BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24543_g2_i3 len=1917 path=[1:0-294 296:295-348 7358:349-349
351:350-408 6772:409-426 428:427-478 480:479-505 507:506-535
3812:536-790 792:791-815 7547:816-838 840:839-857 859:858-889
891:890-1007 1009:1008-1044 1046:1045-1069 1071:1070-1125
1127:1126-1916]

Length=1917
                                                                      Score     E

ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    768   0.0      Vitis vinifera
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    765   0.0      
emb|CBI30345.3|  unnamed protein product                                762   0.0      
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    757   0.0      
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    754   0.0      
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         749   0.0      
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    746   0.0      
emb|CDP10629.1|  unnamed protein product                                744   0.0      
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    743   0.0      
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    740   0.0      
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         740   0.0      Ricinus communis
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             738   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             734   0.0      
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        730   0.0      
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    727   0.0      
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    723   0.0      
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        721   0.0      
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    721   0.0      
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    719   0.0      
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           717   0.0      
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    716   0.0      
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                714   0.0      
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    715   0.0      
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    724   0.0      
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    709   0.0      
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    706   0.0      
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        706   0.0      
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    705   0.0      
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    704   0.0      
emb|CAN61013.1|  hypothetical protein VITISV_036738                     706   0.0      Vitis vinifera
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           702   0.0      
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        696   0.0      
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    684   0.0      
gb|EPS74090.1|  hypothetical protein M569_00662                         683   0.0      
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             677   0.0      
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     672   0.0      
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    667   0.0      
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    664   0.0      
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    663   0.0      
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    660   0.0      
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    652   0.0      
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    649   0.0      
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          646   0.0      
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     619   0.0      
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           617   0.0      
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    617   0.0      
ref|XP_006430124.1|  hypothetical protein CICLE_v10011529mg             595   0.0      
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    589   0.0      
gb|ABR17682.1|  unknown                                                 583   0.0      Picea sitchensis
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        578   0.0      
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         568   0.0      
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        565   0.0      
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          565   0.0      
emb|CBI18675.3|  unnamed protein product                                563   0.0      
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    563   0.0      
emb|CDY46135.1|  BnaA04g14230D                                          563   0.0      
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        563   0.0      
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        562   0.0      
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        562   0.0      
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    561   0.0      
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         561   0.0      Ricinus communis
emb|CDY20293.1|  BnaC04g36630D                                          561   0.0      
dbj|BAJ86079.1|  predicted protein                                      562   0.0      
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    561   0.0      
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    560   0.0      
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        561   0.0      
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             559   0.0      
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    558   0.0      
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        560   0.0      
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        558   0.0      
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             556   0.0      
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    558   0.0      
dbj|BAJ87416.1|  predicted protein                                      557   0.0      
dbj|BAJ92142.1|  predicted protein                                      558   0.0      
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          558   0.0      Sorghum bicolor [broomcorn]
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        556   0.0      
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    555   0.0      
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    554   0.0      
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    555   0.0      
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              553   0.0      
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        552   0.0      
gb|ABR17702.1|  unknown                                                 552   0.0      Picea sitchensis
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        551   0.0      
gb|EEC81080.1|  hypothetical protein OsI_23902                          553   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        550   0.0      
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         551   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        551   0.0      
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        551   0.0      
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                550   0.0      
ref|NP_001058206.1|  Os06g0647400                                       552   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    549   0.0      
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         548   0.0      
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    558   0.0      
emb|CDP10200.1|  unnamed protein product                                547   0.0      
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    546   0.0      
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     548   0.0      Zea mays [maize]
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        546   0.0      
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              546   0.0      Zea mays [maize]
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    544   0.0      
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        543   0.0      
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        542   0.0      
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         539   0.0      
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    538   0.0      
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             538   0.0      
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    537   0.0      
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        537   0.0      
emb|CDY08753.1|  BnaA06g24710D                                          535   0.0      
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        535   0.0      
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    535   1e-180   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    534   2e-180   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             533   4e-180   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    532   7e-180   
dbj|BAK05623.1|  predicted protein                                      532   7e-180   
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    531   3e-179   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    531   4e-179   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    531   6e-179   
gb|EPS59259.1|  hypothetical protein M569_15548                         528   8e-179   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    529   8e-179   
emb|CDY45627.1|  BnaCnng13350D                                          529   2e-178   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    529   2e-178   
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            528   6e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    527   7e-178   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    527   1e-177   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    525   3e-177   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        526   3e-177   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        525   5e-177   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             525   1e-176   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    525   1e-176   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    523   2e-176   
emb|CDP02648.1|  unnamed protein product                                523   3e-176   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    523   3e-176   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        523   3e-176   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             522   1e-175   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    521   2e-175   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    520   3e-175   
emb|CDM83096.1|  unnamed protein product                                521   3e-175   
ref|XP_001776094.1|  predicted protein                                  520   6e-175   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    520   7e-175   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    520   8e-175   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          520   1e-174   Sorghum bicolor [broomcorn]
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   519   1e-174   
dbj|BAK01568.1|  predicted protein                                      518   3e-174   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        516   2e-173   
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       516   2e-173   Arabidopsis thaliana [mouse-ear cress]
gb|AFW87519.1|  putative serine peptidase S28 family protein            516   9e-173   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         514   1e-172   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    514   1e-172   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             514   1e-172   Populus trichocarpa [western balsam poplar]
gb|AAM15096.1|  putative prolylcarboxypeptidase                         512   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    513   3e-172   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         513   3e-172   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    513   3e-172   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    513   5e-172   
ref|NP_001044360.1|  Os01g0767100                                       513   5e-172   Oryza sativa Japonica Group [Japonica rice]
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     514   5e-172   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              510   8e-172   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    514   9e-172   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        511   1e-171   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        510   3e-171   Vitis vinifera
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    510   3e-171   
gb|AFW84965.1|  putative serine peptidase S28 family protein            510   4e-171   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        510   5e-171   
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    510   7e-171   
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    510   7e-171   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               510   7e-171   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          510   1e-170   Sorghum bicolor [broomcorn]
ref|XP_007027868.1|  Alpha/beta-Hydrolases superfamily protein is...    503   3e-170   
gb|KDO70542.1|  hypothetical protein CISIN_1g0106561mg                  502   5e-170   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           507   6e-170   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             506   9e-170   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        511   1e-169   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              507   1e-169   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    506   2e-169   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        506   2e-169   
ref|NP_001065793.1|  Os11g0156200                                       501   2e-167   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80009.1|  hypothetical protein OsI_35177                          500   4e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    497   7e-167   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              498   8e-167   
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          496   3e-165   Oryza sativa Japonica Group [Japonica rice]
gb|AFW87518.1|  putative serine peptidase S28 family protein            512   4e-165   
ref|XP_006577089.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    490   6e-165   
gb|EAY75958.1|  hypothetical protein OsI_03875                          495   1e-164   Oryza sativa Indica Group [Indian rice]
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        487   2e-162   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    476   3e-159   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      479   3e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          478   9e-158   Sorghum bicolor [broomcorn]
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  473   3e-157   
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             468   1e-155   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    467   1e-155   
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    468   9e-155   
gb|EEE66119.1|  hypothetical protein OsJ_22160                          461   6e-154   Oryza sativa Japonica Group [Japonica rice]
gb|ABR16397.1|  unknown                                                 466   7e-154   Picea sitchensis
emb|CDX68714.1|  BnaC01g07390D                                          459   3e-153   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    460   5e-152   
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           460   1e-151   
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    453   4e-150   
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    454   2e-149   
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    452   3e-149   
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    452   1e-148   
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        452   1e-148   Vitis vinifera
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             449   4e-148   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        449   8e-148   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    446   9e-148   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        449   1e-147   Vitis vinifera
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    447   9e-147   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             446   2e-146   
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    446   3e-146   
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    446   4e-146   
gb|AIA26578.1|  serine protease                                         441   5e-146   
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             444   1e-145   Populus trichocarpa [western balsam poplar]
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    444   1e-145   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    443   3e-145   Vitis vinifera
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                442   9e-145   
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    442   1e-144   
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    442   1e-144   
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             439   3e-144   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             441   4e-144   Populus trichocarpa [western balsam poplar]
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             438   7e-144   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         439   1e-143   
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        439   3e-143   
emb|CBI17112.3|  unnamed protein product                                442   4e-143   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    437   8e-143   
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             437   2e-142   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     437   2e-142   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         436   2e-142   
emb|CAN65360.1|  hypothetical protein VITISV_036071                     439   2e-142   Vitis vinifera
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             436   2e-142   Populus trichocarpa [western balsam poplar]
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        437   4e-142   
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    433   4e-142   
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    435   5e-142   
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    432   6e-142   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    436   7e-142   
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             435   7e-142   
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    434   1e-141   
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        434   1e-141   Vitis vinifera
emb|CAN64374.1|  hypothetical protein VITISV_018664                     434   1e-141   Vitis vinifera
gb|EMS59622.1|  Lysosomal Pro-X carboxypeptidase                        431   1e-141   
ref|XP_007203816.1|  hypothetical protein PRUPE_ppa005504m2g            427   1e-141   
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    433   3e-141   
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    432   6e-141   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         432   7e-141   
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         431   1e-140   Ricinus communis
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    431   2e-140   
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   432   2e-140   
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   431   3e-140   
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    429   8e-140   
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             429   9e-140   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    427   2e-139   
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   2e-139   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   2e-139   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    428   3e-139   
emb|CBI17113.3|  unnamed protein product                                432   3e-139   
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         428   4e-139   
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    426   1e-138   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    426   1e-138   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         426   3e-138   Ricinus communis
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        426   3e-138   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   4e-138   
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    425   4e-138   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        423   3e-137   Vitis vinifera
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    422   4e-137   
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    422   6e-137   
emb|CDP17394.1|  unnamed protein product                                422   1e-136   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   3e-136   
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   4e-136   
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  417   4e-136   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    420   4e-136   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       420   5e-136   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         419   7e-136   Ricinus communis
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   9e-136   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    419   9e-136   
emb|CBI17109.3|  unnamed protein product                                433   1e-135   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         418   2e-135   
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    415   3e-135   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             417   4e-135   Populus trichocarpa [western balsam poplar]
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    416   4e-135   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         417   5e-135   Ricinus communis
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   413   7e-135   
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   421   2e-134   
ref|XP_004364392.1|  prolylcarboxypeptidase                             414   5e-134   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    414   7e-134   
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    414   1e-133   
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    410   1e-133   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    413   2e-133   
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        412   2e-133   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        411   3e-133   
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        406   5e-133   
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    410   7e-133   
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    411   1e-132   
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        409   1e-132   
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    410   2e-132   
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           409   5e-132   
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    408   8e-132   
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             408   9e-132   
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        408   1e-131   
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        407   1e-131   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    408   1e-131   
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        406   1e-131   
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    408   2e-131   
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             410   3e-131   
ref|XP_010139237.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        405   4e-131   
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    407   4e-131   
emb|CDP07008.1|  unnamed protein product                                407   6e-131   
ref|XP_008775539.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    402   6e-131   
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        405   1e-130   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    405   1e-130   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             405   2e-130   
gb|KFV84322.1|  Lysosomal Pro-X carboxypeptidase                        402   3e-130   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    405   3e-130   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     405   3e-130   
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     404   4e-130   
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        402   4e-130   
ref|XP_009877154.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        403   4e-130   
ref|XP_008498766.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    404   5e-130   
ref|XP_010651746.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    403   5e-130   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    404   5e-130   
emb|CBI17114.3|  unnamed protein product                                401   6e-130   
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    404   6e-130   
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    404   9e-130   
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    403   9e-130   
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    404   9e-130   
ref|XP_010399419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        403   1e-129   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    403   1e-129   
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        401   1e-129   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    403   1e-129   
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    402   2e-129   
emb|CAN63232.1|  hypothetical protein VITISV_004830                     402   2e-129   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   402   2e-129   
gb|KFP73631.1|  Lysosomal Pro-X carboxypeptidase                        400   3e-129   
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        402   3e-129   
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        400   3e-129   
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        400   4e-129   
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        400   4e-129   
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        399   6e-129   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    402   6e-129   
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        405   6e-129   
gb|EMC81816.1|  Lysosomal Pro-X carboxypeptidase                        399   6e-129   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    402   9e-129   
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        399   1e-128   
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        398   1e-128   
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    400   1e-128   
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        400   1e-128   
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    400   1e-128   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    401   1e-128   
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    400   2e-128   
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        398   2e-128   
gb|KFO92702.1|  Lysosomal Pro-X carboxypeptidase                        397   2e-128   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             400   2e-128   
ref|XP_001175153.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    399   3e-128   
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        397   3e-128   
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   3e-128   
ref|XP_009468660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   4e-128   
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        399   4e-128   
ref|XP_005149846.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        398   5e-128   
ref|XP_009967794.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   5e-128   
ref|XP_004051942.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    399   6e-128   
ref|XP_009563433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   7e-128   
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    399   7e-128   
ref|NP_001125428.1|  lysosomal Pro-X carboxypeptidase precursor         398   8e-128   
gb|KFV02463.1|  Lysosomal Pro-X carboxypeptidase                        396   9e-128   
ref|XP_009070789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   9e-128   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    398   1e-127   
gb|ACO10272.1|  Lysosomal Pro-X carboxypeptidase precursor              398   1e-127   
ref|XP_004763526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    398   1e-127   
ref|XP_002754795.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    398   1e-127   
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        398   1e-127   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    398   1e-127   
gb|KFW73852.1|  Lysosomal Pro-X carboxypeptidase                        395   2e-127   
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   2e-127   
ref|XP_008933120.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   2e-127   
gb|ACO10617.1|  Lysosomal Pro-X carboxypeptidase precursor              397   2e-127   
ref|NP_005031.1|  lysosomal Pro-X carboxypeptidase isoform 1 prep...    397   2e-127   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    397   2e-127   
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   2e-127   
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        395   2e-127   
gb|EFX79132.1|  hypothetical protein DAPPUDRAFT_225197                  397   2e-127   
ref|XP_004590083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   2e-127   
gb|KFP06048.1|  Lysosomal Pro-X carboxypeptidase                        395   2e-127   
ref|NP_001072639.1|  lysosomal Pro-X carboxypeptidase precursor         397   2e-127   
gb|KFO13685.1|  Lysosomal Pro-X carboxypeptidase                        395   2e-127   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    397   3e-127   
dbj|BAG35764.1|  unnamed protein product                                397   3e-127   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   3e-127   
pdb|3N2Z|B  Chain B, The Structure Of Human Prolylcarboxypeptidas...    395   3e-127   
ref|XP_008018493.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    397   3e-127   
ref|XP_008633192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   3e-127   
ref|XP_007900913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        397   3e-127   
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    396   4e-127   
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         396   4e-127   
ref|XP_004408704.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   4e-127   
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        394   6e-127   
gb|KFO79296.1|  Lysosomal Pro-X carboxypeptidase                        394   6e-127   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   7e-127   
ref|XP_009640619.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   8e-127   
ref|XP_009879496.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   9e-127   
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     395   1e-126   
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        396   1e-126   
ref|XP_010361179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        395   1e-126   
ref|XP_003910532.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    395   1e-126   
gb|KFR02889.1|  Lysosomal Pro-X carboxypeptidase                        393   1e-126   
gb|KFQ13604.1|  Lysosomal Pro-X carboxypeptidase                        392   2e-126   
ref|XP_010283636.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   2e-126   
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   2e-126   
gb|KFW74038.1|  Lysosomal Pro-X carboxypeptidase                        392   2e-126   
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   2e-126   
ref|XP_010018717.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        392   2e-126   
ref|NP_001099751.2|  lysosomal Pro-X carboxypeptidase precursor         394   3e-126   
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         392   3e-126   
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             394   3e-126   
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    394   3e-126   
gb|KFV54794.1|  Lysosomal Pro-X carboxypeptidase                        392   3e-126   
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    394   3e-126   
ref|XP_007944471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   3e-126   
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    394   5e-126   
ref|XP_008842416.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    394   5e-126   
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        394   5e-126   
gb|KGL90198.1|  Lysosomal Pro-X carboxypeptidase                        391   6e-126   
gb|KFU94741.1|  Lysosomal Pro-X carboxypeptidase                        391   6e-126   
ref|XP_006273509.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   7e-126   
ref|XP_006747630.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   7e-126   
ref|XP_010002716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        391   7e-126   
gb|KFO60084.1|  Lysosomal Pro-X carboxypeptidase                        391   7e-126   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   8e-126   
gb|KFP09734.1|  Lysosomal Pro-X carboxypeptidase                        391   8e-126   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   8e-126   
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        393   8e-126   
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    393   9e-126   
gb|EHH56621.1|  hypothetical protein EGM_06072                          394   1e-125   
gb|KFZ57497.1|  Lysosomal Pro-X carboxypeptidase                        390   1e-125   
ref|XP_006865042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    394   1e-125   
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        392   1e-125   
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    392   2e-125   
ref|XP_009279588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        390   2e-125   
ref|XP_006763793.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    392   2e-125   
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        392   2e-125   
ref|XP_008702603.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        391   3e-125   
gb|EMP35010.1|  Lysosomal Pro-X carboxypeptidase                        391   3e-125   
gb|ELU04397.1|  hypothetical protein CAPTEDRAFT_174591                  391   3e-125   
ref|XP_010738027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        392   3e-125   
ref|XP_010175531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        390   3e-125   
ref|XP_005579269.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    392   3e-125   
gb|KFQ73298.1|  Lysosomal Pro-X carboxypeptidase                        389   3e-125   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             392   3e-125   
ref|XP_008018495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    390   3e-125   
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            392   3e-125   
ref|XP_004051943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    392   4e-125   
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     392   4e-125   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    392   4e-125   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    390   5e-125   
ref|XP_006098535.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    391   5e-125   
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    391   5e-125   
ref|XP_009321727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        389   5e-125   
gb|EFB15217.1|  hypothetical protein PANDA_014943                       389   8e-125   
gb|KFZ51659.1|  Lysosomal Pro-X carboxypeptidase                        388   8e-125   
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    390   9e-125   
gb|ACE75287.1|  prolylcarboxypeptidase                                  390   9e-125   
ref|XP_533994.2|  PREDICTED: lysosomal Pro-X carboxypeptidase iso...    390   9e-125   
ref|XP_009245155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    392   9e-125   
gb|KFP78240.1|  Lysosomal Pro-X carboxypeptidase                        388   1e-124   
ref|NP_955450.2|  lysosomal Pro-X carboxypeptidase isoform 2 prep...    391   1e-124   
gb|KFQ54980.1|  Lysosomal Pro-X carboxypeptidase                        387   1e-124   
gb|ACE75375.1|  prolylcarboxypeptidase                                  390   2e-124   
ref|XP_005485885.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        388   2e-124   
ref|XP_008148243.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        389   2e-124   
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    389   2e-124   
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181              388   2e-124   
ref|XP_009185279.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    388   2e-124   
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    389   2e-124   
ref|XP_004683302.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        389   3e-124   
ref|XP_009005600.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    388   3e-124   
ref|XP_004093164.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    390   3e-124   
ref|XP_001628070.1|  predicted protein                                  387   3e-124   
ref|XP_002925438.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    390   3e-124   
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    389   4e-124   
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        387   4e-124   
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    389   4e-124   
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        389   4e-124   
ref|XP_005379866.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    388   6e-124   
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             386   6e-124   
ref|XP_003507065.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    389   6e-124   
gb|KFW66681.1|  Lysosomal Pro-X carboxypeptidase                        386   7e-124   
ref|XP_005884890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    388   7e-124   
emb|CAF90249.1|  unnamed protein product                                388   8e-124   
gb|KFM08871.1|  Lysosomal Pro-X carboxypeptidase                        385   9e-124   
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    387   1e-123   
emb|CDY09173.1|  BnaA02g05990D                                          388   1e-123   
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    387   1e-123   
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    387   1e-123   
ref|XP_006098534.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    388   2e-123   
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        387   2e-123   
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        387   2e-123   
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    385   4e-123   
ref|XP_010629189.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    385   4e-123   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    385   5e-123   
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    385   6e-123   
ref|XP_008458664.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    384   6e-123   
ref|XP_004632660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        388   8e-123   
dbj|BAG52417.1|  unnamed protein product                                386   1e-122   
ref|XP_010863507.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        385   1e-122   



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/484 (75%), Positives = 411/484 (85%), Gaps = 9/484 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K TP FP S +  RP  LS SS       +LY+ KYFTQ+LDHF + PQSY TFQQRYLI
Sbjct  27    KITPRFPSSIV--RPEQLSVSSQT-----ELYEAKYFTQLLDHFNYQPQSYRTFQQRYLI  79

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND+YWGGA  +APIFVY GNEGDIEWF QNTGFMFD APHF ALLVFIEHRFYGKS+PFG
Sbjct  80    NDKYWGGADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFG  139

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+   A S++ TLGYLSSTQ LADYATLIIDLKKNL+AT+SPVVVFGGSYGGMLAAWFRL
Sbjct  140   GDTNVAYSNASTLGYLSSTQALADYATLIIDLKKNLSATNSPVVVFGGSYGGMLAAWFRL  199

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL FENITSPY F+++ITQDFRSESENCYKVIKGSW+ I++ A +
Sbjct  200   KYPHVAIGALASSAPILNFENITSPYTFNNIITQDFRSESENCYKVIKGSWEQIEETAMK  259

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
             +GGLE LRKSF ICKNYIS G++E WLSTAY YTAMTDYPT +NFL+PMP YPVKQMCKA
Sbjct  260   NGGLEVLRKSFRICKNYISGGAIENWLSTAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKA  319

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+D  AKLY A N+YYNYTG    CFDLA  SDPHGL  W+WQACTEMIMP+  
Sbjct  320   IDDPAQGNDTFAKLYGAANVYYNYTGTA-ACFDLADDSDPHGLGEWTWQACTEMIMPVNA  378

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +N++SIFP S W+Y+ RA +CK AF IEPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGL
Sbjct  379   NNEESIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGL  438

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVL++ISKS+VAI AK+GAHHVDLRF+T EDP+WL+DVR++EV+II KW S+Y
Sbjct  439   RDPWSGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEY  498

Query  264   YHSL  253
             YH L
Sbjct  499   YHDL  502



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/487 (74%), Positives = 416/487 (85%), Gaps = 5/487 (1%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S+ + +P  L  S A   +  KLY+TKYFTQILDHF + P SY TFQQRYL 
Sbjct  24    KIPPRFPSSSFV-QPENLYFSLASKGN--KLYETKYFTQILDHFNYNPDSYQTFQQRYLF  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND+ WGGAK  APIFVY GNEGDIEWFTQNTGFMF+IAPHF ALLVFIEHRFYGKS+P+G
Sbjct  81    NDKNWGGAKTNAPIFVYTGNEGDIEWFTQNTGFMFEIAPHFKALLVFIEHRFYGKSIPYG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+KE A S++ TLGYLSSTQ LADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL
Sbjct  141   GDKEIAYSNTSTLGYLSSTQALADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHVTIGALASSAPIL F+NITSPY+F+++ITQDFR ESENCYKVIKGSW+ I+D+A+ 
Sbjct  201   KYPHVTIGALASSAPILNFQNITSPYSFNNIITQDFRGESENCYKVIKGSWKKIEDMAKT  260

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
             +GGL++LRKSF ICKNYIS  SL  WLSTA+TYTAMTDYPT +NFLNP+P YPVK+MCKA
Sbjct  261   TGGLKKLRKSFRICKNYISPDSLVNWLSTAFTYTAMTDYPTPSNFLNPLPAYPVKEMCKA  320

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+D   KLY A NIYYNYTG+   C +L  +SDPHGL GW+WQACTEM+MP  G
Sbjct  321   IDDPKTGNDTFEKLYGAANIYYNYTGKA-TCLNLNDNSDPHGLGGWTWQACTEMVMPTNG  379

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +NK+SIFP SEWDYNER ++CK    ++PRP+WITTEFGGH+IERVLK+FGSNIIFFNGL
Sbjct  380   NNKESIFPPSEWDYNERVRFCKLILDVKPRPDWITTEFGGHDIERVLKRFGSNIIFFNGL  439

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLK+ISKS+VAI AKEGAHHVDLR+S+KEDP+WL++VR +E+ II KWISQY
Sbjct  440   RDPWSGGGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRAREINIISKWISQY  499

Query  264   YHSLTDL  244
             Y + TD 
Sbjct  500   YQTKTDF  506



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/477 (75%), Positives = 407/477 (85%), Gaps = 7/477 (1%)
 Frame = -1

Query  1680  FSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGG  1501
             F + I RP  LS SS       +LY+ KYFTQ+LDHF + PQSY TFQQRYLIND+YWGG
Sbjct  10    FPSSIVRPEQLSVSSQT-----ELYEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGG  64

Query  1500  AKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AK  1324
             A  +APIFVY GNEGDIEWF QNTGFMFD APHF ALLVFIEHRFYGKS+PFGG+   A 
Sbjct  65    ADKLAPIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAY  124

Query  1323  SSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTI  1144
             S++ TLGYLSSTQ LADYATLIIDLKKNL+AT+SPVVVFGGSYGGMLAAWFRLKYPHV I
Sbjct  125   SNASTLGYLSSTQALADYATLIIDLKKNLSATNSPVVVFGGSYGGMLAAWFRLKYPHVAI  184

Query  1143  GALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERL  964
             GALASSAPIL FENITSPY F+++ITQDFRSESENCYKVIKGSW+ I++ A ++GGLE L
Sbjct  185   GALASSAPILNFENITSPYTFNNIITQDFRSESENCYKVIKGSWEQIEETAMKNGGLEVL  244

Query  963   RKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHG  784
             RKSF ICKNYIS G++E WLSTAY YTAMTDYPT +NFL+PMP YPVKQMCKAIDDP  G
Sbjct  245   RKSFRICKNYISGGAIENWLSTAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPAQG  304

Query  783   SDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIF  604
             +D  AKLY A N+YYNYTG    CFDLA  SDPHGL  W+WQACTEMIMP+  +N++SIF
Sbjct  305   NDTFAKLYGAANVYYNYTGTA-ACFDLADDSDPHGLGEWTWQACTEMIMPVNANNEESIF  363

Query  603   PASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
             P S W+Y+ RA +CK AF IEPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGLRDPWS G
Sbjct  364   PVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGG  423

Query  423   GVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             GVL++ISKS+VAI AK+GAHHVDLRF+T EDP+WL+DVR++EV+II KW S+YYH L
Sbjct  424   GVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYHDL  480



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/507 (73%), Positives = 420/507 (83%), Gaps = 16/507 (3%)
 Frame = -1

Query  1758  MKTRIILLffffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQIL  1579
             MK R+ILLF  F+   S AK TP FP S   + P       +K   N   YDTKYFTQIL
Sbjct  1     MKMRLILLFLVFFSPISLAKITPKFPSSFDDHLP-------SKGKFN---YDTKYFTQIL  50

Query  1578  DHFTFT-PQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPH  1402
             DHF F  PQ   TFQQRYL+ND+YWGG+KN APIFVY GNEG+IEWFTQNTGFMF+IAPH
Sbjct  51    DHFNFNNPQ---TFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNTGFMFEIAPH  107

Query  1401  FNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATD  1225
             FNALLVFIEHR+YGKS+P+GG+K  A S+  TLGYLSSTQ LADYATLIIDLK NLTA D
Sbjct  108   FNALLVFIEHRYYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLIIDLKNNLTAID  167

Query  1224  SPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSES  1045
             SPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL F NITSPY+F+++ITQDF+ ES
Sbjct  168   SPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFGNITSPYSFNNIITQDFKGES  227

Query  1044  ENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYP  865
             +NCYKVIKGSW+ I+D+A+  GGLE+LRKSF ICKNYIS G+LE WL TA+ YTAMTDYP
Sbjct  228   DNCYKVIKGSWKQIEDMAKTKGGLEKLRKSFRICKNYISQGALENWLYTAFVYTAMTDYP  287

Query  864   TATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDP  685
             T +NFLNP+P YPVKQMCKAIDDP  G D   K+Y A NIYYNYTG    CFDL   SDP
Sbjct  288   TPSNFLNPLPAYPVKQMCKAIDDPKGGKDTFEKIYEAANIYYNYTGNA-TCFDLNDHSDP  346

Query  684   HGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGG  505
             HGL+GW+WQ+CTEM+MP  G+NK+SIFP S+WDYNERAQ+CK  F +EPRPNW+TTEFGG
Sbjct  347   HGLAGWTWQSCTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSIFGVEPRPNWVTTEFGG  406

Query  504   HNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPK  325
             +NIERVLK+FGSNIIFFNGLRDPWS  GVLK+ISKS+VAI AKEGAHHVDLR+S+KEDPK
Sbjct  407   YNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPK  466

Query  324   WLKDVRRKEVEIIQKWISQYYHSLTDL  244
             WL+ VR +EV II  W+SQYY SL ++
Sbjct  467   WLQQVREREVNIISNWLSQYYQSLNEI  493



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/487 (74%), Positives = 413/487 (85%), Gaps = 5/487 (1%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S+ + +P  +  S A   +  KLY T YFTQILDHF + P SY TFQQRYL 
Sbjct  24    KIPPRFPSSSFV-QPEDVYFSLAFKGN--KLYKTNYFTQILDHFNYNPDSYQTFQQRYLF  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND++WGGAKN APIFVY GNEGDIEWFTQNTGFMF+IAPHF ALLVFIEHRFYGKS+P+G
Sbjct  81    NDKHWGGAKNNAPIFVYTGNEGDIEWFTQNTGFMFEIAPHFKALLVFIEHRFYGKSIPYG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+K  A S++ TLGYLSSTQ LADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL
Sbjct  141   GDKVIAYSNTSTLGYLSSTQALADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHVTIGALASSAPIL FENITSPY+F+++ITQDFR ESENCY VIKGSW+ I+D A+ 
Sbjct  201   KYPHVTIGALASSAPILNFENITSPYSFNNIITQDFRGESENCYNVIKGSWKKIEDTAKT  260

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
             +GGL++LRKSF ICKNYIS   L  WLSTA+TYTAMTDYPT +NFLNP+P YPVK+MCKA
Sbjct  261   TGGLKKLRKSFRICKNYISPDFLVNWLSTAFTYTAMTDYPTPSNFLNPLPAYPVKEMCKA  320

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+D   KLY A N+YYNY+G+   CFDL  +SDPHGL GW+WQACTEM+MP  G
Sbjct  321   IDDPKTGNDTFEKLYGAANMYYNYSGKA-TCFDLNDNSDPHGLGGWTWQACTEMVMPTDG  379

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +NK+SIFP SEWDYNER ++C+    ++PR +WITTEFGG+NIERVLK+FGSNIIFFNGL
Sbjct  380   NNKESIFPPSEWDYNERVRFCQLILDVKPRSDWITTEFGGYNIERVLKRFGSNIIFFNGL  439

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLK+ISKS+VAI AKEGAHHVDLR+S+KEDP+WL++VR +EV II  WISQY
Sbjct  440   RDPWSGGGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRGREVNIISNWISQY  499

Query  264   YHSLTDL  244
             Y +LTDL
Sbjct  500   YQTLTDL  506



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/482 (72%), Positives = 412/482 (85%), Gaps = 7/482 (1%)
 Frame = -1

Query  1695  TPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLIND  1516
             TP FP  +I ++   LS+S++       LY  K+FTQ+LDHF F P+SYHTFQ+RYLIND
Sbjct  19    TPRFPSPSIQSQKTSLSSSTSNG-----LYKEKFFTQVLDHFNFNPESYHTFQERYLIND  73

Query  1515  RYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGE  1336
              +WGG K  APIF+Y GNEGDIEWF QNTGFMFDIAPHFNALLVFIEHRFYGKS+PFGG+
Sbjct  74    TFWGGPKKNAPIFLYTGNEGDIEWFAQNTGFMFDIAPHFNALLVFIEHRFYGKSIPFGGD  133

Query  1335  KE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKY  1159
             K+ A S++ TLGYL+STQ LADYATL+ DLK NL+AT+SPVVVFGGSYGGMLAAWFRLKY
Sbjct  134   KKVAYSNASTLGYLTSTQALADYATLMTDLKNNLSATESPVVVFGGSYGGMLAAWFRLKY  193

Query  1158  PHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESG  979
             PH+TIGALASSAPIL F NITSPY+F+ +IT DFR+ESENCYKVIKGSWQ I+D A + G
Sbjct  194   PHITIGALASSAPILGFVNITSPYSFNSIITNDFRNESENCYKVIKGSWQKIEDTASQPG  253

Query  978   GLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAID  799
             GLE+LRK+F ICKNYIS GSLE WL TA+TYTAMTDYPT++NFLNP+PP+PVKQMCKAID
Sbjct  254   GLEKLRKAFKICKNYISAGSLESWLYTAWTYTAMTDYPTSSNFLNPLPPHPVKQMCKAID  313

Query  798   DPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSN  619
             DP  G+D  AKLY A ++YYN++G    CFDL ++SDPHGL GWSWQACTEMI+P GG+N
Sbjct  314   DPTTGNDTFAKLYGAASVYYNHSGTA-TCFDLDNNSDPHGLGGWSWQACTEMILPTGGNN  372

Query  618   KDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRD  439
             K+S+FPAS W  N+RA YC+ AF I+PRPNW+  EFGGHNI+RVLK+FGSNIIFFNGLRD
Sbjct  373   KESMFPASSWSLNDRATYCQYAFHIQPRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRD  432

Query  438   PWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             PWS GGVL++ISKS++AI AK+GAHHVDLR+++ EDPKWL+ VR++E++II KW+S+YY 
Sbjct  433   PWSGGGVLEDISKSIIAIVAKKGAHHVDLRYASSEDPKWLQHVRKREIKIIAKWLSEYYL  492

Query  258   SL  253
              L
Sbjct  493   DL  494



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/457 (77%), Positives = 396/457 (87%), Gaps = 6/457 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFT-PQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+T YFTQILDHF +  PQ   TFQQRYL+ND+YWGG+KN APIFVY GNEG+IEWFTQN
Sbjct  40    YETNYFTQILDHFNYNNPQ---TFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQN  96

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLII  1255
             TGFMF+IAPHFNALLVFIEHRFYGKS+P+GG+K  A S+  TLGYLSSTQ LADYATLII
Sbjct  97    TGFMFEIAPHFNALLVFIEHRFYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLII  156

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
             DLK NLTA DSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL F NITSPY+F++
Sbjct  157   DLKNNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFGNITSPYSFNN  216

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             +ITQDF+ ESENCYKVIKGSW+ I+D+A+  GGLE+LRKSF ICKNYIS G+LE WL TA
Sbjct  217   IITQDFKGESENCYKVIKGSWKQIEDMAKTKGGLEKLRKSFRICKNYISQGALENWLYTA  276

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
             + YTAMTDYPT +NFLNP+P YPVKQMCKAIDDP  G D   K+Y A NIYYNYTG    
Sbjct  277   FVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPKSGKDTFEKIYGAANIYYNYTGNA-T  335

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF+L   SDPHGL+GW+WQACTEM+MP  G+NK+SIFP S+WDYNERAQ+CK  F +EPR
Sbjct  336   CFNLNDHSDPHGLAGWTWQACTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSNFGVEPR  395

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             PNW+TTEFGG+NIERVLK+FGSNIIFFNGLRDPWS  GVLK+ISKS+VAI AKEGAHHVD
Sbjct  396   PNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHHVD  455

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             LR+S+KEDPKWLK VR +EV II  W+SQYY SL ++
Sbjct  456   LRWSSKEDPKWLKQVREREVNIISNWLSQYYQSLNEI  492



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/471 (75%), Positives = 395/471 (84%), Gaps = 20/471 (4%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY+TKY+TQILDHFTFTPQSY TFQQRYLI+ ++WGGAK  APIFVY GNEGDIEWFTQN
Sbjct  48    LYETKYYTQILDHFTFTPQSYQTFQQRYLISYKHWGGAKKNAPIFVYTGNEGDIEWFTQN  107

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLII  1255
             TGFMF+ APHF ALLVFIEHRFYGKS+PFGG K+ A ++S TLGYLSSTQ LADYATLII
Sbjct  108   TGFMFENAPHFKALLVFIEHRFYGKSIPFGGNKDVAYANSSTLGYLSSTQALADYATLII  167

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
             DLKKNL+A DSPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPILYF+NITS Y+F  
Sbjct  168   DLKKNLSAVDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDNITSEYSFHS  227

Query  1074  VITQDFR------------------SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFN  949
              +  DFR                  SESENCYKVIKGSWQLI+D AE+SGGL+ LRKSF 
Sbjct  228   TVGNDFRAFVHMHVSLFDTGKCWRRSESENCYKVIKGSWQLIEDTAEQSGGLDTLRKSFR  287

Query  948   ICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLA  769
             ICKNYIS G+L  WLSTA+ YTAMTDYPT +NFLNP+P YPVKQMCKAIDD   G++ L 
Sbjct  288   ICKNYISAGALVSWLSTAFIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDRKAGNNTLE  347

Query  768   KLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEW  589
             KLYSA N+YYN TG    CF+L   SDPHGL  WSWQACTEMI+P+GG+N D IFP SEW
Sbjct  348   KLYSAANVYYNSTGRAT-CFNLNDDSDPHGLDEWSWQACTEMILPIGGNNADGIFPPSEW  406

Query  588   DYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKN  409
             DY  RAQ C++AF ++PRPNWITTEFGGHNI+RVLK+FGSNIIFFNGLRDPWS GGVLK+
Sbjct  407   DYAGRAQSCEDAFGVQPRPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRDPWSGGGVLKD  466

Query  408   ISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
             ISKSLVAI AKEGAHHVDLRFST EDP+WLK  RR+EV+II+ W+SQYYHS
Sbjct  467   ISKSLVAIVAKEGAHHVDLRFSTPEDPEWLKHARRREVKIIENWLSQYYHS  517



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/486 (71%), Positives = 400/486 (82%), Gaps = 7/486 (1%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S I  RP  LS ++ +     KLY  +YFTQILDHF F P+SY TFQ RYLI
Sbjct  27    KVPPRFPSSVI--RPEQLSLATKRGT---KLYKARYFTQILDHFNFNPKSYQTFQHRYLI  81

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND YW G +  +PIFVY GNEGDIEWF QNTGFMFD+AP+F ALLVFIEHRFYGKS+PFG
Sbjct  82    NDTYWSGPEKNSPIFVYTGNEGDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFG  141

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+K+ A S++ TLGYL+STQ LADYATLIIDLKKNLTA DSPVVVFGGSYGGMLA WFRL
Sbjct  142   GDKDIAYSNASTLGYLTSTQALADYATLIIDLKKNLTADDSPVVVFGGSYGGMLATWFRL  201

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ IGALASSAPIL FENITSPY+F+++ITQDFRSESENCYKVIKGSW+ I+D    
Sbjct  202   KYPHIVIGALASSAPILNFENITSPYSFNNIITQDFRSESENCYKVIKGSWEQIEDTGSR  261

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
             SGGLE LRKSF ICKNYI   +LE WL+TA+ YTAMTDYPT +NFLNP+P YPVKQMCK+
Sbjct  262   SGGLELLRKSFRICKNYIDADALESWLTTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKS  321

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+D  AKLY A N+YYN+TG    CF+LA S DPHGL  WSWQACTEMIMP  G
Sbjct  322   IDDPTTGNDSFAKLYGAANVYYNHTG-TTTCFNLAYSPDPHGLDMWSWQACTEMIMPTDG  380

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +N+DSIFP S+W Y++RA  CK  + ++PRPNWITTEFGGH+I R LK+FGSNIIF+NGL
Sbjct  381   NNQDSIFPESQWSYSQRAAVCKGYYGVDPRPNWITTEFGGHDISRALKRFGSNIIFYNGL  440

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLKNISK++VAI A++GAHHVDLRF+T +DPKWL+ VR +EV+II  WISQY
Sbjct  441   RDPWSGGGVLKNISKTIVAIVAEQGAHHVDLRFATSQDPKWLQQVREREVKIISNWISQY  500

Query  264   YHSLTD  247
             YH L +
Sbjct  501   YHDLAN  506



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/484 (72%), Positives = 402/484 (83%), Gaps = 9/484 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P+FP S I      LS         H+LY  K+FTQ+LDH+TF PQSY TFQQRYLI
Sbjct  25    KPIPSFPSSIIQAEKISLSTP-------HELYHEKFFTQVLDHYTFRPQSYKTFQQRYLI  77

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND+YWGGA+  APIF+Y GNEGDIEWF QNTGF+FDIAPHF  L+VFIEHRFYGKS+PFG
Sbjct  78    NDKYWGGAEKNAPIFLYTGNEGDIEWFAQNTGFIFDIAPHFKPLVVFIEHRFYGKSMPFG  137

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G KE A S+S TLGYL+STQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFRL
Sbjct  138   GNKEVAYSNSSTLGYLTSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRL  197

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASS+PIL FENITSPY+F+++ITQDFR ESENCYKVIK SWQ I++ A +
Sbjct  198   KYPHVAIGALASSSPILNFENITSPYSFNNIITQDFRGESENCYKVIKRSWQEIENTASQ  257

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGLE LR+SF IC+N IS  SL+ WL TA  YTAMTDYPT +NFL+PMP YPVK+MCKA
Sbjct  258   PGGLEILRRSFRICRNSISASSLQSWLYTALVYTAMTDYPTPSNFLSPMPAYPVKEMCKA  317

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G++  AKLY A ++YYNY+G    CF+L   SDPHGL GWSWQACTEMI+P  G
Sbjct  318   IDDPKTGNNTFAKLYGAASVYYNYSGTA-TCFNLDDDSDPHGLGGWSWQACTEMILPTSG  376

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +NKDSIF ASEW+Y++RA +CK  F +EPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGL
Sbjct  377   NNKDSIFTASEWNYDDRATFCKAYFGVEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGL  436

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVL+NIS S+VAI AK+GAHHVDLRF+T EDPKWL+DVR++EV II KW+S+Y
Sbjct  437   RDPWSGGGVLENISSSIVAIVAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSKY  496

Query  264   YHSL  253
             Y  L
Sbjct  497   YDDL  500



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/477 (73%), Positives = 396/477 (83%), Gaps = 2/477 (0%)
 Frame = -1

Query  1680  FSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGG  1501
             FS+ IN        ++ +   +KLY  K+FTQ LDHF F P+SY TFQQRYLIND YW G
Sbjct  28    FSSSINTQPADQKKTSLSTTPNKLYKEKFFTQTLDHFNFNPKSYQTFQQRYLINDTYWAG  87

Query  1500  AKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AK  1324
              KN APIF+Y GNEG+IEWF QNTGFMFD AP FNALLVF+EHRFYGKS+PFGG KE A 
Sbjct  88    PKNNAPIFMYTGNEGEIEWFAQNTGFMFDNAPKFNALLVFVEHRFYGKSIPFGGNKEVAY  147

Query  1323  SSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTI  1144
             S++ TLGYL+STQ LADYATLI DLK NL+ATDSPVVVFGGSYGGMLAAWFRLKYPHVTI
Sbjct  148   SNASTLGYLTSTQSLADYATLITDLKNNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTI  207

Query  1143  GALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERL  964
             GALASSAPIL F NITSPY+F+++IT DFRSESENCYKVIKGSWQ I+D A + GGLE+L
Sbjct  208   GALASSAPILGFVNITSPYSFNNIITHDFRSESENCYKVIKGSWQQIEDTANQHGGLEKL  267

Query  963   RKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHG  784
             RKSF ICKNYIS GSLE WLSTA+ Y+AMTDYPT +NFLNP+P +PVKQMCKAIDDP  G
Sbjct  268   RKSFKICKNYISAGSLENWLSTAWVYSAMTDYPTPSNFLNPLPAFPVKQMCKAIDDPTAG  327

Query  783   SDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIF  604
             +D  AK ++A ++YYNY+G    CFDL   SDPHGL GW WQACTEMI+P GGS  +SIF
Sbjct  328   NDTFAKFHAAASVYYNYSGTA-TCFDLDDDSDPHGLGGWDWQACTEMILPTGGSTAESIF  386

Query  603   PASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
             PASEWDYN+R  YCK  F I+PRPNWITTEFGGHNI+  LK+F SNIIFFNGLRDPWS G
Sbjct  387   PASEWDYNDRVTYCKLRFDIDPRPNWITTEFGGHNIKMALKRFASNIIFFNGLRDPWSGG  446

Query  423   GVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             GVL++ISKSLVA+  ++GAHHVDLRF+T EDPKWL++VR+KEV+II KW+S YY  L
Sbjct  447   GVLEDISKSLVALVEEKGAHHVDLRFATSEDPKWLQEVRQKEVKIIAKWLSDYYQDL  503



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/484 (72%), Positives = 399/484 (82%), Gaps = 9/484 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P+FP S I      LS         ++LY  K+FTQ+LDH+TF PQSY TFQQRYLI
Sbjct  25    KPIPSFPSSIIQAEKISLSTP-------NELYHEKFFTQVLDHYTFRPQSYKTFQQRYLI  77

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND+YWGGA+  APIF+Y GNEGDIEWF QNTGF+FDIAPHF  LLVFIEHRFYGKS+PFG
Sbjct  78    NDKYWGGAEKNAPIFLYTGNEGDIEWFAQNTGFIFDIAPHFKPLLVFIEHRFYGKSMPFG  137

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G KE A S+S TLGYL+STQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFRL
Sbjct  138   GNKEVAYSNSSTLGYLTSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRL  197

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASS+PIL FENITSPY+F+++ITQDFR ESENCYKVIK SWQ I+D A +
Sbjct  198   KYPHVAIGALASSSPILNFENITSPYSFNNIITQDFRGESENCYKVIKRSWQEIEDTASQ  257

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGLE LR SF IC+N +S  SL+ WL TA  YTAMTDYPT +NFLNPMP YPVK+MCKA
Sbjct  258   PGGLEILRSSFRICRNSMSASSLQSWLYTALVYTAMTDYPTPSNFLNPMPAYPVKEMCKA  317

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+   AKLY A ++YYNY+G    CF+    SDPHGL GWSWQACTEMI+P  G
Sbjct  318   IDDPKTGNKTFAKLYGAASVYYNYSGNA-TCFNHDDDSDPHGLGGWSWQACTEMILPTSG  376

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +NKDSIFPASEW+Y++RA +CK  F +EPRPNWIT EFGGH+I+RVLK+FGSNIIFFNGL
Sbjct  377   NNKDSIFPASEWNYDDRASFCKAYFGVEPRPNWITAEFGGHDIKRVLKRFGSNIIFFNGL  436

