ + P  +  LE D EF+E+ ++P
Sbjct  421   GKVSSYEGRERGSIDLEVCLPPDAMSALECDEEFMEFASVP  461



>ref|XP_010447937.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=451

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 157/430 (37%), Positives = 242/430 (56%), Gaps = 19/430 (4%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTPWDL FL     QKGLLF  P+         +N+I  LK+SLS  L  F P A R
Sbjct  28    KIHLTPWDLLFLGSEYSQKGLLFPQPS------DPETNIIPRLKSSLSIALKIFYPFASR  81

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                + N++D T S YVDCN +GV FV A AS ++++ +L+  +  VP+ L+  F   G+ 
Sbjct  82    LVKIENDDDGTSSFYVDCNGSGVRFVHASASSISMSDVLEPVDGTVPEFLKRFFPCTGVK  141

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELS-RGFHQPSTTP-  681
             + +GI   L+ +Q+TEL DG FI    +H + DGTS WNF N W+E+   G     T P 
Sbjct  142   SLEGISDSLIAIQVTELKDGVFIGVGYSHLVTDGTSIWNFSNIWSEICFNGSDHRRTFPP  201

Query  682   -IHERWFPDNTTTCPVHLPPMI--ESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSE  852
              +H  WF D     P+ +P  +  E+ + +       L E++F  +  NI+ LK KAN E
Sbjct  202   LVHRGWFLDGIEY-PIRMPASLTPETPDVVGTSSSILLQEKIFRFTSENISELKAKANGE  260

Query  853   MGTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVF  1020
             +      ISSLQ+  A++WR++ R  +L   E +   L + +R R+  P  +   GN V 
Sbjct  261   VSPDDRKISSLQAVSAYMWRSIVRNSDLSPEEVICCGLMVDLRRRLDPPLEKDCCGNMVG  320

Query  1021  FITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHNGAEIPSSSNT  1200
                 +   G++   GLGW A +I K+V   ++ EE R+    +V++P+    ++ + +N+
Sbjct  321   TAITTTTVGEMFNNGLGWAALKINKSVASQTN-EEFREFAADWVKNPSL--LDVSTVTNS  377

Query  1201  LGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHTLLG  1380
             + ++SSPRF+VYG DFGWGKP+  R+G G   DGK+  + G E G+++I+  +    L  
Sbjct  378   IAVTSSPRFNVYGNDFGWGKPIVARAGPGITHDGKLVAYPGIEPGNIEIQTCLSSSVLAK  437

Query  1381  LENDAEFLEY  1410
             L +DAEFL++
Sbjct  438   LSSDAEFLKH  447



>ref|XP_008347613.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   279 bits (713),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 178/461 (39%), Positives = 255/461 (55%), Gaps = 25/461 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN---SN  261
             IS+CF+     +  +   + + L P DL  L +  IQKGLLF  P     ++      ++
Sbjct  9     ISECFIIPHHVSEES--QQPLYLAPTDLAMLSVHYIQKGLLFAKPPEAMDRRHKAEFVNS  66

Query  262   LIHHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAA  438
             L+  LK SLS  L  F PLAGRFAT   E      VY DC+N+ G  F+ A    V+V  
Sbjct  67    LLDKLKHSLSLALVHFYPLAGRFATKKEENPPLYLVYXDCSNSPGARFIYATLD-VSVLD  125

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S  +VP +++S F  +  +N DG    L+ VQ+TEL+DG FI  ++NH L DGTSF
Sbjct  126   IL--SPTDVPLVVQSFFDHDRAVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLCDGTSF  183

Query  619   WNFFNSWAELSRGFHQP----------STTPIHERWFPDNTTTCPVHLPPMIESSERLPP  768
             W+FFN+W+EL +   Q           S  P+ +RWFPD     P+   P     E +  
Sbjct  184   WHFFNTWSELFQAITQGAHDNTIVPGISRPPVLKRWFPDGHG--PIISLPYTNPDEFIGR  241

Query  769   PQRAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDV  948
              +   L ER+FH S  +IA+LK KANSE   + ISS QS  A LWR++TRAR L  N+  
Sbjct  242   FEAPELRERMFHFSSESIAKLKAKANSESNATKISSFQSLSALLWRSITRARRLPPNQST  301