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVL+NIS S+VAI AK+GAHHVDLRF+T EDPKWL+DVR++EV II KW+S+Y
Sbjct  437   RDPWSGGGVLENISSSIVAIIAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSEY  496

Query  264   YHSL  253
             Y  L
Sbjct  497   YDDL  500



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/507 (70%), Positives = 411/507 (81%), Gaps = 9/507 (2%)
 Frame = -1

Query  1758  MKTRIILLff----ffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYF  1591
             M TR I L F          S AK  PTFP S I   P  LS+  + + D+  LY TKY 
Sbjct  1     MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRIT--PEKLSSLISNSKDSQGLYKTKYH  58

Query  1590  TQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDI  1411
             TQILDHF + PQSY TFQQRYLIND +WGG+KN APIFVY GNEGDIEWF QNTGFM+D+
Sbjct  59    TQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDV  118

Query  1410  APHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             AP F ALLVFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQ LADYA+LIIDLKKNLT
Sbjct  119   APKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLT  178

Query  1233  ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFR  1054
             ATDSPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F+NI SPY+FS++ITQDFR
Sbjct  179   ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFR  238

Query  1053  SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMT  874
             S SENCYKVIKGSW+ I++ A++ GGLE+L+K+F ICK+  ++ ++E WLSTA+ YTAMT
Sbjct  239   SVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNL-AIESWLSTAFVYTAMT  297

Query  873   DYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASS  694
             DYPT +NFLNP+P +PVK+MCKAIDDP  G+D  AKLY A ++YYNY+G    CFDL   
Sbjct  298   DYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAK-CFDLNGD  356

Query  693   SDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTE  514
             SDPHGLS W WQACTEMIM  GG NKDSIF  SE DY+ RA+YCKEA+ ++PRPNWITTE
Sbjct  357   SDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTE  416

Query  513   FGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKE  334
             FGGH I  VLK+F SNIIFFNGLRDPWS GGVLKNISK+++A+  KEGAHHVDLRFSTKE
Sbjct  417   FGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKE  476

Query  333   DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             DP+WLKDVRR+EVEI+ KWISQY+  L
Sbjct  477   DPQWLKDVRRREVEIVGKWISQYFQDL  503



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 405/490 (83%), Gaps = 12/490 (2%)
 Frame = -1

Query  1701  KTTPT---FPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQR  1531
             KTTP    FP S I   P  +SAS+      +KLY TKYFTQILDHF F P+SY TFQQR
Sbjct  22    KTTPAGARFPSSLIT--PEKVSAST-----QNKLYRTKYFTQILDHFNFYPKSYQTFQQR  74

Query  1530  YLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSV  1351
             YLIND +WGGAKN APIFVY GNEG+IEWF QN GF+++ APHF +L+VFIEHRFYGKS+
Sbjct  75    YLINDTFWGGAKNNAPIFVYTGNEGNIEWFAQNLGFLYETAPHFKSLVVFIEHRFYGKSI  134

Query  1350  PFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAW  1174
             P+GG+K  A S++ TLG+LSSTQ LADYA+LIIDLKKNL+ATDSPVVVFGGSYGGMLAAW
Sbjct  135   PYGGKKSVAYSNASTLGHLSSTQALADYASLIIDLKKNLSATDSPVVVFGGSYGGMLAAW  194

Query  1173  FRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDI  994
             FRLKYPHVTIGALASS+PIL FENITS Y+F +++TQDF+S SENCYKVIKGSW+ I++ 
Sbjct  195   FRLKYPHVTIGALASSSPILNFENITSSYSFRNIVTQDFKSVSENCYKVIKGSWEQIENT  254

Query  993   AEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQM  814
             A + GGLE LRKSF +CKN   +  LE WLSTAY YTAMTDYPT +NFL P+P +PVK+M
Sbjct  255   ANQPGGLELLRKSFKLCKNGADLDYLEDWLSTAYAYTAMTDYPTPSNFLCPLPAFPVKKM  314

Query  813   CKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMP  634
             C+AIDDP  G+D  AKLY A N+YYNY+G V  CF+L  +SDPH L GW WQACTEMIMP
Sbjct  315   CEAIDDPTTGNDTFAKLYGAANVYYNYSGTV-TCFELDDNSDPHDLGGWYWQACTEMIMP  373

Query  633   LGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFF  454
              GG+N+DSIFPAS+WDY ++A  CK  F IEPRP WITTEFGGH IERVLK++GSNIIFF
Sbjct  374   TGGNNEDSIFPASDWDYKDQASVCKSRFGIEPRPLWITTEFGGHAIERVLKRYGSNIIFF  433

Query  453   NGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWI  274
             NGLRDPWS GGVLKNISKS+VAI AKEGAHHVDL F + EDP+WL+DVR++E++II KWI
Sbjct  434   NGLRDPWSGGGVLKNISKSIVAIVAKEGAHHVDLMFKSSEDPEWLQDVRKQEIKIIAKWI  493

Query  273   SQYYHSLTDL  244
             SQYYH L  L
Sbjct  494   SQYYHDLAQL  503



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/507 (70%), Positives = 411/507 (81%), Gaps = 9/507 (2%)
 Frame = -1

Query  1758  MKTRIILLff----ffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYF  1591
             M TR I L F          S AK  PTFP S I   P  LS+  + + D+  LY TKY 
Sbjct  1     MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRIT--PEKLSSLISSSKDSQGLYKTKYH  58

Query  1590  TQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDI  1411
             TQILDHF + PQSY TFQQRYLIND +WGG+KN APIFVY GNEGDIEWF QNTGFM+D+
Sbjct  59    TQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDV  118

Query  1410  APHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             AP F ALLVFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQ LADYA+LIIDLKKNLT
Sbjct  119   APKFKALLVFIEHRYYGKSMPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLT  178

Query  1233  ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFR  1054
             ATDSPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F+NI SPY+FS++ITQDFR
Sbjct  179   ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFR  238

Query  1053  SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMT  874
             S SENCYKVIKGSW+ I++ A++ GGLE+L+K+F ICK+  ++ ++E WLSTA+ YTAMT
Sbjct  239   SVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNL-AIESWLSTAFVYTAMT  297

Query  873   DYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASS  694
             DYPT +NFLNP+P +PVK+MCKAIDDP  G+D  AKLY A ++YYNY+G    CFDL   
Sbjct  298   DYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTAK-CFDLNGD  356

Query  693   SDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTE  514
             SDPHGLS W WQACTEMIM  GG NKDSIF  SE DY+ RA+YCKEA+ ++PRPNWITTE
Sbjct  357   SDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTE  416

Query  513   FGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKE  334
             FGGH I  VLK+F SNIIFFNGLRDPWS GGVLKNISK+++A+  KEGAHHVDLRFSTKE
Sbjct  417   FGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKE  476

Query  333   DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             DP+WLKDVRR+EVEII KWISQY+  L
Sbjct  477   DPQWLKDVRRREVEIIGKWISQYFQDL  503



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/484 (71%), Positives = 397/484 (82%), Gaps = 8/484 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K    FP S +  RP+ L++ S K+    + Y+TKYFTQ LDHF F PQSY TFQQRYLI
Sbjct  27    KIASRFPSSIV--RPD-LASLSIKS---QQFYETKYFTQTLDHFNFQPQSYQTFQQRYLI  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND+YWGGA+N APIFVY GNEGDIEWF QNTGFM++ AP F ALLVFIEHRFYG S+PFG
Sbjct  81    NDKYWGGAQNNAPIFVYTGNEGDIEWFAQNTGFMYETAPKFKALLVFIEHRFYGSSIPFG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+KE A S++ TLGYLSSTQ LADYATLIIDLKKNLTA DSPV+ FGGSYGGMLAAWFRL
Sbjct  141   GDKEVAYSNASTLGYLSSTQALADYATLIIDLKKNLTAEDSPVIAFGGSYGGMLAAWFRL  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV +GALASS+PIL FE++TSPY F+ +IT DFRSESENCYKVIKGSW+ I+D A++
Sbjct  201   KYPHVVVGALASSSPILNFEDLTSPYGFNSIITNDFRSESENCYKVIKGSWKEIEDTAKQ  260

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGLE LR SF +CK   +   LE W+ TA  YTAMTDYPT +NFL P+P YPVKQMCKA
Sbjct  261   QGGLEVLRNSFKLCKKAFTADDLESWIETALIYTAMTDYPTPSNFLQPLPAYPVKQMCKA  320

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             ID+P  G+D  A+LY AVNIYYN TG    CFD+   SDPHGLS W+WQACTEMI+P  G
Sbjct  321   IDNPTVGNDTFARLYGAVNIYYNNTGNA-TCFDIEDDSDPHGLSEWTWQACTEMILPTDG  379

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +  DSIFPASEWDY  RA  C+ AF I PRP+WITTE+GG++I RVLK+FGSNIIFFNGL
Sbjct  380   NKNDSIFPASEWDYANRATNCQFAFGINPRPHWITTEYGGYDIRRVLKRFGSNIIFFNGL  439

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVL++ISKS++AI AKEGAHHVDLRFSTKEDP+WL+DVR++EV II+KW+SQY
Sbjct  440   RDPWSGGGVLESISKSIIAIVAKEGAHHVDLRFSTKEDPEWLRDVRKREVGIIRKWLSQY  499

Query  264   YHSL  253
             Y+ L
Sbjct  500   YNDL  503



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/457 (75%), Positives = 385/457 (84%), Gaps = 3/457 (1%)
 Frame = -1

Query  1617  HKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGG-AKNMAPIFVYMGNEGDIEWF  1441
             H+LY+ K+FTQILDHF + PQSY TFQQRYLIND YWGG A   APIFVY GNEGDIEWF
Sbjct  46    HELYEEKFFTQILDHFNYNPQSYETFQQRYLINDNYWGGGADKNAPIFVYTGNEGDIEWF  105

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYAT  1264
              QNTGFMF+ AP F ALL+FIEHR+YGKS+PFGG KE A ++S TLGYLS+TQ LADYAT
Sbjct  106   AQNTGFMFETAPIFKALLLFIEHRYYGKSMPFGGSKERAYANSSTLGYLSATQALADYAT  165

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             LI+DLKKNLTA DSPVVVFGGSYGGMLAAWFRLKYPHV +GALASSAPIL F+NITSP++
Sbjct  166   LILDLKKNLTAIDSPVVVFGGSYGGMLAAWFRLKYPHVAVGALASSAPILNFDNITSPFS  225

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F+++IT DFRSESENCYKVIK SWQ I D A + GGLE LRKSF ICKNYIS  +L+GWL
Sbjct  226   FNNIITHDFRSESENCYKVIKRSWQEIDDTAAKPGGLEILRKSFRICKNYISGEALKGWL  285

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE  724
              TAYTYTAMTDYPT TNFL P+P YPVKQMCKAIDDP  G++   KLY A N+YYNYTG+
Sbjct  286   GTAYTYTAMTDYPTPTNFLAPLPAYPVKQMCKAIDDPKTGNNTFEKLYGAANVYYNYTGD  345

Query  723   VNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
                CFDLA  SDPHGL GW+WQACTEMI+   G+ +DSIFP + + YN+R  +CK+ + I
Sbjct  346   A-TCFDLADDSDPHGLGGWTWQACTEMILLTDGNTEDSIFPPNNYSYNDRFVFCKDNYNI  404

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
             EPRP WI T+FG HNI RVLK+FGSNIIFFNGLRDPWS GGVLK+ISKSLVAI AKEGAH
Sbjct  405   EPRPTWIPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSLVAIVAKEGAH  464

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             HVDLRFST EDPKWL+DVR +EV II KW+SQYY +L
Sbjct  465   HVDLRFSTSEDPKWLEDVRNREVRIISKWLSQYYRTL  501



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/459 (75%), Positives = 390/459 (85%), Gaps = 2/459 (0%)
 Frame = -1

Query  1617  HKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFT  1438
             ++LY T+YFTQILDHF F P+SY TFQQRYLIND +WGGAK+ APIFVY GNEG+IEWF 
Sbjct  56    NQLYRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIEWFA  115

Query  1437  QNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATL  1261
             QNTGF+++ APHF AL+VFIEHRFYGKS+P+GG KE A S++ TLGYLSSTQ LADYA+L
Sbjct  116   QNTGFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYSNATTLGYLSSTQALADYASL  175

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             IIDLKKNL+ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL FENITSPY+F
Sbjct  176   IIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSF  235

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
             +++ITQDFRSESENCYKVIKGSW+ I+  A++ GGLE LR SF ICKNYIS   LEGWL 
Sbjct  236   TNIITQDFRSESENCYKVIKGSWEQIESTADQPGGLELLRNSFKICKNYISADYLEGWLR  295

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             TA+TYTAMTDYPT +NFL+P+P +PVKQMC AIDDP  G+D   KLY A ++YYNY+G  
Sbjct  296   TAFTYTAMTDYPTPSNFLSPLPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGTA  355

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CFDL   SDPH L GWSWQACTEMIMP  G+ ++SIFPASEW Y  RA  CK +F IE
Sbjct  356   -TCFDLDDDSDPHDLGGWSWQACTEMIMPTSGNTEESIFPASEWKYXYRAASCKRSFGIE  414

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP WITTEFGGH+IERVLK++GSNIIFFNGLRDPWS GGVLKNISKS+VAI AKEGAHH
Sbjct  415   PRPLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHH  474

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             VDLRF   EDP WLK+VR++E+ II  WISQYYH L  L
Sbjct  475   VDLRFKNSEDPDWLKEVRKQEINIIGNWISQYYHDLAQL  513



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/459 (75%), Positives = 390/459 (85%), Gaps = 2/459 (0%)
 Frame = -1

Query  1617  HKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFT  1438
             +++Y T+YFTQILDHF F P+SY TFQQRYLIND +WGGAK+ APIFVY GNEG+I+WF 
Sbjct  56    NQIYRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIDWFA  115

Query  1437  QNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATL  1261
             QNTGF+++ APHF AL+VFIEHRFYGKS+P+GG KE A  ++ TLGYLSSTQ LADYA+L
Sbjct  116   QNTGFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYGNATTLGYLSSTQALADYASL  175

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             IIDLKKNL+ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL FENITSPY+F
Sbjct  176   IIDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILNFENITSPYSF  235

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
             S+++TQDFRSESENCYKVIKGSW+ I+  A+E GGLE LR SF ICKNYIS   LEGWL 
Sbjct  236   SNIVTQDFRSESENCYKVIKGSWEQIESTADEPGGLELLRNSFKICKNYISADDLEGWLR  295

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             TA+TYTAMTDYPT +NFL+PMP +PVKQMC AIDDP  G+D   KLY A ++YYNY+G+ 
Sbjct  296   TAFTYTAMTDYPTPSNFLSPMPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGKA  355

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CFDL   SDPH L GWSWQACTEMIMP+GG+ + SIFPASEW Y  RA  C   F IE
Sbjct  356   -TCFDLDDDSDPHDLGGWSWQACTEMIMPMGGNTEVSIFPASEWKYKYRAASCMRNFGIE  414

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP WITTEFGGH+I+RVLK++GSNIIFFNGLRDPWS GGVLKNISKS+VAI AKEGAHH
Sbjct  415   PRPLWITTEFGGHDIKRVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHH  474

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             VDLRF   EDP+WLK+VR++E+ II  WISQYYH L  L
Sbjct  475   VDLRFKNSEDPEWLKEVRKQEINIIGNWISQYYHDLAQL  513



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/482 (71%), Positives = 398/482 (83%), Gaps = 7/482 (1%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP+S +I+    L++ S +    + LY TK+FTQILDHF + PQSY  FQQRYLIND 
Sbjct  24    PRFPYS-VISPEQQLNSGSVQ----NGLYRTKFFTQILDHFNYNPQSYQKFQQRYLINDT  78

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YWGGAK  APIFVY GNEG+IEWFTQNTGFMF+ AP+FNALLVFIEHRFYGKS+PFGG+K
Sbjct  79    YWGGAKKKAPIFVYTGNEGNIEWFTQNTGFMFEQAPYFNALLVFIEHRFYGKSIPFGGKK  138

Query  1332  E-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYP  1156
             + A ++S TLGYLSS Q LADYATLIIDLKKNL+AT+SPVVVFGGSYGGMLAAWFR+KYP
Sbjct  139   KVAYANSSTLGYLSSAQALADYATLIIDLKKNLSATESPVVVFGGSYGGMLAAWFRMKYP  198

Query  1155  HVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGG  976
             HV IGALASSAPIL F+++ SPYAF ++ITQDFRSESENCYKVIKGSW LI++ A++ GG
Sbjct  199   HVAIGALASSAPILQFDDLVSPYAFDNIITQDFRSESENCYKVIKGSWNLIEETAKKHGG  258

Query  975   LERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDD  796
             LE LRKSF IC NYI V +LEGWL  A+ YTAMTDYPT TNFL+P+P YPV++MC+AID 
Sbjct  259   LELLRKSFKICNNYIGVDALEGWLGQAWIYTAMTDYPTPTNFLSPLPAYPVRKMCEAIDS  318

Query  795   PNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNK  616
                G + L KLY A +IYYNY+G  + CFDL   SDPH L GW WQAC+EMIMP G S+K
Sbjct  319   SVTGKNTLEKLYDAASIYYNYSG-TSKCFDLNDHSDPHDLGGWQWQACSEMIMPEGASSK  377

Query  615   DSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  436
             +SIFP S+W   +R  YCK A+ + PRPNWIT+EFGGHNIE VLK+   NIIFFNGLRDP
Sbjct  378   ESIFPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDP  437

Query  435   WSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
             WS GGVLKNISK+++AI AKEGAHHVDLR+STKEDPKWLKDVR++EV+II+ WISQY+  
Sbjct  438   WSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWISQYHQD  497

Query  255   LT  250
             L 
Sbjct  498   LA  499



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 401/487 (82%), Gaps = 9/487 (2%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP S +I     L+++S K    +KLY TK++TQILDHF + PQSY TFQQRYLIND 
Sbjct  31    PKFP-SPLIRPEQQLNSASVK----NKLYRTKFYTQILDHFNYNPQSYQTFQQRYLINDT  85

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YWGGAK  APIFVY GNEG+IEWFTQNTGFMF+ AP+FNALLVFIEHRFYGKS+PFGG K
Sbjct  86    YWGGAKKKAPIFVYTGNEGNIEWFTQNTGFMFEKAPYFNALLVFIEHRFYGKSMPFGGNK  145

Query  1332  E-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYP  1156
             + A ++S TLGYLSSTQ LADYATLIIDLK NL+ATDSPVVVFGGSYGGMLAAWFR+KY 
Sbjct  146   KVAYANSSTLGYLSSTQALADYATLIIDLKNNLSATDSPVVVFGGSYGGMLAAWFRMKYS  205

Query  1155  HVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGG  976
             HV IGALASSAPIL+F ++ SPY F++++TQDFRSESE+CY VIKGSW+LI++ A++ GG
Sbjct  206   HVAIGALASSAPILHFMDLVSPYVFTNIVTQDFRSESEHCYNVIKGSWKLIEETAKKHGG  265

Query  975   LERLRKSFNICKNY-ISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAID  799
             LE L+KSF IC N  I  G+LEGWL TA+ YTAMTDYPT +NFL+PMP YPVK+MC+AID
Sbjct  266   LELLKKSFRICNNNDIGAGALEGWLQTAWIYTAMTDYPTPSNFLSPMPAYPVKKMCEAID  325

Query  798   DP-NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGS  622
             +     +  L KLY+A NIYYNYTG    CFDL  +SDPH L GW WQACTEMIMPL  +
Sbjct  326   NSVTENNHTLGKLYAAANIYYNYTGTAK-CFDLYDNSDPHDLGGWQWQACTEMIMPLDSN  384

Query  621   NKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLR  442
             NK+SIFP SEW Y +R+ YCK  + + PRPNWIT+EFGGH+IE VLK+  SNIIFFNGLR
Sbjct  385   NKESIFPESEWSYKDRSSYCKFEYNVVPRPNWITSEFGGHDIEIVLKRSASNIIFFNGLR  444

Query  441   DPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             DPWS GGVLKNISKS+VA+  KEGAHHVDLRFSTKEDPKWLKDVRR+EV+II+ WISQY+
Sbjct  445   DPWSGGGVLKNISKSIVALVEKEGAHHVDLRFSTKEDPKWLKDVRRQEVKIIESWISQYH  504

Query  261   HSLTDLI  241
               L  +I
Sbjct  505   QDLATII  511



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/492 (70%), Positives = 392/492 (80%), Gaps = 8/492 (2%)
 Frame = -1

Query  1698  TTP-TFPFSTIIN----RPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQ  1534
             TTP  FP S II     + +    S +    N   Y  K+FTQILDHF + PQSYHTFQQ
Sbjct  3     TTPHGFPSSIIIQPAAEQQHDQQLSLSDKESNQIYYKEKFFTQILDHFNYNPQSYHTFQQ  62

Query  1533  RYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKS  1354
             RYLIND YWGG    +PIFVY GNEG I+WF QNTGFMF+ AP FNALLVFIEHR+YGKS
Sbjct  63    RYLINDEYWGGPTTNSPIFVYTGNEGRIDWFAQNTGFMFETAPRFNALLVFIEHRYYGKS  122

Query  1353  VPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAA  1177
             VPFGG KE A ++S TLGYLSS Q LADYA +I+DLK NLTA DSPVVVFGGSYGGMLAA
Sbjct  123   VPFGGNKETAYANSSTLGYLSSAQALADYAAVILDLKNNLTAADSPVVVFGGSYGGMLAA  182

Query  1176  WFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQD  997
             W RLKYPHV IGALASSAPIL F+NITS + F+++ITQDFRSESENCYKVIK SWQ I++
Sbjct  183   WLRLKYPHVAIGALASSAPILNFDNITSSFTFNNIITQDFRSESENCYKVIKRSWQEIEE  242

Query  996   IAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQ  817
              A + GGLE LRKSF ICKNY+S   LEGWL TAYTYTAMTDYPT TNFLNPMP YPVKQ
Sbjct  243   TAAKPGGLEILRKSFKICKNYMSTDYLEGWLGTAYTYTAMTDYPTPTNFLNPMPAYPVKQ  302

Query  816   MCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMI  640
             MCKAIDDP  G++   KLY+A +IYYNYTG    CF+L   SDPHG+  GW+WQACTEMI
Sbjct  303   MCKAIDDPKSGNNTFEKLYAAASIYYNYTGNA-KCFNLIDRSDPHGIRPGWNWQACTEMI  361

Query  639   MPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNII  460
             +   G+ +DSIFPAS + YN+R QYCK  + I+PRP WI TEFG  +I RVLK+FGSNII
Sbjct  362   LLTDGNTEDSIFPASNYSYNDRLQYCKSNYDIDPRPTWIPTEFGARHIHRVLKRFGSNII  421

Query  459   FFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQK  280
             FFNGLRDPWS GGVLK+ISKS+VAI AKEGAHHVDLRFST+EDP+WL++VR++EV II  
Sbjct  422   FFNGLRDPWSGGGVLKDISKSVVAIVAKEGAHHVDLRFSTREDPEWLREVRKREVHIISN  481

Query  279   WISQYYHSLTDL  244
             W+SQYYH+L D 
Sbjct  482   WLSQYYHTLADF  493



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 392/484 (81%), Gaps = 2/484 (0%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP   I    +   + S   + ++ LY+T+YFTQ+LDHF F P+SY TFQQRYLI
Sbjct  29    KIVPRFPSPVIHPESSQRPSISNDHSGSNGLYETRYFTQVLDHFGFRPESYQTFQQRYLI  88

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N  +WGG +  APIFVY GNEGDIEWFTQNTGFMF+ AP FNALLVFIEHRFYGKS+PFG
Sbjct  89    NSTFWGGPQRNAPIFVYTGNEGDIEWFTQNTGFMFETAPRFNALLVFIEHRFYGKSIPFG  148

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G KE A S+S TLGYLSSTQ LADYATLI DLKKN TA DSPVVVFGGSYGGMLAAWFRL
Sbjct  149   GNKEVAYSNSSTLGYLSSTQALADYATLITDLKKNWTAEDSPVVVFGGSYGGMLAAWFRL  208

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ IGAL+SS+PIL F+NITSPY+F+D+IT+DFRSESENCY+VIK SWQ I+D+AE+
Sbjct  209   KYPHIAIGALSSSSPILNFDNITSPYSFNDIITRDFRSESENCYQVIKQSWQKIEDMAEQ  268

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGL+ L KSF +CKN +  G L+GWL TA  YTAMTDYPT +NFLNP+P YPVKQMCKA
Sbjct  269   HGGLKILGKSFGLCKNSMDAGYLQGWLQTALIYTAMTDYPTPSNFLNPLPAYPVKQMCKA  328

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP+ G D  AKLY A NIYYNY+G V +CFDL   SDPHGL  W+WQACTEMI+P GG
Sbjct  329   IDDPSKGDDDFAKLYGAANIYYNYSGGV-SCFDLLDDSDPHGLGEWAWQACTEMILPTGG  387

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             + + SIFPA E++YN+R   C   F + PRP WI  EFGGH+I R L++FGSNIIFFNGL
Sbjct  388   NRETSIFPAHEYNYNDRVATCTSLFGVVPRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGL  447

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLK+ISKS+VAI A++GAHHVDLR+ST EDP+WL+DVR+KE++II  WISQY
Sbjct  448   RDPWSGGGVLKSISKSIVAIVAEKGAHHVDLRYSTNEDPEWLQDVRKKEIKIISGWISQY  507

Query  264   YHSL  253
             Y  L
Sbjct  508   YRDL  511



>ref|XP_004306148.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=795

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/472 (72%), Positives = 396/472 (84%), Gaps = 5/472 (1%)
 Frame = -1

Query  1650  LSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVY  1471
             L    + AA  ++LY TKYFTQILDHF + P+SY TFQQRYLIND +WGGAK+ APIFVY
Sbjct  326   LKEKVSLAARQNQLYRTKYFTQILDHFNYYPKSYDTFQQRYLINDTFWGGAKSNAPIFVY  385

Query  1470  MGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLS  1294
              GNEG IEWF QNTGF+++ APHF AL++FIEHRFYGKS+PFGG+K+ A S++ TLGYLS
Sbjct  386   TGNEGIIEWFAQNTGFLYETAPHFKALIIFIEHRFYGKSIPFGGKKDVAYSNATTLGYLS  445

Query  1293  STQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL  1114
             STQ LADYA+LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS+PIL
Sbjct  446   STQALADYASLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSSPIL  505

Query  1113  YFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNY  934
              FENITSPY+F++++T+DFRSES  CYKVIKGSWQ I++ A + GG+E LRKSF ICKN+
Sbjct  506   NFENITSPYSFNNIVTKDFRSES--CYKVIKGSWQQIEETANQPGGIELLRKSFRICKNH  563

Query  933   ISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA  754
              +   LEGWL TAY YTAMTDYPT +NFL+PMP YPVKQMCKAIDDP  G+D  AKL+ A
Sbjct  564   FTGYDLEGWLETAYIYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPATGNDTFAKLFGA  623

Query  753   VNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNER  574
               +YYNYTG    CFD   +SDPH L GW WQACTEMIMP  G+N++S+FP SEW Y  R
Sbjct  624   ATVYYNYTGTAT-CFDPNDNSDPHDLGGWQWQACTEMIMPTSGNNEESMFPPSEWRYQGR  682

Query  573   AQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSL  394
               YC+ A+ +EPRPNWITTEFGGH+I+RVL+++GSNIIFFNGLRDPWS GGVL NIS+S+
Sbjct  683   VSYCEGAYGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISESI  742

Query  393   VAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLT-DLI  241
             VAI AKEGAHHVDLRF T EDP+WLKDVR++E+ II KWIS+YYH L  DL+
Sbjct  743   VAIVAKEGAHHVDLRFKTSEDPEWLKDVRKQEIGIIAKWISEYYHDLALDLL  794



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/485 (69%), Positives = 396/485 (82%), Gaps = 7/485 (1%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S +  RP  L+       D  K Y TKY+TQILDHF + PQ Y TFQQRYLI
Sbjct  25    KIFPRFPSSNV--RPEQLA--QILKDDEVKPYKTKYYTQILDHFNYNPQGYQTFQQRYLI  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND YWGGAKN +PIFVYMGNEGDIEWF QNTGFMF+ APHF ALLVF+EHRFYGKS+P+G
Sbjct  81    NDTYWGGAKNNSPIFVYMGNEGDIEWFAQNTGFMFENAPHFKALLVFVEHRFYGKSIPYG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+KE A  ++ T GYLSSTQ LADYAT+I+DLKKNLTAT+SPVVVFGGSYGGMLAAWFRL
Sbjct  141   GDKEVAYKNATTQGYLSSTQALADYATIILDLKKNLTATESPVVVFGGSYGGMLAAWFRL  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASS+PIL F N+TSP++F++++TQDF+SESENCYKVIKGSW  I++ A++
Sbjct  201   KYPHVAIGALASSSPILNFGNLTSPFSFNNIVTQDFKSESENCYKVIKGSWAQIEETAQQ  260

Query  984   SGGLERLRKSFNICKNY-ISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GGLE+LR SFNICKN  IS   +E WLS AY YTAMTDYPT +NFLNP+P +PV+QMCK
Sbjct  261   KGGLEKLRSSFNICKNITISTEYVESWLSMAYIYTAMTDYPTPSNFLNPLPAFPVRQMCK  320

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
             AID+P  G+D  AKLY A NIYYNYTG V+ CFD+ + SD HGL  W+WQACTEMI+P  
Sbjct  321   AIDNPELGNDTFAKLYGAANIYYNYTGNVD-CFDITNDSDKHGLDEWTWQACTEMILPTD  379

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
             G+NK+SIFP S  DYN+R  YC   + ++PRP+WITTEFGG +I RVL+++ SNI+FFNG
Sbjct  380   GNNKESIFPTSNDDYNDRDLYCTSIYGVQPRPHWITTEFGGFDIHRVLRRYASNILFFNG  439

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
              RDPWS GGVLKNIS SLVAI AKEGAHHVDLR+ST+EDP WLK++R+ E+  I+KW+S+
Sbjct  440   RRDPWSGGGVLKNISSSLVAIVAKEGAHHVDLRYSTEEDPNWLKEIRKTEIHHIKKWLSR  499

Query  267   YYHSL  253
             YYH L
Sbjct  500   YYHDL  504



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 391/485 (81%), Gaps = 7/485 (1%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHK----LYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             TF F  I+ R    + S+     +H     LY TK+FTQILDHF F PQS HTFQQRYLI
Sbjct  22    TFAFVPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHTFQQRYLI  81

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F ALLVFIEHRFYGKS+PFG
Sbjct  82    NDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFG  141

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G K  A +++ TLGYLSSTQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFR+
Sbjct  142   GNKTVAYANTSTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRM  201

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL+F  + SP  F+++ITQDFRSESENCYKVIKGSW LI D A +
Sbjct  202   KYPHVAIGALASSAPILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDLIDDTANK  261

Query  984   SGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GG+E LRK+F ICK +    GSLEGWL  A+ YTAMTDYPT +NFLNP+P YPVK+MC+
Sbjct  262   PGGMELLRKTFRICKSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCE  321

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
             AID    G++ LAKL++A ++YYNYTG+   CFDL  +SDPH L GW WQACTEMIMP+G
Sbjct  322   AIDSSVTGNNRLAKLHAAASVYYNYTGKAR-CFDLDDNSDPHDLGGWQWQACTEMIMPVG  380

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
             GSNK+SIFP  EW Y  RA +C   + ++PRP+WITTEFGGH +ERVLK+  SNIIFFNG
Sbjct  381   GSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAVERVLKRSASNIIFFNG  440

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             LRDPWS GGVLK ISK+LVAI AK+GAHHVDLRFS+KEDP+WLKDVR+ EV II  WISQ
Sbjct  441   LRDPWSGGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQ  500

Query  267   YYHSL  253
             Y+  L
Sbjct  501   YHQDL  505



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/485 (70%), Positives = 391/485 (81%), Gaps = 7/485 (1%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHK----LYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             TF F  I+ R    + S+     +H     LY TK+FTQILDHF F PQS HTFQQRYLI
Sbjct  22    TFAFVPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHTFQQRYLI  81

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F ALLVFIEHRFYGKS+PFG
Sbjct  82    NDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFG  141

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G K  A +++ TLGYLSSTQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFR+
Sbjct  142   GNKTVAYANTSTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRM  201

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL+F  + SP  F+++ITQDFRSESENCYKVIKGSW LI D A +
Sbjct  202   KYPHVAIGALASSAPILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDLIDDTANK  261

Query  984   SGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GG+E LRK+F ICK +    GSLEGWL  A+ YTAMTDYPT +NFLNP+P YPVK+MC+
Sbjct  262   PGGMELLRKTFRICKSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCE  321

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
             AID    G++ LAKL++A ++YYNYTG+   CFDL  +SDPH L GW WQACTEMIMP+G
Sbjct  322   AIDSSVTGNNRLAKLHAAASVYYNYTGKAR-CFDLDDNSDPHDLGGWQWQACTEMIMPVG  380

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
             GSNK+SIFP  EW Y  RA +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNG
Sbjct  381   GSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNG  440

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             LRDPWS GGVLK ISK+LVAI AK+GAHHVDLRFS+KEDP+WLKDVR+ EV II  WISQ
Sbjct  441   LRDPWSGGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQ  500

Query  267   YYHSL  253
             Y+  L
Sbjct  501   YHQDL  505



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 390/485 (80%), Gaps = 7/485 (1%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHK----LYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             TF F+ I+ R    + S+     +H     LY TK+FTQILDHF F PQS HTFQQRYLI
Sbjct  21    TFAFAPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHTFQQRYLI  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F ALLVFIEHRFYGKS+PFG
Sbjct  81    NDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G K  A +++ TLGYLSSTQ LADYA LIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFR+
Sbjct  141   GNKTVAYANTSTLGYLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRM  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL+F  + SP  F  +ITQDFRSESENCYKVIKGSW LI D A +
Sbjct  201   KYPHVAIGALASSAPILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDLIDDTANK  260

Query  984   SGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GG+E LRK+F ICK +     SLEGWL  A+ YTAMTDYPT +NFLNP+P YPVK+MC+
Sbjct  261   PGGMELLRKTFRICKSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCE  320

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
             AID    G++ LAKLY+A N+YYNYTG+   CFDL  +SDPH L GW WQACTEMIMP+G
Sbjct  321   AIDSSVTGNNRLAKLYAAANVYYNYTGKAT-CFDLDDNSDPHDLGGWQWQACTEMIMPVG  379

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
             GSNK+SIFP  EW Y  RA +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNG
Sbjct  380   GSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNG  439

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             LRDPWSAGGVLK ISK++VAI AK+GAHHVDLR+S+KEDP+WLKDVR++EV II  WISQ
Sbjct  440   LRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQ  499

Query  267   YYHSL  253
             Y+  L
Sbjct  500   YHQDL  504



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/462 (71%), Positives = 390/462 (84%), Gaps = 3/462 (1%)
 Frame = -1

Query  1629  AADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
             +A  ++LY TKYFTQ+LDHF + P+SY TFQ RYLIND YWGGAK+ +PIFVY GNEG+I
Sbjct  51    SARQNQLYTTKYFTQVLDHFNY-PKSYETFQHRYLINDTYWGGAKSNSPIFVYTGNEGNI  109

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLAD  1273
             EWF +NTGF+++ APHF AL++FIEHRFYGKS+PFGG+K+ A S++ TLGYLSSTQ LAD
Sbjct  110   EWFAENTGFLYETAPHFKALIIFIEHRFYGKSLPFGGKKDVAYSNATTLGYLSSTQALAD  169

Query  1272  YATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITS  1093
             YA+LIIDLKKNLTATDSPVVV GGS+G MLAAWFRLKYPHVTIGALASS+PIL F NITS
Sbjct  170   YASLIIDLKKNLTATDSPVVVLGGSHGEMLAAWFRLKYPHVTIGALASSSPILNFNNITS  229

Query  1092  PYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLE  913
             P +F+++IT+DF SESE+CYKVIKGSWQ I+D A++ GGLE L+KSF +CKN ISV  L+
Sbjct  230   PESFNNIITKDFMSESESCYKVIKGSWQQIKDTAKQHGGLELLQKSFKLCKNIISVDDLQ  289

Query  912   GWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNY  733
              WL +A+ YTAMTDYPT +NF+ P+P YPVKQMCKAID+P  G+D  AKLY AV +YYNY
Sbjct  290   NWLESAFIYTAMTDYPTPSNFMTPVPAYPVKQMCKAIDNPATGNDTFAKLYGAVTVYYNY  349

Query  732   TGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEA  553
             +G    CFD   +SDPH L GW WQACTEMIM   G++K+SIFP SE  Y ++  YCKEA
Sbjct  350   SG-TTTCFDPDDNSDPHDLGGWDWQACTEMIMQTNGNDKESIFPPSESQYKDQVSYCKEA  408

Query  552   FKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKE  373
             + +EPRPNWITTEFGGH+I+RVL+++GSNIIFFNGLRDPWS GGVL NISK +VAI AKE
Sbjct  409   YGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISKRIVAIVAKE  468

Query  372   GAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             GAHHVDLRF T EDP+WLKDVR++EV+II KWIS+YYH L D
Sbjct  469   GAHHVDLRFKTNEDPEWLKDVRKQEVKIIAKWISEYYHDLAD  510



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/490 (71%), Positives = 393/490 (80%), Gaps = 24/490 (5%)
 Frame = -1

Query  1764  KTMKTRIIL----LffffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTK  1597
             K M T  IL    LF      FS AK TP FP S +  RP  LS SS       +LY+ K
Sbjct  2     KKMATTFILPCIFLFSISSSGFSAAKITPRFPSSIV--RPEQLSVSSQT-----ELYEAK  54

Query  1596  YFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMF  1417
             YFTQILDHF + PQSY TFQQRYLIND+YWGGA  +APIFVY GNEGDIEWF QNTGFMF
Sbjct  55    YFTQILDHFNYQPQSYRTFQQRYLINDKYWGGADKLAPIFVYTGNEGDIEWFAQNTGFMF  114

Query  1416  DIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKN  1240
             D APHF ALLVFIEHRFYGKS+PFGG+   A S++ TLGYLSSTQ LADYATLIIDLKKN
Sbjct  115   DTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNASTLGYLSSTQALADYATLIIDLKKN  174

Query  1239  LTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQD  1060
             L+AT+SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL FENITSPY F+++ITQD
Sbjct  175   LSATNSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFENITSPYTFNNIITQD  234

Query  1059  FRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTA  880
             F           +GSW+ I++ A ++GGLE LRKSF ICKNYIS G++E WLSTAY YTA
Sbjct  235   F-----------QGSWEQIEETAMKNGGLEVLRKSFRICKNYISGGAIENWLSTAYVYTA  283

Query  879   MTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLA  700
             MTDYPT +NFL+PMP YPVKQMCKAIDDP  G+D  AKLY A N+YYNYTG    CFDLA
Sbjct  284   MTDYPTPSNFLSPMPAYPVKQMCKAIDDPAXGNDTFAKLYGAANVYYNYTGTAA-CFDLA  342

Query  699   SSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWIT  520
               SDPHGL  W+WQACTEMIMP+  +N++SIFP S W+Y+ RA +CK AF IEPRPNWIT
Sbjct  343   DDSDPHGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEPRPNWIT  402

Query  519   TEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFST  340
             TEFGGH+I+RVLK+FGSNIIFFNGLRDPWS GGVL++ISKS+VAI AK+GAHHVDLRF+T
Sbjct  403   TEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIVAIVAKDGAHHVDLRFAT  462

Query  339   KEDPKWLKDV  310
              EDP+WL++ 
Sbjct  463   SEDPEWLQBA  472



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/454 (71%), Positives = 383/454 (84%), Gaps = 7/454 (2%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY TK+FTQILDHF + PQSY TFQQRYLIND YWGGAK  APIFVYMGNEGDI+WF QN
Sbjct  51    LYRTKFFTQILDHFNYNPQSYQTFQQRYLINDTYWGGAKKKAPIFVYMGNEGDIQWFAQN  110

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLII  1255
             TGFMF+IAP+FNA+LVFIEHR+YGKS+PFGG  E A  +S TLGY+SSTQ LADYATLII
Sbjct  111   TGFMFEIAPYFNAILVFIEHRYYGKSIPFGGNDEVANKTSSTLGYMSSTQALADYATLII  170

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
             DLKKNL+ATDSPVVVFGGSYGGMLAAWFR+KYPHV IGALASSAPIL F ++ SPY F++
Sbjct  171   DLKKNLSATDSPVVVFGGSYGGMLAAWFRMKYPHVAIGALASSAPILQFLDLVSPYTFTN  230

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             ++TQD++SESENCYKVIKGSW+ I D A   GG+E+L+KSF +C N IS G L+ WL TA
Sbjct  231   IVTQDYKSESENCYKVIKGSWKEIDDTANTPGGIEQLQKSFRLCNNNISAGDLKNWLQTA  290

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
               YTAMTDYPT +NF+ P+P YPVK+MC+AID  + G++   KLY+A NI+YNY+G V  
Sbjct  291   LMYTAMTDYPTPSNFVTPLPAYPVKKMCEAIDSKSSGNETFTKLYAAANIFYNYSGSV-I  349

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CFD+++ S      GW WQ+CTEMIMPLGG+N++SIFPA +W+  E   YCK+ + I+PR
Sbjct  350   CFDISNDS-----GGWDWQSCTEMIMPLGGNNEESIFPAHKWELEETLSYCKQTYHIDPR  404

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITTEFGGH+I RVLK++GSNIIFFNGLRDPWS GGVLKNISK+L+AI AKEGAHHVD
Sbjct  405   PHWITTEFGGHDIGRVLKRYGSNIIFFNGLRDPWSGGGVLKNISKTLIAIVAKEGAHHVD  464

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             LRFSTKEDP+WLKDVR++EV+II  WISQYY  L
Sbjct  465   LRFSTKEDPEWLKDVRKQEVKIITSWISQYYQDL  498



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/485 (70%), Positives = 388/485 (80%), Gaps = 9/485 (2%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHK----LYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             TF F+ I+ R    + S+     +H     LY TK+FTQILDHF F PQS HTFQQRYLI
Sbjct  21    TFAFAPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHTFQQRYLI  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F ALLVFIEHRFYGKS+PFG
Sbjct  81    NDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFG  140

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G K  A +++ TLGYLSSTQ LADYA LIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFR+
Sbjct  141   GNKTVAYANTSTLGYLSSTQALADYAALIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRM  200

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL+F  + SP  F  +ITQDFRSESENCYKVIKGSW LI D A +
Sbjct  201   KYPHVAIGALASSAPILHFMGMVSPDIFISIITQDFRSESENCYKVIKGSWDLIDDTANK  260

Query  984   SGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GG+E LRK+F ICK +     SLEGWL  A+ YTAMTDYPT +NFL  +P YPVK+MC+
Sbjct  261   PGGMELLRKTFRICKSDDFGPDSLEGWLRAAWIYTAMTDYPTPSNFL--LPAYPVKKMCE  318

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
             AID    G++ LAKLY+A N+YYNYTG+   CFDL  +SDPH L GW WQACTEMIMP+G
Sbjct  319   AIDSSVTGNNRLAKLYAAANVYYNYTGKAT-CFDLDDNSDPHDLGGWQWQACTEMIMPVG  377

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
             GSNK+SIFP  EW Y  RA +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNG
Sbjct  378   GSNKESIFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNG  437

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             LRDPWSAGGVLK ISK++VAI AK+GAHHVDLR+S+KEDP+WLKDVR++EV II  WISQ
Sbjct  438   LRDPWSAGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQ  497

Query  267   YYHSL  253
             Y+  L
Sbjct  498   YHQDL  502



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 383/484 (79%), Gaps = 3/484 (1%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S +I+  N   + S   + N+ LY T+YFTQILDHF++ P+SY TFQQRYLI
Sbjct  32    KIIPRFP-SPLIHPENSQPSLSNDQSGNNGLYKTRYFTQILDHFSYRPESYQTFQQRYLI  90

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N  +WGG +  APIFVY GNEGDIEWF QNTGFMF+ APHFNALLVFIEHR+YGKS+PFG
Sbjct  91    NSTFWGGPRRNAPIFVYTGNEGDIEWFAQNTGFMFETAPHFNALLVFIEHRYYGKSMPFG  150

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+KE A S++  LGYLSSTQ LADYATLI DLKKNLTA  SPVVVFGGSYG +  +WFRL
Sbjct  151   GKKEVAYSNASMLGYLSSTQALADYATLITDLKKNLTAEHSPVVVFGGSYGEVCCSWFRL  210

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ IGAL+SSAPIL F N+TSPY F+D+IT+DFRSES+NCYKVIK SWQ I+ +A++
Sbjct  211   KYPHIAIGALSSSAPILDFFNVTSPYIFNDIITRDFRSESKNCYKVIKRSWQKIEVMAKQ  270

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGLE LRKSF +CKN+     L GWL TA  Y AMTDYPT +NFL P+P YP+KQMCKA
Sbjct  271   QGGLEILRKSFRLCKNFKDAEYLTGWLETALVYAAMTDYPTPSNFLTPLPAYPIKQMCKA  330

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP+ G D  AKLY A NIYYNY+G + +CFDL   SDPHGLSGW WQACTEM+MP+ G
Sbjct  331   IDDPSKGDDDFAKLYGAANIYYNYSGGI-SCFDLMDDSDPHGLSGWGWQACTEMVMPIDG  389

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             + + SIFPA +++Y +    C     +  RP WI  EFGGH+I R L++FGSNIIFFNGL
Sbjct  390   NRETSIFPAYKYNYTDTISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGL  449

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLK+ISKS+VAI A++GAHHVDLR+ST EDP+WL+DVR+KE++II  WISQY
Sbjct  450   RDPWSGGGVLKSISKSIVAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQY  509

Query  264   YHSL  253
             Y  L
Sbjct  510   YRDL  513



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/484 (66%), Positives = 383/484 (79%), Gaps = 8/484 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             KT P FP ST+     G +     +     LY  K+ TQILDHF + PQSY TFQQRYL+
Sbjct  14    KTPPVFP-STLAQLRRGAAGDGGPS-----LYTEKFCTQILDHFNYNPQSYRTFQQRYLV  67

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGA   +PIFVY GNEGDIEWF +NTGFM++IAP F AL+VFIEHRFYGKS+P+G
Sbjct  68    NDTHWGGAAAGSPIFVYTGNEGDIEWFAKNTGFMYEIAPIFKALIVFIEHRFYGKSIPYG  127

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G +  A S+S TLGYL++TQ LADYAT+I+ LKKNLT+ +SPV+VFGGSYGGMLAAWFRL
Sbjct  128   GNRTVAYSNSSTLGYLTATQALADYATVILSLKKNLTSENSPVIVFGGSYGGMLAAWFRL  187

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV  GAL+SSAPIL F+NITS ++F+D++TQDFRSESENCYKVIK SWQ I D A +
Sbjct  188   KYPHVAAGALSSSAPILNFDNITSQFSFNDIVTQDFRSESENCYKVIKKSWQEIDDTAVK  247

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGLE LRK F ICKN+IS  SL  WLSTA  YTAMTDYPT ++FL P+P +PVKQMC+A
Sbjct  248   PGGLEILRKHFRICKNHISAASLHSWLSTALIYTAMTDYPTPSDFLAPLPAHPVKQMCEA  307

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+   AK+Y A N+YYNY+G    CFDLA  SDPHG++GW WQACTEMI+   G
Sbjct  308   IDDPTTGNSTFAKMYGAANVYYNYSGNA-TCFDLADDSDPHGVNGWYWQACTEMILITDG  366

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             + ++SIF AS + YN+R +YCK+ + +EPRPNW  TEFG HNI+R LK FGS+IIFFNGL
Sbjct  367   NREESIFTASNYSYNDRREYCKDKYGVEPRPNWAPTEFGAHNIKRALKNFGSSIIFFNGL  426

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLKN+S+SLVAI AKEGAHHVDLRFSTKEDPKWL DVR++E EII  W+S Y
Sbjct  427   RDPWSGGGVLKNLSESLVAIVAKEGAHHVDLRFSTKEDPKWLVDVRKRETEIISTWLSHY  486

Query  264   YHSL  253
             +  +
Sbjct  487   HSDI  490



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/488 (69%), Positives = 390/488 (80%), Gaps = 9/488 (2%)
 Frame = -1

Query  1698  TTPTFPFSTIINR-PNGLSASSAKAADN---HKLYDTKYFTQILDHFTFTPQSYHTFQQR  1531
             T+ TF  S I+ R P+   ++  K + N   + LY TK+FTQILDHF F PQS H FQQR
Sbjct  18    TSSTFALSPILPRFPSSAVSAELKQSSNSAPNSLYRTKFFTQILDHFNFNPQSNHVFQQR  77

Query  1530  YLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSV  1351
             YLIND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F+ALLVFIEHRFYGKS+
Sbjct  78    YLINDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFHALLVFIEHRFYGKSI  137

Query  1350  PFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAW  1174
             PFGG ++ A +++ TLGYLSSTQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAW
Sbjct  138   PFGGNRKVAYANASTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAW  197

Query  1173  FRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDI  994
             FR+KYPHV IGALASSAPIL+F ++ SP  F+++I+QDFRSESENCYKV+KGSW+LI D 
Sbjct  198   FRMKYPHVAIGALASSAPILHFMDLVSPDIFNNIISQDFRSESENCYKVLKGSWKLIDDT  257

Query  993   AEESGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQ  817
             A + GGL+ L+KSF ICK N    G LE WL TA+ YTAMTDYPT +NFL+P+P YP+K+
Sbjct  258   ANKPGGLQLLQKSFRICKSNDFGPGFLENWLRTAWVYTAMTDYPTPSNFLSPLPAYPIKK  317

Query  816   MCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIM  637
             MC+AID     +D L KLY+A ++YYNYTG    CFDL   SDPH L GW WQACTEMIM
Sbjct  318   MCEAID--REKNDGLGKLYAAASVYYNYTGTAT-CFDLDDDSDPHDLGGWQWQACTEMIM  374

Query  636   PLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIF  457
             P+GGSNK SIFP   W Y +RA  C+  + + PRP+WITTEFGGH I+ VLK+  SNIIF
Sbjct  375   PVGGSNKHSIFPEYVWSYQDRASACQFFYNVTPRPHWITTEFGGHAIQTVLKRSASNIIF  434

Query  456   FNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKW  277
             FNGLRDPWS GGVLKNISK++VAI  K GAHHVDLR+S KEDPKWLKDVRR+EV II  W
Sbjct  435   FNGLRDPWSGGGVLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWLKDVRRQEVNIIASW  494

Query  276   ISQYYHSL  253
             ISQYY  L
Sbjct  495   ISQYYQDL  502



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 372/467 (80%), Gaps = 7/467 (1%)
 Frame = -1

Query  1650  LSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVY  1471
             L  +    + N+ LY T+YFTQILDHF++ P+SY TFQQRYLIN  +WGG +  APIFVY
Sbjct  3     LKVAQMDISGNNGLYKTRYFTQILDHFSYRPESYQTFQQRYLINSTFWGGPRRNAPIFVY  62

Query  1470  MGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLS  1294
              GNEGDIEWF QNTGFMF+ APHFNALLVFIEHR+YGKS+PFGG+KE A S++  LGYLS
Sbjct  63    TGNEGDIEWFAQNTGFMFETAPHFNALLVFIEHRYYGKSMPFGGKKEVAYSNASMLGYLS  122

Query  1293  STQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL  1114
             STQ LADYATLI DLKKNLTA  SPVVVFGG     LAAWFRLKYPH+ IGAL+SSAPIL
Sbjct  123   STQALADYATLITDLKKNLTAEHSPVVVFGG-----LAAWFRLKYPHIAIGALSSSAPIL  177

Query  1113  YFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNY  934
              F N+TSPY F+D+IT+DFRSES+NCYKVIK SWQ I+ +A++ GGLE LRKSF +CKN+
Sbjct  178   DFFNVTSPYIFNDIITRDFRSESKNCYKVIKRSWQKIEVMAKQQGGLEILRKSFRLCKNF  237

Query  933   ISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA  754
                  L GWL TA  Y AMTDYPT +NFL P+P YP+KQMCKAIDDP+ G D  AKLY A
Sbjct  238   KDAEYLTGWLETALVYAAMTDYPTPSNFLTPLPAYPIKQMCKAIDDPSKGDDDFAKLYGA  297

Query  753   VNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNER  574
              NIYYNY+G + +CFDL   SDPHGLSGW WQACTEM+MP+ G+ + SIFPA +++Y + 
Sbjct  298   ANIYYNYSGGI-SCFDLMDDSDPHGLSGWGWQACTEMVMPIDGNRETSIFPAYKYNYTDT  356

Query  573   AQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSL  394
                C     +  RP WI  EFGGH+I R L++FGSNIIFFNGLRDPWS GGVLK+ISKS+
Sbjct  357   ISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSGGGVLKSISKSI  416

Query  393   VAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             VAI A++GAHHVDLR+ST EDP+WL+DVR+KE++II  WISQYY  L
Sbjct  417   VAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQYYRDL  463



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/453 (71%), Positives = 366/453 (81%), Gaps = 3/453 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y T +FTQILDHF F PQSY +FQQRYLIND YWGGA + +PIFVY GNEG+IEWF QNT
Sbjct  49    YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIID  1252
             GF+   APHF AL+VFIEHRFYGKS+PFGG+++ A S+S  LGYLSSTQ LADYATLI D
Sbjct  109   GFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSSMLGYLSSTQALADYATLITD  168

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LKKNL+A DSPV+VFGGSYGGMLAAWFRLKYPH+ +GALASSAPIL  ENITSPYAF+++
Sbjct  169   LKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIALGALASSAPILQLENITSPYAFNNI  228

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +TQDF+SES+NCY VIK SW LI   +    G + LRKSF  CK      S++ WLSTA 
Sbjct  229   VTQDFKSESQNCYSVIKESWHLIDITSTHPQGPQLLRKSFKFCKE-AEAESIKNWLSTAI  287

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              YTAMTDYPT +NFLNP+P YPVKQMCKAIDDP  G+D   KLY A NIYYN+TG V  C
Sbjct  288   IYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPRSGNDSFTKLYGAANIYYNFTGTVT-C  346

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL   SDPH L  WSWQACTEMI+P GG+ K+SIFPAS W + +R Q+CK  F +EPR 
Sbjct  347   FDLDDDSDPHDLGDWSWQACTEMILPTGGNTKESIFPASTWHFADRFQFCKTFFDVEPRR  406

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS GGVLKNIS +++AI AKEGAHHVDL
Sbjct  407   IWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISSTIIAIVAKEGAHHVDL  466

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             RFS  +DPKWLKDVR++EV II+ W+SQYY  L
Sbjct  467   RFSNPDDPKWLKDVRKQEVNIIEDWLSQYYLDL  499



>ref|XP_004167790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=501

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/453 (70%), Positives = 366/453 (81%), Gaps = 4/453 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y T +FTQILDHF F PQSY +FQQRYLIND YWGGA + +PIFVY GNEG+IEWF QNT
Sbjct  49    YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIID  1252
             GF+   APHF AL+VFIEHRFYGKS+PFGG+++ A S+S  LGYLSSTQ LADYATLI D
Sbjct  109   GFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSSMLGYLSSTQALADYATLITD  168

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LKKNL+A DSPV+VFGGSYGGMLAAWFRLKYPH+ +GALASSAPIL  ENITSPYAF+++
Sbjct  169   LKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIALGALASSAPILQLENITSPYAFNNI  228

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +TQDF+SES+NCY VIK SW LI   +    G + LRKSF I +      S++ WLSTA 
Sbjct  229   VTQDFKSESQNCYSVIKESWHLIDITSTHPQGPQLLRKSFQILE--AEAESIKNWLSTAI  286

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              YTAMTDYPT +NFLNP+P YPVKQMCKAIDDP  G+D   KLY A NIYYN+TG V  C
Sbjct  287   IYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPRSGNDSFTKLYGAANIYYNFTGTVT-C  345

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL   SDPH L  WSWQACTEMI+P GG+ K+SIFPAS W + +R Q+CK  F +EPR 
Sbjct  346   FDLDDDSDPHDLGDWSWQACTEMILPTGGNTKESIFPASTWHFADRFQFCKTFFDVEPRR  405

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS GGVLKNIS +++AI AKEGAHHVDL
Sbjct  406   IWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISSTIIAIVAKEGAHHVDL  465

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             RFS  +DPKWLKDVR++EV II+ W+SQYY  L
Sbjct  466   RFSNPDDPKWLKDVRKQEVNIIEDWLSQYYLDL  498



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/453 (70%), Positives = 366/453 (81%), Gaps = 3/453 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y T +FTQILDHF F PQSY  FQQRYLIND YWGGA + +PIFVY GNEG+IEWF QNT
Sbjct  49    YQTGFFTQILDHFNFNPQSYQYFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIID  1252
             GF+   AP F AL+VFIEHRFYGKS+PFGG+++ A S+S TLG+LSSTQ LADYATLI D
Sbjct  109   GFLLQSAPRFRALVVFIEHRFYGKSIPFGGDEDVANSNSSTLGFLSSTQALADYATLITD  168

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LKKNL+A DSPV+VFGGSYGGMLAAWFRLKYPH+ +GALASSAPIL FENITSPYAFS++
Sbjct  169   LKKNLSAVDSPVLVFGGSYGGMLAAWFRLKYPHIAMGALASSAPILQFENITSPYAFSNI  228

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +TQDF+SES+NCY+VIK SW LI   +    G + LRKSF  CK      S++ WLSTA 
Sbjct  229   VTQDFKSESQNCYRVIKESWHLIDITSTHPQGPQLLRKSFKFCKE-AEAESIKNWLSTAI  287

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              YTAMTDYPT +NFLNP+P YPVKQMCKAIDD   G+D  AKLY A N+YYNYTG    C
Sbjct  288   LYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDSRTGNDTFAKLYGAANVYYNYTGTAT-C  346

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL   SDPH L  W+WQACTEMI+P GG+ K+SIFPAS W + +R  +CK  F +EPR 
Sbjct  347   FDLDDDSDPHDLGDWTWQACTEMILPTGGNTKESIFPASTWHFADRLHFCKTFFDVEPRR  406

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS GGVLKNIS +++AI AKEGAHHVDL
Sbjct  407   IWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISSTIIAIVAKEGAHHVDL  466

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             RFS+ EDPKWLKDVR++E+ II+ W+SQYY  L
Sbjct  467   RFSSAEDPKWLKDVRQQELSIIEDWLSQYYLDL  499



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 375/468 (80%), Gaps = 7/468 (1%)
 Frame = -1

Query  1659  PNGLSASSAKAADNHK-LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP  1483
             P  L A   +++D+ + LY+T+YFTQ LDHF FTPQSY TFQQRYL+ND +WGG    AP
Sbjct  33    PAFLKAGLKQSSDSGRGLYETRYFTQGLDHFDFTPQSYGTFQQRYLVNDTHWGGKG--AP  90

Query  1482  IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLG  1303
             IFVY GNEGDI WF QNTGFM++IAP+F ALLVFIEHR+YG+S+PFGGE+ A S++ TLG
Sbjct  91    IFVYTGNEGDIGWFAQNTGFMYEIAPYFRALLVFIEHRYYGESMPFGGEEVAYSNATTLG  150

Query  1302  YLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  1123
             YLSSTQ LADYATLIIDLKKNL++  SPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA
Sbjct  151   YLSSTQALADYATLIIDLKKNLSSEGSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  210

Query  1122  PILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC  943
             PIL F+++ SPY F D++T+DFRSESENCYKVIK SW+ I+D A + GGLE++ KSF +C
Sbjct  211   PILQFDDLVSPYTFDDIVTKDFRSESENCYKVIKNSWKEIEDTASQPGGLEKIEKSFKLC  270

Query  942   KNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKL  763
             K       +E W+  A  YTAMTDYPTA+NFL P+P YPVKQMCKAID+P  G+D  A+L
Sbjct  271   KG--QGQGVENWIGIAIVYTAMTDYPTASNFLVPLPAYPVKQMCKAIDNPTAGNDTFARL  328

Query  762   YSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGGSNKDSIFPASEWD  586
             Y A+NIYYNY+G    C      SD HG++ GWSWQ+CTEM +  GGSN +SI P + ++
Sbjct  329   YGAMNIYYNYSG-TETCLAAGGDSDEHGMARGWSWQSCTEMTIVEGGSNNESILPPATYN  387

Query  585   YNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNI  406
             Y E+A  C+  + + PRP+WITTEFGGH+I RVLK+FGSNIIFFNGLRDPWS GGVLK++
Sbjct  388   YTEQAVACQNYYGVAPRPHWITTEFGGHDIRRVLKRFGSNIIFFNGLRDPWSGGGVLKSL  447

Query  405   SKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             S SL+AI A EGAHHVDLRFSTKEDPKWLK VR KE +II  W+ QYY
Sbjct  448   SNSLIAIVAPEGAHHVDLRFSTKEDPKWLKTVRTKENKIIAGWLEQYY  495



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/481 (65%), Positives = 382/481 (79%), Gaps = 13/481 (3%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP    IN   GL  SS  +     LY+T++FTQILDHF +TP+SY TFQQRYL+
Sbjct  27    KRYPFFP--GFINA--GLKQSSEYSGGG--LYETRFFTQILDHFDYTPRSYETFQQRYLV  80

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGG    APIFVY GNEG+I WF +NTGFM++IAPHF ALLVFIEHR+YG+S+PFG
Sbjct  81    NDTHWGGKG--APIFVYTGNEGEIGWFARNTGFMYEIAPHFKALLVFIEHRYYGESIPFG  138

Query  1341  GEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLK  1162
             G++ A S++ TLGYLS+TQ LADYATLIIDLKKNL++  SPVVVFGGSYGGMLAAWFRLK
Sbjct  139   GKEIAYSNATTLGYLSTTQALADYATLIIDLKKNLSSEGSPVVVFGGSYGGMLAAWFRLK  198

Query  1161  YPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEES  982
             YPH+TIGALASSAPIL F+++ SPY F D+IT+DFRSESENCYKVIK SW+ I+D A + 
Sbjct  199   YPHITIGALASSAPILQFDDMVSPYTFYDIITKDFRSESENCYKVIKNSWKEIEDTASQP  258

Query  981   GGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAI  802
             GGL+R+ KSF +C+    +  +E W+S+A  Y AMTDYPTA+NFL P+P YPVKQMCKAI
Sbjct  259   GGLDRIEKSFKLCEGEGEL--VEDWISSAIVYAAMTDYPTASNFLAPLPAYPVKQMCKAI  316

Query  801   DDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGG  625
             ++P  G+D   +LY A+NIYYNY+G    CF +   SD HG+  GW WQ+C EMI+P G 
Sbjct  317   NNPTAGNDTFTRLYGAMNIYYNYSG-TETCF-VTVGSDEHGMDDGWEWQSCMEMILPTGA  374

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             SN +SIFP S ++Y ++A  C+E + + PRP+WITTEFGGH+I RVLK+ GSNIIFFNGL
Sbjct  375   SNNESIFPPSTYNYTDQAVGCQEYYYVAPRPHWITTEFGGHDIRRVLKRSGSNIIFFNGL  434

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLK++SKSL+AI   EGAHHVDLRFSTKEDPKWLK VR KEV+II +W+ QY
Sbjct  435   RDPWSGGGVLKSLSKSLIAIVEPEGAHHVDLRFSTKEDPKWLKAVRMKEVKIISRWLEQY  494

Query  264   Y  262
             Y
Sbjct  495   Y  495



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/483 (66%), Positives = 389/483 (81%), Gaps = 9/483 (2%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP S++++    ++  SA+    + LY  K+FTQ LDHF + PQSY TFQQRYLIND 
Sbjct  29    PRFP-SSMLHPALDVNLLSAQ----NGLYTAKFFTQTLDHFNYNPQSYQTFQQRYLINDT  83

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YWGGAKN APIFVYMGNEGDIEWF QNTGFMF+ AP+F ALLVFIEHR+YGKS PFGG +
Sbjct  84    YWGGAKNNAPIFVYMGNEGDIEWFAQNTGFMFETAPYFKALLVFIEHRYYGKSFPFGGNE  143

Query  1332  E-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYP  1156
             E A +++ T+GY+SSTQ LADYATLIIDLK NL+ATDSPVVV GGSYGGMLAAWFR+KYP
Sbjct  144   EVADANTTTVGYMSSTQALADYATLIIDLKNNLSATDSPVVVVGGSYGGMLAAWFRMKYP  203

Query  1155  HVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGG  976
             HV IGALASSAPIL F ++ SPY ++D+ITQD++SESENCYKVIKGSW+ I+D A++ GG
Sbjct  204   HVAIGALASSAPILQFLDLVSPYTYTDIITQDYKSESENCYKVIKGSWKQIEDTAQKPGG  263

Query  975   LERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDD  796
             LE+LRKSF ICK+YIS G+L  WL  A    AMTDYPT + FL P+P YPV++MC+AID+
Sbjct  264   LEQLRKSFRICKHYISAGALVYWLQMALGSAAMTDYPTPSVFLAPLPAYPVRKMCEAIDN  323

Query  795   PNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNK  616
              +  ++   KLY+A NI+YNYTG    CF L +++ P  L GW WQACTE+IMPLG +N+
Sbjct  324   LSAVNETFTKLYAAANIFYNYTGTA-TCFFLDNTTAP--LGGWDWQACTELIMPLGANNE  380

Query  615   DSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  436
              S+FP  +W   +   YCK  + I+PRP+WITTEFGGH+I+RVLK+ GSNIIFFNGLRDP
Sbjct  381   GSMFPPYKWKLRDVEFYCKRVYHIQPRPHWITTEFGGHDIKRVLKRSGSNIIFFNGLRDP  440

Query  435   WSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
             WS GGVLKNIS+++VAI AKEGAHHVDLRFST EDP+WLKD+R++E++II  WISQYY  
Sbjct  441   WSGGGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREIKIIANWISQYYQD  500

Query  255   LTD  247
             L +
Sbjct  501   LLN  503



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/480 (62%), Positives = 377/480 (79%), Gaps = 4/480 (1%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P+ PF + + +P  L  + + +++    Y+ KYFTQ LDHF + P  Y TFQQRYLIN +
Sbjct  41    PSPPFPSSLIKPELLKPTISYSSEK-VYYEIKYFTQTLDHFNYVPWGYETFQQRYLINSK  99

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YWGG  + APIFVY GNEGD+EWF QNTGFMF+ AP+F ALLVFIEHR+YG+S+P+G E+
Sbjct  100   YWGGPIDKAPIFVYTGNEGDVEWFAQNTGFMFENAPYFKALLVFIEHRYYGESIPYGSEE  159

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
              A  ++ T GYLSS Q LADYA LIIDLKKNL+A DSPVVV GGSYGGMLA WFRLKYPH
Sbjct  160   IAYKNASTHGYLSSAQALADYAMLIIDLKKNLSAEDSPVVVMGGSYGGMLATWFRLKYPH  219

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             V IGALASSAPIL F +ITSPY+F++++T+DFRSESENCYKVIK SWQ I + A++ GGL
Sbjct  220   VCIGALASSAPILNFADITSPYSFNNIVTEDFRSESENCYKVIKNSWQKIHETAQQPGGL  279

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
             E LRKSF IC NYIS  SL  WL  A+ YTAMTDYP  ++FL P+P +P++QMCKA+DD 
Sbjct  280   EELRKSFRICPNYISEDSLTNWLERAFIYTAMTDYPVPSSFLAPLPAFPIEQMCKAVDDA  339

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
               G +    +Y A NI+YNYTG+ + CF+L+ +SD HGL+GW +QACTEM++  GG  ++
Sbjct  340   --GDEQFKGIYEAANIFYNYTGD-SMCFNLSDNSDRHGLNGWGFQACTEMLLATGGRTQE  396

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             SIFP   ++Y +  +YC++++ I PRP+WITT FGGH+I+RVLK+FGSNIIFFNGLRDPW
Sbjct  397   SIFPPYTYNYTQTQEYCQQSYGINPRPHWITTHFGGHDIKRVLKRFGSNIIFFNGLRDPW  456

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S GGVL+N+S S+VA+ AKEGAHH+DLRFST+ DP WL +VR++E+ I+  W+ QYY  +
Sbjct  457   SGGGVLENLSDSIVALVAKEGAHHIDLRFSTEGDPMWLSEVRKREIHILSMWLEQYYKDI  516



>gb|KCW90505.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=466

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/424 (69%), Positives = 339/424 (80%), Gaps = 2/424 (0%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP   I    +   + S   + ++ LY+T+YFTQ+LDHF F P+SY TFQQRYLI
Sbjct  29    KIVPRFPSPVIHPESSQRPSISNDHSGSNGLYETRYFTQVLDHFGFRPESYQTFQQRYLI  88

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N  +WGG +  APIFVY GNEGDIEWFTQNTGFMF+ AP FNALLVFIEHRFYGKS+PFG
Sbjct  89    NSTFWGGPQRNAPIFVYTGNEGDIEWFTQNTGFMFETAPRFNALLVFIEHRFYGKSIPFG  148

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G KE A S+S TLGYLSSTQ LADYATLI DLKKN TA DSPVVVFGGSYGGMLAAWFRL
Sbjct  149   GNKEVAYSNSSTLGYLSSTQALADYATLITDLKKNWTAEDSPVVVFGGSYGGMLAAWFRL  208

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ IGAL+SS+PIL F+NITSPY+F+D+IT+DFRSESENCY+VIK SWQ I+D+AE+
Sbjct  209   KYPHIAIGALSSSSPILNFDNITSPYSFNDIITRDFRSESENCYQVIKQSWQKIEDMAEQ  268

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
              GGL+ L KSF +CKN +  G L+GWL TA  YTAMTDYPT +NFLNP+P YPVKQMCKA
Sbjct  269   HGGLKILGKSFGLCKNSMDAGYLQGWLQTALIYTAMTDYPTPSNFLNPLPAYPVKQMCKA  328

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP+ G D  AKLY A NIYYNY+G V +CFDL   SDPHGL  W+WQACTEMI+P GG
Sbjct  329   IDDPSKGDDDFAKLYGAANIYYNYSGGV-SCFDLLDDSDPHGLGEWAWQACTEMILPTGG  387

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             + + SIFPA E++YN+R   C   F + PRP WI  EFGGH+I R L++FGSNIIFFNGL
Sbjct  388   NRETSIFPAHEYNYNDRVATCTSLFGVVPRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGL  447

Query  444   RDPW  433
             RDPW
Sbjct  448   RDPW  451



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/482 (63%), Positives = 357/482 (74%), Gaps = 59/482 (12%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP+S +I+    L++ S +    + LY TK+FTQILDHF + PQSY  FQQRYLIND 
Sbjct  42    PRFPYS-VISPEQQLNSGSVQ----NGLYRTKFFTQILDHFNYNPQSYQKFQQRYLINDT  96

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YWGGAK  APIFVY GNEG+IEWFTQNTGFMF+ AP+FNALLVFIEHRFYGKS+PFGG+K
Sbjct  97    YWGGAKKKAPIFVYTGNEGNIEWFTQNTGFMFEQAPYFNALLVFIEHRFYGKSIPFGGKK  156

Query  1332  E-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYP  1156
             + A ++S TLGYLSS Q LADYATLIIDLKKNL+AT+SPVVVFGGSYGGMLAAWFR+KYP
Sbjct  157   KVAYANSSTLGYLSSAQALADYATLIIDLKKNLSATESPVVVFGGSYGGMLAAWFRMKYP  216

Query  1155  HVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGG  976
             HV IGALASSAPIL F+++ SPYAF ++ITQDFRSESENCYKVIKGSW LI++ A++ GG
Sbjct  217   HVAIGALASSAPILQFDDLVSPYAFDNIITQDFRSESENCYKVIKGSWNLIEETAKKHGG  276

Query  975   LERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDD  796
             LE LRKSF IC NYI V +LEGWL  A+ YTAMTDYPT TNFL+P+P YPV++ C  +  
Sbjct  277   LELLRKSFKICNNYIGVDALEGWLGQAWIYTAMTDYPTPTNFLSPLPAYPVRKACSEMIM  336

Query  795   PNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNK  616
             P   S                                                     +K
Sbjct  337   PEGAS-----------------------------------------------------SK  343

Query  615   DSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  436
             +SIFP S+W   +R  YCK A+ + PRPNWIT+EFGGHNIE VLK+   NIIFFNGLRDP
Sbjct  344   ESIFPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDP  403

Query  435   WSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
             WS GGVLKNISK+++AI AKEGAHHVDLR+STKEDPKWLKDVR++EV+II+ WISQY+  
Sbjct  404   WSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWISQYHQD  463

Query  255   LT  250
             L 
Sbjct  464   LA  465



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/452 (63%), Positives = 356/452 (79%), Gaps = 7/452 (2%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY+T+YFTQ LDHF F PQSY  FQQRYL+N  YWGG    +PIFVY GNEG IE F +N
Sbjct  45    LYETRYFTQTLDHFNFNPQSYAKFQQRYLVNHTYWGGKG--SPIFVYTGNEGGIELFAKN  102

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGFMFDIAP F ALLVFIEHR+YG+S+PFGGE  A S++ TLGYL  TQ +AD+ATLIID
Sbjct  103   TGFMFDIAPSFKALLVFIEHRYYGESIPFGGEDVAYSNASTLGYLCVTQAIADFATLIID  162

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LKKNLT+ DSPVV FGGSYGGMLAAWFRLKYPHV +GALASSAP+L F+++ SPY F ++
Sbjct  163   LKKNLTSEDSPVVAFGGSYGGMLAAWFRLKYPHVVLGALASSAPLLQFDDLVSPYTFYNI  222

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +T DFRSESE+CY+ IK SW+ + D     GG ++L K+F  C + +S  +L  W+  A 
Sbjct  223   VTNDFRSESESCYRTIKSSWKELDDTLSRPGGPKKLAKAFKTCSDEVS--NLPQWIEEAL  280

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              Y AMTDYPT ++FL P+P YPVKQMCKAIDDP  G+D  A+LY A+NIYYNYTG+   C
Sbjct  281   VYGAMTDYPTVSDFLTPLPAYPVKQMCKAIDDPISGNDTFARLYGAMNIYYNYTGKA-TC  339

Query  711   FDLASSS--DPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEP  538
             FD+ + S  D  G  GW+WQ+CTEMI+P GG +++S+FPA+++ Y++ A +C+  + + P
Sbjct  340   FDVNTDSLDDTVGTDGWNWQSCTEMILPTGGRSEESMFPANKYSYDDNAGFCESYYGVAP  399

Query  537   RPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHV  358
             RP+WITTEFGGH+I RVLK+FGSNIIFFNGLRDPWS GGVLK+++ SL A+   +GAHHV
Sbjct  400   RPHWITTEFGGHDITRVLKRFGSNIIFFNGLRDPWSGGGVLKSLNPSLKAMVVPQGAHHV  459

Query  357   DLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             DLR+STKEDP WL++VRRKE+ II  W +Q+Y
Sbjct  460   DLRYSTKEDPMWLQNVRRKEINIIAGWTNQFY  491



>ref|XP_006430124.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43364.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=426

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/424 (69%), Positives = 338/424 (80%), Gaps = 9/424 (2%)
 Frame = -1

Query  1758  MKTRIILLff----ffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYF  1591
             M TR I L F          S AK  PTFP S I   P  LS+  + + D+  LY TKY 
Sbjct  1     MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRIT--PEKLSSLISNSKDSQGLYKTKYH  58

Query  1590  TQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDI  1411
             TQILDHF + PQSY TFQQRYLIND +WGG+KN APIFVY GNEGDIEWF QNTGFM+D+
Sbjct  59    TQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDV  118

Query  1410  APHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             AP F ALLVFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQ LADYA+LIIDLKKNLT
Sbjct  119   APKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLT  178

Query  1233  ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFR  1054
             ATDSPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F+NI SPY+FS++ITQDFR
Sbjct  179   ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFR  238

Query  1053  SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMT  874
             S SENCYKVIKGSW+ I++ A++ GGLE+L+K+F ICK+  ++ ++E WLSTA+ YTAMT
Sbjct  239   SVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNL-AIESWLSTAFVYTAMT  297

Query  873   DYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASS  694
             DYPT +NFLNP+P +PVK+MCKAIDDP  G+D  AKLY A ++YYNY+G    CFDL   
Sbjct  298   DYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTA-KCFDLNGD  356

Query  693   SDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTE  514
             SDPHGLS W WQACTEMIM  GG NKDSIF  SE DY+ RA+YCKEA+ ++PRPNWITTE
Sbjct  357   SDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTE  416

Query  513   FGGH  502
             FGGH
Sbjct  417   FGGH  420



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/482 (58%), Positives = 362/482 (75%), Gaps = 7/482 (1%)
 Frame = -1

Query  1698  TTPTFPFSTIINR-PNGLSASSAKAADNHKL-YDTKYFTQILDHFTFTPQSYHTFQQRYL  1525
             TT  F   T   R P    A  A    + KL + T +F Q LDHFTF P++Y  F Q+YL
Sbjct  43    TTTVFSLPTFFQRAPLQSLAQRAHTVKDPKLPFTTHFFPQQLDHFTFQPKAYKVFYQKYL  102

Query  1524  INDRYWG-GAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVP  1348
             +N  YW  G  + APIFVY GNEG+IEWF +NTGFM DIAP FNALLVFIEHRFYG+S+P
Sbjct  103   MNSTYWDQGPNHTAPIFVYTGNEGNIEWFAENTGFMLDIAPKFNALLVFIEHRFYGESMP  162

Query  1347  FGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFR  1168
             FG  KE+  S+ TLGYL+STQ LADYA LI  LK+NL+A  SPVVVFGGSYGGMLAAWFR
Sbjct  163   FG--KESYKSASTLGYLTSTQALADYAVLIRSLKQNLSAEASPVVVFGGSYGGMLAAWFR  220

Query  1167  LKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAE  988
             LKYPH+TIGALASSAPIL F+ IT   +F D +++D++ ES NC++VIKGSW  +  +A 
Sbjct  221   LKYPHITIGALASSAPILEFDYITPWSSFYDAVSEDYKDESINCFEVIKGSWDELMVVAA  280

Query  987   ESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
             + GG+  L K+F  CK+  SV S+  WL TA+ YTAM DYPTA+NFL P+P YP+K+MC+
Sbjct  281   QKGGMLELSKTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPAYPIKEMCR  340

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
              ID    G+  L K++SA ++YYNY+G+  +CFD+ + +DPHGL GW WQACTEM+MP+ 
Sbjct  341   IIDGFPQGASKLTKVFSAASLYYNYSGD-QSCFDIENGTDPHGLHGWDWQACTEMVMPMI  399

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
              SN +S+FP+S +DY+E    C   + + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG
Sbjct  400   CSN-ESMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNG  458

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             +RDPWS GGVL+NIS S++A+  ++GAHH+DLR++TK+DPKWL + R++E++IIQ WI Q
Sbjct  459   MRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQ  518

Query  267   YY  262
             Y+
Sbjct  519   YH  520



>gb|ABR17682.1| unknown [Picea sitchensis]
Length=501

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 351/473 (74%), Gaps = 24/473 (5%)
 Frame = -1

Query  1653  GLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFV  1474
             G +   A A+ +   YD +Y+TQILDHF+F P+SY TFQQ+YLIN  +WGGA   +PIFV
Sbjct  45    GAATVLASASVSAAKYDVRYYTQILDHFSFVPESYQTFQQKYLINSDHWGGASAKSPIFV  104

Query  1473  YMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLS  1294
             Y GNEG IEWFT+NTGFMFDIAP F A+LVFIEHRFYG S+PFG +K A S+S TLG+LS
Sbjct  105   YTGNEGFIEWFTENTGFMFDIAPQFKAMLVFIEHRFYGHSMPFGSQKAAYSNSSTLGFLS  164

Query  1293  STQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL  1114
             S Q LAD+ATLI DLKKNL+A DSPVVVF                   + G ++SSAPIL
Sbjct  165   SAQALADFATLITDLKKNLSAEDSPVVVF-----------------GGSYGGISSSAPIL  207

Query  1113  YFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICK--  940
             YF+NIT   +F D +++DFRSESENC+KVIKGSW +I ++     GL+ LRK+  ICK  
Sbjct  208   YFDNITPIGSFDDTVSEDFRSESENCFKVIKGSWNVIDEMTSTPEGLKSLRKALRICKSN  267

Query  939   --NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAK  766
               NYI+ G+L GWL  AY   AMTDYP A NF+ P+P YPVKQMCKAID+P+  +D L++
Sbjct  268   SDNYIA-GNLAGWLYDAYYTAAMTDYPVAANFVQPLPAYPVKQMCKAIDNPSGSTDLLSQ  326

Query  765   LYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWD  586
             LY   N+YYNYTG  ++CFD+   SDPHG  GW +QACTEM+MP+    K S+FP S +D
Sbjct  327   LYGVANVYYNYTGR-SSCFDI-RPSDPHGEDGWQFQACTEMVMPMADDPKKSMFPNSTFD  384

Query  585   YNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNI  406
             Y ER   C+ A+ ++PR +WITT++GGH+I+RVLK F SNIIFFNGLRDPWS GGVL++I
Sbjct  385   YQERVDSCESAYGVQPRRHWITTQYGGHHIKRVLKNFASNIIFFNGLRDPWSGGGVLEDI  444

Query  405   SKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             ++S+VAI AKEGAHHVD RF+TK+DP+WLKD R KE+ II+ W+ QYY  L +
Sbjct  445   NESVVAIVAKEGAHHVDFRFATKDDPQWLKDARTKEISIIKSWLQQYYMELQN  497



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/469 (59%), Positives = 342/469 (73%), Gaps = 5/469 (1%)
 Frame = -1

Query  1656  NGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWG-GAKNMAPI  1480
               L+     A D+   +   +F Q LDHFTF P++YH F Q+YLIN  YW  G  + API
Sbjct  40    QSLAQKRKPAMDSELPFTAHFFPQQLDHFTFRPKAYHVFYQKYLINSTYWDQGPVHTAPI  99

Query  1479  FVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGY  1300
             FVY GNEG+IEWF  NTGFM DIAP F ALLVFIEHRFYG+S+PFG   ++  S++ LGY
Sbjct  100   FVYTGNEGNIEWFAANTGFMLDIAPKFKALLVFIEHRFYGESMPFG--NDSYESAEELGY  157

Query  1299  LSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  1120
             L+STQ +ADYA LI  LKKNL+A  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAP
Sbjct  158   LTSTQAMADYAILIRSLKKNLSAEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAP  217

Query  1119  ILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICK  940
             IL F++I    +F D ++QDF+ ES NC++VIK SW  +  +  + GG+  L K+F  CK
Sbjct  218   ILQFDHIVPWSSFYDGVSQDFKDESINCFEVIKDSWDELMVVGAKKGGMLELTKTFRACK  277

Query  939   NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLY  760
                SV S+  WL TA+ YTAM DYPT  NFL P+P YPVK+MC+ ID    G D L K++
Sbjct  278   KLQSVYSVRDWLWTAFVYTAMIDYPTPANFLMPLPAYPVKEMCRIIDGFPAGEDILIKVF  337

Query  759   SAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYN  580
             SA ++YYNY+   N+CFD+ + SDPHGL GW WQACTEM+MP+  SN +S+FP S +DY 
Sbjct  338   SAASLYYNYSS-TNSCFDIENGSDPHGLHGWDWQACTEMVMPMTSSN-ESMFPPSTYDYK  395

Query  579   ERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISK  400
             E    C   +++ PRP+WITTE+GG+ IE VLK+FGSNIIF NG+RDPWS GGVLKNIS 
Sbjct  396   EFGDQCMTKYEVRPRPHWITTEYGGNKIELVLKRFGSNIIFSNGMRDPWSRGGVLKNISS  455

Query  399   SLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S++A+    GAHH+D R +TK+DPKWLK+ R  EV+IIQ WI QYY  L
Sbjct  456   SIIALVTPLGAHHLDFRAATKDDPKWLKEQRETEVKIIQAWIDQYYEDL  504



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 340/458 (74%), Gaps = 8/458 (2%)
 Frame = -1

Query  1617  HKL-YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             H+L ++T+YF Q LDHF+FTP SY  F Q+YLIN+R+W   +   PIFVY GNEGDI+WF
Sbjct  42    HELPFETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFVYTGNEGDIDWF  98

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               NTGFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYL+S Q LADYA L
Sbjct  99    ASNTGFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAIL  156

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             I  LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +F
Sbjct  157   IRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSF  216

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D I+QDF+  S NC+KVIK SW+ ++ ++    GL+ L K F  CK   S  S   WLS
Sbjct  217   YDAISQDFKDASINCFKVIKRSWEELEAVSTMKNGLQELSKKFRTCKGLHSQYSARDWLS  276

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
              A+ YTAM +YPTA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G  
Sbjct  277   GAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-  335

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CF++   +D HGL GW +QACTEM+MP+  SN+ S+ P  E D     + C   + ++
Sbjct  336   EKCFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDSEAFQEQCMTRYGVK  394

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S+VA+  K+GAHH
Sbjct  395   PRPHWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHH  454

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              DLR +TK+DP+WLK+ RR+EV II+KWIS+YY  L +
Sbjct  455   ADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLRE  492



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 337/454 (74%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF FTP+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  46    FETRYFPQNLDHFGFTPESYTVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYLSS Q LADYA LI  L
Sbjct  103   GFMSDIAPKFQALLVFIEHRFYGESTPFG--KKSHKSAETLGYLSSQQALADYAILIRSL  160

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +F D I
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSFYDAI  220

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+ VIK SW+ ++ ++    GL+ L K F  CK   S  S   WLS A+ 
Sbjct  221   SQDFKDASINCFTVIKRSWEELEAVSTMKNGLQELSKKFRTCKGLQSKYSARDWLSGAFV  280

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPTA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  281   YTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  339

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL+GW +QACTEM+MP+  SN+ S+ P  + DY    + C   + ++PRP+
Sbjct  340   EMEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDYEAFQEQCMSTYGVKPRPH  398

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S+VA+  K+GAHH DLR
Sbjct  399   WITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADLR  458

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK+DP+WLK+ RR+EV II+KWIS+YY  L +
Sbjct  459   AATKDDPEWLKEQRRQEVSIIEKWISEYYRDLRE  492



>gb|KHN33176.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=420

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/456 (62%), Positives = 335/456 (73%), Gaps = 54/456 (12%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY  K+FTQ LDHF + PQSY TFQQRYLIND YWGGAKN APIFVYMGNEGDIEWF QN
Sbjct  17    LYTAKFFTQTLDHFNYNPQSYQTFQQRYLINDTYWGGAKNNAPIFVYMGNEGDIEWFAQN  76

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLII  1255
             TGFMF+ AP+F ALLVFIEHR+YGKS PFGG +E A +++ T+GY+SSTQ LADYATLII
Sbjct  77    TGFMFETAPYFKALLVFIEHRYYGKSFPFGGNEEVADANTTTVGYMSSTQALADYATLII  136

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
             DLK NL+ATDSPVVV GGSYGGMLAAWFR+KYPHV IGALASSAPIL F ++ SPY ++D
Sbjct  137   DLKNNLSATDSPVVVVGGSYGGMLAAWFRMKYPHVAIGALASSAPILQFLDLVSPYTYTD  196

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             +ITQD++SESENCYKVIKGSW+ I+D A++ GGLE+LRKSF ICK+YIS G+L  WL  A
Sbjct  197   IITQDYKSESENCYKVIKGSWKQIEDTAQKPGGLEQLRKSFRICKHYISAGALVYWLQMA  256

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
                 AMTDYPT + FL P+P YPV++ C  +  P                          
Sbjct  257   LGSAAMTDYPTPSVFLAPLPAYPVRKACTELIMP--------------------------  290

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
                                        LG +N+ S+FP  +W   +   YCK  + I+PR
Sbjct  291   ---------------------------LGANNEGSMFPPYKWKLRDVEFYCKRVYHIQPR  323

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITTEFGGH+I+RVLK+ GSNIIFFNGLRDPWS GGVLKNIS+++VAI AKEGAHHVD
Sbjct  324   PHWITTEFGGHDIKRVLKRSGSNIIFFNGLRDPWSGGGVLKNISETIVAIVAKEGAHHVD  383

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             LRFST EDP+WLKD+R++E++II  WISQYY  L +
Sbjct  384   LRFSTTEDPEWLKDIRKREIKIIANWISQYYQDLLN  419



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/465 (56%), Positives = 340/465 (73%), Gaps = 4/465 (1%)
 Frame = -1

Query  1659  PNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPI  1480
             P+  S    +  DN   Y   +F QILDHFTFTPQS   F Q+YL+N  YW G K  API
Sbjct  27    PSLQSLCLQQNPDNKSDYKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEYWDGPKKRAPI  86

Query  1479  FVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGY  1300
             FVY GNEGDIEWF  NTGF+ DIAP F ALLVFIEHRFYG+S+PFG  K A  S+ TLGY
Sbjct  87    FVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFG--KGAYKSATTLGY  144

Query  1299  LSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAP  1120
             L+S Q LADYATLI  LK+NL+A   PVVVFGGSYGGMLAAWFRLKYPH+ +GA+ASSAP
Sbjct  145   LTSQQALADYATLITSLKQNLSAQACPVVVFGGSYGGMLAAWFRLKYPHIAMGAVASSAP  204

Query  1119  ILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICK  940
             IL F++I S  +F D +++DF+  S NC+ VI+ SW  +Q I+ +  GL++L + F  C+
Sbjct  205   ILQFDDIASWTSFYDGVSKDFKDASLNCFNVIRASWDKLQVISTQEKGLQKLNRVFRTCE  264

Query  939   NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLY  760
             +  SV S+  WL +A+ YTAM +YPT  NF+ P+P YP+ +MC+ ID     +D L K++
Sbjct  265   DIKSVYSVRDWLWSAFVYTAMVNYPTPANFMRPLPAYPINEMCRNIDGLPSETDTLVKVF  324

Query  759   SAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYN  580
             +A ++YYNY+     CFD+ ++SD HGL GW+WQACTEM+MP+  S +  +FP S + Y 
Sbjct  325   AAASVYYNYS-STKKCFDMENASDAHGLHGWNWQACTEMVMPMSCSQQ-GMFPPSTFSYK  382

Query  579   ERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISK  400
             E    C + + ++ RP+WITTEFGGHNIE VLK+FGSNIIF NG+ DPWS GGVLKNIS 
Sbjct  383   EIEDDCMKKYGVKARPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSRGGVLKNISS  442

Query  399   SLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             S+VA+  ++GAHH+D RF+T++DP+WL + RR+E+E+IQ WI +Y
Sbjct  443   SIVALVTEKGAHHLDFRFATRQDPRWLVEQRRQEIELIQGWIHEY  487



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/446 (60%), Positives = 335/446 (75%), Gaps = 7/446 (2%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             T+YF Q+LDHFTFTP+S   F Q+YLIN +YW    + APIFVY GNEGDI+WF  NTGF
Sbjct  58    TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  114

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             + DIAP F A+LVFIEHRFYG+S+PFG  KE+  S +TLGYL+S Q LAD+A LI  LK+
Sbjct  115   LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSLKQ  172

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
             NL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F++IT   +F D ++Q
Sbjct  173   NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILQFDDITPWSSFYDAVSQ  232

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DF+  S NCY+VIKGSW  +  ++ + GGL  + ++F  CK+  SV S   WL +A+ YT
Sbjct  233   DFKEASLNCYEVIKGSWAELDAMSAKEGGLAEVSRTFRTCKDINSVYSARDWLWSAFVYT  292

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             AM +YPT  NF+ P+P YPV++MCK ID   HG+  +++ ++A ++YYNY+G    CFDL
Sbjct  293   AMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSG-TEKCFDL  351

Query  702   ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWI  523
              +  D HGL GW WQACTEM+MPL  SN +S+FP S ++Y E A  C   + + PRP+WI
Sbjct  352   ENGKDAHGLHGWDWQACTEMVMPLTCSN-ESMFPPSSFEYKEFADECTRKYGVMPRPHWI  410

Query  522   TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFS  343
             TTEFGG  IE+VLK+  SNIIF NG++DPWS G VLKNIS S+VA+  K+GAHHVD RF+
Sbjct  411   TTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRFA  470

Query  342   TKEDPKWLKDVRRKEVEIIQKWISQY  265
             TKEDP WL + RR+EVEI+QKWI  Y
Sbjct  471   TKEDPDWLIEQRRQEVEILQKWIHDY  496



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/452 (59%), Positives = 334/452 (74%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +   YF Q LDHFTF P+S   F Q+YLIN  YW      APIFVY GNEGDIEWF  NT
Sbjct  51    FKVHYFPQTLDHFTFQPKSSKIFYQKYLINSHYWHKG---APIFVYTGNEGDIEWFAANT  107