Query  949   HLILGIGMRARMGLPEG--YWGNAVFFI-TESIKAGDVLGKGLGWVAWQIKKTVEKHSHE  1119
                L    RAR+  P    Y+GN++  I +E++ AG++L   LGW AW++ + V K   +
Sbjct  302   RCRLAANNRARLDPPLSGDYFGNSIHPINSEAVTAGELLQHSLGWAAWKLHEAVVKLD-D  360

Query  1120  EEVRKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLD  1299
              E+R     +++SP             + + SSPRF++YG +FG GK V +RSG  NK  
Sbjct  361   REIRGFVDAWLQSPTVYLLGQFFDPYMVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFG  420

Query  1300  GKVTLFGGCEEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
             GKV+ + G E GS+D+E+ + P  +  LE D EF+E+ ++P
Sbjct  421   GKVSSYEGRERGSIDLEVCLPPDAMSALECDEEFMEFASVP  461



>gb|KDP41703.1| hypothetical protein JCGZ_16110 [Jatropha curcas]
Length=450

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 172/451 (38%), Positives = 253/451 (56%), Gaps = 29/451 (6%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS+CF+            +   L+PWDL  + +  IQKGLLF  P         + N++H
Sbjct  9     ISECFIKPQHVVEE--AEQPYYLSPWDLAMVSVHYIQKGLLFPKPP------REDFNILH  60

Query  271   ---HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAA  438
                 LK SL+ TL  F PLAGR AT  +++  +  +YVDC N+ G  FV A    +TV+ 
Sbjct  61    LLEKLKHSLALTLVHFYPLAGRLATSKSQDPPSYVIYVDCRNSPGARFVHATVD-MTVSD  119

Query  439   ILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSF  618
             IL  S   VP +++S F  +  LN DG  + L+ +Q+TEL+DG FI C+ NH++GDGTS+
Sbjct  120   IL--SPTYVPSVVQSFFDHHRALNHDGHVRSLLTIQVTELVDGIFIGCSFNHAIGDGTSY  177

Query  619   WNFFNSWAELSRGFHQP----STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFL  786
             W+F N+W+E+ +         S  P+ + WFPD     PV   P     + L P +   L
Sbjct  178   WHFLNTWSEIFQAEGDDGAAISRPPVLKPWFPDGYG--PVINLPFTHHEQFLCPFESPVL  235

Query  787   AERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGI  966
              ER+FH S  +IA+LKEKAN+E  T+ ISS QS  A +WR +TR+R+L  ++  +  L  
Sbjct  236   KERIFHFSAESIAKLKEKANAEYNTNKISSFQSLSAFMWRCITRSRHLPHDQITNCRLAC  295

Query  967   GMRARMGLP--EGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMY  1140
               R+R   P    Y+GN +  I  S  AG++L + LGW AW + ++V   +  E++++  
Sbjct  296   NNRSRFNPPLSPNYFGNCIDAIAASSTAGELLQQNLGWAAWMLHQSVVNQT-SEKIQERI  354

Query  1141  MKFVESP--AHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTL  1314
               + +SP   H G      S  +G  SSPRF+ YG  FG GK + +RSG  +K  GKV+ 
Sbjct  355   EAWKKSPFIYHIGRSFDPFSVMMG--SSPRFNKYGCQFGLGKALTLRSGYAHKFSGKVSA  412

Query  1315  FGGCE-EGSVDIELSIHPHTLLGLENDAEFL  1404
             + G E  GSVD+E+ + P ++  LE+D EF 
Sbjct  413   YPGREGGGSVDLEVCLPPDSMAALESDKEFF  443



>gb|KDP42394.1| hypothetical protein JCGZ_02451 [Jatropha curcas]
Length=448

 Score =   278 bits (711),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 171/426 (40%), Positives = 248/426 (58%), Gaps = 20/426 (5%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRFAT  336
             L+P DL  +    IQ+GLLF  PTPQ+  + F+  L+  LK SL+ TL  F PLAGR AT
Sbjct  29    LSPCDLGMVSACYIQRGLLFAKPTPQEDFKIFD--LLEKLKHSLALTLVHFYPLAGRLAT  86

Query  337   VMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILNR  513
               +E+  +  +YVDC+N+ G  FV A    +TV+ IL  S   VP +++S F  +  LN 
Sbjct  87    SKSEDPPSYVIYVDCSNSPGARFVHATVE-MTVSDIL--SPTYVPSVVQSFFDHHRALNH  143