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  KE+  S+KTLGYL+S Q LAD+A LI +L
Sbjct  108   GFMLDIAPKFKALLVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALADFAVLIRNL  165

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ I    +F D +
Sbjct  166   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIIPWSSFYDAV  225

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW+ ++ ++ +   L  L K+F  CK+  S  S   WL TA+ 
Sbjct  226   SQDFKDVSWNCYEVIKGSWEELEAMSTQKEALAELSKAFRTCKSLHSTASARDWLWTAFV  285

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NFL P+P YPV++MCK ID    G+  L++ ++A ++YYNY+    NCF
Sbjct  286   YTAMVNYPTEANFLKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYS-RAENCF  344

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++    D HGL GW WQ CTEM+MP+  S K+S+FP S +DY E A+ C+  +++ PRP+
Sbjct  345   EIEHEVDTHGLHGWDWQTCTEMVMPMTCS-KESMFPPSGFDYEEFAEQCQMKYEVLPRPH  403

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  I++VLKKFGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHHVD R
Sbjct  404   WITTEFGGERIQKVLKKFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFR  463

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK+DP WL + RR+EVEIIQKW+++YY  L
Sbjct  464   SATKDDPDWLVEQRRQEVEIIQKWLNEYYADL  495



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/454 (59%), Positives = 334/454 (74%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F P+SY  FQQ+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  46    FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  +++TLGYLSS Q LADYA LI  L
Sbjct  103   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  160

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D I
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLASFYDAI  220

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  ++    GL  L K F  CK   S+ S   WL  A+ 
Sbjct  221   SQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCKGLHSIYSARDWLMEAFV  280

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +Y TA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  281   YTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  339

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW +QACTEM+MP+  SN+ S+FP  E DY    + C   + ++PRP+
Sbjct  340   ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRPH  398

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHH DLR
Sbjct  399   WITTEFGGKKIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLR  458

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK DP+WLK+ RR+EV II+KWIS+YY  L +
Sbjct  459   AATKGDPEWLKEQRRQEVAIIEKWISEYYRDLKE  492



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 350/454 (77%), Gaps = 12/454 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+++ Q+LDHFTFTP+S   F Q+YLIN+ YW   +N APIFVY GNEGDIEWFT NT
Sbjct  49    FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFTANT  105

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ DIAP F+ALLVFIEHRFYG+S+PFG +  + +S++TLGYL+S Q LADYA LI  L
Sbjct  106   GFLPDIAPKFHALLVFIEHRFYGESMPFGND--SYNSAETLGYLTSQQALADYAVLIRSL  163

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVV FGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +F D +
Sbjct  164   KQNLSSEASPVVAFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPWSSFYDAV  223

Query  1068  TQDFRSESENCYKVIKGSW-QLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +QDF+  S NC+KVIK SW +L Q+ +EE  GL  L K+F  CKN  SV S+  WL +A+
Sbjct  224   SQDFKDASLNCFKVIKESWTELEQEFSEE--GLAELSKTFRTCKNLHSVSSVRDWLWSAF  281

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT-GEVNN  715
              YT+M +YPT  NF+ P+P YPV++MCK ID     +  L K+++A ++YYNY+ GE   
Sbjct  282   VYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLDKVFAAASLYYNYSHGE--K  339

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF++ +  D HGLSGW WQACTEM+MP+  SN+ S+FP SE+DY E A  CK+ + + PR
Sbjct  340   CFNVENGPDLHGLSGWDWQACTEMVMPMTCSNQ-SMFPPSEFDYEEFATDCKKKYGVSPR  398

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITTEFGG  IE VLK+FGSN+IF NG++DPWS GGVL+NIS S++AI  ++GAHHVD
Sbjct  399   PHWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGVLRNISTSIIAIVTEKGAHHVD  458

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              R +TK+DP WL + R++EVEII +WI++YY  +
Sbjct  459   FRSATKDDPDWLVEQRKQEVEIIHQWINEYYADM  492



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/446 (60%), Positives = 335/446 (75%), Gaps = 7/446 (2%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             T+YF Q+LDHFTFTP+S   F Q+YLIN +YW    + APIFVY GNEGDI+WF  NTGF
Sbjct  44    TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  100

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             + DIAP F A+LVFIEHRFYG+S+PFG  KE+  S +TLGYL+S Q LAD+A LI  LK+
Sbjct  101   LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSLKQ  158

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
             NL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F++IT   +F D ++Q
Sbjct  159   NLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILQFDDITPWSSFYDAVSQ  218

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DF+  S NCY+VIKGSW  +  ++ + GGL  + ++F  CK+  SV S   WL +A+ YT
Sbjct  219   DFKEASLNCYEVIKGSWAELDAMSAKEGGLAEVSRTFRTCKDINSVYSARDWLWSAFVYT  278

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             AM +YPT  NF+ P+P YPV++MCK ID   HG+  +++ ++A ++YYNY+G    CFDL
Sbjct  279   AMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSG-TEKCFDL  337

Query  702   ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWI  523
              +  D HGL GW WQACTEM+MPL  SN +S+FP S ++Y E A  C   + + PRP+WI
Sbjct  338   ENGKDAHGLHGWDWQACTEMVMPLTCSN-ESMFPPSSFEYKEFADECTRKYGVMPRPHWI  396

Query  522   TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFS  343
             TTEFGG  IE+VLK+  SNIIF NG++DPWS G VLKNIS S+VA+  K+GAHHVD RF+
Sbjct  397   TTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHVDFRFA  456

Query  342   TKEDPKWLKDVRRKEVEIIQKWISQY  265
             TKEDP WL + RR+EVEI+QKWI  Y
Sbjct  457   TKEDPDWLIEQRRQEVEILQKWIHDY  482



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/450 (59%), Positives = 333/450 (74%), Gaps = 12/450 (3%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYW--GGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             T+YF QILDHF+F P SY TF Q+YLIN  +W  GG     PIFVY GNEGDIEWF  NT
Sbjct  57    TRYFPQILDHFSFRPDSYRTFHQKYLINSHFWHIGG-----PIFVYTGNEGDIEWFASNT  111

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFMFDIAP F ALLVFIEHRFYG+S+PFG  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  112   GFMFDIAPKFRALLVFIEHRFYGESLPFG--KKSYKSAETLGYLNSQQALADFAVLIRSL  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+++GALASSAPIL F+NI    +F D +
Sbjct  170   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHISLGALASSAPILQFDNIVPSTSFYDAV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S +C++VIK SW  ++  +  + GL +L K F  CK+  SV S  GWL TA+ 
Sbjct  230   SQDFKDASSDCFEVIKRSWAEMEAFSTMNAGLTKLSKIFRTCKDLRSVSSAIGWLQTAFV  289

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAID-DPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             YTAM +YPT  NF+ P+P YPV +MCK ID     G+  L ++++A ++YYNY+G    C
Sbjct  290   YTAMVNYPTEANFMAPLPAYPVDKMCKIIDGSAARGASDLERVFAAASLYYNYSGS-EKC  348

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FD+    D HGLSGW WQACTEM+MP+  S+ + +F   E DY    + C   F ++PRP
Sbjct  349   FDIGHEEDAHGLSGWGWQACTEMVMPMSCSD-ECMFQPFEEDYKGFEENCVFRFGVKPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +WITTEFGG  IE+VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHH DL
Sbjct  408   HWITTEFGGQRIEKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKQGAHHADL  467

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             R  T+EDP WLK+ RR+EV IIQKWI +YY
Sbjct  468   RRETEEDPDWLKEQRRQEVAIIQKWIDEYY  497



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 351/454 (77%), Gaps = 12/454 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+++ Q+LDHFTFTP+S   F Q+YLIN+ YW   +N APIFVY GNEGDIEWF  NT
Sbjct  49    FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFAANT  105

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ DIAP F+ALLVFIEHRFYG+S PFG +  + +S++TLGYL+S Q LADYA LI  L
Sbjct  106   GFLPDIAPEFHALLVFIEHRFYGESTPFGND--SYNSAETLGYLTSQQALADYAVLIRSL  163

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +F D +
Sbjct  164   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPWSSFYDAV  223

Query  1068  TQDFRSESENCYKVIKGSW-QLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +QDF+  S NC++VIKGSW +L Q+ +EE  GL  L K+F  CKN  SV S++ WL +A+
Sbjct  224   SQDFKDASLNCFEVIKGSWTELQQEFSEE--GLAELSKTFRTCKNLHSVSSVQDWLWSAF  281

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT-GEVNN  715
              YT+M +YPT  NF+ P+P YPV++MCK ID     +  L K ++A ++YYNY+ GE   
Sbjct  282   VYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLNKAFAAASLYYNYSHGE--K  339

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF++ +  D HGLSGW+WQACTEM+MP+  SN+ S+FP S++DY E A  CK+ + + PR
Sbjct  340   CFNVENGPDLHGLSGWNWQACTEMVMPMTCSNQ-SMFPPSKFDYEEFATDCKKKYGVSPR  398

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITTE+GG  IE VLK+FGSNIIF NG++DPWS GGVL+NIS S+VA+  ++GAHHVD
Sbjct  399   PHWITTEYGGERIEEVLKRFGSNIIFSNGMQDPWSRGGVLRNISTSIVALVTEKGAHHVD  458

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              R +TK+DP WL + RR+EVEII +WI+++Y  +
Sbjct  459   FRSATKDDPDWLVEQRRQEVEIIHQWINEHYADM  492



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/453 (58%), Positives = 342/453 (75%), Gaps = 9/453 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y T+YF Q+LDHFTF P  Y  F Q+YLI+ +YW      APIFVY GNEGDIEWF  NT
Sbjct  50    YKTRYFPQLLDHFTFQPNGYKIFYQKYLISSQYW---HKEAPIFVYTGNEGDIEWFAANT  106

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ DIAP F ALLVFIEHRFYG+S+PFG  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  107   GFLLDIAPKFRALLVFIEHRFYGESMPFG--KDSYKSAETLGYLNSQQALADFAVLIRSL  164

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLA WFRLKYPH+ IGALASSAPIL F++IT   +F D +
Sbjct  165   KQNLSSEASPVVVFGGSYGGMLATWFRLKYPHIAIGALASSAPILQFDDITPWSSFYDAV  224

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDFR  S NCY+VIKGSW  ++ ++ +  GL  L ++F  CK+  S+ S+  WL +AY 
Sbjct  225   SQDFREASLNCYEVIKGSWAELETLSSQKEGLIELSRTFRTCKDLHSLDSVWDWLWSAYV  284

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT-GEVNNC  712
             Y+AM +YPT  NF+ P+P YPVK+MCK ID    G+  ++++++A ++YYNY+ GE   C
Sbjct  285   YSAMVNYPTEANFMKPLPAYPVKEMCKIIDGFPAGASKVSRVFAAASLYYNYSRGE--KC  342

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             F L +  D HGL GW+WQACTEM+MP+  S K+S+FP S +DY E A+ CK+ F + PR 
Sbjct  343   FQLENVPDAHGLHGWNWQACTEMVMPMTCS-KESMFPPSGYDYKEFAEECKKKFGVMPRQ  401

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +WITTEFGG  I++VLK+FGSNIIF NG+ DPWS GGVLKNIS S++AI  K+GAHHVD 
Sbjct  402   HWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWSRGGVLKNISSSIIAIVTKKGAHHVDF  461

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             R +TK+DP WLK++R++E++II +WI +YY  L
Sbjct  462   RSATKDDPNWLKEMRKQEIQIIGRWIDEYYADL  494



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/454 (58%), Positives = 334/454 (74%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F P+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  46    FETRYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYL+S Q LADYA LI  L
Sbjct  103   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D I
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAI  220

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ ++ ++    GL  L K F  CK   S+ S   WL  A+ 
Sbjct  221   SQDFKDASINCFKVIKRSWEELEAVSNMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFV  280

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +Y TA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  281   YTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  339

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW +QACTEM+MP+  SN+ S+FP  E DY    + C   + ++PRP+
Sbjct  340   ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRPH  398

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHH DLR
Sbjct  399   WITTEFGGKRIESVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLR  458

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK DP+WLK+ RR+EV II+KWIS+YY  + +
Sbjct  459   AATKGDPEWLKEQRRQEVAIIEKWISEYYRDMKE  492



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 334/457 (73%), Gaps = 4/457 (1%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ  1435
             K +   YF Q LDHFTFTP + + F Q+YL+ND +W       P+FVY GNEGDIEWF  
Sbjct  74    KPFTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFAT  133

Query  1434  NTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLII  1255
             NTGFMFDIAP F ALLVFIEHRFYG+S PFG   ++  S+ TLGYL+STQ LAD+A LI 
Sbjct  134   NTGFMFDIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLIT  191

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
              LK+NL+A D+PVVVFGGSYGGMLA+WFRLKYPHV IGALASSAPIL FE+IT   +F +
Sbjct  192   SLKQNLSAVDAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAPILQFEDITPWSSFYE  251

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
              +++DF+SES NC+ VIK  W ++        GL  L K+F  CK  +   SL  WLSTA
Sbjct  252   AVSEDFKSESLNCFSVIKAVWDVLTVRGSNDTGLLELSKTFRACKTVLLPNSLLDWLSTA  311

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
             +TYTAM DYPT  NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG+   
Sbjct  312   FTYTAMVDYPTPANFMQNLPAYPVKEMCKIIDSFPAGADVVEKAFAAASLYYNYTGD-QK  370

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF++    DPHGLSGW WQACTEM+MP+  SN +S+FP S + Y E+++ C  A+ + PR
Sbjct  371   CFEVEGGDDPHGLSGWGWQACTEMVMPMTVSN-ESMFPPSGFSYEEKSEGCIAAYDVRPR  429

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
              +WITTE+GGH I++VLK+FGSNIIF N +RDPWS GGVLKNIS S++A+  ++GAHH+D
Sbjct  430   MHWITTEYGGHKIDKVLKRFGSNIIFSNEMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  489

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              R +TK+DP W+ + RR+EVEII  WI QY   +  +
Sbjct  490   FRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDIAQM  526



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 351/475 (74%), Gaps = 12/475 (3%)
 Frame = -1

Query  1677  STIINRPNGLSASSAKAADNHKL---YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW  1507
             ST I  P     S  K A + KL   Y T++F Q+LDHFTF PQS   F Q+YLIND YW
Sbjct  22    STQIFFPRATHQSLIKQAKDPKLSIPYKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYW  81

Query  1506  GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEA  1327
                ++ APIFVY GNEG+IEWF +NTGFM DIAP F ALLVFIEHRFYG+S+PFG  K++
Sbjct  82    ---EHGAPIFVYTGNEGNIEWFAENTGFMLDIAPKFRALLVFIEHRFYGESLPFG--KDS  136

Query  1326  KSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVT  1147
               S+KTLGYL+S Q LAD+A LI  +K NL +  SPV+VFGGSYGGMLAAWFRLKYPHV 
Sbjct  137   YKSAKTLGYLNSQQALADFAVLIQSMK-NLLSEVSPVLVFGGSYGGMLAAWFRLKYPHVA  195

Query  1146  IGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLER  967
             +GALASSAPIL F++IT   +F D +TQDF+  S+NCY+VIKGSW  +Q ++E+ G L  
Sbjct  196   LGALASSAPILQFDDITPWTSFYDAVTQDFKDASQNCYEVIKGSWAELQAVSEQKG-LAE  254

Query  966   LRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNH  787
             L +SF  C+N  S+ S   WL TA+ YTAM +YPT  NF+ P+P YPV++MCK ID    
Sbjct  255   LSRSFRSCENLHSMYSARNWLWTAFVYTAMVNYPTEANFMMPLPAYPVREMCKIIDGFPP  314

Query  786   GSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSI  607
              +  L+++ +A ++YYNY+     CF + +++D HGL GW WQACTEM+MP+  S KDS+
Sbjct  315   RATKLSRVVAAASLYYNYS-RTEKCFKIENATDAHGLHGWDWQACTEMVMPMTCS-KDSM  372

Query  606   FPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  427
             FP S +DY   ++ C   + + PRP+WITTEFGG+ IE+VLK+FGSNIIF NG++DPWS 
Sbjct  373   FPPSTFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSR  432

Query  426   GGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             G VLKNIS S++A+  ++GAHHVD R +TKEDP WL + RR+EVEIIQ+WI++Y+
Sbjct  433   GSVLKNISASIIALATEKGAHHVDFRSATKEDPDWLVEQRRQEVEIIQRWINEYH  487



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 334/452 (74%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+FTP+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  47    FETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P    K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  104   GFMSDIAPKFRALLVFIEHRFYGESTPI--RKKSHKSAETLGYLNSQQALADFAILIRSL  161

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D +
Sbjct  162   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAV  221

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  ++ +  GL+ L K F  CK   S  S   WLS A+ 
Sbjct  222   SQDFKDASMNCFKVIKRSWEELDAVSTKKNGLQELSKKFRTCKGLQSRYSASNWLSGAFV  281

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPTA NF+ P+P YPV++MCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  282   YTAMVNYPTAANFMAPLPGYPVEEMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  340

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL+GW +QACTEM+MP+  SN+ S+ P  + DY    + CK  + ++PRP+
Sbjct  341   EMEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDYEAFEEQCKSRYGVKPRPH  399

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S+VA+  K+GAHH DLR
Sbjct  400   WITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLR  459

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK DP+WLK+ R +EV II+KWIS+YY  L
Sbjct  460   AATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 333/454 (73%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F P+SY  FQQ+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  78    FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  134

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  +++TLGYLSS Q LADYA LI  L
Sbjct  135   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  192

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D I
Sbjct  193   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLASFYDAI  252

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  ++    GL  L K F  CK   S+ S   WL  A+ 
Sbjct  253   SQDFKDASVNCFKVIKRSWEELDAVSTMKHGLPELSKKFRTCKGLHSIYSARDWLMGAFV  312

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +Y T  NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  313   YTAMVNYATTANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  371

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW +QACTEM+MP+  SN+ S+FP  E DY    + C   + ++PRP+
Sbjct  372   ELEQPTDDHGLDGWGYQACTEMVMPMSCSNQ-SMFPPYENDYEAFEEQCMSKYGVKPRPH  430

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S++A+  K+GAHH DLR
Sbjct  431   WITTEFGGKRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADLR  490

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK DP+WLK+ RR+EV I++KWIS+YY  L +
Sbjct  491   AATKGDPEWLKEQRRQEVAIVEKWISEYYRDLKE  524



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 334/454 (74%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+FTP SY  F Q+YLIN  +W   +   PIFVY GNEGDI+WF  NT
Sbjct  47    FETRYFPQNLDHFSFTPDSYKVFHQKYLINSHFW---RKGGPIFVYTGNEGDIDWFATNT  103

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  104   GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADFAILIRSL  161

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D +
Sbjct  162   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAV  221

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  ++    GL+ L K F  CK   S+ S   WLS A+ 
Sbjct  222   SQDFKDASINCFKVIKRSWEELDALSTMKNGLQELSKKFRTCKGLHSIYSARDWLSGAFV  281

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPTA NF+  +P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  282   YTAMVNYPTAANFMASLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-KKCF  340

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   SD HGL+GW +QACTEM+MP+  SN+ S+ P  E DY    + C   + ++PRP+
Sbjct  341   EMEQQSDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYENDYEAFKEQCMSRYGVKPRPH  399

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S++A+  K+GAHH DLR
Sbjct  400   WITTEFGGKSIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADLR  459

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK DP+WLK+ RR+EV II+ WIS+YY  L +
Sbjct  460   AATKGDPEWLKEQRRQEVAIIENWISEYYRDLRE  493



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/452 (58%), Positives = 334/452 (74%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+FTP+SY  F Q+YLIN+R W   +   PIFVY GNEGDI+WF  NT
Sbjct  47    FETRYFPQNLDHFSFTPESYKVFHQKYLINNRSW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P G  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  104   GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  161

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D +
Sbjct  162   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAV  221

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  ++ +  GL+ L K F  CK   S+ S   WLS A+ 
Sbjct  222   SQDFKDASINCFKVIKRSWEELDAVSTKKNGLQELSKKFRTCKGLQSIYSASNWLSGAFV  281

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  282   YTAMVNYPTPANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  340

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL+GW +QACTEM+MP+  SN+ S+ P  + DY    + C   + ++PRP+
Sbjct  341   EMEQQTDDHGLNGWQYQACTEMVMPMSCSNQ-SMLPPYDNDYEAFKEQCMSRYGVKPRPH  399

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S+VA+  K+GAHH DLR
Sbjct  400   WITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLR  459

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK DP+WLK+ R +EV II+KWIS+YY  L
Sbjct  460   AATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/463 (57%), Positives = 335/463 (72%), Gaps = 12/463 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW--------GGAKNMAPIFVYMGNEGD  1453
             +   YF Q LDHFTFTP +   F Q+YL+ND +W        G A    P+FVY GNEGD
Sbjct  76    FRAHYFPQELDHFTFTPNASRIFYQKYLVNDTFWRKPTGKGRGAAAAPGPVFVYTGNEGD  135

Query  1452  IEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLAD  1273
             IEWF  N+GF+FDIAP F+ALLVFIEHRFYG+S PFG   E+  S+ TLGYL+STQ LAD
Sbjct  136   IEWFATNSGFLFDIAPKFSALLVFIEHRFYGESKPFG--NESYGSAATLGYLTSTQALAD  193

Query  1272  YATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITS  1093
             +A LI  LK NL+A  +PVVVFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F++IT 
Sbjct  194   FAVLITSLKHNLSAPVAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAPILQFDDITP  253

Query  1092  PYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLE  913
               +F D  +QDF+SES+NC+ VIK  W ++ +      GL +L K+F  CK    V SL 
Sbjct  254   WSSFYDAASQDFKSESKNCFSVIKAVWDVLDERGSNDKGLLQLSKTFRACKTVKYVDSLS  313

Query  912   GWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNY  733
              WL TA+ YTAM DYPT  NFL  +P YPVK+MCK ID    G+D + K +SA ++YYNY
Sbjct  314   NWLWTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKIIDAFPPGADIVDKAFSAASLYYNY  373

Query  732   TGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEA  553
             TG+   CFD+    DPHGLSGW WQACTEM+MP+  SNK S+FP S + Y E+++ C  +
Sbjct  374   TGD-QKCFDVEGGDDPHGLSGWGWQACTEMVMPMTVSNK-SMFPPSSFSYEEKSEGCLAS  431

Query  552   FKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKE  373
             + + PR +WITTE+GGH I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++
Sbjct  432   YGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEK  491

Query  372   GAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             GAHH+D R +TK+DP W+ + RR+EVEIIQ WI QY   +  +
Sbjct  492   GAHHLDFRTATKDDPDWVIEQRRQEVEIIQGWIDQYNKDIAHM  534



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/455 (59%), Positives = 332/455 (73%), Gaps = 11/455 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW---GGAKNMAPIFVYMGNEGDIEWFT  1438
             + T YF QILDHFTF P+S   F Q+YLIND+YW   GG     PIFVY GNEG+I+WF 
Sbjct  49    FKTHYFPQILDHFTFLPKSCKVFYQKYLINDQYWNKDGGG----PIFVYTGNEGNIDWFA  104

Query  1437  QNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLI  1258
              NTGFM DI P+FNALL+FIEHRFYG S+PFG    +  S+KTLGYL+S Q LADYA LI
Sbjct  105   ANTGFMIDIVPNFNALLIFIEHRFYGDSMPFGNN--SYKSAKTLGYLNSQQALADYAVLI  162

Query  1257  IDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFS  1078
               LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGA+ASSAPIL FE IT   +F 
Sbjct  163   RSLKQNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAPILQFEKITPWSSFY  222

Query  1077  DVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLST  898
             D ++QDF+  S NCYKVIKGSW  +  ++    GL ++ K F  CK   SV S   WL  
Sbjct  223   DAVSQDFKDASLNCYKVIKGSWAELDALSRHDDGLIKVSKLFRTCKALQSVFSARDWLWE  282

Query  897   AYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVN  718
             A+ YTAM +YPT  NF+ P+P YPVK+MCK ID    G   L+K ++A ++YYNYT +  
Sbjct  283   AFVYTAMVNYPTEANFMMPLPAYPVKEMCKIIDGLPKGGSKLSKAFAAASLYYNYT-QTE  341

Query  717   NCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEP  538
              CF+L   +D HGL GW WQACTEM+MP+  SN +S+FP S + Y E ++ CK+ F ++P
Sbjct  342   KCFNLEGGTDSHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSFSYKEFSKDCKKQFGVKP  400

Query  537   RPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHV  358
             RP+WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS GGVLKNIS S+VA+  ++GAHHV
Sbjct  401   RPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISSSIVALVTQKGAHHV  460

Query  357   DLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             D R  TK DP WL   R++EV II+KW+ +YY  L
Sbjct  461   DFRSETKNDPDWLIMQRKQEVAIIEKWLEEYYKDL  495



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/454 (58%), Positives = 334/454 (74%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T YF Q LDHF+F P+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  46    FETLYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYL+S Q LADYA LI  L
Sbjct  103   GFMSDIAPKFGALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F+NI    +F D I
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDNIVPLTSFYDAI  220

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC++VIK SWQ ++ ++    GL  L K F  CK   S  +   WL +A+ 
Sbjct  221   SQDFKDASVNCFEVIKRSWQELEAVSNMKHGLPELSKKFRTCKGLHSQYAARDWLMSAFI  280

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +Y TA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G    CF
Sbjct  281   YTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  339

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW WQACTEM+MP+  SN+ S+FP  + DY    + C   + ++PRP+
Sbjct  340   ELEQPTDDHGLDGWGWQACTEMVMPMSCSNQ-SMFPPYDNDYEAFKEQCMSRYGVKPRPH  398

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHH DLR
Sbjct  399   WITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADLR  458

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              ++K DP+WLK+ RR+EV II+KWIS+Y+ +L +
Sbjct  459   AASKGDPEWLKEQRRQEVAIIEKWISEYHRALRE  492



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/460 (58%), Positives = 334/460 (73%), Gaps = 9/460 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW-----GGAKNMAPIFVYMGNEGDIEW  1444
             +  +YF Q LDHFTFTP S   F Q+YL+ND +W      G     PIFVY GNEGDIEW
Sbjct  75    FTARYFPQELDHFTFTPNSSALFYQKYLVNDTFWRRSSGAGGDTAGPIFVYTGNEGDIEW  134

Query  1443  FTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYAT  1264
             F  NTGFMFDIAP F A+LVFIEHRFYG+S PFG   ++ SS++ LGYL+STQ LAD+A 
Sbjct  135   FATNTGFMFDIAPRFGAMLVFIEHRFYGESKPFG--NDSNSSAEKLGYLTSTQALADFAV  192

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             LI  LK+NL+A  +PVVVFGGSYGGMLA+WFRLKYPHVTIGA+ASSAPIL F+ ITS  +
Sbjct  193   LITSLKQNLSAVAAPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAPILQFDYITSWSS  252

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F D ++QD++SES NC+ VIK +W L+ +      GL +L K F  CK   SV S   WL
Sbjct  253   FYDAVSQDYKSESLNCFSVIKAAWDLMDERGSTDAGLLQLSKIFRACKTVKSVYSFRNWL  312

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE  724
              TA+ YTAM DYPT  NFL  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG+
Sbjct  313   WTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKIIDGFPAGADIVDKAFAAASLYYNYTGD  372

Query  723   VNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
                CF+L    DPHGLSGW WQACTEM+MP+  SN +S+FP   + Y  ++  C +++ +
Sbjct  373   -QTCFELEDGGDPHGLSGWGWQACTEMVMPMTISN-ESMFPPFTFTYEGKSDDCFQSYGV  430

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS GGVLKNIS S+ A+  ++GAH
Sbjct  431   RPRPHWITTEYGGNKIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIFALVTEKGAH  490

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             H+D R +TK+DP W+ + RR+EVEIIQ WI QY   +  +
Sbjct  491   HLDFRSATKDDPDWVVEQRRQEVEIIQGWIDQYNKDIAQM  530



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/457 (57%), Positives = 328/457 (72%), Gaps = 4/457 (1%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ  1435
             K +   YF Q LDHFTFTP + + F Q+YL+ND +W       P+FVY GNEGDIEWF  
Sbjct  72    KPFTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFAT  131

Query  1434  NTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLII  1255
             NTGF+FDIAP F ALLVFIEHRFYG+S PFG   ++  S+ TLGYL+STQ LAD+A LI 
Sbjct  132   NTGFLFDIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLIT  189

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
              LK NL+  D+PVVVFGGSYGGMLA+WFRLKYPHV +GA+ASSAPIL F++IT   +F D
Sbjct  190   SLKHNLSTVDAPVVVFGGSYGGMLASWFRLKYPHVAMGAVASSAPILQFDDITPWSSFYD  249

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
              ++QDF+SES NC+ VIK +W ++ D      GL  L K+F  CK   S  SL  WLSTA
Sbjct  250   TVSQDFKSESLNCFSVIKAAWDVLDDRGSNHTGLLELSKTFRACKTVKSADSLGDWLSTA  309

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
             +TYTAM DYPT  NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG+   
Sbjct  310   FTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPTGADIIDKAFAAASLYYNYTGD-QK  368

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF +    DPHGL GW WQACTEM+MP+  SN +S+FP S + Y   +  C   + + PR
Sbjct  369   CFQVEGDDDPHGLDGWDWQACTEMVMPMIVSN-ESMFPPSSFSYENNSDACLADYGVRPR  427

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
              NWITTE+GGH I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++GAHH+D
Sbjct  428   MNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  487

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              R  TK+DP W+ + RR+EVEII  WI QY   +  +
Sbjct  488   FRSETKDDPDWVVEQRRQEVEIIHGWIDQYNKDIAQM  524



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/455 (57%), Positives = 327/455 (72%), Gaps = 4/455 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +   YF Q LDHFTFTP + + F Q+YL+ND +W       P+FVY GNEGDIEWF  NT
Sbjct  85    FTAHYFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNT  144

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+FDIAP F ALLVFIEHRFYG+S PFG   ++  S+ TLGYL+STQ LAD+A LI  L
Sbjct  145   GFLFDIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSL  202

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL+  D+PVVVFGGSYGGMLA+WFRLKYPHV +GA+ASSAPIL F++IT   +F D +
Sbjct  203   KHNLSTVDAPVVVFGGSYGGMLASWFRLKYPHVAMGAVASSAPILQFDDITPWSSFYDTV  262

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+SES NC+ VIK +W ++ D      GL  L K+F  CK   S  SL  WLSTA+T
Sbjct  263   SQDFKSESLNCFSVIKAAWDVLDDRGSNHTGLLELSKTFRACKTVKSADSLGDWLSTAFT  322

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM DYPT  NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG+   CF
Sbjct  323   YTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPTGADIIDKAFAAASLYYNYTGD-QKCF  381

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              +    DPHGL GW WQACTEM+MP+  SN +S+FP S + Y   +  C   + + PR N
Sbjct  382   QVEGDDDPHGLDGWDWQACTEMVMPMIVSN-ESMFPPSSFSYENNSDACLADYGVRPRMN  440

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTE+GGH I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++GAHH+D R
Sbjct  441   WITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFR  500

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
               TK+DP W+ + RR+EVEII  WI QY   +  +
Sbjct  501   SETKDDPDWVVEQRRQEVEIIHGWIDQYNKDIAQM  535



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 338/469 (72%), Gaps = 9/469 (2%)
 Frame = -1

Query  1638  SAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW-----GGAKNMAPIFV  1474
             +A      K +   YF Q LDHFTFTP +   F+Q+YL+ND +W     G      P+FV
Sbjct  91    TANGTAAKKPFTVHYFAQELDHFTFTPNASMVFRQKYLLNDTFWRRPSAGDGDGAGPLFV  150

Query  1473  YMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLS  1294
             Y GNEGDIEWF  NTGFMFDIAP F ALLVFIEHRFYG+S PFG   ++  S++TLGYL+
Sbjct  151   YTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESKPFG--NDSYKSAETLGYLT  208

Query  1293  STQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPIL  1114
             STQ LAD+A LI  LKKNL+A  +PVVVFGGSYGGMLA+WFRLKYPHVTIGA+ASSAPIL
Sbjct  209   STQALADFAILIRSLKKNLSAEAAPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAPIL  268

Query  1113  YFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNY  934
              F+ IT   +F D ++QDF+SES NC+ VIKG+W ++ +      GL  L K F  CK  
Sbjct  269   QFDYITPWSSFYDGVSQDFKSESLNCFSVIKGTWDVLDERGSTDKGLLDLSKLFRACKTV  328

Query  933   ISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA  754
                 S+  WL TA++YTAM DYPT  NFL  +P YPVK+MCK ID    G+D L K ++A
Sbjct  329   KYAYSIRNWLWTAFSYTAMVDYPTPANFLENLPAYPVKEMCKIIDGFPTGADILEKAFAA  388

Query  753   VNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNER  574
              ++YYNYTG+   C  +    DPHGL GW WQACTEMIMP+  SN +S+FP S + Y+ER
Sbjct  389   ASLYYNYTGD-QTCNKIEDGDDPHGLDGWQWQACTEMIMPMTVSN-ESMFPPSSFSYDER  446

Query  573   AQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSL  394
             +  C +++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S+
Sbjct  447   SDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSI  506

Query  393   VAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             +A+  ++GAHH+D R STK DP W+ + RR+EV+IIQ WI QY+  + +
Sbjct  507   IALVTEKGAHHLDFRSSTKGDPDWVIEQRRQEVDIIQGWIDQYHQDMAE  555



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/452 (58%), Positives = 333/452 (74%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T YF Q LDHFTF P+S   F Q+YLIN  YW   +  APIFVY GNEG+IEWF  NT
Sbjct  48    FKTHYFPQTLDHFTFQPKSSKLFYQKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANT  104

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYGKS+PFG  K++  S+KTLGYL+S Q LAD+A LI  L
Sbjct  105   GFMLDIAPKFKALLVFIEHRFYGKSMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSL  162

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ +    +F D +
Sbjct  163   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKLIPWSSFYDAV  222

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW  ++ ++ +   L  L K+F  CK+  S  S   WL TA+ 
Sbjct  223   SQDFKDVSLNCYQVIKGSWAELEAMSTQKQALAELSKTFRTCKSLHSTASARDWLWTAFV  282

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  +F+ P+P YPV++MCK ID     +  L++ ++A ++YYNY+    NCF
Sbjct  283   YTAMVNYPTKADFMKPLPAYPVQKMCKIIDKIPSRATKLSRAFAAASLYYNYS-RSENCF  341

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              +    D HGL GW WQ CTEM+MP+  S K+S+FP S +DY E A+ C+  + + PRP+
Sbjct  342   KIEHEVDGHGLHGWDWQTCTEMVMPMTCS-KESMFPPSGFDYEEFAEQCRMKYCVSPRPH  400

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  I++VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  ++GAHHVD R
Sbjct  401   WITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFR  460

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK+DPKWL  +R++EVEIIQKW+++YY  L
Sbjct  461   SATKKDPKWLIQLRKQEVEIIQKWLNEYYADL  492



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/452 (59%), Positives = 331/452 (73%), Gaps = 5/452 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T YF QILDHFTF P+S   F Q+YLIND+YW   +   PIFVY GNEG+I+WF  NT
Sbjct  49    FKTHYFPQILDHFTFLPKSSKVFYQKYLINDQYWH-KEGGGPIFVYTGNEGNIDWFAVNT  107

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP FNALLVFIEHRFYG S+PFG    +  S+KTLGYL+S Q LADYA LI  L
Sbjct  108   GFMVDIAPKFNALLVFIEHRFYGDSMPFGNN--SYKSAKTLGYLNSQQALADYAVLIRSL  165

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGA+ASSAPIL F+ IT   +F D +
Sbjct  166   KQNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAPILQFDKITPWSSFYDAV  225

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCYKVIKGSW  +  ++    GL  + K F  CK   SV S   WL  A+ 
Sbjct  226   SQDFKDASLNCYKVIKGSWAELDALSTHDDGLIEVSKLFRTCKALHSVYSARDWLWEAFV  285

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NF+ P+P YPV++MCK ID    G+  L+K ++A ++YYNYT +   CF
Sbjct  286   YTAMVNYPTEANFMMPLPAYPVEEMCKIIDGLPKGASKLSKAFAAASLYYNYT-QTEKCF  344

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW WQACTEM+MP+  SN +S+FP S + Y E +Q CK+ + ++PRP+
Sbjct  345   NLEGGTDSHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSFSYKEFSQDCKKQYGVKPRPH  403

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS GGVLKNIS S+VA+  ++GAHHVD R
Sbjct  404   WITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISSSIVALVTQKGAHHVDFR  463

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
               TK DP WL   R++EV II+KW+ +YY  L
Sbjct  464   SETKNDPDWLIMQRKQEVAIIEKWLEEYYKDL  495



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 332/471 (70%), Gaps = 13/471 (3%)
 Frame = -1

Query  1665  NRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMA  1486
             +R N  ++ S     +H  ++T+YF Q LDHF+F P+SY  F Q+YLIN R+W   +   
Sbjct  40    SRQNRKTSKSNTELPSH--FETRYFPQNLDHFSFQPESYQVFHQKYLINSRFW---RKGG  94

Query  1485  PIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL  1306
             PIFVY GNEGDIEWF  NTGFM DIAP F ALLVFIEHRFYG+S P          + TL
Sbjct  95    PIFVYTGNEGDIEWFASNTGFMLDIAPKFKALLVFIEHRFYGESKP-------HKLANTL  147

Query  1305  GYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS  1126
             G+L+S Q LADYA LI  LK+NLT+  SPV+VFGGSYGGMLAAWFRLKYPH+ IGALASS
Sbjct  148   GFLNSQQALADYAILIRSLKQNLTSEASPVIVFGGSYGGMLAAWFRLKYPHIAIGALASS  207

Query  1125  APILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNI  946
             APIL F+NI    +F D ++QDF+  S NC++VIK SW  ++  +    GL+ L K F  
Sbjct  208   APILNFDNIVPSSSFYDTVSQDFKEVSVNCFEVIKRSWGEMEVFSTIKDGLQELSKMFRT  267

Query  945   CKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAK  766
             CK   SV S  GWL TA+  TAM +YPT  NF+ P+P YPV QMCK +D+    +  L +
Sbjct  268   CKTLHSVDSASGWLETAFIETAMVNYPTPANFMAPLPAYPVGQMCKIMDELPLEASNLER  327

Query  765   LYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWD  586
              ++A ++YYNY+G V  CFD+ + +D HGL+GW WQACTEM+MP+  SN+    P    D
Sbjct  328   AFAAASLYYNYSGSV-TCFDMENHTDSHGLNGWGWQACTEMVMPMSCSNQTMFRPFESDD  386

Query  585   YNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNI  406
                  +YC   + ++PRPNWITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNI
Sbjct  387   EKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVLKNI  446

Query  405   SKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S S++A+  ++GAHH DLR +TK+DP+WLK  RR+EV II+KWIS+YY+ L
Sbjct  447   SSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYNDL  497



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 342/473 (72%), Gaps = 13/473 (3%)
 Frame = -1

Query  1644  ASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW----GGAKNMA--P  1483
             AS+  AA   K +   YF Q LDHFTFTP +   F Q+YL+ND YW    GG K  A  P
Sbjct  77    ASNGTAA---KPFTAHYFPQELDHFTFTPNASMVFYQKYLVNDTYWRRPSGGRKGGAAGP  133

Query  1482  IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLG  1303
             +FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIEHRFYG+S PFG   ++  S++TLG
Sbjct  134   LFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESKPFG--NDSYKSAETLG  191

Query  1302  YLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  1123
             YL+STQ LAD+A LI  LK+NL+A  +PVVVFGGSYGGMLA+WFR+KYPHV IGALASSA
Sbjct  192   YLTSTQALADFAILIGSLKQNLSAEGAPVVVFGGSYGGMLASWFRIKYPHVAIGALASSA  251

Query  1122  PILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC  943
             PIL F+ IT   +F D ++QDF+SES NC+ VIK +W ++ +      GL  L K F  C
Sbjct  252   PILQFDYITPWSSFYDAVSQDFKSESFNCFSVIKATWDVLDERGASDKGLLELSKLFRAC  311

Query  942   KNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKL  763
             K      S+  WLSTA+TYTAM DYPT  NFL  +P YPVK+MCK ID     +D L K 
Sbjct  312   KTVKYAYSIPNWLSTAFTYTAMVDYPTPANFLENLPAYPVKEMCKIIDGFPTNTDILEKA  371

Query  762   YSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDY  583
             ++A ++YYNYTG++  C  +    DPHGL GW WQACTEMIMP+  SN +S+FP S + Y
Sbjct  372   FAAASLYYNYTGDL-TCNPIEDEDDPHGLDGWQWQACTEMIMPMTVSN-ESMFPPSSFSY  429

Query  582   NERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNIS  403
              +R+  C +++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPWS GGVLKNIS
Sbjct  430   KDRSDGCFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNIS  489

Query  402   KSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              S++A+  ++GAHH+D R +TK DP W+ + RR+EVEIIQ WI QY+  + ++
Sbjct  490   SSIIALVTEKGAHHLDFRSATKGDPDWVIEQRRQEVEIIQGWIDQYHQDMAEI  542



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/454 (57%), Positives = 332/454 (73%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F P+SY  F Q+YLIN  +W   +   PIFVY GNEGDI+WF  NT
Sbjct  48    FETRYFPQNLDHFSFKPESYKVFHQKYLINGSFW---RKGGPIFVYTGNEGDIDWFASNT  104

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P G  K++  +++TLGYL+S Q LADYA LI  L
Sbjct  105   GFMSDIAPKFKALLVFIEHRFYGESTPLG--KKSPKTAETLGYLNSQQALADYAILIRSL  162

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +F D I
Sbjct  163   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTSFYDAI  222

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC KVIK SW+ ++ ++    GL  L K F  CK   S+ S   WL +A+ 
Sbjct  223   SQDFKDASVNCVKVIKRSWEELEAVSTMKTGLPELSKKFRTCKGLQSIYSARDWLMSAFV  282

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +Y TA NF+ P+P YPV+QMCK +D    GS  L + ++A ++YYNY+G    CF
Sbjct  283   YTAMVNYATAANFMAPLPAYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGS-KKCF  341

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL GW WQACTEM+MP+  SN+ S+FP  + DY      C   + ++PRP+
Sbjct  342   EMEQPTDDHGLDGWGWQACTEMVMPMSISNQ-SMFPPYDNDYEAFQDQCMGRYGVKPRPH  400

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S+VA+  K+GAHH DLR
Sbjct  401   WITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADLR  460

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              +TK+DP+WLK+ R +EV II++WI+QYY  L +
Sbjct  461   AATKDDPEWLKEQRMQEVTIIEQWITQYYKDLRE  494



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 331/452 (73%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T+YF Q LDHF+F P+S   F Q+YLIN +YW      +PIFVY GNEGDIEWF  NT
Sbjct  54    FKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKG---SPIFVYTGNEGDIEWFAANT  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALL+FIEHRFYG+S+PFG  K++  S+KTLGYL+S Q LAD A LI  L
Sbjct  111   GFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSYQSAKTLGYLNSQQALADLAVLIRSL  168

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGG+LAAWFRLKYPH+ IGALASSAPIL F+ I    +F D +
Sbjct  169   KQNLSSEASPVVVFGGSYGGLLAAWFRLKYPHIAIGALASSAPILQFDKIIPWSSFYDAV  228

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+  S+NCY+VIKGSW  +  I+     L  L K+F  CK+  S  S+  WL TA+ 
Sbjct  229   SLDFKDVSQNCYEVIKGSWAELVAISTRKQALAELSKAFRTCKSLHSTASVLEWLWTAFV  288

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTA+ +YPT  NFL P+P YPV+QMCK ID    G   L++ ++A ++YYNY+ +  NCF
Sbjct  289   YTAIVNYPTEANFLKPLPAYPVQQMCKIIDKSPSGETKLSRAFAAASLYYNYS-QTENCF  347

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++    DPHGL GW WQ CTEM+MP+  SN +S+FP S +DY   A+ C+  + + PRP+
Sbjct  348   EVEYEVDPHGLHGWHWQTCTEMVMPMTCSN-ESMFPPSGFDYKRFAEQCRMKYGVLPRPH  406

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE+VLK+FGSNIIF NG++DPWS GGVL+NIS +++A+  ++GAHHVD R
Sbjct  407   WITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSRGGVLRNISATIIALVTEKGAHHVDFR  466

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK+DP WL   RR+EVEIIQ+W+ +YY  L
Sbjct  467   AATKDDPDWLIQQRRQEVEIIQRWLDEYYVDL  498



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/450 (56%), Positives = 333/450 (74%), Gaps = 3/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+TKYFTQ LDHF+F      TFQQRYLIND+YW GA+ M PIF Y GNEG I+WF  NT
Sbjct  54    YETKYFTQRLDHFSFKNHKNSTFQQRYLINDKYWLGAERMGPIFYYCGNEGYIDWFAVNT  113

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM+DIAP F ALLVF EHR+YG+S+P+G +  A     +L YL++ Q LAD+ATLI+DL
Sbjct  114   GFMWDIAPQFGALLVFPEHRYYGESMPYGSQSMAYKDGDSLSYLTAEQALADFATLIVDL  173

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KKNL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I     F +++
Sbjct  174   KKNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPSDTFYNLV  233

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ESENC+KVI+ SW+ ++   E   GL+ L K F +C++  S   +E WL++AY+
Sbjct  234   SNDFKRESENCFKVIQQSWKALETYGERDEGLQNLSKKFRMCRDLNSTDEIEDWLNSAYS  293

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               AM DYP   +FL P+P YP+K++CK ID  ++G+D L ++++ V++YYNYTGE   CF
Sbjct  294   NLAMVDYPYPASFLMPLPAYPIKEVCKVIDSFSNGTDVLDRIFAGVSVYYNYTGE-EKCF  352

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             D+  + DPHG +GW+WQACTEM+MP+  + + SIFP   +D     + C   F +EPRP+
Sbjct  353   DV--NDDPHGENGWNWQACTEMVMPMSSNPESSIFPQFTFDIESYTKNCLNMFGVEPRPH  410

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +I+RVLK +GSNIIF NGL DPWS GGVL+NIS S+VA+  + GAHH+DLR
Sbjct  411   WITTEFGGQDIKRVLKNYGSNIIFSNGLLDPWSGGGVLQNISNSIVALVTELGAHHLDLR  470

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
              +T+ DP WL + R  E++II KW+++YY 
Sbjct  471   AATENDPLWLVEQRNAEMKIINKWMNEYYQ  500