Query  514   DGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL---SRGFHQP-STTP  681
             +G  + L+ +Q+TEL+DG FI C+ NH +GDGTS+W+F N+W+E+    R  H P S  P
Sbjct  144   EGHVRSLLTIQVTELIDGIFIGCSFNHVIGDGTSYWHFLNTWSEIFQAQRDDHVPISQPP  203

Query  682   IHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEMGT  861
             + +RWFPDN    P+   P     + L P +   L ER+FH S  +IA+LK KAN+E  T
Sbjct  204   VLKRWFPDNCG--PIINLPFTHHEQFLVPFEAPLLKERIFHFSAESIAKLKVKANTEYNT  261

Query  862   SIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVFFITES  1035
               ISS QS  A +WR +TRAR++  ++  H  L    R+R+  P    Y+GN V  ++ S
Sbjct  262   DKISSFQSLSAFMWRCITRARHIPHDQVTHCSLACNNRSRLNPPLSPNYFGNFVDAVSAS  321

Query  1036  IKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPA--HNGAEIPSSSNTLGI  1209
                 ++L + LGW AW + + V   + +++ R     +++SP   H G          G 
Sbjct  322   TTGCELLEQNLGWAAWLLHQAVINQT-DKKFRDRIDSWIKSPIIYHLGQFFGLYGVVFG-  379

Query  1210  SSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EGSVDIELSIHPHTLLGLE  1386
              SSPRF  YG +FG GK + +RSG  NK  GKV+ + G E  GSVD+E+ + P ++  LE
Sbjct  380   -SSPRFSKYGCEFGLGKALSLRSGYANKFCGKVSAYPGREGGGSVDLEVCLLPDSMTALE  438

Query  1387  NDAEFL  1404
             +D EF+
Sbjct  439   SDKEFM  444



>gb|EEC82800.1| hypothetical protein OsI_27569 [Oryza sativa Indica Group]
Length=463

 Score =   278 bits (712),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 174/452 (38%), Positives = 242/452 (54%), Gaps = 44/452 (10%)
 Frame = +1

Query  151   VELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGRF  330
             V LTPWDL  L    IQKG+L   P           +L+ HL +S +  L  F P AGR 
Sbjct  28    VHLTPWDLPLLTAEYIQKGVLLPKPP------TGGEHLVEHLASSFARALGRFYPFAGRL  81

Query  331   ATVMNEED----NTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLN  498
             A    E+     ++ SV++ CN+ G EFV A A  V VA I    ++ +P+++ S F L 
Sbjct  82    AVAEVEDGASPPSSISVFLRCNDEGAEFVHATAPDVAVADI--AGSLYIPRVVWSFFPLT  139

Query  499   GILNRDGICK--PLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPS  672
             G+L         P++  Q+TEL DG FIA +LNH +GDGT+FW F N+W+E+SR   +  
Sbjct  140   GLLPAVAAADSLPVLAAQVTELSDGVFIAMSLNHVVGDGTNFWEFMNTWSEISRSRSKLD  199

Query  673   TTP-----------IHERWFPDNTTTCPVHLP-------PMIESSERLPPPQRAFLAERV  798
              +P           + +RWF D   TCPV +P        +I   +  PPP    L E  
Sbjct  200   ISPSPPPPSPSPPLVVKRWFLD---TCPVPIPLPFAKLEHIIPRRDHPPPP----LQECF  252

Query  799   FHLSKVNIARLKEKANSEMG--TSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGM  972
             F  S  +I +LK KAN E+    + ISSLQ+ +AH+WR+V+RA  L   ++   +L IG 
Sbjct  253   FAFSAESIRKLKAKANGEIAGAAATISSLQALLAHVWRSVSRAHGLAPRQETAYVLVIGC  312

Query  973   RARM-GLPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
             R R+ G+  GY GNAV      + AG+V+ +GLGW AWQ+ + V     E  +R     +
Sbjct  313   RGRVSGISPGYVGNAVVPGAVRLTAGEVMERGLGWTAWQLNRFVASLD-EAAMRGAIAPW  371

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLF-GGC  1326
               +P        +    +   SSPRFDV+G DFGWG+PV VRSGG NK DGKVT++ G  
Sbjct  372   PRAPEFANFAKAAGGTAVHTGSSPRFDVFGNDFGWGRPVSVRSGGANKFDGKVTVYEGPG  431

Query  1327  EEGSVDIELSIHPHTLLGLENDAEFLEYFTIP  1422
               GS+ +E+ + P  L  L  D EF+   T P
Sbjct  432   GAGSMSLEVCLAPAALGKLVADEEFMGAVTTP  463



>ref|NP_190597.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 sp|Q9SND9.1|Y3028_ARATH RecName: Full=Uncharacterized acetyltransferase At3g50280 [Arabidopsis 
thaliana]
 emb|CAB62307.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEE78648.1| uncharacterized acetyltransferase [Arabidopsis thaliana]
Length=443

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 238/432 (55%), Gaps = 27/432 (6%)
 Frame = +1

Query  148   RVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAGR  327
             ++ LTP+DL  L +   Q+GLLF  P P        ++ I  L+TSLSS LD + P AGR
Sbjct  24    KIHLTPFDLNLLYVDYTQRGLLFPKPDP-------ETHFISRLRTSLSSALDIYFPFAGR  76

Query  328   FATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGIL  507
                V N ED T S Y++C+ +G +F+ A +  V+V+ +L + + +VP   R  + +NG+ 
Sbjct  77    LNKVENHEDETVSFYINCDGSGAKFIHAVSDSVSVSDLL-RPDGSVPDFFRIFYPMNGVK  135

Query  508   NRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTPIH  687
             + DG+ +PL+ +Q+TE+ DG FI    NH + DG S WNFF +W+++     + +  P+ 
Sbjct  136   SIDGLSEPLLALQVTEMRDGVFIGFGYNHMVADGASIWNFFRTWSKICSNGQRENLQPLA  195

Query  688   ERWFPDNTTTCPVHLPPMIESSERLPPPQR--AFLAERVFHLSKVNIARLKEKANSEMGT  861
              +    +    P+H+P  +  +E  PP +       ERVFH +K NI+ LK K N E+G 
Sbjct  196   LKGLFVDGMDFPIHIP--VSDTETSPPSRELSPTFKERVFHFTKRNISDLKAKVNGEIGL  253

Query  862   S--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLP--EGYWGNAVFFIT  1029
                 +SSLQ+  AH+WR++ R   L+  E     + + +R R+  P  +  +G+ ++   
Sbjct  254   RDHKVSSLQAVSAHMWRSIIRHSGLNQEEKTRCFVAVDLRQRLNPPLDKECFGHVIYNSV  313

Query  1030  ESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESPAHN------GAEIPSS  1191
              +   G++  +GLGW   QI   +   ++E+     Y  + E+   N      G     +
Sbjct  314   VTTTVGELHDQGLGWAFLQINNMLRSLTNED-----YRIYAENWVRNMKIQKSGLGSKMT  368

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
              +++ +SSSPRF+VY  DFGWGKP+ VR+G  N + GK+  F G EEG +D+   + P  
Sbjct  369   RDSVIVSSSPRFEVYDNDFGWGKPIAVRAGPSNSISGKLVFFRGIEEGCIDVHAFLLPDV  428

Query  1372  LLGLENDAEFLE  1407
             L+ L  D EFLE
Sbjct  429   LVKLLADVEFLE  440



>dbj|BAB11280.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
Length=442

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 162/416 (39%), Positives = 244/416 (59%), Gaps = 25/416 (6%)
 Frame = +1

Query  145   RRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIHHLKTSLSSTLDFFPPLAG  324
             +++ LTP DL  L +   Q+GLLFH P P        +++I  L  SLS+ L+ + P AG
Sbjct  23    QKIHLTPHDLDLLYLFYPQRGLLFHKPDP-------ENSIIPRLMASLSTALEIYFPFAG  75

Query  325   RFATVMNEEDNTCSVYVDCNNAGVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGI  504
             R   V N ED+T S Y+DC+  G +FV AKA  +TV  +L QS+ +VP  +   F  N +
Sbjct  76    RLVKVNNHEDDTVSFYIDCDGLGAKFVHAKAESITVNDVL-QSHGSVPYFISKFFPANNV  134

Query  505   LNRDG-ICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAELSRGFHQPSTTP  681
              +RD  + +PL+ +Q+TE+ DG FI+   NH + DGT FW FF++W+++      PS   
Sbjct  135   QSRDALVSEPLLALQVTEMKDGVFISFGYNHMVADGTCFWKFFHTWSKICLNGSDPSIQS  194