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/454 (57%), Positives = 333/454 (73%), Gaps = 7/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +   YF QILDHFTF P+S   F+Q+YLIND+YW   +   PIFVY GNEG+I+WF  NT
Sbjct  50    FKAHYFPQILDHFTFLPKSSKVFKQKYLINDKYW---QKGGPIFVYTGNEGNIDWFAANT  106

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F+ALLVFIEHRFYG S+PFG  K++  S KTLGYL+S Q LADYA LI  L
Sbjct  107   GFMLDIAPKFHALLVFIEHRFYGNSMPFG--KKSYKSPKTLGYLNSQQALADYAVLIRSL  164

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLA+WFRLKYPH+ IGA+ASSAPIL F+ IT   +F D +
Sbjct  165   KQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGAVASSAPILQFDKITPWSSFYDAV  224

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW  +  +++   GL ++   F  CK   SV S   WL  A+ 
Sbjct  225   SQDFKESSLNCYEVIKGSWTELNALSKHEEGLTKVSTLFRTCKGLHSVYSARDWLWEAFV  284

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NF+ P+P YPVK+MC+ ID    G+  +++ ++A ++YYNYT +   CF
Sbjct  285   YTAMVNYPTEANFMMPLPAYPVKEMCRIIDGFPKGASKISRAFAAASLYYNYT-QTEKCF  343

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   +D HGL GW WQACTEM+MP+  SN +S+FP S + Y E  + CK+ + +EPRP+
Sbjct  344   NLEGGNDAHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSYSYKEFKEDCKKKYGVEPRPH  402

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS GGVLKNIS S+VA+  ++GAHHVD R
Sbjct  403   WITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISASIVALVTQKGAHHVDFR  462

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
               TK DP WL   R++E+ IIQKW+ +YY  L +
Sbjct  463   SETKNDPDWLIMQRKQEMAIIQKWLEEYYIDLKE  496



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/462 (58%), Positives = 331/462 (72%), Gaps = 9/462 (2%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW-----GGAKNMAPIFVYMGNEGDI  1450
             K +   YF Q LDHFTFTP +   F Q+YL+ND +W      G     PIFVY GNEGDI
Sbjct  80    KPFTAHYFPQELDHFTFTPNASALFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDI  139

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
             EWF  NTGFMF IAP F ALLVFIEHRFYG+S PFG   E+ SS + LGYL+STQ LAD+
Sbjct  140   EWFATNTGFMFHIAPSFGALLVFIEHRFYGESKPFG--NESNSSPEKLGYLTSTQALADF  197

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A LI  LK NL+A  SPVVVFGGSYGGMLA+WFRLKYPHVTIGA+ASSAPIL F+ IT  
Sbjct  198   AVLITSLKHNLSAVSSPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAPILQFDYITPW  257

Query  1089  YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEG  910
              +F D ++QD++SES NC+ VIK +W LI +      GL +L K+F  CK   SV S   
Sbjct  258   SSFYDAVSQDYKSESFNCFSVIKAAWDLIDEKGSTDAGLLQLSKTFRACKTVKSVYSFRN  317

Query  909   WLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT  730
             WL TA+ YTAM DYPT  NFL  +P YP+K+MCK ID    G+D + K ++A ++YYNYT
Sbjct  318   WLWTAFVYTAMVDYPTPANFLMNLPAYPIKEMCKIIDGFPAGADIVDKAFAAASLYYNYT  377

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
             G+   CF L    DPHGLSGW WQACTEM+MP+  SN +S+FP   + Y  ++  C +++
Sbjct  378   GD-QTCFQLEDGEDPHGLSGWGWQACTEMVMPMTISN-ESMFPPFTFTYEGKSDDCFQSY  435

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++G
Sbjct  436   GVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKG  495

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             AHH+D R +TK+DP W+ + RR+EV+IIQ WI QY   L  +
Sbjct  496   AHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQYNEDLAQI  537



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/450 (58%), Positives = 329/450 (73%), Gaps = 8/450 (2%)
 Frame = -1

Query  1581  LDHFTFTPQSYHTFQQRYLINDRYW----GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFD  1414
             LDHFTFTP S   F Q+YL+ND +W     GA  + P+FVY GNEGDIEWF  NTGFMFD
Sbjct  14    LDHFTFTPNSSRVFSQKYLLNDTFWRKPTAGAGGVGPLFVYTGNEGDIEWFATNTGFMFD  73

Query  1413  IAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             IAP F ALLVFIEHR+YG+S PFG   ++ +S+ T+GYL+STQ LAD+A LI  LK+NL+
Sbjct  74    IAPEFGALLVFIEHRYYGESKPFG--NDSYTSADTVGYLTSTQALADFAILITSLKQNLS  131

Query  1233  ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFR  1054
             A D+PVVVFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F++IT   +F+D I+QDF+
Sbjct  132   AVDAPVVVFGGSYGGMLASWFRLKYPHVAMGALASSAPILQFDDITPWSSFNDAISQDFK  191

Query  1053  SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMT  874
             SES NC+ VIK  W L++D      GL  L K+F  CK   SV  L  WL  A+T TAM 
Sbjct  192   SESLNCFSVIKAVWDLLEDKGSNDTGLLELSKTFRACKTVHSVYPLALWLRAAFTTTAMV  251

Query  873   DYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASS  694
             DYPT  NF+  +P YPVK+MCK ID     +D + K ++A ++YYNYTG+   CF++   
Sbjct  252   DYPTPANFMMNLPAYPVKEMCKIIDSFPAEADVIGKAFAAASLYYNYTGD-QKCFEVEGG  310

Query  693   SDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTE  514
              DPHGL GW WQACTEM+MP+  SN +S+FP S +   +R++ C   + + PR +WITTE
Sbjct  311   DDPHGLHGWGWQACTEMVMPMTVSN-ESMFPPSSFSDEKRSEGCHLVYGVRPRMHWITTE  369

Query  513   FGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKE  334
             +GGH I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++GAHH+DLR +TK+
Sbjct  370   YGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDLRSATKD  429

Query  333   DPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             DP WL + RR+EV II  WI QY   +  +
Sbjct  430   DPDWLVEQRRQEVGIIHGWIDQYNKDIAQM  459



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/464 (56%), Positives = 339/464 (73%), Gaps = 7/464 (2%)
 Frame = -1

Query  1644  ASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMG  1465
             A   KA+     Y T YF Q+LDHFTF P+S   F Q+YL+N  YW      APIFVY G
Sbjct  38    AKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKYLVNSHYW---HRGAPIFVYTG  94

Query  1464  NEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQ  1285
             NEGDIEWF  NTGF+ DIAP F ALLVFIEHRFYG+S+PFG +  +  S++TLGYL+S Q
Sbjct  95    NEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGNK--SYKSAETLGYLNSQQ  152

Query  1284  VLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFE  1105
              LAD+A LI  LK NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+
Sbjct  153   ALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFD  212

Query  1104  NITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISV  925
             +IT   +F D ++QDF+  S NCY+VIKGSW  ++ ++ ++ GL  L ++F  C++  S+
Sbjct  213   DITPWSSFYDAVSQDFKEASLNCYEVIKGSWAELEALSAQNEGLAELSRTFRACQDLHSL  272

Query  924   GSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNI  745
              S+  WL +A+ YTAM +YPT  NF+ P+P YPV+ MCK ID    G+  + ++++A ++
Sbjct  273   DSVWEWLWSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASL  332

Query  744   YYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQY  565
             YYNY+     CF L    D HGL GW+WQACTEM+MP+  S ++S+FP S + Y E A+ 
Sbjct  333   YYNYS-RAEKCFKLEHGPDAHGLHGWNWQACTEMVMPMTCS-EESMFPTSSFSYKEFAED  390

Query  564   CKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAI  385
             C + F ++PRP+WITTEFGG  I+ VLK+ G NIIF NG++DPWS GGVLKNIS S++A+
Sbjct  391   CMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIAL  450

Query  384   TAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
               ++GAHHVD R +TK+DP+WLK++RR+EVEIIQ WI QYY  L
Sbjct  451   VTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYYPDL  494



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/452 (58%), Positives = 328/452 (73%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +   YF QILDHFTF P+S   F+Q+YLIND YW   K   PIFVY GNEG+I+WF  NT
Sbjct  50    FKVHYFPQILDHFTFLPKSSKVFKQKYLINDNYW---KQGGPIFVYTGNEGNIDWFAANT  106

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F+ALLVFIEHRFYG S+PFG  K++  S KTLGYL+S Q LADYA LI  L
Sbjct  107   GFMLDIAPKFHALLVFIEHRFYGDSMPFG--KKSYKSPKTLGYLNSQQALADYAVLIRSL  164

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLA+WFRLKYPH+ IGA+ASSAPIL F+ IT   +F D +
Sbjct  165   KQNLSSESSPVVVFGGSYGGMLASWFRLKYPHIAIGAVASSAPILQFDKITPWSSFYDAV  224

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW  +  +++   GL  + K F  CK   SV S   WL  A+ 
Sbjct  225   SQDFKEVSLNCYRVIKGSWTELDALSKHEEGLTEVSKLFRTCKGLHSVYSARDWLWEAFV  284

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NF+ P+P YPV++MCK ID    G+  +++ ++A ++YYNYT     CF
Sbjct  285   YTAMVNYPTKANFMMPLPAYPVQEMCKIIDGLPKGASKISRAFAAASLYYNYTKR-EKCF  343

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    D HGL GW WQACTEM+MP+  SN +S+FP S + Y E  + CK+ + +EPRP+
Sbjct  344   NLEGGDDAHGLHGWDWQACTEMVMPMTCSN-ESMFPPSSYSYKEFKEDCKKKYGVEPRPH  402

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS GGVLKNIS S+VA+  ++GAHHVD R
Sbjct  403   WITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISASIVALVTQKGAHHVDFR  462

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
               TK DP WL   R++E  IIQKW+ +YY  L
Sbjct  463   SETKNDPGWLIMQRKQEAAIIQKWLEEYYRDL  494



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/452 (57%), Positives = 337/452 (75%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T++F QILDHFT+ P+SY  F Q+YLIN ++W    + APIFVY GNEG+IEWF  NT
Sbjct  56    FKTQFFPQILDHFTYNPKSYIIFYQKYLINSQFW---HHGAPIFVYTGNEGNIEWFAANT  112

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ DIAP F ALLVFIEHR+YG+S+PFG  K++ +S++T+GYL+S Q LADYA LI  L
Sbjct  113   GFLLDIAPKFRALLVFIEHRYYGESLPFG--KDSYNSAETVGYLNSQQALADYAVLIRSL  170

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL+F++I    +F D +
Sbjct  171   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILHFDDIIPQTSFYDAV  230

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+S S NCY+VIKGSW  +   + +  GL  L K+F  CK   SV + + WL  A+ 
Sbjct  231   SQDFKSVSLNCYQVIKGSWAELAAFSSQGQGLAELSKNFKSCKGLHSVDAAQNWLWAAFV  290

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NF+  +P YPVK+MCK ID    G   L+K ++A ++YYNY+ +   CF
Sbjct  291   YTAMVNYPTEANFMMHLPAYPVKEMCKIIDALPPGETKLSKAFAAASLYYNYS-QTEKCF  349

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             D+   SD HGL GW WQACTEM+MP+  S+ +S+F    ++Y+  A+ C + + + PRP+
Sbjct  350   DIEHGSDAHGLHGWDWQACTEMVMPMSCSS-ESMFTPYSYNYSAFAEQCMKNYGVTPRPH  408

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WI TEFGG  IE++LK+FGSNIIF NG++DPWS GGVLKNIS S+VA+  +EGAHHVD R
Sbjct  409   WIATEFGGKQIEKILKRFGSNIIFSNGMQDPWSRGGVLKNISASIVALVTEEGAHHVDFR  468

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             F+TK+DP WL + R++EV+IIQ WI +YY  L
Sbjct  469   FATKDDPNWLVEQRKQEVDIIQSWIDEYYADL  500



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 335/449 (75%), Gaps = 7/449 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T YF Q LDHFTF PQSY  F Q+YLIN  +W   +  APIFVY GNEGDI+WF  NT
Sbjct  54    YETHYFPQNLDHFTFLPQSYRIFNQKYLINRDFW---QKGAPIFVYTGNEGDIDWFAANT  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ D+AP F ALLVFIEHR+YG+S PFG  K++  S+K LGYL+S Q +AD+A LI  L
Sbjct  111   GFLLDVAPRFRALLVFIEHRYYGESKPFG--KDSYKSAKKLGYLNSQQAMADFALLIRSL  168

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F++IT   +F D +
Sbjct  169   KHNLSSDSSPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDDITPWSSFYDAV  228

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW  ++DI     GL  L ++F  CK   S+ S   WL  A+ 
Sbjct  229   SQDFKDASLNCYEVIKGSWAELEDIPRYKQGLAELSRNFRACKEVRSIYSARDWLWEAFV  288

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AMT+YPT +NF+ P+P +PVKQMCK ID  +  +  L++++ A ++YYNY+     CF
Sbjct  289   YVAMTNYPTESNFIKPLPAHPVKQMCKIIDGLSPETTKLSRVFEAASLYYNYS-RTEKCF  347

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L + +D HGL GW+WQACTEM+MP+  SN +S+FP  ++ Y + +  C + + + PRP+
Sbjct  348   ELENENDDHGLHGWNWQACTEMVMPMSISN-ESMFPPYQFSYKDFSDDCLKNYGVRPRPH  406

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG NIE+VLK+FGSNIIF NGL+DPWS G VLKNIS S+VA+ A++GAHH DLR
Sbjct  407   WITTEFGGTNIEQVLKRFGSNIIFSNGLQDPWSRGSVLKNISTSIVALVAEKGAHHTDLR  466

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T++DP WL + R++E+EIIQKWIS YY
Sbjct  467   RATRKDPDWLIEQRKQEIEIIQKWISDYY  495



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 331/462 (72%), Gaps = 9/462 (2%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW-----GGAKNMAPIFVYMGNEGDI  1450
             K +   YF Q LDHFTFTP +   F Q+YL+ND +W      G     PIFVY GNEGDI
Sbjct  80    KPFTAHYFPQELDHFTFTPNASAVFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDI  139

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
             EWF  NTGFMFDIAP F ALLVFIEHRFYG+S PFG   E+ SS + LGYL+STQ LAD+
Sbjct  140   EWFATNTGFMFDIAPSFGALLVFIEHRFYGESKPFG--NESNSSPEKLGYLTSTQALADF  197

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A LI  LK NL+A  SPVVVFGGSYGGMLA+WFRLKYPHVTIGA+ASSAPIL F+ IT  
Sbjct  198   AVLITSLKHNLSAVSSPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAPILQFDYITPW  257

Query  1089  YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEG  910
              +F + ++QD++SES NC+ VIK +W LI +      GL +L K+F  CK   SV S   
Sbjct  258   SSFYEAVSQDYKSESFNCFSVIKAAWDLIDERGSTDAGLLQLSKTFRACKTVKSVYSFRN  317

Query  909   WLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT  730
             WL TA+ YTAM DYPT  NFL  +P YP+K+MCK I     G+D + K ++A ++YYNYT
Sbjct  318   WLWTAFVYTAMVDYPTPANFLMNLPAYPIKEMCKIIHGFPAGADIVDKAFAAASLYYNYT  377

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
             G+   CF L    DPHGLSGW WQACTEM+MP+  SN +S+FP   + Y  ++  C +++
Sbjct  378   GD-QTCFQLEDGEDPHGLSGWGWQACTEMVMPMTISN-ESMFPPFTFTYEGKSDDCFQSY  435

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++G
Sbjct  436   GVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKG  495

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             AHH+D R +TK+DP W+ + RR+EV+IIQ WI QY   L  +
Sbjct  496   AHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQYNEDLAQI  537



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/485 (55%), Positives = 347/485 (72%), Gaps = 14/485 (3%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPN-GLSASSAKAADNHKL-YDTKYFTQILDHFTFTPQSYHTFQQRY  1528
             ++ PTF       RP+ G S +    A   K+ Y T YF Q+LDHFTF P+S   F Q+Y
Sbjct  22    QSVPTF-----FPRPSYGQSLAKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKY  76

Query  1527  LINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVP  1348
             L+N  YW      APIFVY GNEGDIEWF  NTGF+ DIAP F ALLVFIEHRFYG+S+P
Sbjct  77    LVNSHYW---HRGAPIFVYTGNEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMP  133

Query  1347  FGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFR  1168
             FG +  +  S++TLGYL+S Q LAD+A LI  LK NL++  SPVVVFGGSYGGMLAAWFR
Sbjct  134   FGNK--SYKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPVVVFGGSYGGMLAAWFR  191

Query  1167  LKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAE  988
             LKYPH+ IGALASSAPIL F++IT   +F D ++QDF+  S NCY+VIKGSW  ++ ++ 
Sbjct  192   LKYPHIAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASSNCYEVIKGSWAELEALSA  251

Query  987   ESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
             +  GL  L ++F  C++  S+ S+  WL +A+ YTAM +YPT  NF+ P+P YPV+ MCK
Sbjct  252   QKEGLAELSRTFRACQDLHSLDSVWEWLWSAFVYTAMVNYPTEANFMMPLPAYPVQAMCK  311

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG  628
              ID    G+  + ++++A ++YYNY+     CF L    D HGL GW+WQACTEM+MP+ 
Sbjct  312   IIDGFPSGASKITRVFAAASLYYNYS-RAEKCFKLEHGPDAHGLHGWNWQACTEMVMPMT  370

Query  627   GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  448
              S ++S+FP S + Y E A+ C + F ++PR +WITTEFGG  I+ VLK+ G NIIF NG
Sbjct  371   CS-EESMFPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNG  429

Query  447   LRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQ  268
             ++DPWS GGVLKNIS S++A+  ++GAHHVD R +TK+DP+WLK++RR+EVEIIQ WI Q
Sbjct  430   MQDPWSRGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQ  489

Query  267   YYHSL  253
             YY  L
Sbjct  490   YYPDL  494



>gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/458 (57%), Positives = 344/458 (75%), Gaps = 10/458 (2%)
 Frame = -1

Query  1620  NHKL-YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEW  1444
             N K+ Y T YF QILDHFTF P+SY  F Q+YLIN +YW      APIFVY GNEGDI+W
Sbjct  45    NQKIPYKTHYFPQILDHFTFQPKSYEIFYQKYLINGQYW---HRGAPIFVYTGNEGDIDW  101

Query  1443  FTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYAT  1264
             F  NTGF+ DIAP F ALLVFIEHRFYG+S+PFG  K++ +S++TLGYL+S Q LAD++ 
Sbjct  102   FAANTGFLLDIAPKFRALLVFIEHRFYGESLPFG--KDSYNSAETLGYLNSQQALADFSV  159

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             LI  LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGA+ASSAPIL F++IT   +
Sbjct  160   LIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGAVASSAPILQFDDITPRSS  219

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F D ++QD++  S NCY+VIKGSW  ++  + +  GL  L ++F  CK+  S+  +  WL
Sbjct  220   FYDAVSQDYKEASLNCYEVIKGSWTELEAFSAQKEGLHELSRTFRTCKDLRSLDFVWDWL  279

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT-G  727
              +A+ YTAM +YPT  NF+ P+P YPVK+MCK ID    G+  ++++++A ++YYNY+ G
Sbjct  280   WSAFVYTAMMNYPTEANFMMPLPAYPVKEMCKIIDGFPPGASKISRVFAAASLYYNYSHG  339

Query  726   EVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFK  547
             E   CF+L +  D HGL GW+WQACTEM+MP+  S K+S+FP S +DY E ++ CK+ + 
Sbjct  340   E--KCFELENEHDAHGLHGWNWQACTEMVMPMTCS-KESMFPPSGFDYKEFSKGCKKKYG  396

Query  546   IEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGA  367
             + PRP+WITTE+GG  I++VLK+ G NIIF NG++DPWS GGVLKNIS S++A+   +GA
Sbjct  397   VMPRPHWITTEYGGKRIDQVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIALVTDKGA  456

Query  366   HHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             HHVD R S K+DP WL+++R +EVEII KWI +YY  L
Sbjct  457   HHVDFRSSMKDDPYWLRELRSQEVEIISKWIDEYYADL  494



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/452 (58%), Positives = 332/452 (73%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+FTP+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  47    FETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P G  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  104   GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  161

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASS+PIL+F+ I    +F D +
Sbjct  162   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSSPILHFDKIVPLTSFYDAV  221

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  +  +  GL+ L K F  CK   S+ S   WLS A+ 
Sbjct  222   SQDFKDASINCFKVIKKSWEELDAVTNKKNGLQELSKKFRTCKGLHSIYSASNWLSGAFV  281

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPTA NF+ P+P YPV+QMCK +D    GS  L + ++A ++YYNY+G    CF
Sbjct  282   YTAMVNYPTAANFMAPLPGYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  340

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL GW +QACTEM+MP+  SN+ S+ P  E DY    + C   + ++PRP+
Sbjct  341   EMEQQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDYEAFEEQCMSRYGVKPRPH  399

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S+VA+  K+GAHH DLR
Sbjct  400   WITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADLR  459

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK DP+WLK+ R +EV II+KWIS+YY  L
Sbjct  460   AATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491


 Score =   355 bits (912),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 219/317 (69%), Gaps = 10/317 (3%)
 Frame = -1

Query  1173  FRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDI  994
             FRLKYPH+ IGALASS+PIL+F+ I    +F D ++QDF+  S NC+KVIK SW+ +  +
Sbjct  494   FRLKYPHIAIGALASSSPILHFDKIVPLTSFYDAVSQDFKDASINCFKVIKKSWEELDAV  553

Query  993   AEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQM  814
               +  GL+ L K F  CK   S+ S   WLS A+ YTAM +YPTA NF+ P+P YPV+QM
Sbjct  554   TNKKNGLQELSKKFRTCKGLHSIYSASNWLSGAFVYTAMVNYPTAANFMAPLPGYPVEQM  613

Query  813   CKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMP  634
             CK +D    GS  L + ++A ++YYNY+G    CF++   +D HGL GW +QACTEM+MP
Sbjct  614   CKIVDGFPRGSSNLDRAFAAASLYYNYSGS-EKCFEMEQQTDDHGLDGWQYQACTEMVMP  672

Query  633   LGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFF  454
             +  SN+ S+ P  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF 
Sbjct  673   MSCSNQ-SMLPPYENDYEAFEEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFS  731

Query  453   NGLRDPWSAGG--------VLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKE  298
             NGL+DPWS GG        VLKNIS S+VA+  K+GAHH DLR +TK DP+WLK+ R +E
Sbjct  732   NGLQDPWSRGGSVLTSNFRVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQE  791

Query  297   VEIIQKWISQYYHSLTD  247
             V II+KWIS+YY  L +
Sbjct  792   VAIIEKWISEYYRDLRE  808



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/465 (57%), Positives = 330/465 (71%), Gaps = 7/465 (2%)
 Frame = -1

Query  1656  NGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIF  1477
             + L     K+A     Y+  YF Q+LDHFTF P+SY  F Q+YL+N +YW      APIF
Sbjct  33    SSLLKKQVKSAKPEIPYEAHYFPQVLDHFTFRPRSYKIFYQKYLMNSQYWHEG---APIF  89

Query  1476  VYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYL  1297
             VY GNEGDIEWF  NTGFM DIAP F ALLVFIEHRFYG+S+PF   K+  +S+KTLGYL
Sbjct  90    VYTGNEGDIEWFAANTGFMLDIAPKFRALLVFIEHRFYGESLPF--HKKDLNSAKTLGYL  147

Query  1296  SSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPI  1117
             SS Q LADYA LI  LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPI
Sbjct  148   SSQQALADYAVLIRSLKRNLSSEASPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPI  207

Query  1116  LYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKN  937
             L F++IT   +F D ++QDF+  S NCY+VIKG+W  +    +   GLE+L K F  CK 
Sbjct  208   LQFDDITPWSSFYDAVSQDFKEASLNCYEVIKGAWTELDAFGKRKDGLEKLSKMFRACKK  267

Query  936   YISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYS  757
               SV     WL +A+TYTAM +YP   NF+  +P YPV++MCK ID  +  +  L++  +
Sbjct  268   LSSVDYARNWLWSAFTYTAMVNYPMEANFMKHLPAYPVEEMCKIIDGHSPRATKLSRAVA  327

Query  756   AVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNE  577
             A ++YYNY+ +   CF L    + HGL GW+WQACTEM+MP+  SN  S+FP S + Y E
Sbjct  328   AASLYYNYS-KTEKCFKLEDEDNDHGLQGWNWQACTEMVMPMTCSN-GSMFPPSPYSYKE  385

Query  576   RAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKS  397
              A  C   F + PR +WITTEFGG  I  VLK+FGSNIIF NG++DPWS GGVLKNIS S
Sbjct  386   FADDCNRQFGVWPREHWITTEFGGMRINLVLKRFGSNIIFSNGMQDPWSRGGVLKNISSS  445

Query  396   LVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             +VA+  ++GAHHVD R +T +DP+WL D RR+EVEIIQKW+ +YY
Sbjct  446   IVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKWLQEYY  490



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/467 (53%), Positives = 336/467 (72%), Gaps = 7/467 (1%)
 Frame = -1

Query  1659  PNGLSASSAKAADNHK--LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMA  1486
             P  L   S     NH+   Y+T+YF+Q LDHF+F+      F+QRYLIN  +W GA  + 
Sbjct  39    PRFLGKHSHSIKTNHQQYRYETRYFSQRLDHFSFS--DLPNFRQRYLINTEHWVGASRLG  96

Query  1485  PIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL  1306
             PIF+Y GNEGDIEWF  NTGF++DIAPHF A+++F EHR+YG+S+P+G ++EA  ++ TL
Sbjct  97    PIFLYCGNEGDIEWFAVNTGFVWDIAPHFGAMVLFPEHRYYGESMPYGSKEEAYKNATTL  156

Query  1305  GYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS  1126
              YL++ Q LAD+A LI DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASS
Sbjct  157   SYLTTEQALADFAVLITDLKRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASS  216

Query  1125  APILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNI  946
             APIL FE+I  P  F ++++  F+ ES +C+  IK SW  +    +   GL++L ++F++
Sbjct  217   APILQFEDIVPPDTFYNIVSNSFKHESNSCFDTIKQSWNALTSAGQREDGLQQLSQTFHL  276

Query  945   CKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAK  766
             C+   SV  L  WL +AY+Y  M +YP  +NFL P+P +P++++C+ ID    GS  L +
Sbjct  277   CRELKSVEDLSNWLESAYSYLGMVNYPYPSNFLMPLPGHPIREVCRKIDSSPDGSSILER  336

Query  765   LYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWD  586
             +++ V++YYNYTGEV +CF L    DPHG+ GW+WQACTEM+MP+      S+FPA ++D
Sbjct  337   IFNGVSVYYNYTGEV-DCFQL--DDDPHGMDGWNWQACTEMVMPMSSDRNTSMFPAYDYD  393

Query  585   YNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNI  406
             Y+   + C+  F++ PRP WITTEFGGH+IE VLK FGSNIIF NGL DPWS GGVLKNI
Sbjct  394   YSAFQEECRRDFQVTPRPRWITTEFGGHDIEHVLKFFGSNIIFSNGLLDPWSGGGVLKNI  453

Query  405   SKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             S+++VA+  +EGAHH+DLR ST EDP WL + R  E+E+I+ W+  Y
Sbjct  454   SQTIVALVTEEGAHHIDLRASTTEDPDWLVEQRETEIELIEGWLDNY  500



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/482 (55%), Positives = 343/482 (71%), Gaps = 12/482 (2%)
 Frame = -1

Query  1668  INRPNGLSAS--SAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW----  1507
             + RP+  SA   +  A  + K +   YF Q+LDHF FTP +   F+ +YL+ND +W    
Sbjct  62    LRRPSSSSAELVAGPANASTKPFTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPG  121

Query  1506  --GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
                G     P+FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIEHRFYG+S PFG   
Sbjct  122   AGAGDDGPGPLFVYTGNEGDIEWFATNTGFMFDIAPTFGALLVFIEHRFYGESKPFG--N  179

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             ++  S++TLGYL+STQ LAD+A +I  LK++L A  +PVVVFGGSYGGMLA+WFRLKYPH
Sbjct  180   DSYRSAETLGYLTSTQALADFAVVIRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPH  239

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             V IGALASSAPIL F++IT   +F D ++QDF+SES NC+ VI+ +W ++ +      GL
Sbjct  240   VAIGALASSAPILQFDHITPWSSFYDAVSQDFKSESSNCFGVIRAAWDVLDERGATDKGL  299

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
               L K F  CK      S+  WL TA+TYTAM DYPT  NFL  +P YPVK+MCK ID  
Sbjct  300   LDLSKLFRACKTVKYAYSIRNWLWTAFTYTAMVDYPTPANFLENLPAYPVKEMCKTIDAF  359

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
               G+D L K ++A ++YYNYTG+   C  +    DPHGL GW WQACTEMIMP+  SN +
Sbjct  360   PAGADVLEKAFAAASLYYNYTGD-QACNKIEDGDDPHGLDGWQWQACTEMIMPMTISN-E  417

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FP S + Y++R+  C +++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPW
Sbjct  418   SMFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPW  477

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S GGVLKNIS S++A+  ++GAHH+DLR STK DP WL + RR+EVEIIQ WI QY+  +
Sbjct  478   SRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQDM  537

Query  252   TD  247
              +
Sbjct  538   AE  539



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/477 (53%), Positives = 338/477 (71%), Gaps = 8/477 (2%)
 Frame = -1

Query  1695  TPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLIND  1516
             +P FP  ++ +R    S    +       Y+T+YF+Q LDHF+F      TF QRYLIN 
Sbjct  37    SPRFPRYSVWHR---TSTQPLRRDQPEYQYETRYFSQRLDHFSFA--DLPTFSQRYLINF  91

Query  1515  RYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGE  1336
              +W G   + PIF+Y GNEGDIEWF  N+GFM++IAP F ALLVF EHR+YG+S+PFGG 
Sbjct  92    DHWLGPARLGPIFLYCGNEGDIEWFATNSGFMWEIAPKFGALLVFPEHRYYGESMPFGGR  151

Query  1335  KEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYP  1156
             +EA  ++ TL YL++ Q LAD+A  I DLK+NL+A   PVV+FGGSYGGMLAAW RLKYP
Sbjct  152   EEAYKNASTLSYLTTEQALADFAVFITDLKRNLSAESCPVVLFGGSYGGMLAAWMRLKYP  211

Query  1155  HVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGG  976
             H+ IGALASSAPIL FE+I  P  F D+++ DFR ES +C+  IK SW  I +  ++  G
Sbjct  212   HIAIGALASSAPILQFEDIVPPETFYDIVSNDFRRESTSCFNTIKESWDAITEEGQKENG  271

Query  975   LERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDD  796
             L+RL K+F+ C+   S   L  WLS+AY+Y AM DYP   NF+ PMP +P++++C+ +D+
Sbjct  272   LQRLTKTFHFCRELKSTDDLADWLSSAYSYLAMVDYPYPANFMMPMPGHPIREVCRRVDE  331

Query  795   PNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNK  616
              + G+  L ++++ V++YYNYTG V  CF L    DPHGL GW +QACTEM+MP+  S +
Sbjct  332   SHDGTSILDRIFAGVSVYYNYTGNV-GCFKL--DDDPHGLDGWDFQACTEMVMPMSSSKE  388

Query  615   DSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  436
             +S+FP  +++Y+   + C + F++ PRP WITTEFGGH IE +LK FGSNIIF NGL DP
Sbjct  389   NSMFPTYDFNYSSYKEECWDMFRVIPRPRWITTEFGGHGIETILKMFGSNIIFSNGLLDP  448

Query  435   WSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             WS G +LKNIS+++VA+  KEGAHH+DLR ST EDP+WL + R  E+ +IQ WI+ Y
Sbjct  449   WSGGSILKNISETIVALVTKEGAHHLDLRPSTPEDPQWLVEQREAEIRVIQGWINSY  505



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/482 (55%), Positives = 343/482 (71%), Gaps = 12/482 (2%)
 Frame = -1

Query  1668  INRPNGLSAS--SAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW----  1507
             + RP+  SA   +  A  + K +   YF Q+LDHF FTP +   F+ +YL+ND +W    
Sbjct  62    LRRPSSSSAELVAGPANASTKPFTAHYFPQLLDHFAFTPNASTVFRHKYLLNDTFWRRPG  121

Query  1506  --GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
                G     P+FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIEH+FYG+S PFG   
Sbjct  122   AGAGDDGPGPLFVYTGNEGDIEWFATNTGFMFDIAPTFGALLVFIEHQFYGESKPFG--N  179

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             ++  S++TLGYL+STQ LAD+A +I  LK++L A  +PVVVFGGSYGGMLA+WFRLKYPH
Sbjct  180   DSYRSAETLGYLTSTQALADFAVVIRGLKRDLGAEAAPVVVFGGSYGGMLASWFRLKYPH  239

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             V IGALASSAPIL F++IT   +F D ++QDF+SES NC+ VI+ +W ++ +      GL
Sbjct  240   VAIGALASSAPILQFDHITPWSSFYDAVSQDFKSESSNCFGVIRAAWDVLDERGATDKGL  299

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
               L K F  CK      S+  WL TA+TYTAM DYPT  NFL  +P YPVK+MCK ID  
Sbjct  300   LDLSKLFRACKTVKYAYSIRNWLWTAFTYTAMVDYPTPANFLENLPAYPVKEMCKTIDAF  359

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
               G+D L K ++A ++YYNYTG+   C  +    DPHGL GW WQACTEMIMP+  SN +
Sbjct  360   PAGADVLEKAFAAASLYYNYTGD-QACNKIEDGDDPHGLDGWQWQACTEMIMPMTISN-E  417

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FP S + Y++R+  C +++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPW
Sbjct  418   SMFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPW  477

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S GGVLKNIS S++A+  ++GAHH+DLR STK DP WL + RR+EVEIIQ WI QY+  +
Sbjct  478   SRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQDM  537

Query  252   TD  247
              +
Sbjct  538   AE  539



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/509 (54%), Positives = 351/509 (69%), Gaps = 46/509 (9%)
 Frame = -1

Query  1677  STIINRPNGLSASSAKAADNHKL---YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW  1507
             ST I  P     S  K A + KL   Y T++F Q+LDHFTF PQS   F Q+YLIND YW
Sbjct  22    STQIFFPRATHQSLIKQAKDPKLSIPYKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYW  81

Query  1506  GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEA  1327
                ++ APIFVY GNEG+IEWF +NTGFM DIAP F ALLVFIEHRFYG+S+PFG  K++
Sbjct  82    ---EHGAPIFVYTGNEGNIEWFAENTGFMLDIAPKFRALLVFIEHRFYGESLPFG--KDS  136

Query  1326  KSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVT  1147
               S+KTLGYL+S Q LAD+A LI  +K NL +  SPV+VFGGSYGGMLAAWFRLKYPHV 
Sbjct  137   YKSAKTLGYLNSQQALADFAVLIQSMK-NLLSEVSPVLVFGGSYGGMLAAWFRLKYPHVA  195

Query  1146  IGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLER  967
             +GALASSAPIL F++IT   +F D +TQDF+  S+NCY+VIKGSW  +Q ++E+  GL  
Sbjct  196   LGALASSAPILQFDDITPWTSFYDAVTQDFKDASQNCYEVIKGSWAELQAVSEQK-GLAE  254

Query  966   LRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNH  787
             L +SF  C+N  S+ S   WL TA+ YTAM +YPT  NF+ P+P YPV++MCK ID    
Sbjct  255   LSRSFRSCENLHSMYSARNWLWTAFVYTAMVNYPTEANFMMPLPAYPVREMCKIIDGFPP  314

Query  786   GSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSI  607
              +  L+++ +A ++YYNY+     CF + +++D HGL GW WQACTEM+MP+  S KDS+
Sbjct  315   RATKLSRVVAAASLYYNYS-RTEKCFKIENATDAHGLHGWDWQACTEMVMPMTCS-KDSM  372

Query  606   FPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  427
             FP S +DY   ++ C   + + PRP+WITTEFGG+ IE+VLK+FGSNIIF NG++DPWS 
Sbjct  373   FPPSTFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSR  432

Query  426   G----------------------------------GVLKNISKSLVAITAKEGAHHVDLR  349
             G                                   VLKNIS S++A+  ++GAHHVD R
Sbjct  433   GRFQGKSFSEMKCEALSLFVFFFLEKNGTVMECPLSVLKNISASIIALATEKGAHHVDFR  492

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +TKEDP WL + RR+EVEIIQ+WI++Y+
Sbjct  493   SATKEDPDWLVEQRRQEVEIIQRWINEYH  521



>gb|EMT13135.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=515

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/456 (56%), Positives = 326/456 (71%), Gaps = 14/456 (3%)
 Frame = -1

Query  1581  LDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPH  1402
             LDHFTFTP S H F Q+YL+ND +W       P+FVY GNEG+IEWF  NTGFMFDIAP 
Sbjct  64    LDHFTFTPNSSHLFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFATNTGFMFDIAPE  123

Query  1401  FNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDS  1222
             F ALLVFIEHRFYG+S+PFG      SS+ TLGYL+STQ LAD+A LI  LK+NL+A D+
Sbjct  124   FGALLVFIEHRFYGESMPFG--DGPYSSADTLGYLTSTQALADFAVLITSLKQNLSAVDA  181

Query  1221  PVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESE  1042
             PV+VFGGSYGGMLA+WFRLKYPHV +GA+ASSAPIL F++IT   +F D ++QDF+SES 
Sbjct  182   PVIVFGGSYGGMLASWFRLKYPHVAMGAVASSAPILQFDDITPWSSFYDAVSQDFKSESL  241

Query  1041  NCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPT  862
             NC++VIK  W ++ D      GL  L K+F  CK   S  SL  WL  A+TYTAM DYPT
Sbjct  242   NCFRVIKAVWDVLDDRGSNHTGLLELSKTFRACKTVQSADSLSNWLWNAFTYTAMVDYPT  301

Query  861   ATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPH  682
               NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNY+G+   CF++    DPH
Sbjct  302   PANFMMNLPAYPVKEMCKIIDSFPVGADVIDKAFAAASLYYNYSGD-QKCFEMEGGDDPH  360

Query  681   GLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGH  502
             GL GW WQACTEM+MP+  SN +S+FP   + Y   ++ C   + + PR +WITTE+GGH
Sbjct  361   GLDGWGWQACTEMVMPMIVSN-ESMFPPFSFSYENNSEGCLAYYGVRPRIHWITTEYGGH  419

Query  501   NIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAK----------EGAHHVDL  352
              I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  +          +GAHH+D 
Sbjct  420   KIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTENGKHEFKENMQGAHHLDF  479

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             R +TK+DP+W+ + RR+EVEII  WI QY   +  +
Sbjct  480   RSATKDDPEWVVEQRRQEVEIIHGWIDQYNKDIAQM  515



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/472 (55%), Positives = 328/472 (69%), Gaps = 30/472 (6%)
 Frame = -1

Query  1581  LDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPH  1402
             LDHFTFTP +   F  +YL+ND +W       P+FVY GNEGDIEWFT NTGFMFDIAP 
Sbjct  72    LDHFTFTPNASRLFSHKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFTTNTGFMFDIAPE  131

Query  1401  FNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDS  1222
             F ALLVFIEHRFYG+S PFG   ++  S+ TLGYL+STQ LAD+A LI  LK+NL+A D+
Sbjct  132   FGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSLKQNLSAVDA  189

Query  1221  PVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRS---  1051
             PVVVFGGSYGGMLA+WFRLKYPHV +GALASSAPIL F++IT   +F D ++QDF+S   
Sbjct  190   PVVVFGGSYGGMLASWFRLKYPHVAMGALASSAPILQFDDITPWSSFYDAVSQDFKSFSK  249

Query  1050  -----------------------ESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICK  940
                                    ES NC+ VIK  W ++        GL  L K+F  CK
Sbjct  250   AEVSKKDTAAYFADCNIQLILQSESLNCFSVIKAVWDVLDYRGSNDSGLLELSKTFRACK  309

Query  939   NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLY  760
                   SL  WL TA+TYTAM DYPT  NF+  +P YPVK+MCK ID    G+D + K +
Sbjct  310   TVRFPSSLSNWLWTAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPVGADVVEKAF  369

Query  759   SAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYN  580
             +A ++YYNYTG+   CF++    DPHGLSGW WQACTEM+MP+  SN +S+FP S + Y 
Sbjct  370   TAASLYYNYTGD-QKCFEMEGGDDPHGLSGWGWQACTEMVMPMTVSN-ESMFPPSGFSYE  427

Query  579   ERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISK  400
             E+++ C  ++++ PR NWITTE+GGH I++VLK+FGSNIIF NG+RDPWS GGVLKNIS 
Sbjct  428   EKSEGCFASYEVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISS  487

Query  399   SLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             S++A+  ++GAHH+D R +TK+DP W+ + RR+EVEII  WI QY   +  +
Sbjct  488   SIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDIAQM  539



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/470 (56%), Positives = 335/470 (71%), Gaps = 14/470 (3%)
 Frame = -1

Query  1662  RPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP  1483
             R N  ++ S      H  + T+YF Q LDHF+F P+SY  F Q+YLI+  +W   +   P
Sbjct  35    RQNSKTSKSKAELPFH--FQTRYFPQNLDHFSFQPESYRIFHQKYLISSHFW---RKGGP  89

Query  1482  IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLG  1303
             IFVY GNEGDIEWF  NTGFM DIAP F ALLVFIEHRFYG+S P        + +KTLG
Sbjct  90    IFVYTGNEGDIEWFASNTGFMLDIAPKFQALLVFIEHRFYGESKP-------HNLAKTLG  142

Query  1302  YLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  1123
             YL+S Q LADYA LI  LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSA
Sbjct  143   YLNSQQALADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSA  202

Query  1122  PILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC  943
             PIL F+ I    +F +V++QDF+  S NC++VIK SW+ ++  +    GL+ L K F  C
Sbjct  203   PILQFDKIVPSSSFYNVVSQDFKDASLNCFEVIKKSWRELEVFSTMKDGLQELSKKFRTC  262

Query  942   KNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKL  763
             K+  +V     WL TA+T TAM +YPT  NF+ P+P YPV++MCK ID     +  L + 
Sbjct  263   KDLHAVYLASRWLETAFTDTAMVNYPTPANFMAPLPAYPVEEMCKIIDWFPLEASNLDRA  322

Query  762   YSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDY  583
             ++A ++YYNY+G   NCFD+ + +DPHGL+GW WQACTEM+MP+  SN+ S+F   E+D 
Sbjct  323   FAAASLYYNYSGS-ENCFDIENQTDPHGLNGWYWQACTEMVMPISCSNQ-SMFQPFEYDE  380

Query  582   NERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNIS  403
                 + C + + ++PRP+WITTEFGGH IE VLK+FGSNIIF NG++DPWS  GVLKNIS
Sbjct  381   KVDQEDCLKEYGVKPRPHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNIS  440

Query  402   KSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              S++A   K+GAHH DLR +TK+DP+WLK+ RR+EV  I+KWIS+YY  L
Sbjct  441   SSIIAFVTKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKWISEYYSDL  490



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/479 (52%), Positives = 332/479 (69%), Gaps = 8/479 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP     N  N       +   N   Y+TK+F+Q LDHF+F       FQQRYLI
Sbjct  24    KLLPRFP---RYNNQNRARIKPFRGDRNEYRYETKFFSQQLDHFSFA--DLPKFQQRYLI  78

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N  +W GA ++APIF+Y GNEGDIEWF  N+GF++DIAP F ALLVF EHR+YG+S+P+G
Sbjct  79    NSDHWLGASSLAPIFLYCGNEGDIEWFATNSGFIWDIAPKFGALLVFPEHRYYGESMPYG  138

Query  1341  GEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLK  1162
                EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLK
Sbjct  139   SRDEAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLK  198

Query  1161  YPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEES  982
             YPH+ IGALASSAPIL FE+I  P  F D+ + DF+ ES +C+  IK SW  I    ++ 
Sbjct  199   YPHIAIGALASSAPILQFEDIVPPETFYDIASNDFKRESISCFNTIKNSWDAIIAEGQKE  258

Query  981   GGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAI  802
              GL++L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P +P++++C+ I
Sbjct  259   NGLQQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCRKI  318

Query  801   DDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGS  622
             D  N  +  L ++Y+ V++YYNYTG V +CF+L    DPHGL GW+WQACTEM+MP+  S
Sbjct  319   DGANSDASILDRIYAGVSVYYNYTGNV-DCFEL--DDDPHGLDGWNWQACTEMVMPMSSS  375

Query  621   NKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLR  442
              ++S+FPA +++Y+   + C + F++ PRP W TTEFGGH+IE  LK FGSNIIF NGL 
Sbjct  376   QENSMFPADDFNYSSYKEECWDTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGLL  435

Query  441   DPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             DPWS G VLKN+S ++VA+  KEGAHH+DLR ST  DPKWL D R  E+ +I+ WI  Y
Sbjct  436   DPWSGGSVLKNLSDTIVALVTKEGAHHLDLRPSTPNDPKWLVDQREAEIGLIEGWIETY  494



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 330/476 (69%), Gaps = 8/476 (2%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP  TI NR         +   N   Y+TK+F+Q LDHF+F       F QRYLIN  
Sbjct  36    PRFPRYTIQNRAR---IKPFRGVRNEYRYETKFFSQQLDHFSFA--DLPKFPQRYLINSD  90

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             +W GA  +APIF+Y GNEGDIEWF  N+GF+++IAP F ALLVF EHR+YG+S+P+G   
Sbjct  91    HWLGASALAPIFLYCGNEGDIEWFATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSRD  150

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH
Sbjct  151   EAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLKYPH  210

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             + IGALASSAPIL FE+I  P  F D+ + DF+ ES +C+  IK SW  I    ++  GL
Sbjct  211   IAIGALASSAPILQFEDIVPPETFYDIASNDFKRESISCFNTIKNSWDAIIAEGQKENGL  270

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
             ++L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P  P++++C+ ID  
Sbjct  271   QQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGDPIREVCRKIDGA  330

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
             N  +  L ++Y+ V++YYNYTG + +CF+L    DPHGL GW+WQACTEM+MP+  S  +
Sbjct  331   NSDATVLDRIYAGVSVYYNYTGNI-DCFEL--DDDPHGLDGWNWQACTEMVMPMSSSQGN  387

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FPA +++Y+   + C   F++ PRP W+TTEFGGH+IE  LK FGSNIIF NGL DPW
Sbjct  388   SMFPADDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGLLDPW  447

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             S G VLKN+S S++A+  KEGAHH+DLR ST EDPKWL D R  E+ +IQ WI  Y
Sbjct  448   SGGSVLKNLSNSIIALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  503