Query  682   I-HERWFPDNTTTCPVHLPPM-IESSERLPPPQRAFLAERVFHLSKVNIARLKEKANSEM  855
             I  + WF D     PVH+P + +E+  R  P  +    ERVFHLSK NI  LK KAN+E+
Sbjct  195   IVLKDWFCDGIDY-PVHVPVLEMETLPRWEPSTK----ERVFHLSKKNILDLKAKANNEI  249

Query  856   GTS--IISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMG--LPEGYWGNAVFF  1023
              T+   ISSLQ+ +A+LW ++ R   L+  E+    +   MR R+   L +  +GN    
Sbjct  250   DTNDLKISSLQAVVAYLWLSIIRHSGLNREEETQCNVAADMRPRLNPLLKKECFGNVTNL  309

Query  1024  ITESIKAGDVLGKGLGWVAWQIKKTVEKHSHE--EEVRKMYMKFVESPAHN-GAEIPSSS  1194
              T +   G++L  GLGW A QI K+V   ++E  E   K +++ V+ P  + G+ +  ++
Sbjct  310   ATATTTVGELLDHGLGWTALQISKSVRSETNESYEVFAKNWVRNVKRPKTSFGSRL--AN  367

Query  1195  NTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIH  1362
             N+L ISSSPRF+VY  DFGWGKP+  R+G  +   G + +F G EEGS+D+  +++
Sbjct  368   NSLIISSSPRFEVYEHDFGWGKPIAARAGPADGAGGMLVMFRGVEEGSIDVHATLN  423



>ref|XP_008393787.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   278 bits (710),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 172/436 (39%), Positives = 256/436 (59%), Gaps = 23/436 (5%)
 Frame = +1

Query  157   LTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSN-LIHHLKTSLSSTLDFFPPLAGRFA  333
             LTP DL  L +  IQ+GLLF  P      Q   +N L+  LK SLS  L  F PLAGR  
Sbjct  29    LTPXDLALLSVHYIQRGLLFTKPPEAILDQKNFTNSLLERLKXSLSIALVHFYPLAGRLV  88

Query  334   TVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAILDQSNINVPQILRSLFTLNGILN  510
             T  +E+     VYVDCNN+ G +F+ A    ++++ I   S  +VP +++S F  +  +N
Sbjct  89    TTKSEDPALYLVYVDCNNSPGAKFMYATLD-MSISDIJ--SPTDVPLVVQSFFDHDRAVN  145

Query  511   RDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL----SRGFHQP---  669
              DG    L+ +Q+TEL+DG FI  ++NH LGDGTSFW+FFN W+E+    ++G H     
Sbjct  146   HDGHFMSLVTIQVTELVDGIFIGLSMNHCLGDGTSFWHFFNIWSEIFQAQAQGGHSNFVA  205

Query  670   --STTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFHLSKVNIARLKEKA  843
               S  P+ +RWFPD     P+   P   S E +   +   L ER+FH +  +IA+LK KA
Sbjct  206   TISRPPVLKRWFPDGHG--PIISLPFKHSDEFIGRFEAPPLRERMFHFTAESIAKLKAKA  263

Query  844   NSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARMGLPEG--YWGNAV  1017
             N+E  T+ ISS Q+  A LWR++TRAR    ++     L    RAR+  P    Y+GN++
Sbjct  264   NAESDTTKISSFQALSALLWRSITRARCQPPDQGTSCRLAANNRARLDPPLSGDYFGNSI  323

Query  1018  FFITES-IKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVESP-AHNGAEIPSS  1191
             + I+   + AG++L  GLGW AW++ + V  H+ ++ +R+    ++ESP  +  +    S
Sbjct  324   YPISSKMVPAGELLEHGLGWAAWKLHEAVVNHN-DKVIREHTNAWLESPVVYQVSVFEPS  382

Query  1192  SNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCEEGSVDIELSIHPHT  1371
             S T+G  SSPRF++YG +FG GK V +RSG  +K  GKV+ + G +EGS+D E+ + P  
Sbjct  383   SVTIG--SSPRFNMYGTEFGMGKAVALRSGYAHKFSGKVSSYEGRKEGSIDTEVCLLPDA  440

Query  1372  LLGLENDAEFLEYFTI  1419
             +  LE D EF+E+ ++
Sbjct  441   MSALECDKEFMEFVSV  456



>ref|XP_010059908.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66386.1| hypothetical protein EUGRSUZ_F00203 [Eucalyptus grandis]
Length=463