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/498 (51%), Positives = 338/498 (68%), Gaps = 8/498 (2%)
 Frame = -1

Query  1758  MKTRIILLffffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQIL  1579
             M   +I+ F       S  K  P FP     N  N       +   N   Y+TK+F+Q L
Sbjct  1     MANLLIITFVSVITLSSSFKLLPRFP---RYNNQNRARIKPFRGDRNEYRYETKFFSQQL  57

Query  1578  DHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHF  1399
             DHF+F       FQQRYLIN  +W GA ++APIF+Y GNEGDIEWF  N+GF++DIAP F
Sbjct  58    DHFSFA--DLPKFQQRYLINSDHWLGASSLAPIFLYCGNEGDIEWFATNSGFIWDIAPKF  115

Query  1398  NALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSP  1219
              ALLVF EHR+YG+S+P+G   EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   P
Sbjct  116   GALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACP  175

Query  1218  VVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESEN  1039
             VV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I     F D+ + DF+ ES +
Sbjct  176   VVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPLETFYDIASNDFKRESIS  235

Query  1038  CYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTA  859
             C+  IK SW +I    ++  GL++L K+F+ C+   S   L  WL +AY+Y AM DYP  
Sbjct  236   CFNTIKNSWDVIIAEGQKENGLQQLTKTFHFCRLLNSTDDLSDWLDSAYSYLAMVDYPYP  295

Query  858   TNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHG  679
              +F+ P+P +P++++C+ ID  N  +  L ++Y+ V++YYNYTG V +CF+L    DPHG
Sbjct  296   ADFMMPLPGHPIREVCRKIDGANSDASILDRIYAGVSVYYNYTGNV-DCFEL--DDDPHG  352

Query  678   LSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHN  499
             L GW+WQACTEM+MP+  S ++S+FPA  ++Y+   + C + F++ PRP W TTEFGGH+
Sbjct  353   LDGWNWQACTEMVMPMSSSQENSMFPADGFNYSSYKEECWKTFRVNPRPKWATTEFGGHD  412

Query  498   IERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWL  319
             IE  LK FGSNIIF NGL DPWS G VLKN+S ++VA+  KEGAHH+DLR ST +DPKWL
Sbjct  413   IETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHLDLRPSTPDDPKWL  472

Query  318   KDVRRKEVEIIQKWISQY  265
              D R  E+ +IQ WI  Y
Sbjct  473   VDQREAEIRLIQGWIETY  490



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/454 (57%), Positives = 324/454 (71%), Gaps = 15/454 (3%)
 Frame = -1

Query  1593  FTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFD  1414
             F + LDHFTFTP S H F Q+YL+ND +W       P+FVY GNEG+IEWFT NTGFMFD
Sbjct  110   FIEELDHFTFTPNSSHVFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFTTNTGFMFD  169

Query  1413  IAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             IAP F ALLVFIEHRFYG+S+PFG      SS  TLGYL+STQ LAD+A LI  LK+NL+
Sbjct  170   IAPEFGALLVFIEHRFYGESMPFG--DGPYSSPDTLGYLTSTQALADFAVLITSLKQNLS  227

Query  1233  ATDSPVVVFGGSYGGML-----------AAWFRLKYPHVTIGALASSAPILYFENITSPY  1087
             A D+PVVVFGGSYGG +           AAWFRLKYPHV +GA+ASSAPIL F++IT   
Sbjct  228   AVDAPVVVFGGSYGGRVNDFLSLLVLVLAAWFRLKYPHVAMGAVASSAPILQFDDITPWS  287

Query  1086  AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGW  907
             +F D ++QDF+SES NC+ VIK  W ++ D      GL  L K+F  CK   S  SL  W
Sbjct  288   SFYDAVSQDFKSESPNCFSVIKAVWDVLDDRGFNHTGLLELSKTFRACKTVQSADSLSNW  347

Query  906   LSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTG  727
             L  A+TYTAM DYPT  NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG
Sbjct  348   LWNAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPAGADVVDKAFAAASLYYNYTG  407

Query  726   EVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFK  547
             +   CF +    DPH L GW WQACTEM+MP+  SN +S+FP   ++Y   ++ C   + 
Sbjct  408   D-QKCFQVEGDDDPHDLDGWGWQACTEMVMPMTVSN-ESMFPPDSFNYENMSEDCLLYYG  465

Query  546   IEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGA  367
             + PR +WITTE+GGH I++VLKKFGSNIIF NG+RDPWS GGVLKNIS S++A+  ++GA
Sbjct  466   VRPRMHWITTEYGGHKIDKVLKKFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGA  525

Query  366   HHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             HH+DLR +TK+DP W+ + RR+EVEII+ WI QY
Sbjct  526   HHLDLRSATKDDPDWVVEQRRQEVEIIRGWIDQY  559


 Score =   108 bits (270),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  1581  LDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPH  1402
             LDHFTFTP S H F Q+YL+ND +W       P+FVY GNEG+IEWFT NTGFMFDIAP 
Sbjct  44    LDHFTFTPNSSHVFSQKYLLNDTFWRRKPTAGPLFVYTGNEGEIEWFTTNTGFMFDIAPE  103

Query  1401  FNALLVFIEH  1372
             F ALLVFIE 
Sbjct  104   FGALLVFIEE  113



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 325/452 (72%), Gaps = 5/452 (1%)
 Frame = -1

Query  1620  NHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             N   Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y GNEGDIEWF
Sbjct  45    NDYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWF  102

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               N+GF+++IAP F ALLVF EHR+YG+S+P+G ++EA  ++ TL YL++ Q LAD+A  
Sbjct  103   ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSKEEAYKNATTLSYLTTEQALADFAVF  162

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             + DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F
Sbjct  163   VTDLKRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPQTF  222

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D+++ DF+ ES +C+  IK SW  I    +++ GL++L K+F+ C+   S   L  WL 
Sbjct  223   YDIVSNDFKRESSSCFNTIKNSWDAIIAEGQKANGLQQLSKTFHFCRALNSTDDLSDWLD  282

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             +AY+Y AM DYP   +F+ P+P +P+K++C+ ID  +  +  L ++Y+ V++YYNYTG+V
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CF+L    DPHGL GW+WQACTEM+MP+  S K+S+F A +++Y+   + C   F++ 
Sbjct  343   -GCFEL--DDDPHGLDGWNWQACTEMVMPMSSSQKNSMFTAYDFNYSSYKEDCWNTFRVN  399

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VLKN+S ++VA+  KEG HH
Sbjct  400   PRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTKEGGHH  459

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             +DLR ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  460   LDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 324/452 (72%), Gaps = 5/452 (1%)
 Frame = -1

Query  1620  NHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             N   Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y GNEGDIEWF
Sbjct  45    NDYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWF  102

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               N+GF+++IAP F ALLVF EHR+YG+S+P+G  +EA  ++ TL YL++ Q LAD+A  
Sbjct  103   ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVF  162

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             + DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F
Sbjct  163   VTDLKRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPQTF  222

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D+++ DF+ ES +C+  IK SW  I    +++ GL++L K+F+ C+   S   L  WL 
Sbjct  223   YDIVSNDFKRESSSCFNTIKNSWDAIIAEGQKANGLQQLSKTFHFCRALNSTNDLSDWLD  282

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             +AY+Y AM DYP   +F+ P+P +P+K++C+ ID  +  +  L ++Y+ V++YYNYTG+V
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CF+L    DPHGL GW+WQACTEM+MP+  S K+S+F A +++Y+   + C   F++ 
Sbjct  343   -GCFEL--DDDPHGLDGWNWQACTEMVMPMSSSQKNSMFTAYDFNYSSYKEDCWNTFRVN  399

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VLKN+S ++VA+  KEG HH
Sbjct  400   PRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTKEGGHH  459

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             +DLR ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  460   LDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   535 bits (1378),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 327/455 (72%), Gaps = 3/455 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y GNEGDIEWF  NT
Sbjct  64    YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP FNA++VF EHR+YGKS+PFG    A  ++ +L YL++ Q LAD+A LI DL
Sbjct  122   GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N++A   PVV+FGGSYGGMLAAW R+KYPH+ IGALASSAPIL FENI  P  F D++
Sbjct  182   KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAPILQFENIVPPETFYDIV  241

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW  I+   +   GL RL + F++C+N  S   LE WL +AY+
Sbjct  242   SNDFRRESVSCFNTIKKSWDAIEAEGQTEEGLLRLTEEFHLCRNLRSTQDLEDWLESAYS  301

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P  P+K++C+ ID    G+  L ++++ V++YYNYTG V +CF
Sbjct  302   YLAMVDYPYPSDFMMPLPGNPIKEVCRKIDSFPDGTSTLERIFAGVSVYYNYTGVV-DCF  360

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL  S+   G  GW WQACTEM+MP+  S   S+F A +++Y+     C + F I+PR  
Sbjct  361   DLGESNQDLGADGWDWQACTEMVMPMSSSQSTSMFTAYDFNYSSYQDECFKHFGIKPRSR  420

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGHN+   LK FGSNIIF NGL DPWS GGVL+N+S+++ A+  KEGAHH+DLR
Sbjct  421   WITTEFGGHNLLTDLKTFGSNIIFSNGLLDPWSGGGVLQNVSETITALVTKEGAHHIDLR  480

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              S  EDP WL + R  EV++I  WI++YY   + L
Sbjct  481   PSIDEDPDWLVEQRASEVKLITGWINKYYQERSVL  515



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   534 bits (1375),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/481 (52%), Positives = 336/481 (70%), Gaps = 5/481 (1%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRY  1510
             T P + I  R   ++A++         Y+TKY+ Q LDHF   P SY TF QRYL+N  Y
Sbjct  37    TSPLTHIHRRRPIVAAAAGGGVPTQVRYETKYYEQRLDHFDALPASYRTFPQRYLVNGTY  96

Query  1509  WGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE  1330
             WGG    +P+F+Y GNEG++E FT NTGFM+++AP F ALL+F+EHR+YGKS PFG E+ 
Sbjct  97    WGG--KTSPVFLYAGNEGNVELFTNNTGFMWELAPRFRALLLFVEHRYYGKSFPFGSEEA  154

Query  1329  AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHV  1150
             A  ++ T+GYL++TQ +AD ATL+  LK NL+A  +PV+VFGGSYGGMLAAW R+KYPHV
Sbjct  155   AFRNTSTVGYLTTTQAVADLATLVQSLKSNLSAHAAPVIVFGGSYGGMLAAWVRMKYPHV  214

Query  1149  TIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLE  970
              +GA+ASSAPIL F  +  PYAF DVI+ DF+SES+NC+ V+  SW  +        G  
Sbjct  215   VMGAVASSAPILGFYGLADPYAFYDVISNDFKSESKNCHDVLMKSWGELDKALSNDAGRA  274

Query  969   RLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPN  790
              L  +F +C+   +V ++   L TA TY+AMTDYPT++ FL P+PPYPVK+MC+AID P 
Sbjct  275   DLNSTFKMCRAS-TVDAIPDLLDTALTYSAMTDYPTSSGFLTPLPPYPVKEMCRAIDHPK  333

Query  789   HGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKD  613
              G+D  A++  A+++YYN+TG    C   A+ SDP+G+  GW WQACTEMI+   G    
Sbjct  334   SGNDTFARIKGALDVYYNHTG-AEPCLGDATESDPYGMFDGWDWQACTEMILMTYGVRNG  392

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             ++FP   +++ +    C+ +  + PRP WI TEFGG +I+ VL++  SNIIFFNGLRDPW
Sbjct  393   TVFPPEPFNFTDLLAGCRASTGLPPRPYWIPTEFGGFDIKHVLRRSASNIIFFNGLRDPW  452

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             S+GGVLK+IS S++A+   +G+HHVDLRFSTKEDP+WLK VR KE  II  W+ QYY   
Sbjct  453   SSGGVLKSISNSIIALVEPKGSHHVDLRFSTKEDPEWLKQVRIKETRIIAHWLRQYYKEE  512

Query  252   T  250
             T
Sbjct  513   T  513



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 242/451 (54%), Positives = 324/451 (72%), Gaps = 5/451 (1%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y GNEGDIEWF QN
Sbjct  53    LYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQN  110

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IAP F A++VF EHR+YG+S+PFG  KEA   + TL YL++ Q LAD++ LI D
Sbjct  111   TGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITD  170

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+N +A D PVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I  P  F D+
Sbjct  171   LKQNFSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPPETFYDI  230

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ +F+ ES  C+  IK SW  I    +   GLERL K+FN+C+   S   L  WL +AY
Sbjct  231   VSNNFKRESSTCFNYIKQSWDEITSTGQTYNGLERLTKTFNLCQKLKSTVDLYDWLESAY  290

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM +YP  ++FL  +P +P++++CK ID    G++ L ++Y  VN+YYNYTG+   C
Sbjct  291   SYLAMVNYPYPSDFLMTLPGHPIREVCKKIDGVPAGTNILERIYEGVNVYYNYTGK-EKC  349

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             F+L    DPHG+SGW WQACTEM+MP+  +   S+FP  E++Y    + C   + ++PRP
Sbjct  350   FEL--DDDPHGMSGWDWQACTEMVMPMSSNQDSSMFPPYEYNYTSFQEECLNDYGVKPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WITTEFGGH+I   LKKFGSNIIF NGL DPWS G VL+NIS+S+V++  +EGAHH+DL
Sbjct  408   KWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGGSVLQNISESVVSLVTEEGAHHIDL  467

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R ST+ DP WL + R  E+++I+ WIS Y+ 
Sbjct  468   RPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score =   532 bits (1370),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 253/453 (56%), Positives = 324/453 (72%), Gaps = 13/453 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T+YF Q LDHF+F P+SY  F Q+YLI+  +W   +   PIFVY GNE DIEWF  NT
Sbjct  51    FRTRYFPQNLDHFSFQPESYRIFHQKYLISSHFW---RKGGPIFVYTGNEADIEWFASNT  107

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F AL+VFIEHRFYG+S P       +  +KT+GYL+S Q LADYA LI  L
Sbjct  108   GFMLDIAPKFQALVVFIEHRFYGESKP-------QMLAKTMGYLNSQQALADYAILIRSL  160

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ +    +F D +
Sbjct  161   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKMAPSSSFYDTV  220

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC++VIK SW  ++       G ++L K F  CK+  S+ S   WL +A+ 
Sbjct  221   SQDFKDVSVNCFEVIKRSWGELEAFLTIKDGKQKLSKKFRTCKDLQSLASASLWLESAFV  280

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDD-PNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              TAM +YPTA NF+ P+P YPV+QMCK ID  P   S  L + ++A ++YYNY+G    C
Sbjct  281   DTAMVNYPTAANFMAPLPAYPVEQMCKIIDGFPLGASSNLERAFAAASLYYNYSGS-EIC  339

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FD+ + +DPHGL+ W WQACTEM+MP+  SN+ S+FP  E D     + C  A+ ++ RP
Sbjct  340   FDMENQTDPHGLAFWGWQACTEMVMPMSSSNQ-SMFPPFENDDEGEQELCMLAYGVKSRP  398

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +WITTEFGG  IE VLK+FGSNIIF NG++DPWS GGVLKNIS S++A+  K+GAHH DL
Sbjct  399   HWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSRGGVLKNISNSIIALVTKKGAHHTDL  458

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             R +TK DP+WLK+ RR+EV II+KWI++YY  L
Sbjct  459   RAATKYDPEWLKEQRRQEVAIIEKWINEYYSDL  491



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   532 bits (1371),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 247/450 (55%), Positives = 326/450 (72%), Gaps = 5/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+Y+TQ LDHF   P SY TF QRYL+N  YWGG    AP+FVY GNEG IE FT NT
Sbjct  59    YETRYYTQRLDHFNAAPVSYSTFPQRYLVNGTYWGG--KTAPVFVYAGNEGSIELFTNNT  116

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM+++AP F A+LVFIEHR+YG+SVPFG E+ A  ++ T+GYLS+TQ +AD+ATL+  L
Sbjct  117   GFMWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFKNASTMGYLSTTQAVADFATLVQSL  176

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL+A  +PVVVFGGSYGGMLAAW R+KYPHV IGA+ASSAPIL F  +  PYAF D+I
Sbjct  177   KANLSAPAAPVVVFGGSYGGMLAAWMRMKYPHVVIGAVASSAPILGFYGMADPYAFYDII  236

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+SES+NC+ V+  SW+ + +      G  +L ++F +C+   +V ++   L TA  
Sbjct  237   SNDFKSESKNCHDVLMNSWKELDNALSNDAGRAQLNRTFKMCRGS-TVEAIPDMLDTAIV  295

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y+AMTDYPT + FL  +P YPVK++C+AID P  G D  +++  A+ +YYNYTG  + CF
Sbjct  296   YSAMTDYPTESGFLTHLPAYPVKEICRAIDHPKSGKDTFSRIKDALTVYYNYTGNAH-CF  354

Query  708   DLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
               AS  DP+G+ +GW WQACTEMI+   G    S+ P   +++ +    C+ +  + PRP
Sbjct  355   GDASEDDPYGMFNGWDWQACTEMILMSYGVRNRSVLPPEPFNFTKLLDGCRASTGLPPRP  414

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WI TEFGG +I  VLK+  SNIIFFNGLRDPWS+GGVLK+IS+S++A+   +G+HHVDL
Sbjct  415   YWIPTEFGGFDIANVLKRSASNIIFFNGLRDPWSSGGVLKDISRSILALVEPKGSHHVDL  474

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             RFS+K+DP WLK VR KE  II  W++QYY
Sbjct  475   RFSSKDDPHWLKQVREKETRIIAHWLNQYY  504



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   531 bits (1367),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 242/452 (54%), Positives = 320/452 (71%), Gaps = 5/452 (1%)
 Frame = -1

Query  1620  NHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             N   Y+TKYFTQ LDHF+F       F QRYLIN  +W GA  + PIF+Y GNEGDI+WF
Sbjct  52    NEYRYETKYFTQQLDHFSFA--DLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIDWF  109

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               N+GF++DIAP F ALLVF EHR+YG+S+P+G  KEA  ++ TL YL++ Q LAD+A  
Sbjct  110   ATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSMKEAYKNATTLAYLTTEQALADFAVF  169

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             + DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I     F
Sbjct  170   VTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPTETF  229

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D+++ DF+ ES +C+  IK SW  I    ++  GL +L ++F  C+   S   L  WL 
Sbjct  230   YDIVSNDFKRESTSCFNTIKNSWDAIVAEGKKENGLMQLTETFRFCRLLNSTDDLSDWLD  289

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             +AY+Y AM DYP + +F+ P+P +P+K++C+ ID     +  L ++Y+ +++YYNYTG+V
Sbjct  290   SAYSYLAMVDYPYSADFMMPLPGHPIKEVCRKIDSAPSDASILDRIYAGISVYYNYTGDV  349

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
              +CF L    DPHGL GW WQACTEM+MP+  S ++S+FPA +++Y+   + C   F++ 
Sbjct  350   -DCFKL--DDDPHGLDGWDWQACTEMVMPMSSSQENSMFPADDFNYSSYKEECWNTFRVN  406

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VLKN+S ++VA+  KEGAHH
Sbjct  407   PRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHH  466

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             +DLR ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  467   LDLRPSTPEDPKWLVEQREAEIRLIQGWIETY  498



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   531 bits (1367),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 238/449 (53%), Positives = 330/449 (73%), Gaps = 5/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+TKYF Q LDHF+F      +F QRYLIN ++W G  + APIF+Y GNEGDIEWF  NT
Sbjct  68    YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSHSAPIFLYCGNEGDIEWFAANT  125

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G ++EA  ++ TL YL++ Q LADYA LI ++
Sbjct  126   GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLITEI  185

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP+L FE++  P  F  ++
Sbjct  186   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAPVLQFEDLVPPETFYSIV  245

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  FR ES +C+  IK SW +I  + + +GGL +L K+F+IC+   SV SL  WL +AY+
Sbjct  246   SDGFRRESMSCFNTIKESWDVINKVGQINGGLAQLTKTFHICRELESVESLSNWLESAYS  305

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP +T+FL P+P  P+K++C+ ID    G+  L +++  ++IYYNYTG+V +CF
Sbjct  306   YLAMVNYPYSTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV-DCF  364

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL  + DPHG+SGW WQACTEMIMP+  +   S+FP   +D     + C + F ++PRP 
Sbjct  365   DL--NDDPHGMSGWDWQACTEMIMPMASNRTTSMFPEFYYDPKSNEEQCLKDFHVKPRPT  422

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+++S+++VA+T K+GAHH+DLR
Sbjct  423   WITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHLDLR  482

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  483   AATAEDPDWLLDQRSSEIKLIRGWLDEHY  511



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   531 bits (1368),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 343/478 (72%), Gaps = 13/478 (3%)
 Frame = -1

Query  1650  LSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP----  1483
             +SA++       + + T YF Q LDHFTFTP +   F+Q+YL+ND +W   +        
Sbjct  59    VSAAADGTNSTAQPFTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAG  118

Query  1482  -IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL  1306
              +FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIEHRFYG+S+PFG   ++ SS++T 
Sbjct  119   PLFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESLPFG--DDSYSSAETE  176

Query  1305  GYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS  1126
             GYL+STQ LAD+A LI  LK+NL+A  +PVVVFGGSYGGMLA+WFRLKYPHV IGALASS
Sbjct  177   GYLTSTQALADFAILITGLKRNLSAETAPVVVFGGSYGGMLASWFRLKYPHVAIGALASS  236

Query  1125  APILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNI  946
             APIL F++IT   +FSD ++QD++SES NC+ VIK +W ++ +      GL  L K F  
Sbjct  237   APILQFDHITPWNSFSDAVSQDYKSESLNCFSVIKAAWDVLDERGSTDTGLLELSKLFRA  296

Query  945   CKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAK  766
             CK+     S+ GWL TA+TYTAM DYPT  NFL  +P YPVK+MCK ID    G+D L K
Sbjct  297   CKSVKHADSIAGWLQTAFTYTAMVDYPTPANFLMDLPAYPVKEMCKIIDGFPAGADILEK  356

Query  765   LYSAVNIYYNYTGEVNNCFDL----ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPA  598
             +++A N+YYNYTG+   C  +      SS   GLSGW WQACTEMIMP+  SN  S+FP 
Sbjct  357   VFAAANLYYNYTGD-QACNQIESDSDDSSSSLGLSGWGWQACTEMIMPMSTSNA-SMFPP  414

Query  597   SEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  418
             S + Y + +  C ++  + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPWS GGV
Sbjct  415   SSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDPWSRGGV  474

Query  417   LKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             LKNIS S+VA+  ++GAHH+DLRF+T EDP W+ + RR+EVEII+ WI QY+  +  +
Sbjct  475   LKNISSSIVALVTEKGAHHLDLRFATDEDPDWVTEQRRQEVEIIEGWIDQYHRDMAQV  532



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   528 bits (1360),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 325/449 (72%), Gaps = 6/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF QILDHF+F+      F+QRYLI+  +W G     PIF+Y GNEGDIEWF +NT
Sbjct  23    YETRYFDQILDHFSFSGP--ERFRQRYLISTEHWTGPDRQGPIFLYCGNEGDIEWFAENT  80

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A++VF EHR+YGKS+P+GGE+EA  ++ TL +L+S Q LAD+A LI DL
Sbjct  81    GFVWEIAPRFGAMVVFTEHRYYGKSMPYGGEEEAYKNATTLAHLTSEQALADFAILITDL  140

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KKNL+A   PVV+FGGSYGGMLAAW RLKYPHV IGALASSAP+L FE+I     F D+ 
Sbjct  141   KKNLSAQSCPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPVLQFEDIVPQETFYDIA  200

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW +I+   ++  GL  L + F  CK   S   L  WLS+ Y+
Sbjct  201   SNDFRRESVSCFDTIKASWDVIETEGQKVNGLSYLTELFRFCKKLESADDLSNWLSSGYS  260

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP AT+FL PMP  P+K++C+ ID   +G+D L +++  V++YYN+TG V +CF
Sbjct  261   YLAMADYPYATDFLMPMPKNPIKEVCRRIDSYPNGTDILRRIFEGVSVYYNFTGNV-DCF  319

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              L    DPHG++GW+WQACTEM+MPL    K S+FP  ++D +  A +C ++F++ PRP 
Sbjct  320   KL--DDDPHGMNGWNWQACTEMVMPLSSGTK-SMFPGYDFDLDSDAYWCFQSFRVTPRPT  376

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH  +  L+ FGSNI+F NGL DPWS G VL+N+S ++VA+  ++GAHH+DLR
Sbjct  377   WITTEFGGHGFKNALRWFGSNIVFSNGLLDPWSGGSVLENVSDTIVALVTEKGAHHLDLR  436

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T EDP WL D R  E+++IQ W+ +YY
Sbjct  437   PATVEDPDWLLDQREIEMKLIQGWLDEYY  465



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   529 bits (1362),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 329/449 (73%), Gaps = 5/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+TKYF Q LDHF+F      +F QRYLIN ++W G    APIF+Y GNEGDIEWF  NT
Sbjct  36    YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFADNT  93

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G ++EA  ++ TL YL++ Q LADYA LII+L
Sbjct  94    GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLIIEL  153

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP+L FE++  P  F  ++
Sbjct  154   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAPVLQFEDLVPPETFYSIV  213

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  FR ES +C+  IK SW +I  + +  GGL +L K+F+IC+   S+ +L  WL +AY+
Sbjct  214   SNGFRRESMSCFNTIKESWDVINKVGQIDGGLAQLTKTFHICRELESIDNLSNWLESAYS  273

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  T+FL P+P  P+K++C+ ID    G+  L +++  ++IYYNYTG+V +CF
Sbjct  274   YLAMVNYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV-DCF  332

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L  + DPHG+SGW WQACTEMIMP+  +   S+FP   +D     + C + F+++PRP 
Sbjct  333   NL--NDDPHGMSGWDWQACTEMIMPMASNMTTSMFPEFYYDPKSNEEQCLKDFRVKPRPT  390

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+++S+++VA+T K+GAHH+DLR
Sbjct  391   WITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHLDLR  450

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  451   AATAEDPDWLLDQRSSEIKLIRGWLDEHY  479



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   529 bits (1362),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 320/452 (71%), Gaps = 5/452 (1%)
 Frame = -1

Query  1620  NHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             N   Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y GNEGDIEWF
Sbjct  45    NSYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSDHWTGASELGPIFLYCGNEGDIEWF  102

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               N+GF+++IAP F ALLVF EHR+YG+S+P+G   EA  ++ TL YL++ Q LAD+A  
Sbjct  103   ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVF  162

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             + DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F
Sbjct  163   VTDLKRNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPQTF  222

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D+++ DF+ ES  C+  IK SW  I    ++  GL++L K+F+ C+   S   L  WL 
Sbjct  223   YDIVSNDFKRESSTCFNTIKNSWDAIIAEGQKENGLQQLSKTFHFCRALNSTDDLSDWLD  282

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             +AY+Y AM DYP   +F+ P+P +P+K++C+ ID  +  +  L ++Y+ V++YYNYTG+V
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
               CF+L    DPHGL GW+WQACTEM+MP+  S ++S+F A +++Y+   + C   F + 
Sbjct  343   -GCFEL--DDDPHGLDGWNWQACTEMVMPMSSSQENSMFTAYDFNYSSYKEDCWNTFGVN  399

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VLKN+S ++VA+  +EG HH
Sbjct  400   PRPRWVTTELGGHDIETALKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTEEGGHH  459

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             +DLR ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  460   LDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   529 bits (1362),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 329/449 (73%), Gaps = 5/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+TKYF Q LDHF+F      +F QRYLIN ++W G    APIF+Y GNEGDIEWF  NT
Sbjct  52    YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFADNT  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G ++EA  ++ TL YL++ Q LADYA LII+L
Sbjct  110   GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLIIEL  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH++IGALASSAP+L FE++  P  F  ++
Sbjct  170   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAPVLQFEDLVPPETFYSIV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  FR ES +C+  IK SW +I  + +  GGL +L K+F+IC+   S+ +L  WL +AY+
Sbjct  230   SNGFRRESMSCFNTIKESWDVINKVGQIDGGLAQLTKTFHICRELESIDNLSNWLESAYS  289

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  T+FL P+P  P+K++C+ ID    G+  L +++  ++IYYNYTG+V +CF
Sbjct  290   YLAMVNYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV-DCF  348

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L  + DPHG+SGW WQACTEMIMP+  +   S+FP   +D     + C + F+++PRP 
Sbjct  349   NL--NDDPHGMSGWDWQACTEMIMPMASNMTTSMFPEFYYDPKSNEEQCLKDFRVKPRPT  406

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+++S+++VA+T K+GAHH+DLR
Sbjct  407   WITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHLDLR  466

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  467   AATAEDPDWLLDQRSSEIKLIRGWLDEHY  495



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   528 bits (1359),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 326/476 (68%), Gaps = 7/476 (1%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP  T  NR   +     +   N   Y+TK+F+Q LDHF+F       F QRYLIN  
Sbjct  32    PRFPRYTFQNREARIQ--QFRGDRNEYRYETKFFSQQLDHFSFA--DLPKFSQRYLINSD  87

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             +W GA  + PIF+Y GNEGDIEWF  N+GF++DIAP F ALLVF EHR+YG+S+P+G  +
Sbjct  88    HWLGASALGPIFLYCGNEGDIEWFATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSRE  147

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH
Sbjct  148   EAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLKYPH  207

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             + IGALASSAPIL FE++  P  F D+ + DF+ ES +C+  IK SW  I    ++  GL
Sbjct  208   IAIGALASSAPILQFEDVVPPETFYDIASNDFKRESSSCFNTIKDSWDAIIAEGQKENGL  267

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
              +L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P +P++++C+ ID  
Sbjct  268   LQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGA  327

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
                +  L ++Y+ +++YYNYTG V +CF L    DPHGL GW+WQACTEM+MP+  + ++
Sbjct  328   GSNASILDRIYAGISVYYNYTGNV-DCFKL--DDDPHGLDGWNWQACTEMVMPMSSNQEN  384

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FP   ++Y+   + C   F++ PRP W+TTEFGGH+I   LK FGSNIIF NGL DPW
Sbjct  385   SMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPW  444

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             S G VLKN+S ++VA+  KEGAHH+DLR ST EDPKWL D R  E+ +IQ WI  Y
Sbjct  445   SGGSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  500



>ref|XP_010432914.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=499

 Score =   527 bits (1357),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 248/452 (55%), Positives = 321/452 (71%), Gaps = 12/452 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T+YF Q LDHF+F P+SY  F Q+YLI+  +W   +   PIFVY GNEGDIEWF  NT
Sbjct  53    FQTRYFPQNLDHFSFQPESYIIFHQKYLISSHFW---RKGGPIFVYTGNEGDIEWFASNT  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALL+FIEHRFYG+S P         S+K +GYL+S Q LADYA LI  L
Sbjct  110   GFMLDIAPKFQALLIFIEHRFYGESNP-------PRSAKKMGYLNSQQALADYAILIRSL  162

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPV+V GGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ I    +F D +
Sbjct  163   KQNLSSEASPVIVLGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIVPSSSFYDTV  222

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC++VIK SW  +   +    GL++L K F  CK+   V S  GWL +A+ 
Sbjct  223   SQDFKDASVNCFEVIKRSWGELDAFSTMKDGLQKLSKKFRTCKDLHYVSSASGWLESAFV  282

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
              TAM +YPT  +F+ P+P YPV++MCK ID     +  L + ++A N+YYNY+    NCF
Sbjct  283   NTAMVNYPTPASFMAPLPAYPVEEMCKIIDGFPLEASNLDRAFAAANLYYNYSSS-ENCF  341

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             D+ + +DPHGL+GW WQACTEM+MP+  SN+ S+F   E +     + C   + ++PRP+
Sbjct  342   DIENETDPHGLNGWYWQACTEMVMPISCSNQ-SMFQPFESNDKRDQEACLREYGVKPRPH  400

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS  GVLKNIS S++A+  K+GAHH DLR
Sbjct  401   WITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNISSSIIALVTKKGAHHADLR  460

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TK+DP+WLK+ RR+EV  ++KWIS+YY  L
Sbjct  461   AATKDDPEWLKEQRRQEVAEMEKWISEYYSDL  492



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 321/450 (71%), Gaps = 5/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T++F Q LDHF+F+     TF QRYLIN  +W G ++  PIF Y GNEGDI WF QNT
Sbjct  56    YETRFFQQQLDHFSFS--DLPTFPQRYLINTDHWLGPQHSGPIFFYCGNEGDIVWFAQNT  113

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++++AP F A++VF EHR+YG+SVP+G + EA  ++ TL +L++ Q LAD++ L+ DL
Sbjct  114   GFLWELAPSFGAMIVFPEHRYYGESVPYGSKDEAYKNATTLSFLTAEQALADFSVLLTDL  173

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N +A D PVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FENI  P  F D++
Sbjct  174   KRNYSAIDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFENIVPPKTFYDIV  233

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES  C+  IK SW  I    + S GLE L K+F  C+       L  WL +AY+
Sbjct  234   SNDFKRESSTCFNYIKQSWDEIASKGQTSNGLELLTKTFKFCQILNRTDDLLDWLESAYS  293

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  + F+ P+P YP+K++C+ ID    G+  L ++Y  VN+YYNYTGE   CF
Sbjct  294   YLAMVNYPYPSEFMMPLPGYPIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEA-KCF  352

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHGL GW+WQACTEM+MP+  S + S+FP  E++Y    + C + F ++PRP 
Sbjct  353   EL--DDDPHGLDGWNWQACTEMVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKPRPK  410

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGHNI   LKKFGSNIIF NGL DPWS G VL+NIS+S+V++  +EGAHH+DLR
Sbjct  411   WITTEFGGHNIHAALKKFGSNIIFSNGLLDPWSGGSVLQNISESIVSLVTQEGAHHLDLR  470

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
              ST+ DP WL + R  E+++I+ WI++YY 
Sbjct  471   ASTENDPDWLIEQRATEIKLIEGWINEYYQ  500



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   525 bits (1353),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 332/451 (74%), Gaps = 8/451 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLI-NDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+ +YF Q LDHF+F       F QRYLI N   W  A+   PIF Y GNEGDIEWF  N
Sbjct  47    YEERYFRQSLDHFSFA--DLPPFDQRYLIANTGAW--ARPAGPIFFYCGNEGDIEWFADN  102

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF++DIAP F+AL+VF EHR+YGKS+P+G +++A  ++++L YL++ Q LAD++ L+ D
Sbjct  103   TGFVWDIAPRFSALVVFAEHRYYGKSMPYGSQEKAYKNAESLSYLTTEQALADFSALLTD  162

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+NL++ +SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D+
Sbjct  163   LKRNLSSEESPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPDTFYDL  222

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DF+ ES +C++ IK SW++++   E++ GL +L + F +C+N  +   L  WLS+AY
Sbjct  223   VSNDFKRESLSCFEAIKESWKVLETQGEDNDGLLKLSRDFRLCQNLNNTEELSDWLSSAY  282

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM DYP  ++F+ P+P  P+K++C+ ID+   G+  L ++++ V+IYYNYTG V +C
Sbjct  283   SYLAMVDYPYPSDFMMPLPANPIKEVCRKIDNYLDGTTVLERIFAGVSIYYNYTGNV-DC  341

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL    DPHGLSGW+WQACTEM+MP+  S ++S+FPA ++DY      C + + + PRP
Sbjct  342   FDL--EDDPHGLSGWNWQACTEMVMPMSSSQENSMFPAYDFDYAAYQDQCLQDYGVRPRP  399

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WITTEFGGH+I+  LKKFGSNIIF NGL DPWS G VL+N+S+S++A+  + GAHH+DL
Sbjct  400   RWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSGGSVLQNVSESIIALVTELGAHHIDL  459

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R STKEDP WL + R  E+ +I+ W+  YY 
Sbjct  460   RASTKEDPDWLVEQRNTEINLIKGWLYDYYQ  490



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   526 bits (1354),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 328/459 (71%), Gaps = 5/459 (1%)
 Frame = -1

Query  1638  SAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNE  1459
             +AK+      Y+TKYF Q LDHF+F      +F QRYLIN ++W G   +APIF+Y GNE
Sbjct  49    AAKSKAPKYEYETKYFQQKLDHFSFA--DLPSFPQRYLINTQHWMGPSRLAPIFLYCGNE  106

Query  1458  GDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVL  1279
             G IEWF  NTGF+++IAP F A+++F EHR+YG+S+PFG ++EA  ++ TL YL++ Q L
Sbjct  107   GGIEWFAANTGFVWEIAPRFGAMVIFPEHRYYGESMPFGSKEEAYKNATTLSYLTAEQAL  166

Query  1278  ADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENI  1099
             ADYA LI +LK+NL+A   PVV+FGGSYGGMLAAW RLKYPH++IGALASSAPIL FE++
Sbjct  167   ADYAVLITELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAPILQFEDL  226

Query  1098  TSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGS  919
               P  F ++++ DF+ ES +C+  IK SW +I  + + +GGL +L K+F++C+   SV  
Sbjct  227   VPPETFYNIVSNDFKGESMSCFNTIKESWDVINSVGQINGGLAQLTKTFHLCRKLDSVDG  286

Query  918   LEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYY  739
             L  WL +AY+Y AM +YP  T+FL P+P  P+K++C+ ID    G+  L +++  +N+YY
Sbjct  287   LSNWLESAYSYLAMANYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGINVYY  346

Query  738   NYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCK  559
             NYTG V +CF+L    DPHG+ GW WQACTEM+MP+  +   S+FP   +D     + C 
Sbjct  347   NYTGTV-DCFNL--DDDPHGMGGWDWQACTEMVMPMASNRTTSMFPEFYYDPTSNEEQCL  403

Query  558   EAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITA  379
             + F ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+N+SK++VA+T 
Sbjct  404   KDFHVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLENVSKTIVALTT  463

Query  378   KEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             ++GAHH+DLR  T  DP WL + R  E+++I+ W+ +YY
Sbjct  464   EKGAHHLDLRAGTASDPDWLLEQRSSEIKLIRGWLDKYY  502



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   525 bits (1353),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 333/467 (71%), Gaps = 5/467 (1%)
 Frame = -1

Query  1662  RPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP  1483
             R   LS ++ +       Y+T+YF Q LDHF+F+     TF+QRYLIN  YWGG   + P
Sbjct  48    RKFSLSNNTGRLGAPRYRYETRYFDQNLDHFSFS--DLPTFRQRYLINTEYWGGPTKLGP  105

Query  1482  IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLG  1303
             IF+Y GNEGDIEWF  NTGF++++AP F A+++F EHR+YG+S+P+G  +EA  ++ TL 
Sbjct  106   IFLYCGNEGDIEWFAANTGFVWELAPRFRAMIIFPEHRYYGESMPYGSWEEAYKNASTLA  165

Query  1302  YLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  1123
             +L++ Q LAD+A LI +LKKN +A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSA
Sbjct  166   HLTAEQALADFAVLITELKKNFSAQACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSA  225

Query  1122  PILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC  943
             P+L FE+I  P  F ++++ DFR ES +C+  IK SW +I+   +++ GL  L ++F  C
Sbjct  226   PVLQFEDIVPPETFYNIVSNDFRRESISCFNTIKESWDVIESEGQKTNGLSYLTETFRFC  285

Query  942   KNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKL  763
             +   S   +  WLS+AY+Y AM DYP   +FL PMP  P+K++CK ID+   G+  + ++
Sbjct  286   RKLESTDDISNWLSSAYSYLAMADYPYPADFLMPMPANPIKEVCKKIDNCPDGTSIIQRI  345

Query  762   YSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDY  583
                V++YYNYTG+V +CFDL    DPHG++GW+WQACTEM+MP   S   S+FPA +++Y
Sbjct  346   VEGVSVYYNYTGKV-DCFDL--DDDPHGMNGWNWQACTEMVMPTSSSKDASMFPAYDYNY  402

Query  582   NERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNIS  403
                 ++C E ++++PRP WI+TEFGGH  +  LK FGSNIIF NGL DPWS G VL++IS
Sbjct  403   TSDEEWCWENYRVKPRPTWISTEFGGHGFKHTLKNFGSNIIFSNGLLDPWSGGSVLEDIS  462

Query  402   KSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             +++VA+  ++GAHH+DLR +T EDP WL + R  EV++IQ W+ +Y+
Sbjct  463   ETIVALVTEKGAHHLDLRPATAEDPDWLVEQRAAEVKLIQGWLDEYF  509



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   525 bits (1352),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/479 (51%), Positives = 329/479 (69%), Gaps = 8/479 (2%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP  T  N P  +       +     Y+TK+F+Q LDHF+F       F QRYLI
Sbjct  41    KRLPRFPRHTFKN-PTRIQRFRGDGSGYK--YETKFFSQQLDHFSFA--DLPKFSQRYLI  95

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N  +W GA  + PIF+Y GNEGDIEWF  N+GF+++IAP F ALLVF EHR+YG+S+P+G
Sbjct  96    NSDHWLGASALGPIFLYCGNEGDIEWFATNSGFLWEIAPKFGALLVFPEHRYYGESMPYG  155

Query  1341  GEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLK  1162
               +EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLK
Sbjct  156   SREEAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLK  215

Query  1161  YPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEES  982
             YPH+ IGALASSAPIL FE+I  P  F D+++ DF  ES +C+  IK SW  I    ++ 
Sbjct  216   YPHIAIGALASSAPILQFEDIVPPETFYDIVSNDFMRESSSCFNTIKNSWDAIIAEGQKE  275

Query  981   GGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAI  802
              GL++L K+F+ C+   S   L  WL +AY+Y AM +YP   NF+ P+P +P+K++C+ I
Sbjct  276   NGLQQLAKTFHFCRVLNSTDDLSDWLDSAYSYLAMVNYPYPANFMMPLPGHPIKEVCRKI  335

Query  801   DDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGS  622
             D  +  +  L ++++ +++YYNYTG+V +CF+L    DPHGL GW+WQACTEM+MP+  S
Sbjct  336   DGASSDASILDRIFAGISVYYNYTGDV-DCFEL--DDDPHGLDGWNWQACTEMVMPMSSS  392

Query  621   NKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLR  442
              ++S+FPA  ++Y+     C   F++ PRP W+TTE GGH+IE  LK FGSNIIF NGL 
Sbjct  393   EENSMFPAYAFNYSSYKDECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLL  452

Query  441   DPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             DPWS G VLKN+S ++VA+  +EG HH+DLR ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  453   DPWSGGSVLKNLSNTIVALVTQEGGHHLDLRPSTPEDPKWLVEQREAEIRLIQGWIRTY  511



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   525 bits (1352),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/460 (54%), Positives = 323/460 (70%), Gaps = 12/460 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW---GGAKNMAPIFVYMGNEGDIEWFT  1438
             +   YF Q LDHF+FTP +   F Q+YL+ND +W   GG     P+ VY+G E DIE   
Sbjct  79    FTVHYFQQELDHFSFTPNASTVFYQKYLVNDTFWRRPGGGGTAGPLLVYVGGEADIECIA  138

Query  1437  QNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLI  1258
              N GFMFDIAP F ALLVF+EHRFYG+S+PFG      +S++ LGYL+STQ LAD A LI
Sbjct  139   HNVGFMFDIAPTFGALLVFVEHRFYGESLPFG-----NNSAQALGYLTSTQALADLAILI  193

Query  1257  IDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFS  1078
              DLK+NL+A  SPVV+FGGSYGGMLA+WFRLKYPHVTIGALASSAPIL F+ IT   +F 
Sbjct  194   TDLKRNLSAETSPVVIFGGSYGGMLASWFRLKYPHVTIGALASSAPILQFDYITPWSSFY  253

Query  1077  DVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLST  898
             DV++QD++SES NC+ VIK +W ++++      GL  L K F  CK      S+  WL T
Sbjct  254   DVVSQDYKSESLNCFSVIKAAWDVLEERGSNGNGLVELSKLFRACKTVKYADSIRRWLRT  313

Query  897   AYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVN  718
             A+   AM DYPT  +FL  +P YPVK+MCK +D     +D L K+++A ++YYNYTG+  
Sbjct  314   AFVSIAMMDYPTPASFLENLPAYPVKEMCKIVDGFPADADILEKVFAAASLYYNYTGD-Q  372

Query  717   NCFDLASSSDPH--GLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
              C  +    +P    L+ W WQACTE++MP+  +N DS+FP   + Y ++A YC + F +
Sbjct  373   TCNQIEDEGNPRCLNLNYWGWQACTELMMPMSSAN-DSMFPPHTFSYEDKANYCLQTFGV  431

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS GGVLKNIS S+VA+  ++GAH
Sbjct  432   RPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTEKGAH  491

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             H+DLR +TK+DP W+ + RR+EVEII  WI QYY  +  +
Sbjct  492   HLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYYRDMAQV  531



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   523 bits (1347),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 238/448 (53%), Positives = 320/448 (71%), Gaps = 5/448 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ LDHF+F    Y  F QRYLIN   W GA+   PIF+Y GNEGDIEWF  N+
Sbjct  42    YETQYFTQKLDHFSF--HEYGNFSQRYLINTDDWVGAQRRGPIFMYCGNEGDIEWFASNS  99

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++DIAPHF ALL+F EHR+YG+S+P+G ++EA   S TL YL++ Q +ADYA L+ +L
Sbjct  100   GFLWDIAPHFGALLLFPEHRYYGESMPYGSKEEAYKDSTTLSYLTAEQAIADYAVLLREL  159

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A D PVV+FGGSYGGMLAAW RLKYPH+T+GALASSAPIL FENI  P  F D++
Sbjct  160   KRNLSAQDCPVVLFGGSYGGMLAAWMRLKYPHLTVGALASSAPILQFENIVPPETFYDIV  219

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW  +Q +AE + GL +L K+F++C        L  WLS+AY+
Sbjct  220   SNDFRRESTSCFNTIKESWGALQSMAENADGLIQLTKTFHLCGELKRAQDLSDWLSSAYS  279

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  ++FL  +P +P++++C+ ID    G+  L ++++ V +YYNY+G V +CF
Sbjct  280   YLAMVNYPYPSDFLMSLPGHPIREVCRRIDSAADGTSVLDRIFNGVTVYYNYSGTV-DCF  338

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              L    DPHG+SGW WQACTEM+MP+    K S+FP   ++Y    + C +++ ++PR  
Sbjct  339   KL--DDDPHGMSGWQWQACTEMVMPMSSDPKTSMFPTFTFNYTYEQERCMKSYGVKPRGR  396