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 182/458 (40%), Positives = 252/458 (55%), Gaps = 22/458 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffNSNLIH  270
             IS CF+  +     +G +R + L PWDL  L +  IQKGLLF  P    Q  F     IH
Sbjct  12    ISDCFIKPS--QLPDGSNRPLHLPPWDLTMLSVHYIQKGLLFPLPPRCLQPGFDRPAFIH  69

Query  271   ----HLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDC-NNAGVEFVEAKASGVTVA  435
                  LK SLSS L  F PLAGR AT+   +    +V+VDC N+ G  F+ A   G+TVA
Sbjct  70    SFLEKLKRSLSSALFHFYPLAGRLATLKQTDPPFYTVFVDCANSPGARFIHATL-GMTVA  128

Query  436   AILDQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTS  615
              IL  S   VP +++S F  +  +N DG    L+ VQ+TEL DG FI  ++NH++GDGTS
Sbjct  129   DIL--SPTYVPDVVQSFFDHDRAINHDGHTLSLLSVQVTELADGVFIGLSMNHAIGDGTS  186

Query  616   FWNFFNSWAELSRG-------FHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQ  774
             FW FFNSW+E+ +          Q S  P+  RWFP+N    P+ LP   + S  L   +
Sbjct  187   FWLFFNSWSEIFQAQEKGAVDVFQLSRPPVLTRWFPENHPG-PLSLPYTDDPSSFLARYE  245

Query  775   RAFLAERVFHLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHL  954
                L ERVFH S   IA LK +AN + GT+ ISS QS  A +WR +TRAR    N+    
Sbjct  246   APELRERVFHFSADAIAGLKAEANRQCGTTNISSWQSLTALVWRCITRARRFPPNQVTGC  305

Query  955   ILGIGMRARMG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEV  1128
              +    RAR+   L   Y+GN++  +  +   G++LG GLGW A  +   V  HS+  ++
Sbjct  306   RMAASNRARLDPQLSPEYFGNSITPLRTAATVGELLGSGLGWAAQLLHAAVAGHSN-AKL  364

Query  1129  RKMYMKFVESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKV  1308
             R+    +++ P     +     +++ + SSPRFD YG +FG GK V +RSG   K DGK 
Sbjct  365   REWNEDWIKRPQVYHMDKTFDRHSIMMGSSPRFDKYGNEFGLGKAVALRSGYAFKFDGKA  424

Query  1309  TLFGGCE-EGSVDIELSIHPHTLLGLENDAEFLEYFTI  1419
             + + G E  GSVD+E+ + P T+  LE D EF+   T+
Sbjct  425   SGYPGREGGGSVDLEICLPPVTMALLEADPEFMAAVTV  462



>ref|XP_003603068.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73319.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=438

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/443 (37%), Positives = 247/443 (56%), Gaps = 23/443 (5%)
 Frame = +1

Query  91    ISKCFVGAAGAARSNGVSRRVELTPWDLQFLQIGPIQKGLLFHNPTPqqqqqffN-SNLI  267
             +S CF+      + +  ++   LT WD+  L     QKGL+F  PT     Q     NL+
Sbjct  9     VSSCFIKPYPTIKDS--NQICYLTHWDIAMLSTHYNQKGLIFKKPTSSSLNQQHFIENLV  66

Query  268   HHLKTSLSSTLDFFPPLAGRFATVMNEEDNTCSVYVDCNNA-GVEFVEAKASGVTVAAIL  444
               LK SLS TL  F PL+GR  T  +E+ ++ +V+VDC N+ G +F+ A    +T+  IL
Sbjct  67    EKLKHSLSLTLFHFYPLSGRLVTKKSEDPDSYTVFVDCKNSPGAKFIHATLD-ITINDIL  125

Query  445   DQSNINVPQILRSLFTLNGILNRDGICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWN  624
               + I+VP I+ S F  +  +N DG    L+ +Q+TEL+DG FI C++NH L DGT++WN
Sbjct  126   --TPIDVPPIVHSFFDHDKAVNHDGHTMSLLSIQVTELVDGVFIGCSMNHCLCDGTAYWN  183

Query  625   FFNSWAELSRGFHQPSTTPIHERWFPDNTTTCPVHLPPMIESSERLPPPQRAFLAERVFH  804
             FFN+++E+ +           +RWFP      P+   P     E +   +   L ER+FH
Sbjct  184   FFNTFSEIFQN----------DRWFPQGYG--PIINLPFKHHHEFVHRYETPILRERIFH  231