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH+ +   K+ GSNIIF +GL DPWS G VL+N+S++LVA+  +EGAHH+DLR
Sbjct  397   WITTEFGGHDFKTTWKESGSNIIFASGLLDPWSGGSVLQNVSETLVALVTEEGAHHLDLR  456

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQY  265
              ST  DP WL   R  E+ +IQ WI  Y
Sbjct  457   ASTPNDPDWLVQQRASEIRLIQGWIDDY  484



>emb|CDP02648.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   523 bits (1347),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 238/476 (50%), Positives = 331/476 (70%), Gaps = 5/476 (1%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRY  1510
             ++P  +  + P  L   S       + Y+T+YF Q LDHF+F      +F+Q+YLIN ++
Sbjct  24    SYPPRSSKHAPRFLGKFSHLHQPTDQKYETRYFEQRLDHFSFA--DLPSFRQKYLINTQH  81

Query  1509  WGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE  1330
             W G   + PIF Y GNEG+IEWF  NTGF+++IAP F A+++F EHR+YG+S+P+G  + 
Sbjct  82    WLGPSRLGPIFFYCGNEGNIEWFAANTGFVWEIAPRFGAMIIFPEHRYYGESMPYGSREI  141

Query  1329  AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHV  1150
             A  ++ TL YL++ Q LADYA  I +LK+NL+A   PVV+FGGSYGGMLAAW RLKYPH+
Sbjct  142   AYKNASTLSYLTAEQALADYAVFITELKRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHI  201

Query  1149  TIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLE  970
              IGALASSAP+L FE+I  P  + D+++ DFR ES +C+  IK SW +I    EE+ GL 
Sbjct  202   AIGALASSAPVLQFEDIVPPETYYDIVSNDFRRESISCFNTIKESWDIIASKGEENDGLN  261

Query  969   RLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPN  790
             +L K+F+ C+   S   L  WL +AY Y AM DYP   +FL P+P  P+K++C+ ID   
Sbjct  262   QLTKAFHFCRKLDSSEDLSDWLDSAYGYLAMADYPYPADFLMPLPGNPIKELCRRIDSCP  321

Query  789   HGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDS  610
              G+  L ++Y  VN+YYNYTG V +CF+L    DPHG+ GW WQACTEM+MP   S    
Sbjct  322   DGTSTLQRVYEGVNVYYNYTGTV-DCFNL--DDDPHGMIGWDWQACTEMVMPFASSKNTG  378

Query  609   IFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  430
             +FP  E++Y +  + C + + ++PRP WI+TEFGGH+++ VLKKFGSNIIF NGL DPWS
Sbjct  379   MFPEFEYNYADDEERCLKDYNVKPRPTWISTEFGGHDLKNVLKKFGSNIIFSNGLLDPWS  438

Query  429   AGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              G VL+++S+++VA+  ++GAHH+DLR +T EDP WL D R  EV++I+KW+ +YY
Sbjct  439   GGSVLEDVSETIVALVTEKGAHHLDLRAATDEDPDWLVDQRESEVKLIKKWLQEYY  494



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   523 bits (1348),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 238/449 (53%), Positives = 321/449 (71%), Gaps = 5/449 (1%)
 Frame = -1

Query  1605  DTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTG  1426
             +T+YF Q LDHF+F      TF QRYLIN  +W G   + PIF+Y GNEGDIEWF  N+G
Sbjct  69    ETRYFEQRLDHFSFA--DLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  1425  FMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLK  1246
             F++DIAP F A+LVF EHR+YG+S+P+G  + A  ++ TL YL++ Q LAD+A  I +LK
Sbjct  127   FVWDIAPRFGAMLVFPEHRYYGESMPYGSREVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  1245  KNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVIT  1066
             +NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F ++++
Sbjct  187   QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYNIVS  246

Query  1065  QDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTY  886
              DF+ ES +C+  IK SW  +  + ++  GL  L K+F++C+   S   L  WL +AY+Y
Sbjct  247   SDFKRESASCFNTIKESWGELVSVGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSY  306

Query  885   TAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFD  706
              AM DYP  ++F+ P+P YP++++CK ID+    +  L +++  V++YYNYTG V +CF 
Sbjct  307   LAMVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGNV-DCFQ  365

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
             L    DPHGL GW+WQACTEM+MP+  S   S+FPA +++Y+   + C   F + PRP W
Sbjct  366   L--DDDPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRW  423

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             ITTEFGGH+I+ VLK FGSNIIF NGL DPWS G VL+N+S+++VA+  +EGAHH+DLR 
Sbjct  424   ITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEEGAHHLDLRP  483

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             ST EDP WLK  R  E+++I+ WI  YY 
Sbjct  484   STNEDPDWLKKQRETEIKLIEGWIDNYYR  512



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   523 bits (1347),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 327/449 (73%), Gaps = 5/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+TKYF Q LDHF+F      +FQQRYLIN ++W G   + PIF+Y GNEGDIEWF  NT
Sbjct  59    YETKYFQQKLDHFSFA--DLPSFQQRYLINTQHWVGPSRLGPIFLYCGNEGDIEWFAANT  116

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F AL++F EHR+YG+S+P+G ++EA  ++ TL YL++ Q LAD+A LI +L
Sbjct  117   GFVWEIAPRFGALVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADFAVLITEL  176

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH++IGALASSAPIL FE++  P  F +++
Sbjct  177   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHISIGALASSAPILQFEDLVPPETFYNIV  236

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+ +IK SW +I  + + +GGL +L K+F++C+   SV  L  WL +AY+
Sbjct  237   SNDFKRESMSCFNIIKESWDVINSVGQINGGLAQLTKTFHLCRKLESVDGLSNWLESAYS  296

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  T FL P+P  P+K++C+ ID    G+  L +++  +N+YYNYTG+V +CF
Sbjct  297   YLAMANYPYPTGFLMPLPGSPIKEVCRKIDGLPDGASVLQRIFEGINVYYNYTGKV-DCF  355

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHG+SGW WQACTEM+MP+  +   S+FP   +D     + C + F ++PRP 
Sbjct  356   NL--DDDPHGMSGWDWQACTEMVMPMASNKTTSMFPEFYYDPKLNEEQCLKDFHVKPRPT  413

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITT FGGH  +  LK FGSNIIF NGL DPWS G VL+++S+++VA+  ++GAHH+DLR
Sbjct  414   WITTAFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALITEKGAHHLDLR  473

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +T EDP WL + R  E+++I+ W+ +YY
Sbjct  474   AATAEDPDWLLEQRSSEIKLIRGWLDKYY  502



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   522 bits (1344),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 320/447 (72%), Gaps = 5/447 (1%)
 Frame = -1

Query  1599  KYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFM  1420
             +YF Q LDHF+F      TF QRYLIN  +W G   + PIF+Y GNEGDIEWF  N+GF+
Sbjct  68    RYFEQRLDHFSFA--DLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSGFV  125

Query  1419  FDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKN  1240
             +DIAP F A+LVF EHR+YG+S+P+G  + A  ++ TL YL++ Q LAD+A  I +LK+N
Sbjct  126   WDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLKQN  185

Query  1239  LTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQD  1060
             L+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F ++++ D
Sbjct  186   LSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYNIVSSD  245

Query  1059  FRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTA  880
             F+ ES +C+  IK SW  +  + ++  GL  L K+F++C+   S   L  WL +AY+Y A
Sbjct  246   FKRESASCFNTIKESWGELVSVGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSYLA  305

Query  879   MTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLA  700
             M DYP  ++F+ P+P YP++++CK ID+    +  L +++  V++YYNYTG+V +CF L 
Sbjct  306   MVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGDV-DCFQL-  363

Query  699   SSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWIT  520
                DPHGL GW+WQACTEM+MP+  S   S+FPA +++Y+   + C   F + PRP WIT
Sbjct  364   -DDDPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRWIT  422

Query  519   TEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFST  340
             TEFGGH+I+ VLK FGSNIIF NGL DPWS G VL+N+S+++VA+  +EGAHH+DLR ST
Sbjct  423   TEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEEGAHHLDLRPST  482

Query  339   KEDPKWLKDVRRKEVEIIQKWISQYYH  259
              EDP WLK  R  E+++I+ WI  YY 
Sbjct  483   NEDPDWLKKQRETEIKLIEDWIDNYYR  509



>ref|XP_008654499.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654500.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654501.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654502.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654503.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654504.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654505.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 gb|AFW84964.1| putative serine peptidase S28 family protein [Zea mays]
Length=517

 Score =   521 bits (1342),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 248/456 (54%), Positives = 325/456 (71%), Gaps = 11/456 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF-------TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
             Y+T+YF Q LDHF+F         ++   FQQRYL+     G A    PIF Y GNEGDI
Sbjct  48    YETRYFRQRLDHFSFPGVGDEDEDEAAAFFQQRYLVGRGG-GWAGPGGPIFFYCGNEGDI  106

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
              WF  N+G +++ AP F AL+VF EHR+YG+S+PFG + +A S SK+L YL++ Q LAD+
Sbjct  107   AWFAANSGLVWEAAPRFAALVVFAEHRYYGESMPFGSKAKAYSDSKSLAYLTAEQALADF  166

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A L+ DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I   
Sbjct  167   AVLLTDLKRNLSAEGSPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPS  226

Query  1089  YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEG  910
               F D+++ DFR ES +C+  IK SW+ + D A E  GL +L K+F++C+   + G L  
Sbjct  227   TIFYDLVSDDFRRESLSCFLTIKDSWKELDDQANEQDGLLKLSKTFHLCQTLKTSGDLSD  286

Query  909   WLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT  730
             WLS+AY+Y AM DYP  + FL P+P  P+K++C+ ID    G+  L ++Y+ VN+YYNYT
Sbjct  287   WLSSAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPKGTGTLERIYAGVNVYYNYT  346

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
             G V +CFDL  + DPHG+ GW WQACTEM+MP+  S + S++P  ++DY   A+ C +++
Sbjct  347   GTV-DCFDL--NDDPHGMGGWDWQACTEMVMPMSYSEQRSMYPPYKFDYASYAEDCIKSY  403

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP WITTEFGGHNI +VL+ FGSNIIFFNGL DPWS GGVLKNIS+S+VAI A  G
Sbjct  404   GVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLG  463

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             AHH+DLR +T +DP WL  +R  E+EII  W+  YY
Sbjct  464   AHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  499



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   520 bits (1340),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 332/453 (73%), Gaps = 10/453 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLI-NDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+ +YF Q LDHF+F       F QRYLI N   W  A+   PIF Y GNEGDIEWF  N
Sbjct  47    YEERYFRQSLDHFSFA--DLPPFDQRYLIANTGAW--ARPAGPIFFYCGNEGDIEWFADN  102

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF++DIAP F+AL+VF EHR+YGKS+P+G +++A  ++++L YL++ Q LAD++ L+ D
Sbjct  103   TGFVWDIAPRFSALVVFAEHRYYGKSMPYGSQEKAYKNAESLSYLTTEQALADFSALLTD  162

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+NL++ +SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D+
Sbjct  163   LKRNLSSEESPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPDTFYDL  222

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC--KNYISVGSLEGWLST  898
             ++ DF+ ES +C++ IK SW++++   E++ GL +L + F +C  +N  +   L  WLS+
Sbjct  223   VSNDFKRESLSCFEAIKESWKVLETQGEDNDGLLKLSRDFRLCHHRNLNNTEELSDWLSS  282

Query  897   AYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVN  718
             AY+Y AM DYP  ++F+ P+P  P+K++C+ ID+   G+  L ++++ V+IYYNYTG V 
Sbjct  283   AYSYLAMVDYPYPSDFMMPLPANPIKEVCRKIDNYLDGTTVLERIFAGVSIYYNYTGNV-  341

Query  717   NCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEP  538
             +CFDL    DPHGLSGW+WQACTEM+MP+  S ++S+FPA ++DY      C + + + P
Sbjct  342   DCFDL--EDDPHGLSGWNWQACTEMVMPMSSSQENSMFPAYDFDYAAYQDQCLQDYGVRP  399

Query  537   RPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHV  358
             RP WITTEFGGH+I+  LKKFGSNIIF NGL DPWS G VL+N+S+S++A+  + GAHH+
Sbjct  400   RPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSGGSVLQNVSESIIALVTELGAHHI  459

Query  357   DLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             DLR STKEDP WL + R  E+ +I+ W+  YY 
Sbjct  460   DLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQ  492



>emb|CDM83096.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   521 bits (1341),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 325/451 (72%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F+ +    FQQRYL+     G A    PIF Y GNEGDI WF  N+
Sbjct  53    FETRYFRQRLDHFSFSGEE-EFFQQRYLVGRAG-GWAGPGGPIFFYCGNEGDIAWFAANS  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             G +++ AP F +L+VF EHR+YG+S+PFG + +A ++S+++ YL++ Q LADYA L+ DL
Sbjct  111   GLVWEAAPRFASLVVFAEHRYYGESMPFGSKDKAYNNSRSMAYLTAEQALADYAVLLTDL  170

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I     F D++
Sbjct  171   KRNLSSESSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPDTIFYDLV  230

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C++ IK SW+ + +      GL +L K+F++C+   + G+L  WLS+AY+
Sbjct  231   SNDFKRESLSCFQTIKDSWKELDEQGNGQDGLLKLSKTFHLCQTLNTTGALSDWLSSAYS  290

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  + FL P+P  P+K++C+ ID    GS  L ++Y+ VNIYYNYTG V +CF
Sbjct  291   YLAMVDYPMPSEFLMPLPASPIKEVCRNIDKQPEGSSILERIYAGVNIYYNYTGTV-DCF  349

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHG+ GW WQACTEM+MP+  S   S+FP  E+DY   A  C + F + PRP 
Sbjct  350   DL--DDDPHGMGGWDWQACTEMVMPMSSSEGLSMFPPDEFDYELYADDCVKNFGVRPRPR  407

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WI+TEFGGHNI  VL+KFGSNIIFFNGL DPWS GGVLKNIS+S+VAI A  GAHH+DLR
Sbjct  408   WISTEFGGHNISSVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHIDLR  467

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +TKEDP WL  +R  E+EII  W+S +Y +
Sbjct  468   PATKEDPDWLVSLRESELEIISGWLSDHYRA  498



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   520 bits (1338),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 249/496 (50%), Positives = 341/496 (69%), Gaps = 13/496 (3%)
 Frame = -1

Query  1746  IILLffffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFT  1567
             ++LL     F  +     P FP   +  R N   +S   A D        YFTQ++DHF+
Sbjct  1     MLLLALSGLFTSAARPPRPLFPIGLLGGRKNVGQSSVTYAVD--------YFTQVIDHFS  52

Query  1566  FTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALL  1387
             F  ++  +FQQRYLI  RYW GA +  PIF+Y GNEGD+EWF +NTGF+++IAP F AL+
Sbjct  53    FRREA--SFQQRYLIEKRYWKGAADRGPIFMYCGNEGDVEWFAKNTGFLWEIAPSFGALI  110

Query  1386  VFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVF  1207
             +F EHR+YGKS+P+G  + +   + +L  L+S Q LAD+ATL+IDLKKNLTA  SPVV+F
Sbjct  111   LFPEHRYYGKSMPYGTMEASYKDADSLSTLTSEQALADFATLVIDLKKNLTAAASPVVLF  170

Query  1206  GGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKV  1027
             GGSYGGMLA+W RLKYPH+ IGA+A+SAPIL FE+I     F  +++ DF+ ES +C+  
Sbjct  171   GGSYGGMLASWMRLKYPHIAIGAVAASAPILQFEDIVPSDTFYKIVSADFKRESASCFNY  230

Query  1026  IKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFL  847
             I+ SW +I  IA ++GGL  L   F++C++  +   LE WLS+AY+Y AM DYP  TNF+
Sbjct  231   IRESWGVIDKIASKNGGLHDLSTQFHMCRDLNASWELENWLSSAYSYVAMVDYPIPTNFI  290

Query  846   NPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLAS-SSDPHGLSG  670
              P+P YPV+++C+ ID    GSD L+++++  ++YYNY+G+   CF  +   +D  G++G
Sbjct  291   TPLPAYPVREICRVIDSLPEGSDILSRIFAGASVYYNYSGQA-ECFQPSDPGNDDLGVTG  349

Query  669   WSW-QACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIE  493
             W W QACTEMIMP+  ++ +S+F   +WD     QYC + + + PRPNWITT +GG +I+
Sbjct  350   WDWQQACTEMIMPMSSNSSNSMFQPYDWDLEGNIQYCMKTYGVRPRPNWITTNYGGKDIK  409

Query  492   RVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKD  313
              VLK FGSNI+F NGL DPWS GGVL+NIS S++A+ A EGAHH+DLR STK DP WL +
Sbjct  410   AVLKDFGSNIVFSNGLLDPWSGGGVLENISSSIIALVAPEGAHHLDLRASTKIDPDWLVE  469

Query  312   VRRKEVEIIQKWISQY  265
              R  EV  I KWI+ Y
Sbjct  470   QRATEVAYITKWIAAY  485



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   520 bits (1338),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 321/451 (71%), Gaps = 8/451 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLIN-DRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+T+YF Q LDHF+F      +FQQRYL+    +W  A+   PIF Y GNEGDIEWF  N
Sbjct  56    YETRYFRQRLDHFSFA--ELPSFQQRYLVGPSDHW--ARPAGPIFFYCGNEGDIEWFASN  111

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IAP F+AL+VF EHR+YG+S+P+G    A  ++++L YL++ Q LAD+A L+ D
Sbjct  112   TGFVWEIAPLFSALVVFAEHRYYGESMPYGSRDRAYENAESLSYLTTEQALADFAVLLTD  171

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+NL+A DSPVV+FGGSYGGMLAAW RLKYPHV IGALASSAPIL FE+I  P  F D+
Sbjct  172   LKRNLSAEDSPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPILQFEDIVPPETFYDM  231

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DFR ES +C+K IK SW  ++D  +    L  L + F +C+   +   L  WLS+AY
Sbjct  232   VSSDFRRESLSCFKAIKESWDALEDQGQGHDNLVNLSRKFRLCRELNNTAELSNWLSSAY  291

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM DYP  ++FL P+P  P+K++C+ ID    G+D L ++++ V+IYYNYTG V +C
Sbjct  292   SYLAMVDYPYPSDFLMPLPANPIKEVCRKIDSYPDGTDLLDRIFAGVSIYYNYTGTV-DC  350

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL    DPHG+SGW WQACTEM+MP+  S ++S+FP   + Y      C   + + PRP
Sbjct  351   FDL--EDDPHGMSGWGWQACTEMVMPMSSSQENSMFPTYNFSYAAYQDECVHNYGVRPRP  408

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              W+TTEFGGH+I+  LK+FGSNIIF NGL DPWS G VL+NIS+S++A+  + GAHH+DL
Sbjct  409   RWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHIDL  468

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R ST EDP WL + R+ E+ +I+ WI  YY 
Sbjct  469   RPSTNEDPDWLIEQRKSEISLIRGWIYDYYQ  499



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   520 bits (1338),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 314/450 (70%), Gaps = 5/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+ +YF Q LDHF+F+     TF QRYLI+  +W G   + PIF Y GNEGDIEWF QNT
Sbjct  61    YEKRYFQQRLDHFSFS--ELPTFPQRYLISTEHWVGPHRLGPIFFYCGNEGDIEWFAQNT  118

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A++VF EHR+YG+SVP+G  +EA  ++ TL YL++ Q LAD++ LI  L
Sbjct  119   GFVWEIAPRFGAMVVFPEHRYYGESVPYGSAEEAYKNATTLSYLTAEQALADFSVLITYL  178

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K N +A D PVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I  P  F D++
Sbjct  179   KHNYSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPPETFYDLV  238

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  F+ ES  C+  IK SW  I    + + GLE L K+FN+C+       L  W   AY+
Sbjct  239   SNAFKRESFTCFNYIKQSWNEIASTGQTNNGLELLTKTFNLCQKLKRTKDLYDWAEAAYS  298

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP    F+  +P +P++++C+ ID    G+  L ++Y  VN+YYNYTGE   CF
Sbjct  299   YLAMVNYPYPAEFMMTLPEHPIREVCRRIDGGPAGTSILERIYEGVNVYYNYTGEA-KCF  357

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHG+SGW WQACTEM+MP+  S + S+FP  E++Y      C + F ++PRP 
Sbjct  358   EL--DDDPHGMSGWEWQACTEMVMPMSSSQESSMFPPYEYNYTSIQAECLKKFGVKPRPR  415

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH+I   LKKFGSNIIF NGL DPWS GGVL+NIS+S+V++  +EGAHH+DLR
Sbjct  416   WITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGGGVLQNISESVVSLVTEEGAHHIDLR  475

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
              STK DP WL + R  E+++I+ WIS Y+ 
Sbjct  476   SSTKNDPDWLVEQRETEIKLIEGWISDYHQ  505



>ref|XP_002458558.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
 gb|EES03678.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
Length=518

 Score =   520 bits (1338),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 324/454 (71%), Gaps = 9/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF-----TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEW  1444
             Y+T+YF Q LDHF+F       ++   FQQRYL+     G A    PIF Y GNEGDI W
Sbjct  51    YETRYFRQRLDHFSFPGVADEDEAAAFFQQRYLVGRGG-GWAGPGGPIFFYCGNEGDIAW  109

Query  1443  FTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYAT  1264
             F  N+G +++ AP F AL+VF EHR+YG+S+PFG + +A + SK+L YL++ Q LAD+A 
Sbjct  110   FASNSGLVWEAAPRFAALVVFAEHRYYGESMPFGSKAKAYNDSKSLAYLTAEQALADFAV  169

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             L+ DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+++GAL+SSAPIL FE+I     
Sbjct  170   LLTDLKRNLSAEGSPVVLFGGSYGGMLAAWMRLKYPHISVGALSSSAPILQFEDIVPSTI  229

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F D+++ DFR ES +C+  IK SW+ + D   E GGL +L K+F++C+   + G L  WL
Sbjct  230   FYDLVSDDFRRESLSCFLTIKDSWKELDDQGNEQGGLLKLSKTFHLCQTLKTSGDLSDWL  289

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE  724
             S+AY+Y AM DYP  + FL P+P  P+K++C+ ID    G+  L ++Y+ VN+YYNYTG 
Sbjct  290   SSAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPEGTSTLERIYAGVNVYYNYTGT  349

Query  723   VNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
             V  CFDL  + DPHG+ GW WQACTEM+MP+  S   S++P  ++DY   A  C +++ +
Sbjct  350   V-GCFDL--NDDPHGMGGWDWQACTEMVMPMSYSEGRSMYPPYKFDYPSYADGCIKSYGV  406

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP WITTEFGGHNI  VL+KFGSNIIFFNGL DPWS GGVLKNIS+S++AI A  GAH
Sbjct  407   RPRPRWITTEFGGHNITTVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIAIVAPLGAH  466

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             H+DLR +T +DP WL  +R  E++II  W+S YY
Sbjct  467   HIDLRPATPDDPDWLVALRESELKIISGWLSDYY  500



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   519 bits (1337),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 235/455 (52%), Positives = 329/455 (72%), Gaps = 6/455 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF+Q LDHF+F+   +  F QRYLI+  +W G   + PIFVY GNEGDI+WF  NT
Sbjct  63    YETRYFSQRLDHFSFS--EHPRFSQRYLISTEHWVGPNRLGPIFVYCGNEGDIDWFAANT  120

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+PFG  +EA  ++ TL YL++ Q LAD+A LI +L
Sbjct  121   GFVWEIAPQFGAMVLFPEHRYYGESIPFGSREEAYRNASTLSYLTAEQALADFAVLITEL  180

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N +A D PVV+FGGSYGGMLA+W RLKYPH+ IGALASSAPIL FE+I     F D++
Sbjct  181   KRNFSAEDCPVVLFGGSYGGMLASWMRLKYPHIAIGALASSAPILQFEDIVPTEIFYDLV  240

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW +   + E++ GL  L K+F++C+       L  WLS+AY+
Sbjct  241   SNDFKRESTSCFNTIKESWDVFTSVGEKNDGLLELTKTFHLCRTLKRTEDLTDWLSSAYS  300

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  +NF+ P+P +P++++CK ID    G+  L +++  ++++YNYTG+V  CF
Sbjct  301   YLAMVNYPYPSNFIMPLPGHPIREVCKKIDGSPVGTSTLEQIFEGISVFYNYTGDV-ECF  359

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              L    DPHG+ GW+WQACTEM+MP   S+  S+FP  +++ +   + C   F ++PRP 
Sbjct  360   QL--DDDPHGMDGWNWQACTEMVMPT-SSSWGSMFPRYDFNLSAYEEQCWNDFGVKPRPR  416

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH+I+  L++FGSNIIFFNGL DPWS GGVL+NIS+S+VA+   EGAHH+DLR
Sbjct  417   WITTEFGGHDIKADLERFGSNIIFFNGLLDPWSGGGVLQNISESIVALVTIEGAHHIDLR  476

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              STKEDP WL ++R  E+++I+ WI  YY   T +
Sbjct  477   ASTKEDPDWLVELRETEIKLIKGWIDNYYQRKTKV  511



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   518 bits (1334),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 245/451 (54%), Positives = 323/451 (72%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+F+ +    FQQRYL+     G A    PIF Y GNEGDI WF  N+
Sbjct  52    FETRYFRQRLDHFSFSGEE-EFFQQRYLVGRAG-GWAGPGGPIFFYCGNEGDIAWFAANS  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             G +++ AP F AL+VF EHR+YG+S+PFG +++A +SS+++ YL++ Q LADYA L+ DL
Sbjct  110   GLVWEAAPRFAALVVFAEHRYYGESMPFGSKEKAYNSSRSMAYLTAEQALADYAVLLTDL  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I     F D++
Sbjct  170   KRNLSSESSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPDTIFYDLV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C++ IK SW+ + +      GL +L K+F++C+   + G+L  WLS+AY+
Sbjct  230   SNDFKRESLSCFQTIKDSWKELDEQGNGQDGLLKLSKTFHLCQTLNTTGALSDWLSSAYS  289

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  + FL P+P  P+K++C+ ID     S  L ++Y+ VNIYYNYTG V +CF
Sbjct  290   YLAMVDYPMPSEFLMPLPANPIKEVCRNIDKQPERSSILERIYAGVNIYYNYTGTV-HCF  348

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHG+ GW WQACTEM+MP+  S   S+FP  E+DY   A  C + F + PRP 
Sbjct  349   DL--DDDPHGMGGWDWQACTEMVMPMSSSEGLSMFPPDEFDYALYADDCVKNFGVRPRPR  406

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WI+TEFGGHNI  VL+KF SNIIFFNGL DPWS GGVLKNIS S+VAI A  GAHH+DLR
Sbjct  407   WISTEFGGHNISSVLEKFSSNIIFFNGLLDPWSGGGVLKNISDSVVAIVAPLGAHHIDLR  466

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +TKEDP WL  +R  E+EII  W+S +Y +
Sbjct  467   PATKEDPDWLVSLRESELEIISGWLSDHYRA  497



>ref|XP_003569899.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=512

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 323/449 (72%), Gaps = 5/449 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +DT+YF Q LDHF+F+     +FQQRYL+     G A    PIF Y GNEGDI WF  N+
Sbjct  49    FDTRYFRQRLDHFSFSGGE-ESFQQRYLVGRAG-GWAGPGGPIFFYCGNEGDIAWFAANS  106

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             G +++ AP F AL+VF EHR+YG+S+PFG +++A ++S++L YL++ Q +ADYA L+ DL
Sbjct  107   GLVWEAAPRFAALVVFAEHRYYGESMPFGSKEKAYNNSRSLAYLTAEQAIADYAVLLTDL  166

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I     F D++
Sbjct  167   KRNLSSESSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPQTIFYDIV  226

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C++ IK SW+ + +      GL +L K+F++C+   + G L  WL++AY 
Sbjct  227   SNDFKRESLSCFQTIKDSWKELDEQGNGQDGLLKLSKTFHLCQTLKTTGGLSDWLNSAYG  286

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             + AM DYP +++FL P+P  P+K++C+ ID    G+  L ++Y+ VNIYYNYTG V +CF
Sbjct  287   FLAMVDYPMSSDFLMPLPSNPIKEVCRNIDKQLDGTSTLERIYAGVNIYYNYTGTV-DCF  345

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHG+ GW WQACTEM+MP+  S   S+FP  E+DY   A  C ++F + P P 
Sbjct  346   DL--DDDPHGMGGWQWQACTEMVMPMSSSESLSMFPPYEFDYASYADDCVKSFGVRPSPR  403

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGHNI  VL+KFGSNIIFFNGL DPWS GGVLKNIS S+VAI A  GAHH+DLR
Sbjct  404   WITTEFGGHNISAVLEKFGSNIIFFNGLLDPWSGGGVLKNISGSVVAIVAPLGAHHIDLR  463

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
              +TKEDP WL  +R  E+ II  W+S +Y
Sbjct  464   PATKEDPDWLVSLRESELGIISGWLSDHY  492



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   516 bits (1330),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 244/490 (50%), Positives = 326/490 (67%), Gaps = 21/490 (4%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP  T  NR   +     +   N   Y+TK+F+Q LDHF+F       F QRYLIN  
Sbjct  32    PRFPRYTFQNREARIQ--QFRGDRNEYRYETKFFSQQLDHFSFA--DLPKFSQRYLINSD  87

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             +W GA  + PIF+Y GNEGDIEWF  N+GF++DIAP F ALLVF EHR+YG+S+P+G  +
Sbjct  88    HWLGASALGPIFLYCGNEGDIEWFATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSRE  147

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGG------------  1189
             EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGG            
Sbjct  148   EAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGSNNCVFVFVVID  207

Query  1188  --MLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGS  1015
               +LAAW RLKYPH+ IGALASSAPIL FE++  P  F D+ + DF+ ES +C+  IK S
Sbjct  208   ATVLAAWMRLKYPHIAIGALASSAPILQFEDVVPPETFYDIASNDFKRESSSCFNTIKDS  267

Query  1014  WQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMP  835
             W  I    ++  GL +L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P
Sbjct  268   WDAIIAEGQKENGLLQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLP  327

Query  834   PYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQA  655
              +P++++C+ ID     +  L ++Y+ +++YYNYTG V+ CF L    DPHGL GW+WQA
Sbjct  328   GHPIREVCRKIDGAGSNASILDRIYAGISVYYNYTGNVD-CFKL--DDDPHGLDGWNWQA  384

Query  654   CTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKF  475
             CTEM+MP+  + ++S+FP   ++Y+   + C   F++ PRP W+TTEFGGH+I   LK F
Sbjct  385   CTEMVMPMSSNQENSMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSF  444

Query  474   GSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEV  295
             GSNIIF NGL DPWS G VLKN+S ++VA+  KEGAHH+DLR ST EDPKWL D R  E+
Sbjct  445   GSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEI  504

Query  294   EIIQKWISQY  265
              +IQ WI  Y
Sbjct  505   RLIQGWIETY  514



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   516 bits (1328),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 268/497 (54%), Positives = 343/497 (69%), Gaps = 32/497 (6%)
 Frame = -1

Query  1650  LSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP----  1483
             +SA++       + + T YF Q LDHFTFTP +   F+Q+YL+ND +W   +        
Sbjct  59    VSAAADGTNSTAQPFTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAG  118

Query  1482  -IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL  1306
              +FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIEHRFYG+S+PFG   ++ SS++T 
Sbjct  119   PLFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESLPFG--DDSYSSAETE  176

Query  1305  GYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS  1126
             GYL+STQ LAD+A LI  LK+NL+A  +PVVVFGGSYGGMLA+WFRLKYPHV IGALASS
Sbjct  177   GYLTSTQALADFAILITGLKRNLSAETAPVVVFGGSYGGMLASWFRLKYPHVAIGALASS  236

Query  1125  APILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNI  946
             APIL F++IT   +FSD ++QD++SES NC+ VIK +W ++ +      GL  L K F  
Sbjct  237   APILQFDHITPWNSFSDAVSQDYKSESLNCFSVIKAAWDVLDERGSTDTGLLELSKLFRA  296

Query  945   CKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVK---QMCKAIDDPNHGSDP  775
             CK+     S+ GWL TA+TYTAM DYPT  NFL  +P YPVK   QMCK ID    G+D 
Sbjct  297   CKSVKHADSIAGWLQTAFTYTAMVDYPTPANFLMDLPAYPVKEPIQMCKIIDGFPAGADI  356

Query  774   LAKLYSAVNIYYNYTGEVNNCFDL----ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSI  607
             L K+++A N+YYNYTG+   C  +      SS   GLSGW WQACTEMIMP+  SN  S+
Sbjct  357   LEKVFAAANLYYNYTGD-QACNQIESDSDDSSSSLGLSGWGWQACTEMIMPMSTSNA-SM  414

Query  606   FPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  427
             FP S + Y + +  C ++  + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPWS 
Sbjct  415   FPPSSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDPWSR  474

Query  426   GGVLKNISKSLVAITAKEG----------------AHHVDLRFSTKEDPKWLKDVRRKEV  295
             GGVLKNIS S+VA+  ++G                AHH+DLRF+T EDP W+ + RR+EV
Sbjct  475   GGVLKNISSSIVALVTEKGEHGNLRRKKKKKKKKWAHHLDLRFATDEDPDWVTEQRRQEV  534

Query  294   EIIQKWISQYYHSLTDL  244
             EII+ WI QY+  +  +
Sbjct  535   EIIEGWIDQYHRDMAQV  551



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   514 bits (1324),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 323/476 (68%), Gaps = 8/476 (2%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP  T  NR         +   N   Y+TK+F+Q LDHF+F       F QRYLIN  
Sbjct  32    PRFPRYTSRNRGR---IQQFRGDRNEYRYETKFFSQQLDHFSFA--DLPKFPQRYLINSD  86

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             YW GA  + PIF+Y GNEGDIEWF  N+GF++DIAP F ALLVF E R     +P+G  +
Sbjct  87    YWLGASALGPIFLYCGNEGDIEWFATNSGFIWDIAPKFGALLVFPEVRSCLFCMPYGSME  146

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH
Sbjct  147   EAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLKYPH  206

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             + IGALASSAPIL FE+I  P  F D+ + DF+ ES +C+  IK SW  I    ++  GL
Sbjct  207   IAIGALASSAPILQFEDIVPPETFYDIASNDFKRESSSCFNTIKDSWDAIIAEGQKENGL  266

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
              +L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P +P++++C+ ID  
Sbjct  267   LQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGA  326

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
             +  +  L ++++ +++YYNYTG V +CF L    DPHGL GW+WQACTEM+MP+  + + 
Sbjct  327   HSDASILDRIFAGISVYYNYTGNV-DCFKL--DDDPHGLDGWNWQACTEMVMPMSSNQEK  383

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FPA +++Y+   + C   F++ PRP W+TTEFGGH+IE  LK FGSNIIF NG+ DPW
Sbjct  384   SMFPAYDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGMLDPW  443

Query  432   SAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             S G VLKN+S ++VA+  KEGAHH+DLR ST EDPKWL D R  E+++IQ WI  Y
Sbjct  444   SGGSVLKNLSNTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIQLIQGWIETY  499



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   514 bits (1324),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 315/451 (70%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F+      F QRYLI+  +W G K + PIFVY GNEGDIEWF  NT
Sbjct  65    YETRYFEQRLDHFSFS--KLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  122

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A++VF EHR+YGKS+PFG  ++A  ++ TL YL++ Q LAD+  LI+ L
Sbjct  123   GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  182

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N++A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL F  I  P +F D++
Sbjct  183   KRNVSAAACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFPEIAEPDSFYDIV  242

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +    ++  GL RL + F +C        L GWL   Y+
Sbjct  243   SNDFKRESASCFNTIKASWNALTAEGQKKDGLSRLTRMFRLCGELKDSEDLAGWLDNGYS  302

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               AM +YP  ++FL P+P YP++++C+ ID    G+  L +++  V++YYNYTG+V +CF
Sbjct  303   NLAMVNYPYPSDFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGKV-DCF  361

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHG++GW WQ+CTEM+MP+  +   S+FP  ++D +   +YC+  +K+ PRP 
Sbjct  362   DLY--DDPHGMAGWDWQSCTEMVMPMSSNPHTSMFPRYDFDLSADKEYCRTEYKVNPRPE  419

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +I   LK FGSNIIF NGL DPWS G V KN+S S+VA+  +EGAHH+DLR
Sbjct  420   WITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWSGGSVTKNVSDSIVALNTQEGAHHLDLR  479

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +T  DP WL + R  E+++I+KW+  YY +
Sbjct  480   AATAHDPDWLVEQRATEIKLIRKWLRDYYQA  510



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 237/448 (53%), Positives = 321/448 (72%), Gaps = 5/448 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y++KYF Q LDHF+F   +   F QRYLIN  +W G +   PIF+Y GNEGDIEWF  NT
Sbjct  63    YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G  +EA  ++ TL YL++ Q LAD+A LI DL
Sbjct  121   GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPHV IGALASSAPIL FE+I  P  F +++
Sbjct  181   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPILQFEDIVPPETFYNIV  240

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +     +  GL +L K+F++C+   S   L  WL +AY+
Sbjct  241   SNDFKRESTSCFNTIKESWDALLSEGLKKNGLVQLTKTFHLCRELKSTEDLANWLDSAYS  300

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P YP+ ++CK ID    G+  L +++  ++IYYNYTGE+ +CF
Sbjct  301   YLAMVDYPYPSSFMMPLPGYPIGEVCKRIDGCPDGTSILERIFEGISIYYNYTGEL-HCF  359

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHGL GW+WQACTEM+MP+  S+  S+FP  +++Y+   + C E F + PRP 
Sbjct  360   EL--DDDPHGLDGWNWQACTEMVMPMSSSHNASMFPTYDFNYSSYQEGCWEEFGVIPRPR  417

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +I+  L+ FGSNIIF NGL DPWS G VL+NIS+++VA+  +EGAHH+DLR
Sbjct  418   WITTEFGGQDIKTALETFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHIDLR  477

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQY  265
              ST EDP WL + R  EV++I+ WI  Y
Sbjct  478   PSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>gb|AAM15096.1| putative prolylcarboxypeptidase [Arabidopsis thaliana]
Length=476

 Score =   512 bits (1319),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 253/464 (55%), Positives = 320/464 (69%), Gaps = 36/464 (8%)
 Frame = -1

Query  1620  NHKL-YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEW  1444
              H+L ++T+YF Q LDHF+FTP SY  F Q+YLIN+R+W   +   PIFVY GNEGDI+W
Sbjct  41    KHELPFETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFVYTGNEGDIDW  97

Query  1443  FTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYAT  1264
             F  NTGFM DIAP F ALLVFIEHRFYG+S PFG  K++  S++TLGYL+S Q LADYA 
Sbjct  98    FASNTGFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAI  155

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             LI  LK+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+TIGALASSAPIL+F+NI    +
Sbjct  156   LIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALASSAPILHFDNIVPLTS  215

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F D I+QDF+  S NC+KVIK SW+ ++ ++    GL+ L K F  CK   S  S   WL
Sbjct  216   FYDAISQDFKDASINCFKVIKRSWEELEAVSTMKNGLQELSKKFRTCKGLHSQYSARDWL  275

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE  724
             S A+ YTAM +YPTA NF+ P+P YPV+QMCK ID    GS  L + ++A ++YYNY+G 
Sbjct  276   SGAFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGS  335

Query  723   VNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
                CF++   +D HGL GW +QACTEM+MP+  SN+ S+ P  E D     + C   + +
Sbjct  336   -EKCFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDSEAFQEQCMTRYGV  393

Query  543   EPRPNWITTEFGG-----HNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITA  379
             +PRP+WITTEFGG     H I R                       VLKNIS S+VA+  
Sbjct  394   KPRPHWITTEFGGMMDYFHQIFR-----------------------VLKNISSSIVALVT  430

Query  378   KEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             K+GAHH DLR +TK+DP+WLK+ RR+EV II+KWIS+YY  L +
Sbjct  431   KKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLRE  474



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   513 bits (1322),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 325/452 (72%), Gaps = 7/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+++TQ LDHF   P SY TFQQRYLIN  +W G    +PIF+Y GNEGD+E FT NT
Sbjct  66    YETRHYTQRLDHFNSAPSSYATFQQRYLINGTFWRG--KTSPIFLYAGNEGDVELFTNNT  123

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM++ AP F A+LVFIEHR+YGKS+PFGG++ A   + T GYL+  Q LADYA+ ++ L
Sbjct  124   GFMWEAAPRFGAMLVFIEHRYYGKSMPFGGKEAAYRDAATKGYLTVPQALADYASFVLSL  183

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL+A  +PV+V GGSYGGMLAAW R+KYPH+ +GA+ASSAPIL F  +  PYAF D +
Sbjct  184   KANLSAPAAPVLVLGGSYGGMLAAWMRIKYPHIVMGAVASSAPILSFYGLADPYAFYDRM  243

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T DF+SES++CY+V++ SW ++  +     G   L+++FN+C N  SV  +   L +A  
Sbjct  244   TDDFKSESKHCYEVLRDSWAVLDSLLATKEGSALLKRTFNMC-NGSSVEDIPSLLESAVV  302

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSD-PLAKLYSAVNIYYNYTGEVNNC  712
             Y AMTDYPT + FL  +P YPV++MC+A+DDP+ G +  LA++ +A+++YYN+TG    C
Sbjct  303   YAAMTDYPTPSGFLTALPAYPVREMCRAVDDPSSGGNGTLARVRAAMDVYYNHTGAA-AC  361

Query  711   FDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSIF-PASEWDYNERAQYCKEAFKIEP  538
             F      DP+G+  GW+WQACTEM++   G + DSI  P   +++ +    C+ A  + P
Sbjct  362   FRGEEEDDPYGMYDGWNWQACTEMVLMTYGLSNDSILQPPWPFNFTDVIASCRNATGLPP  421

Query  537   RPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHV  358
             RP WI TEFGG++I  VLK+  SNIIFFNGLRDPWS GGVLK+IS S++A+   +GAHHV
Sbjct  422   RPFWIETEFGGYDIGNVLKRSASNIIFFNGLRDPWSTGGVLKSISDSIIALVEPKGAHHV  481

Query  357   DLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             DLRFS+++DP WLK VR KE  II +W+ QYY
Sbjct  482   DLRFSSEDDPDWLKQVRAKETRIIARWLKQYY  513



>gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   513 bits (1321),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 320/447 (72%), Gaps = 5/447 (1%)
 Frame = -1

Query  1605  DTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTG  1426
             +T+YF Q LDHF+F+      F QRYL+N  +W G   + PIF+Y GNEGDIEWF  NTG
Sbjct  63    ETRYFYQKLDHFSFS--DLPKFPQRYLLNTDHWVGPNRLGPIFLYCGNEGDIEWFAVNTG  120

Query  1425  FMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLK  1246
             F++DIAP F A++VF EHR+YG+S+P+G    A  ++ TL +L++ Q LAD+A LI DLK
Sbjct  121   FVWDIAPRFGAMVVFPEHRYYGESMPYGSRDVAYKNATTLSHLTAEQALADFAVLITDLK  180

Query  1245  KNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVIT  1066
             +NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D+++
Sbjct  181   RNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYDIVS  240

Query  1065  QDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTY  886
              DF+ ES +C+  IK SW  +    ++  GL +L ++F++C+   S   L  WL +AY+Y
Sbjct  241   SDFKRESTSCFNTIKESWHALVSEGQKENGLVQLTETFHLCRKLNSTEELSNWLDSAYSY  300

Query  885   TAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFD  706
              AM DYP  + F+ P+P +P++++CK ID    G++ L +++  V+IYYNYTG+V +CF+
Sbjct  301   LAMVDYPYPSAFMMPLPGHPIREVCKKIDGSPDGTNILERIFEGVSIYYNYTGDV-DCFE  359

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
             L    DPHGL GW+WQACTEM+MP+  S   S+F   +++Y    + C + F +EPRP W
Sbjct  360   L--DDDPHGLDGWNWQACTEMVMPMASSKDASMFLTYDFNYTSFKEECLKNFGVEPRPRW  417

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             ITTEFGGH+I+  L+ FGSNIIF NGL DPWS G VL+N+S+++VA+  KEGAHH+DLR 
Sbjct  418   ITTEFGGHDIKTALESFGSNIIFSNGLLDPWSGGSVLQNLSETVVALVTKEGAHHIDLRS  477

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQY  265
             ST EDP WL + R  E+++I+ WI+ Y
Sbjct  478   STPEDPDWLVEQRATEIKLIEGWINGY  504



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   513 bits (1322),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 318/451 (71%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F      TF+QRYLI+  +W G   + PIF+Y GNEGDIEWF  N+
Sbjct  65    YETRYFEQQLDHFSFA--ELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A++VF EHR+YG+S+P+G ++EA  +  +L YL++ Q LAD+A LI DL
Sbjct  123   GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D++
Sbjct  183   KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYDIV  242

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +    ++  GL +L K F +C+   +   L  WL +AY+
Sbjct  243   SNDFKRESTSCFNTIKASWNALISEGQKENGLSKLTKMFRLCRELKNTEELANWLDSAYS  302

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             + AM DYP  + FL P+P YP++++C+ ID    G+  L +++  V++YYNYTGEV +CF
Sbjct  303   FLAMVDYPYPSEFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGEV-DCF  361

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHG+ GW+WQACTEM+MP+  S   S+FP  +++++   + C   FK+ PRP 
Sbjct  362   EL--DDDPHGMDGWNWQACTEMVMPMSSSPDASMFPTYDFNFSAFQEECWTDFKVIPRPT  419

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITT FGG +I   LK FGSNIIF NG  DPWS   V +N+S SLVA+  +EGAHH+DLR
Sbjct  420   WITTHFGGKDIMTTLKTFGSNIIFSNGFLDPWSGYSVTQNVSDSLVALNTQEGAHHIDLR  479

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +T EDP WL + R  E+++++KW+S YY +
Sbjct  480   AATAEDPDWLVEQRAAEIKLMKKWLSDYYQA  510



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   513 bits (1321),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 320/451 (71%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F      TF QRYLI+  +W G   + PIFVY GNEGDIEWF  NT
Sbjct  69    YETRYFEQRLDHFSFL--ELPTFNQRYLISSEHWSGPSQLGPIFVYCGNEGDIEWFAANT  126

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++++AP F A++VF EHR+YG+S+PFG ++EA  ++ TL YL++ Q LAD++ LI +L
Sbjct  127   GFVWEMAPSFGAMVVFPEHRYYGESMPFGSQEEAYKNAATLSYLTADQALADFSVLITNL  186

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P +F D++
Sbjct  187   KRNLSAEACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIFPPESFYDIV  246