Query  805   LSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRARM  984
              S  +IA+LK KAN+E  T+ ISS QS  A +WR++T AR L   +     +    R RM
Sbjct  232   FSVESIAKLKAKANAESNTNKISSFQSLSALVWRSITHARQLQHGQRTTCKMATNNRTRM  291

Query  985   G--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVES  1158
                LP+ Y+GN+++ ++     G++L   LGW AW+I   +  H  ++ VR+   K+  S
Sbjct  292   EPPLPKEYFGNSLYVVSAETTVGELLENDLGWAAWKIHVAIANHD-DKVVRRSVEKWFRS  350

Query  1159  PAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGGCE-EG  1335
             P     ++     T+ IS SPRF+ YG +FG GK + VRSG  NK DGKV  + G E  G
Sbjct  351   PFLYRMDLFFDPYTVMISGSPRFNTYGNEFGMGKALAVRSGYANKFDGKVISYPGQEGGG  410

Query  1336  SVDIELSIHPHTLLGLENDAEFL  1404
             S+D+E+ + P  ++ LE + EF+
Sbjct  411   SIDLEVCLSPKKMMVLETNEEFM  433



>ref|XP_008361421.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like, 
partial [Malus domestica]
Length=594

 Score =   281 bits (719),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 211/325 (65%), Gaps = 28/325 (9%)
 Frame = +1

Query  472   ILRSLFTLNGILNRDG-ICKPLMGVQITELLDGYFIACTLNHSLGDGTSFWNFFNSWAEL  648
             I+ S F +NGILN +G + KPL+ VQ+TEL+DG FI CT+NHS+ DG+SFW+FFN+W+E+
Sbjct  4     IVYSFFLMNGILNYEGGVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEI  63

Query  649   SR------GFHQPSTTPIHERWFPDNTTTCPVHLP---PMIESSERLPPPQRAFLAERVF  801
             SR         QP   PI  R + D     PV +P     I  ++ L P     L +RVF
Sbjct  64    SRRGSTNGKLSQPP--PIFGREYLDGIIDLPVRIPFFQNQIPKTKFLAP----ILKQRVF  117

Query  802   HLSKVNIARLKEKANSEMGTSIISSLQSYMAHLWRAVTRARNLHSNEDVHLILGIGMRAR  981
             H SK  IA+LK KANSEMGT+ ISSLQ+ +AHLW +VTR + L + ++    + +GMR R
Sbjct  118   HFSKETIAQLKAKANSEMGTTKISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQR  177

Query  982   MG--LPEGYWGNAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKFVE  1155
             +   LP+ Y GNAV F   +   G++L +GLGW AW++ K +   + E +VRK+   +++
Sbjct  178   LQPPLPDQYLGNAVLFGIVTSSVGELLERGLGWAAWEMNKMIAAQT-EHDVRKLLEDWIK  236

Query  1156  SPAHNGAEIPS----SSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVTLFGG  1323
             +P     ++P+    +SN+L   SSPRFDV+G DFGWG+P+ VRSG GNK DGK+T+F G
Sbjct  237   NP-----KVPNLGSLASNSLLTGSSPRFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQG  291

Query  1324  CEEGSVDIELSIHPHTLLGLENDAE  1398
              EEGS+D E  + P TL  L +DAE
Sbjct  292   AEEGSIDFEACLSPQTLHALAHDAE  316


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = +1

Query  997   GYWG---------NAVFFITESIKAGDVLGKGLGWVAWQIKKTVEKHSHEEEVRKMYMKF  1149
             G WG         NAV F   +    D+L + LGWVA ++ K +   + E+ +     ++
Sbjct  445   GIWGRHYPINTLXNAVLFGMTTSTVSDLLYRELGWVALEMNKMIASKTKEDAI-NFLKQW  503

Query  1150  VESPAHNGAEIPSSSNTLGISSSPRFDVYGADFGWGKPVQVRSGGGNKLDGKVT  1311
             ++SP        +S + L   SSPRF++Y  +FGWG P+ VRSG  NK  GK+T
Sbjct  504   IKSPKMTKMNALASDHALATGSSPRFNMYINNFGWGSPLAVRSGARNKFXGKLT  557



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4921153598812