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +    ++  GL +L + F +C+   +   L  WL +AY+
Sbjct  247   SNDFKRESTSCFNTIKASWNALISEGQKENGLSQLTRMFRLCRELKNTEELVNWLDSAYS  306

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP  ++F+ P+P +P++++C+ ID    G+  L ++   V +YYN+TGEV NCF
Sbjct  307   YLAMVNYPYPSDFIMPLPGHPIREVCRKIDGCPDGTSILERVSEGVGVYYNHTGEV-NCF  365

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHG++GW+WQACTEM+MPL  S   S+FP  +++++   + C   FK+ PRP 
Sbjct  366   EL--DDDPHGMNGWNWQACTEMVMPLSSSPDTSMFPTYDFNFSAFQEECWTDFKVNPRPR  423

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +I   LK FGSNIIF NG  DPWS G V +N+S S+VA+  +EGAHH+DLR
Sbjct  424   WITTEFGGKDIMTDLKTFGSNIIFSNGFLDPWSGGSVTQNVSDSIVALNTQEGAHHLDLR  483

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +T EDP WL + R  E+ +I+KW+S YY +
Sbjct  484   AATAEDPNWLVEQRATEIRVIKKWLSDYYQA  514



>ref|NP_001044360.1| Os01g0767100 [Oryza sativa Japonica Group]
 dbj|BAD53352.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD53324.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06274.1| Os01g0767100 [Oryza sativa Japonica Group]
Length=517

 Score =   513 bits (1320),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 324/453 (72%), Gaps = 9/453 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHT----FQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             Y+T+YF Q LDHF+F  +        FQQRYL+     G A    PIF Y GNEGDI WF
Sbjct  48    YETRYFRQRLDHFSFLEEEGEEGDGFFQQRYLVGRGG-GWAGAGGPIFFYCGNEGDIAWF  106

Query  1440  TQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATL  1261
               N+G +++ A  F AL+VF EHR+YG+S+PFG + +A ++SK+L YL++ Q LADYA L
Sbjct  107   AANSGLVWEAATRFAALVVFAEHRYYGESMPFGSKDKAYNNSKSLAYLTAEQALADYAVL  166

Query  1260  IIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAF  1081
             + DLKKNL++  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE++     F
Sbjct  167   LTDLKKNLSSEGSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDVVPSTIF  226

Query  1080  SDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLS  901
              D+++ DF+ ES +C++ IK SW+ +        GL +L K+F++CK   + G L  WLS
Sbjct  227   YDLVSNDFKRESLSCFQTIKDSWKALDAQGNGQDGLLKLSKTFHLCKTIKNTGELSDWLS  286

Query  900   TAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEV  721
             +AY+Y AM DYP   +F+ P+P  P+K++C  ID+   G+  L ++Y+ VN+YYNYTG V
Sbjct  287   SAYSYLAMVDYPMPADFMMPLPGNPIKELCTKIDNQPDGTSILERIYAGVNVYYNYTGTV  346

Query  720   NNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
              +CFDL  + DPHG+ GW WQACTEM+MP+  S +DS+FPA +++Y    + C  +F +E
Sbjct  347   -DCFDL--NDDPHGMDGWDWQACTEMVMPMSYS-EDSMFPADKFNYTSYEKDCINSFGVE  402

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             PRP WITTEFGGHNI  VL++FGSNIIFFNGL DPWS GGVLKNIS+S+VAI A  GAHH
Sbjct  403   PRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIIAPLGAHH  462

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             +DLR ++K+DP WL  +R  E+ II  W+S YY
Sbjct  463   IDLRPASKDDPDWLVRLRESELGIISGWLSDYY  495



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   514 bits (1323),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 315/451 (70%), Gaps = 5/451 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F+      F QRYLI+  +W G K + PIFVY GNEGDIEWF  NT
Sbjct  100   YETRYFEQRLDHFSFS--KLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  157

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A++VF EHR+YGKS+PFG  ++A  ++ TL YL++ Q LAD+  LI+ L
Sbjct  158   GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  217

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N++A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL F  I  P +F D++
Sbjct  218   KRNVSAAACPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFPEIAEPDSFYDIV  277

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +    ++  GL RL + F +C        L GWL   Y+
Sbjct  278   SNDFKRESASCFNTIKASWNALTAEGQKKDGLSRLTRMFRLCGELKDSEDLAGWLDNGYS  337

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               AM +YP  ++FL P+P YP++++C+ ID    G+  L +++  V++YYNYTG+V +CF
Sbjct  338   NLAMVNYPYPSDFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGKV-DCF  396

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHG++GW WQ+CTEM+MP+  +   S+FP  ++D +   +YC+  +K+ PRP 
Sbjct  397   DLY--DDPHGMAGWDWQSCTEMVMPMSSNPHTSMFPRYDFDLSADKEYCRTEYKVNPRPE  454

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG +I   LK FGSNIIF NGL DPWS G V KN+S S+VA+  +EGAHH+DLR
Sbjct  455   WITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWSGGSVTKNVSDSIVALNTQEGAHHLDLR  514

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHS  256
              +T  DP WL + R  E+++I+KW+  YY +
Sbjct  515   AATAHDPDWLVEQRATEIKLIRKWLRDYYQA  545



>ref|XP_002962483.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
 gb|EFJ35946.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
Length=474

 Score =   510 bits (1314),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 322/461 (70%), Gaps = 18/461 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y   YF Q LDHF     +   F QRYL+++  W G  + APIFVY GNEGDI WF +NT
Sbjct  20    YTEHYFQQTLDHFNVG--NITLFPQRYLLHNASWSGGASGAPIFVYCGNEGDIVWFAENT  77

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFMFDIAP F ALLVF EHRFYGKS PFGG+    +  K L + S+ Q LAD+ATLI+DL
Sbjct  78    GFMFDIAPLFGALLVFPEHRFYGKSQPFGGQ----NGPKELAFCSAEQALADFATLILDL  133

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL FENI     F D++
Sbjct  134   KRNLSAQASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFENIVPYTTFYDIV  193

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  F+ E E C+++I+ SW  I + AE+  GL  L + F++C ++ +   L  WL +AY+
Sbjct  194   SNAFKREGEKCFEIIRNSWTAITEAAEQQNGLRNLSQDFHMCSDFKNADELINWLESAYS  253

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP A NF  P+P +PV+++C+A+ +    S  L ++Y+ VN+YYN+TG    CF
Sbjct  254   YLAMANYPYAANFTMPLPAHPVRKVCQAMVNSPVASSILQRIYAGVNVYYNFTGAA-KCF  312

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHGLSGW+WQ+CTEM+MP+  ++  S++P  EWD    +++C E +   PRP+
Sbjct  313   DL--DDDPHGLSGWNWQSCTEMVMPMSSNSNTSMYPPFEWDGEAWSRFCWENYGAIPRPS  370

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGG---------VLKNISKSLVAITAK  376
             W+TTEFGGH+I+ VL+ FGSNI+F NGL DPWS G          VL++IS +++A   K
Sbjct  371   WVTTEFGGHDIKSVLRNFGSNIVFSNGLLDPWSGGRQAMNDSFRFVLESISSTILAFVTK  430

Query  375   EGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             EGAHH+D R+S K+DP+WL + R  EV  I++W+S+Y+ ++
Sbjct  431   EGAHHLDFRWSRKDDPQWLIEQRESEVREIKRWLSEYHQNV  471



>ref|XP_004970093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=565

 Score =   514 bits (1323),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 242/454 (53%), Positives = 323/454 (71%), Gaps = 9/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF-----TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEW  1444
             Y+T+YF Q LDHF+F       +    FQQRYL+     G A    PIF Y GNEGDI W
Sbjct  98    YETRYFRQRLDHFSFPGVGDEDEETAFFQQRYLVGRGA-GWAGPGGPIFFYCGNEGDIAW  156

Query  1443  FTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYAT  1264
             F  N+G +++ AP F AL+VF EHR+YG+S+PFG + +A ++SK+L YL++ Q +AD+A 
Sbjct  157   FAANSGLVWEAAPRFAALVVFAEHRYYGESMPFGSKAKAYNNSKSLAYLTAEQAIADFAV  216

Query  1263  LIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYA  1084
             L+ DLK+NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I     
Sbjct  217   LLTDLKRNLSAEGSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPSTI  276

Query  1083  FSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWL  904
             F D+++ DFR ES +C++ IK SW+++ D      GL +L K+F++C+   + G L  WL
Sbjct  277   FYDLVSDDFRRESLSCFQTIKDSWKVLDDQGNGQDGLLKLSKTFHLCQTLKTSGDLSDWL  336

Query  903   STAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE  724
             S+AY+Y AM DYP  + FL P+P  P+K++C+ ID    G+  L ++Y+ VN+YYNYTG 
Sbjct  337   SSAYSYLAMVDYPIPSEFLMPLPANPIKEVCRNIDSQPEGTSILERIYAGVNVYYNYTGT  396

Query  723   VNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
             V  CFDL  + DPHG+ GW WQACTEM+MP+  S   S++P  ++DY   A+ C +++ +
Sbjct  397   V-GCFDL--NDDPHGMGGWDWQACTEMVMPMSYSEDRSMYPPYKFDYASYAENCIKSYGV  453

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP WITT FGGHNI  VL+KFGSNIIFFNGL DPWS GGVLKNIS+S++AI A  GAH
Sbjct  454   RPRPRWITTNFGGHNITTVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIAIVAPLGAH  513

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             H+DLR +T +DP WL  +R  E++II  W+S YY
Sbjct  514   HIDLRPATSDDPDWLVSLRESELKIISGWLSDYY  547



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   511 bits (1317),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 322/451 (71%), Gaps = 8/451 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLIN-DRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+T+YF Q LDHF+F      +FQQRYL+    +W  A+   PIF Y GNEGDIEWF  N
Sbjct  58    YETRYFQQRLDHFSFA--ELPSFQQRYLVGPSDHW--ARPAGPIFFYCGNEGDIEWFASN  113

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IA  F+AL+VF EHR+YG+S+P+G +  A  ++ +L YL++ Q LAD+A L+ D
Sbjct  114   TGFVWEIAHLFSALVVFAEHRYYGESMPYGSKDRAYENAGSLSYLTTEQALADFAVLLTD  173

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+NL+A DSPVV+FGGSYGGM+AAW RLKYPH+ +GALASSAPIL FE+I  P  F D+
Sbjct  174   LKRNLSAEDSPVVLFGGSYGGMMAAWMRLKYPHIAVGALASSAPILQFEDIVPPETFYDL  233

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DFR ES +C+K IK SW  ++D  +    L  L + F +C++  +   L  WLS+AY
Sbjct  234   VSSDFRRESVSCFKAIKESWNALEDQGQGRDNLVNLSRKFCLCRDLNNTTELSNWLSSAY  293

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM DYP  ++FL P+P  P+K++C  ID    G+D L ++++ V++YYNYTG V +C
Sbjct  294   SYLAMVDYPYPSDFLMPLPANPIKEVCTKIDSYPDGTDLLDRIFAGVSVYYNYTGTV-DC  352

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             FDL    DPHG+SGW WQACTEM+MP+  S ++S+FPA  + Y      C + + ++PRP
Sbjct  353   FDL--EDDPHGMSGWDWQACTEMVMPMSSSQENSMFPAYNFSYAAYQDGCVQNYGVKPRP  410

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              W+TTEFGGH+I+  L KFGSNIIF NGL DPWS G VL+NIS+S++A+  + GAHH+DL
Sbjct  411   RWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHIDL  470

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R ST EDP WL + R+ E+ +I+ WI  +Y 
Sbjct  471   RPSTDEDPDWLIEQRKSEISLIRGWIYDHYQ  501



>ref|XP_002263389.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI29519.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   510 bits (1314),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 324/450 (72%), Gaps = 5/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+        F+QRYLI+ R+W G   M PIF+Y GNEGDIEWF  NT
Sbjct  58    YETRYFEQRLDHFSIA--DLPKFRQRYLISTRHWTGPDRMGPIFLYCGNEGDIEWFAANT  115

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++D+AP F A+++F EHR+YG+S+P+G   +A +++ +L YL++ Q LAD+A L+ +L
Sbjct  116   GFVWDMAPRFGAMVLFPEHRYYGESMPYGSRDKAYANAASLSYLTAEQALADFAVLVTNL  175

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D++
Sbjct  176   KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYDIV  235

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + +F+ ES +C+  IK SW ++    +++ GL++L K+F +C++      L  WL +AY+
Sbjct  236   SNNFKRESISCFDTIKKSWDVLISEGQKNDGLKQLTKAFRLCRDLKRTEDLYDWLDSAYS  295

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             + AM +YP  ++FL P+P +P+K++C+ +D    G+  L +++  V++YYNYTG+V  CF
Sbjct  296   FLAMVNYPYPSDFLMPLPGHPIKEVCRKMDSCPEGTSVLERIFEGVSVYYNYTGKV-ECF  354

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              L    DPHG+ GW+WQACTEM+MP+  S + S+FP  +++Y+   + C + F ++PRP 
Sbjct  355   QL--DDDPHGMDGWNWQACTEMVMPMASSRESSMFPTYDYNYSSFQEECWKDFSVKPRPT  412

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+NIS+++VA+  +EGAHH+DLR
Sbjct  413   WITTEFGGHEFKTTLKVFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHIDLR  472

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
              ST EDP WL + R  EV++I+ WI  Y+ 
Sbjct  473   SSTAEDPDWLVEQRAFEVKLIKGWIEDYHQ  502



>ref|XP_006646360.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=500

 Score =   510 bits (1313),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 317/447 (71%), Gaps = 12/447 (3%)
 Frame = -1

Query  1581  LDHFTFTPQSYHT------FQQRYLINDR-YWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             LDHF+F  +          FQQRYL+     W G    APIF Y GNEGDI WF  N+G 
Sbjct  40    LDHFSFLEEEEEEEGGEGFFQQRYLVGRAGEWAGGG--APIFFYCGNEGDIAWFAPNSGL  97

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             +++ AP F AL+VF EHR+YG+S+PFG +++A ++SK++ YL++ Q LADYA L+ DLKK
Sbjct  98    VWEAAPRFAALVVFAEHRYYGESMPFGSKEKAYNNSKSMAYLTAEQALADYAVLLTDLKK  157

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
             NL++  SPVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I     F D+++ 
Sbjct  158   NLSSEGSPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPSTIFYDLVSN  217

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DF+ ES +C++ IK SW+ ++D      GL +L K+F++C+   +   L  WLS+AY+Y 
Sbjct  218   DFKRESLSCFQTIKDSWKALEDQGNGQEGLLKLSKTFHLCQTIKTTRELSDWLSSAYSYL  277

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             AM DYP  ++FL P+P  P+K++C+ ID    G+  L ++Y+ VNIYYNYTG   +CFDL
Sbjct  278   AMVDYPMPSDFLMPLPGNPIKEVCRKIDSQPDGTSILERIYAGVNIYYNYTGTF-DCFDL  336

Query  702   ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWI  523
               + DPHG+ GW WQACTEM+MP+  S   S+FPA ++DY      C  +F + PRP WI
Sbjct  337   --NDDPHGMGGWDWQACTEMVMPMSYSEDGSMFPAYKFDYASYENDCISSFGVRPRPQWI  394

Query  522   TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFS  343
             TTEFGGHNI  VL++FGSNIIFFNGL DPWS GGVLKNIS+S+VAI A  GAHH+DLR +
Sbjct  395   TTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHIDLRPA  454

Query  342   TKEDPKWLKDVRRKEVEIIQKWISQYY  262
             TK DP WL  +R+ E++II  W+  YY
Sbjct  455   TKADPDWLVSIRKSELDIISGWLLDYY  481



>gb|AFW84965.1| putative serine peptidase S28 family protein [Zea mays]
Length=515

 Score =   510 bits (1313),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 245/456 (54%), Positives = 322/456 (71%), Gaps = 13/456 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF-------TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
             Y+T+YF Q LDHF+F         ++   FQQRYL+     G A    PIF Y GNEGDI
Sbjct  48    YETRYFRQRLDHFSFPGVGDEDEDEAAAFFQQRYLVGRGG-GWAGPGGPIFFYCGNEGDI  106

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
              WF  N+G +++ AP F AL+VF EHR+YG+S+PFG + +A S SK+L YL++ Q LAD+
Sbjct  107   AWFAANSGLVWEAAPRFAALVVFAEHRYYGESMPFGSKAKAYSDSKSLAYLTAEQALADF  166

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A L+ DLK+NL+A  SPVV+FGGSYGG   AW RLKYPH+ IGALASSAPIL FE+I   
Sbjct  167   AVLLTDLKRNLSAEGSPVVLFGGSYGG--TAWMRLKYPHIAIGALASSAPILQFEDIVPS  224

Query  1089  YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEG  910
               F D+++ DFR ES +C+  IK SW+ + D A E  GL +L K+F++C+   + G L  
Sbjct  225   TIFYDLVSDDFRRESLSCFLTIKDSWKELDDQANEQDGLLKLSKTFHLCQTLKTSGDLSD  284

Query  909   WLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYT  730
             WLS+AY+Y AM DYP  + FL P+P  P+K++C+ ID    G+  L ++Y+ VN+YYNYT
Sbjct  285   WLSSAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPKGTGTLERIYAGVNVYYNYT  344

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
             G V+ CFDL  + DPHG+ GW WQACTEM+MP+  S + S++P  ++DY   A+ C +++
Sbjct  345   GTVD-CFDL--NDDPHGMGGWDWQACTEMVMPMSYSEQRSMYPPYKFDYASYAEDCIKSY  401

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP WITTEFGGHNI +VL+ FGSNIIFFNGL DPWS GGVLKNIS+S+VAI A  G
Sbjct  402   GVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLG  461

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             AHH+DLR +T +DP WL  +R  E+EII  W+  YY
Sbjct  462   AHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  497



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   510 bits (1313),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 235/448 (52%), Positives = 320/448 (71%), Gaps = 5/448 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y++KYF Q LDHF+F   +   F QRYLIN  +W G +   PIF+Y GNEGDIEWF  NT
Sbjct  63    YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G  +EA  ++ TL YL++ Q LAD+A LI DL
Sbjct  121   GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPHV IGALASSAPIL FE+I  P  F +++
Sbjct  181   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPILQFEDIVPPETFYNIV  240

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +     +  GL +L K+F++C+   S   L  WL +AY+
Sbjct  241   SNDFKRESTSCFNTIKESWDALLSEGLKKNGLVQLTKTFHLCRELKSTEDLANWLDSAYS  300

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P YP++++CK ID    G+  L +++  ++IYYNYTGE+ +CF
Sbjct  301   YLAMVDYPYPSSFMMPLPGYPIREVCKRIDGCPDGTSILERIFEGISIYYNYTGEL-HCF  359

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHGL GW+WQACTEM+MP+  S+  S+F   +++Y+   + C E F + PRP 
Sbjct  360   EL--DDDPHGLDGWNWQACTEMVMPMSSSHDASMFSTYDFNYSSYQEGCWEEFGVIPRPR  417

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WIT EFGG +I+  L+ FGSNIIF NGL DPWS G VL+NIS+++VA+  +EGAHH+DLR
Sbjct  418   WITMEFGGQDIKTALETFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHIDLR  477

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQY  265
              ST EDP WL + R  EV++I+ WI  Y
Sbjct  478   PSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   510 bits (1313),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 325/450 (72%), Gaps = 5/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+FT      FQQRYLIN  +W GA+ + PIF Y GNEG IEWF +NT
Sbjct  69    YETRYFAQRLDHFSFT--DTPKFQQRYLINTEHWVGAQRLGPIFFYCGNEGGIEWFAENT  126

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++++AP F A+++F EHR+YG+S+P+G E+EA  ++ TL +L++ Q LAD+A LI +L
Sbjct  127   GFVWELAPRFGAMVLFPEHRYYGESMPYGSEEEAYKNASTLSFLTAGQTLADFAVLITEL  186

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I     F +++
Sbjct  187   KRNLSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPTETFYNIV  246

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW  +    ++  GL +L K+F +C+    +  L  WL +AY+
Sbjct  247   SNDFRRESSSCFNTIKASWDALVTEGQKDNGLVQLTKTFRLCRELKKIDDLSDWLDSAYS  306

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP    F+ P+P +P+K++C+ IDD   G+  L +++  V+I+YNYTG+   CF
Sbjct  307   YLAMVNYPYPAEFVMPLPGHPIKEVCRKIDDCPDGTSTLERVFEGVSIFYNYTGQA-ECF  365

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L  +S   G  GW+WQACTEM+MP+  S   S+FP  +++ +   + C + + ++PRP 
Sbjct  366   ELEDTS-AVGTDGWNWQACTEMVMPM-SSRDASMFPTYDFNLSSFEEECLKNYNVKPRPT  423

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTE+GGH+I+  LK FGSNIIF NGL DPWS G VL+N+S+++VA+ A+EGAHH+DLR
Sbjct  424   WITTEYGGHDIKATLKAFGSNIIFSNGLLDPWSGGSVLQNVSETIVALVAEEGAHHLDLR  483

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             FSTK+DPKWL + R  E+++I+ WI ++Y 
Sbjct  484   FSTKDDPKWLIEQRETEIKLIEGWIEKFYQ  513



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   510 bits (1314),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 246/469 (52%), Positives = 321/469 (68%), Gaps = 24/469 (5%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+++TQ LDHF   P SY TFQQRYL+ND +WGG    APIF+Y GNEGD++ FT NT
Sbjct  63    YETRWYTQRLDHFNSAPASYATFQQRYLVNDTFWGGPT--APIFLYAGNEGDVDLFTNNT  120

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAK-SSSKTLGYLSSTQVLADYATLIID  1252
             GFM++ AP F ALLVF+EHR+YG+S+PFGG + A    ++T GYL+ TQ LADYA+ ++ 
Sbjct  121   GFMWESAPRFRALLVFVEHRYYGESMPFGGTRAAAFRDARTKGYLTVTQALADYASFVLS  180

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK NL+A  +PVVVFGGSYGGMLAAW RLKYPH+ +GA+ASSAPIL F  I  PYAF D 
Sbjct  181   LKANLSAPAAPVVVFGGSYGGMLAAWMRLKYPHIVMGAVASSAPILSFYGIVDPYAFYDR  240

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             IT DF+SES++CY V++ SW ++ D      G  +LR++F +C N  SV  +   L +A 
Sbjct  241   ITDDFKSESKHCYDVLRKSWDVLDDALATKEGQAQLRRTFTMC-NGSSVQDIPSLLESAV  299

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAID---------------DPNHGSDP---LAK  766
              Y AMTDYPT + FL P+P YPV+ MC+AID               D N  S     L++
Sbjct  300   VYAAMTDYPTPSGFLTPLPAYPVRAMCRAIDASRAESAEASSGAANDGNSNSTAQLTLSQ  359

Query  765   LYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSIFPASEW  589
             +  A+++YYN+TG    CF      DPHG+  GW+WQACTE+++   G     +   S +
Sbjct  360   VRDAMDVYYNHTGAAA-CFRAEEDDDPHGMYDGWNWQACTEVMVMAYGIRDGGVLQPSPF  418

Query  588   DYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKN  409
             ++ +    C+    + PRP WI TEFGG +I  VLKK  SNI+FFNGLRDPWS GGVLK+
Sbjct  419   NFTDVVDSCRNYTGLPPRPFWIETEFGGFDIGNVLKKSASNIVFFNGLRDPWSTGGVLKS  478

Query  408   ISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             IS S++A+   +G+HHVDLRFS+KEDP+WLK VR KE  II +W+ QYY
Sbjct  479   ISDSIIALVEPKGSHHVDLRFSSKEDPEWLKQVRVKETRIIARWLKQYY  527



>gb|AGT17295.1| hypothetical protein SHCRBa_168_J15_F_160 [Saccharum hybrid cultivar 
R570]
Length=523

 Score =   510 bits (1313),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 247/462 (53%), Positives = 325/462 (70%), Gaps = 17/462 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF-----TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEW  1444
             Y+T+YF Q LDHF+F       ++   FQQRYL+     G A   APIF Y GNEGDI W
Sbjct  48    YETRYFRQRLDHFSFPGVGDEDEAAAFFQQRYLVGRGG-GWAGPGAPIFFYCGNEGDIAW  106

Query  1443  FTQNTGFMFDIAPHFNALLVFIE--------HRFYGKSVPFGGEKEAKSSSKTLGYLSST  1288
             F  N+G +++ AP F AL+VF E        HR+YG+S+PFG + +A + SK+L YL++ 
Sbjct  107   FASNSGLVWEAAPRFAALVVFAEATVLPRPLHRYYGESMPFGSKAKAYNDSKSLAYLTAE  166

Query  1287  QVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYF  1108
             Q LAD+A L+ DLK NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL F
Sbjct  167   QALADFAVLLTDLKSNLSAEGSPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQF  226

Query  1107  ENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYIS  928
             E+I     F D+++ DFR ES +C+  IK SW+ + D   + GGL +L K+F++C+   +
Sbjct  227   EDIVPSTIFYDLVSDDFRRESLSCFLTIKDSWKELDDQGNKQGGLLKLSKTFHLCQTLKT  286

Query  927   VGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVN  748
              G L  WLS+AY+Y AM DYP  + FL P+P  P+K++C+ ID    G+  L ++Y+ VN
Sbjct  287   SGDLSDWLSSAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPEGTSTLERIYAGVN  346

Query  747   IYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQ  568
             +YYNYTG V  CFDL  + DPHG+ GW WQACTEM+MP+  S   S++P  ++DY   A+
Sbjct  347   VYYNYTGTV-GCFDL--NDDPHGMGGWDWQACTEMVMPMSYSEVRSMYPPYKFDYPSYAE  403

Query  567   YCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVA  388
              C +++ + PRP WITTEFGGHNI +VL+KFGSNIIFFNGL DPWS GGVLKNIS+S++A
Sbjct  404   DCIKSYGVRPRPRWITTEFGGHNITKVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIA  463

Query  387   ITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             I A  GAHH+DLR +T +DP WL  +R  E++II  W+S YY
Sbjct  464   IVAPLGAHHIDLRPATPDDPDWLVALRESELKIISGWLSDYY  505



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   510 bits (1314),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 248/475 (52%), Positives = 318/475 (67%), Gaps = 28/475 (6%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+ +TQ LDHF   P SY TFQQRYLIND +WGG    APIF+Y GNEGDI+ FT NT
Sbjct  74    YETRRYTQRLDHFNSLPSSYATFQQRYLINDTFWGGRSRTAPIFLYAGNEGDIDLFTNNT  133

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAK-SSSKTLGYLSSTQVLADYATLIID  1252
             GFM++ AP F A+LVF+EHR+YG+S+PFGG +EA    + T GYL+ TQ LADYA+ ++ 
Sbjct  134   GFMWEAAPRFRAMLVFVEHRYYGESMPFGGTREAAFRDAATKGYLTVTQALADYASFVLS  193

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK NL+   +PVVVFGGSYGGMLAAW RLKYPHV +GA+ASSAPIL F  I  PYAF D 
Sbjct  194   LKANLSVPAAPVVVFGGSYGGMLAAWMRLKYPHVVMGAVASSAPILSFYGIVDPYAFYDR  253

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             I  D++SES+NCY V++ SW ++ D      G  +LR++FN+C N  SV  +   L  A 
Sbjct  254   INDDYKSESKNCYDVLRKSWDVLDDALATKEGQAQLRRTFNMC-NGSSVWDIPSLLENAM  312

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNH-----------GSDP----------  775
                AMTDYPT + FL P+P YPV+ MC+AID  +            G+D           
Sbjct  313   VEAAMTDYPTTSGFLTPLPAYPVRAMCRAIDARHQQAAASTSTSGSGNDDGNNSSSSTAL  372

Query  774   ---LAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSI  607
                  ++  A+N+YYN+TG    CF      DP+GL  GW+WQACTE+++   G    ++
Sbjct  373   LLLSEQVRDAMNVYYNHTGGAA-CFRAEEDDDPYGLYDGWNWQACTEVMVMAYGVRDGTV  431

Query  606   FPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  427
                + +++ E    C+    + PRP WI TEFGG++I  VLKK  SNIIFFNGLRDPWS 
Sbjct  432   LQPAPFNFTEVVDDCRNVTGLPPRPFWIETEFGGYDIANVLKKSASNIIFFNGLRDPWST  491

Query  426   GGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             GGVLK+IS S++A+   +GAHHVDLRFS+KEDP+WLK VR KE  II +W+ QYY
Sbjct  492   GGVLKSISDSIIALVEPKGAHHVDLRFSSKEDPEWLKKVRVKETRIIARWLKQYY  546



>ref|XP_007027868.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY08370.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=387

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 253/401 (63%), Positives = 285/401 (71%), Gaps = 59/401 (15%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             K  P FP S I  RP  LS ++ +     KLY  +YFTQILDHF F P+SY TFQ RYLI
Sbjct  27    KVPPRFPSSVI--RPEQLSLATKRGT---KLYKARYFTQILDHFNFNPKSYQTFQHRYLI  81

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND YW G +  +PIFVY GNEGDIEWF QNTGFMFD+AP+F ALLVFIEHRFYGKS+PFG
Sbjct  82    NDTYWSGPEKNSPIFVYTGNEGDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFG  141

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G+K+ A S++ TLGYL+STQ LADYATLIIDLKKNLTA DSPVVVFGGSYGGMLA WFRL
Sbjct  142   GDKDIAYSNASTLGYLTSTQALADYATLIIDLKKNLTADDSPVVVFGGSYGGMLATWFRL  201

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ IGALASSAPIL FENITSPY+F+++ITQDFRSESENCYKVIKGSW+ I+D    
Sbjct  202   KYPHIVIGALASSAPILNFENITSPYSFNNIITQDFRSESENCYKVIKGSWEQIEDTGSR  261

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
             SGGLE LRKSF ICKNYI   +LE WL+TA+ YTAMTDYPT +NFLNP+P YPVKQMCK+
Sbjct  262   SGGLELLRKSFRICKNYIDADALESWLTTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKS  321

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGG  625
             IDDP  G+D  AKLY A N+YYN+TG    CF+LA S                       
Sbjct  322   IDDPTTGNDSFAKLYGAANVYYNHTG-TTTCFNLAYSP----------------------  358

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGH  502
                                           PNWITTEFGGH
Sbjct  359   ------------------------------PNWITTEFGGH  369



>gb|KDO70542.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70543.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70544.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70545.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
Length=368

 Score =   502 bits (1292),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 253/372 (68%), Positives = 294/372 (79%), Gaps = 9/372 (2%)
 Frame = -1

Query  1758  MKTRIILLff----ffyfafsfAKTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYF  1591
             M TR I L F          S AK  PTFP S I   P  LS+  + + D+  LY TKY 
Sbjct  1     MATRFIFLSFCLLFSSTLTISNAKIFPTFPSSRIT--PEKLSSLISSSKDSQGLYKTKYH  58

Query  1590  TQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDI  1411
             TQILDHF + PQSY TFQQRYLIND +WGG+KN APIFVY GNEGDIEWF QNTGFM+D+
Sbjct  59    TQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQNTGFMYDV  118

Query  1410  APHFNALLVFIEHRFYGKSVPFGGEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLT  1234
             AP F ALLVFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQ LADYA+LIIDLKKNLT
Sbjct  119   APKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLIIDLKKNLT  178

Query  1233  ATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFR  1054
             ATDSPVVVFGGSYGGMLAAWFRLKYPHV IGALASSAPIL F+NI SPY+FS++ITQDFR
Sbjct  179   ATDSPVVVFGGSYGGMLAAWFRLKYPHVAIGALASSAPILNFDNIVSPYSFSNIITQDFR  238

Query  1053  SESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMT  874
             S SENCYKVIKGSW+ I++ A++ GGLE+L+K+F ICK+  ++ ++E WLSTA+ YTAMT
Sbjct  239   SVSENCYKVIKGSWKQIEETAKKPGGLEKLQKAFRICKSEKNL-AIESWLSTAFVYTAMT  297

Query  873   DYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASS  694
             DYPT +NFLNP+P +PVK+MCKAIDDP  G+D  AKLY A ++YYNY+G    CFDL   
Sbjct  298   DYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTA-KCFDLNGD  356

Query  693   SDPHGLSGWSWQ  658
             SDPHGLS W WQ
Sbjct  357   SDPHGLSEWGWQ  368



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   507 bits (1305),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 314/451 (70%), Gaps = 5/451 (1%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y GNEGDIEWF QN
Sbjct  53    LYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQN  110

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IAP F A++VF EHR+YG+S+PFG  KEA   + TL YL++ Q LAD++ LI D
Sbjct  111   TGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITD  170

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+N +A D PVV+FGGSYGGMLAAW  LKYPH+ +GALASSAPIL FE+I +P  F D+
Sbjct  171   LKQNFSAKDCPVVLFGGSYGGMLAAWMXLKYPHIAVGALASSAPILQFEDIVAPETFYDI  230

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ +F+ ES  C+  IK SW  I    +   GLE L K+FN+C+   S G L  W+ +A 
Sbjct  231   VSNNFKRESSTCFNYIKQSWDEITSTGQTYNGLELLTKTFNLCQKLKSTGDLYDWVESAD  290

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              Y  M +YP  + FL  +P + ++++CK ID    G+  L  +Y  VN+Y NYTG+   C
Sbjct  291   RYMTMMNYPYPSEFLMTLPGHRIREVCKKIDGVPAGTSILEGIYEGVNVYCNYTGK-RKC  349

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             F++    D HG+SGW WQACTEM+MP+  +   S+FP  E +Y    + C   + ++PRP
Sbjct  350   FEV--DDDRHGMSGWDWQACTEMVMPMSSNQDSSMFPPYECNYTSFQEECLNDYGVKPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              WITTEFGGH+I   LKKFGS+IIF NGL DPWS G VL+NIS+S+V++  +EGAHH+DL
Sbjct  408   KWITTEFGGHDIHATLKKFGSDIIFSNGLLDPWSGGSVLQNISESVVSLVTEEGAHHIDL  467

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R ST+ DP WL + R  E+++I+ WIS Y+ 
Sbjct  468   RPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>ref|XP_006285773.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
 gb|EOA18671.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
Length=483

 Score =   506 bits (1302),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 314/452 (69%), Gaps = 24/452 (5%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T YF Q LDHF+F P+SY  F Q+YLI+  +W   +   PIFVY GNEGDIEWF  NT
Sbjct  48    FQTHYFPQNLDHFSFQPESYRIFHQKYLISSHFW---RKGGPIFVYTGNEGDIEWFASNT  104

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P         S+K +GYL+S Q LADYA LI  L
Sbjct  105   GFMLDIAPKFEALLVFIEHRFYGESKP-------PRSAKAMGYLNSQQALADYAILIRSL  157

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVV GGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ I    +F D I
Sbjct  158   KQNLSSEASPVVVLGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIVPSSSFYDSI  217

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+S  E       G +  ++D      GL+ L K F  CK   +V +   WL +A+ 
Sbjct  218   SQDFKSSRE------AGVFSTMKD------GLQELSKKFRSCKGLHNVTAASQWLDSAFV  265

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
              TAM +YPT  NF+ P+P YPV++MCK ID     +  L + ++A ++YYNY+G    CF
Sbjct  266   NTAMVNYPTPANFMAPLPAYPVEEMCKIIDGFPPEASNLDRAFAAASLYYNYSGS-EKCF  324

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             D+ + +DPHG++GW WQACTEM+MP+  SN+ S+F   E D     +YC   + ++PRP+
Sbjct  325   DIENETDPHGVNGWYWQACTEMVMPISCSNQ-SMFQPFENDDKGDQEYCLREYGVKPRPH  383

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGG  IE VLK+FGSNIIF NG++DPWS  G+LKNIS S++A+  K+GAHH DLR
Sbjct  384   WITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGILKNISSSIIALVTKKGAHHADLR  443

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +TKEDP+WLK+ RR+EV  ++KWIS+YY  L
Sbjct  444   AATKEDPEWLKEQRRQEVAEMEKWISEYYSDL  475



>gb|EMS54706.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=632

 Score =   511 bits (1315),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 240/410 (59%), Positives = 301/410 (73%), Gaps = 4/410 (1%)
 Frame = -1

Query  1581  LDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPH  1402
             LDHFTFTP +   F  +YL+ND +W       P+FVYMGNEGDIEWF  NTGFMFDIAP 
Sbjct  104   LDHFTFTPNASALFSHKYLLNDTFWRRKPTAGPLFVYMGNEGDIEWFATNTGFMFDIAPQ  163

Query  1401  FNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDS  1222
             F ALLVFIEHRFYG+S PFG   ++  S+ TLGYL+STQ LAD+A LI  LK NL+A D+
Sbjct  164   FGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSLKHNLSAVDA  221

Query  1221  PVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESE  1042
             PVVVFGGSYGGMLA+WFRLKYPHV +GALASSAPIL FE+IT   +F D ++QDF+SES 
Sbjct  222   PVVVFGGSYGGMLASWFRLKYPHVAMGALASSAPILQFEDITPWSSFYDAVSQDFKSESL  281

Query  1041  NCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPT  862
             NC+ VIK  W ++ D      GL  L K+F  CK      SL  WL TA+TYTAM DYPT
Sbjct  282   NCFSVIKAVWDMLDDRGSSDTGLLELSKTFRACKTVRFPSSLSNWLWTAFTYTAMVDYPT  341

Query  861   ATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPH  682
               NF+  +P YPVK+MCK ID    G+D + K ++A ++YYNYTG+   CF +    DPH
Sbjct  342   PANFMMNLPAYPVKEMCKIIDSFPAGADVVEKAFAAASLYYNYTGD-QKCFQVEGGDDPH  400

Query  681   GLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGH  502
             GLSGW WQACTEM+MP+  SN +S+FP S + Y E+++ C  ++++ PR NWITTE+GGH
Sbjct  401   GLSGWGWQACTEMVMPMTVSN-ESMFPPSGFSYEEKSEGCFASYEVRPRMNWITTEYGGH  459

Query  501   NIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              I++VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++  ++ D+
Sbjct  460   KIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKAQYNKDI  509


 Score =   162 bits (409),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = -1

Query  621  NKD-SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
            NKD ++FP S + Y E+++ C  ++++ PR NWITTE+GGH I++VLK+FGSNIIF NG+
Sbjct  506  NKDIAMFPPSGFSYEEKSEGCFASYEVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGM  565

Query  444  RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
            RDPWS GGVLKNIS S++A+  ++GAHH+D R +TK+DP W+ + RR+EVEII  WI QY
Sbjct  566  RDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  625



>gb|KEH31545.1| serine carboxypeptidase S28 family protein [Medicago truncatula]
Length=527

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 253/501 (50%), Positives = 334/501 (67%), Gaps = 40/501 (8%)
 Frame = -1

Query  1686  FPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTF--TPQSYHTFQQRYLINDR  1513
             FPF +     +  S+ S    D H  Y+TK+F Q L+HF+F  TP     F QRYLIN  
Sbjct  36    FPFPS-----SAKSSQSQPQLDIH--YETKFFQQRLNHFSFFKTPM----FPQRYLINTE  84

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
              W       PIF+Y GNEGDI WF QNTGF+++IAP F A++VF EHR+YG+SVPFG ++
Sbjct  85    NW--VVGSGPIFLYCGNEGDIVWFAQNTGFIWEIAPKFGAMVVFPEHRYYGESVPFGSKE  142

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             EA  ++ TLGYL++ Q L D+A L+ DLK+N +A   PVV+FGGSYGGMLAAW RLKYPH
Sbjct  143   EAYKNASTLGYLNAQQALFDFAVLVTDLKRNYSANACPVVLFGGSYGGMLAAWMRLKYPH  202

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             + IGALASSAPIL FE+I  P  F D+++  F+ ES +C+  IK SW +I+   + S GL
Sbjct  203   IAIGALASSAPILQFEDIVPPETFYDIVSNGFKRESSSCFNYIKQSWDVIESKGQTSDGL  262

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAID--  799
             E L K+F  C+   S   L  WL +AY+Y AM +YP  + FL P+P +P+K++C+ ID  
Sbjct  263   ELLTKTFRFCQKLKSTEDLRDWLESAYSYLAMVNYPYPSEFLMPLPGHPIKEVCRRIDKG  322

Query  798   --------------DPNH------GSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHG  679
                           + N+      G+  L ++Y  VN+YYNYTGE   CF+L    DPHG
Sbjct  323   PAGTSILERIFEGVNVNYNYKGPAGTSILERIYEGVNVYYNYTGEA-KCFEL--DDDPHG  379

Query  678   LSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHN  499
             LSGW++QACTEM+MP+  S K S+FP  E++Y+   + C + F ++PRP  ITT FGGHN
Sbjct  380   LSGWNFQACTEMVMPMSSSRKSSMFPPYEYNYSSFQEDCLKNFGVKPRPKQITTVFGGHN  439

Query  498   IERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWL  319
             I   L+KFGSNIIF NGL DPWS G VL+NIS+S+V++  +EGAHH+DLR ST+ DP WL
Sbjct  440   IHLALRKFGSNIIFSNGLLDPWSGGSVLQNISESIVSLVTEEGAHHIDLRASTENDPDWL  499

Query  318   KDVRRKEVEIIQKWISQYYHS  256
              + R  EV++IQ WIS YY +
Sbjct  500   VEQRATEVKLIQGWISDYYQN  520



>ref|XP_004288288.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 320/452 (71%), Gaps = 8/452 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTF--TPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ  1435
             Y+T+YF Q LDHF+F  TP+    FQQRYL+N   W G +   PIF+Y GNEGDI WF +
Sbjct  56    YETRYFPQNLDHFSFSDTPK----FQQRYLVNSENWVGPQRHGPIFLYCGNEGDIVWFAE  111

Query  1434  NTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLII  1255
             NTGF++++AP F A+++F EHR+YG+S+PFG E+EA  ++ TL +L++ Q LAD+A LI 
Sbjct  112   NTGFVWELAPRFGAMVLFPEHRYYGESMPFGSEEEAYKNASTLSFLTAEQALADFAVLIT  171

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
             +LK+N +A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I     F D
Sbjct  172   ELKRNWSAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPTETFYD  231

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             +++ DFR ES +C+  IK SW  +  I ++  GL  L K+F++C+       L  WL +A
Sbjct  232   IVSNDFRRESSSCFNTIKESWDALMTIGQKQNGLLELTKTFHLCRELKKTEDLADWLESA  291

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
             Y+Y AM +YP  + F+ P+P +P++++C+ ID    G+  L +++  +++YYNY+G   +
Sbjct  292   YSYLAMVNYPYGSEFMMPLPGHPIREVCRRIDGCPDGTSTLERVFEGISVYYNYSGNA-D  350

Query  714   CFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
             CF+L  +SD  G  GW+WQACTEM+MP+  S   S+F   +++++    +C +    +PR
Sbjct  351   CFELEDTSDV-GTDGWNWQACTEMVMPMSSSRDRSMFKTYDYNFSSFQDWCWKELNAKPR  409

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P WITTEFGGH+I+  LK FGSNIIF NGL DPWS G VL+NIS+S+VA+  +EGAHH+D
Sbjct  410   PTWITTEFGGHDIKATLKNFGSNIIFSNGLLDPWSGGSVLQNISQSIVALVTEEGAHHID  469

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             LRFSTK DP WL + R  E+++IQ W+ ++Y 
Sbjct  470   LRFSTKGDPDWLVEQRESEIKLIQGWLDEFYQ  501



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 226/450 (50%), Positives = 320/450 (71%), Gaps = 4/450 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F+      FQQRYLIN  +W G + + PIF Y GNEGDIEWF +NT
Sbjct  64    YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRVGPIFFYCGNEGDIEWFAENT  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++++AP F A+++F EHR+YG+S+P+G + EA  ++ TL +L++ Q LAD+A LI +L
Sbjct  122   GFVWEVAPQFGAMILFPEHRYYGESMPYGSKAEAYKNASTLSFLTAEQALADFAVLITEL  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D++
Sbjct  182   KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYDIV  241

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  F+ ES +C+  IK SW  +    ++  GL +L K+F++C+   S   L  WL +AY+
Sbjct  242   SNGFKRESSSCFNTIKESWDTLVTEGKKQNGLRQLTKTFHLCRELNSTNDLANWLESAYS  301

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP A  F+ P+P +P+K++C+ ID    G+  L +++  V+I+YNYTG+   CF
Sbjct  302   YLAMVNYPYAAEFVMPLPGHPIKEVCRKIDGCPDGTSTLERIFEGVSIFYNYTGQA-KCF  360

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   SD  G  GW+WQACTEM+MP+  S   S+F   +++ +   + C + + ++PRP 
Sbjct  361   ELIDDSDV-GTDGWNWQACTEMVMPMSCSQDASMFQTYDYNLSSFQEECWKDYNVKPRPT  419

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
              ITTEFGGH+I+  LK FGSNIIF NGL DPWS G VL+N+S+++VA+  +EGAHH+DLR
Sbjct  420   RITTEFGGHDIKATLKSFGSNIIFSNGLLDPWSGGSVLQNVSETIVALVTEEGAHHIDLR  479

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             FS KEDP+WL D R  E+++I+ W+ ++Y 
Sbjct  480   FSKKEDPEWLVDQRATEIKLIEGWLEKFYQ  509



>ref|NP_001065793.1| Os11g0156200 [Oryza sativa Japonica Group]
 gb|AAX92949.1| At2g24280/F27D4.19 [Oryza sativa Japonica Group]
 gb|ABA91540.1| Serine carboxypeptidase S28 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27638.1| Os11g0156200 [Oryza sativa Japonica Group]
Length=511

 Score =   501 bits (1289),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/454 (52%), Positives = 321/454 (71%), Gaps = 10/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ LDHF   P S  TF+QRYL+N  +WGGA   AP+FVY GNEGD+  F  NT
Sbjct  53    YETRYFTQRLDHFNELPASNGTFRQRYLVNGTFWGGAA--APVFVYAGNEGDVALFASNT  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL-GYLSSTQVLADYATLIID  1252
             GFM++ AP F A+LVF+EHR+YG+S+PFGG + A  +  +  GYL++ Q LAD+A LI+ 
Sbjct  111   GFMWEAAPRFRAMLVFVEHRYYGESLPFGGTRAAAFADASAAGYLTTAQALADFAELILS  170

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK NLTA  +PVV+FGGSYGGMLAAW R+KYPH+ +GA+ASSAPIL    ++ PY+F +V
Sbjct  171   LKSNLTACKAPVVIFGGSYGGMLAAWMRMKYPHIVMGAVASSAPILGLNGLSDPYSFYNV  230

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DF+SES++CY V++ SW  +        G  RL ++FN+CK   +V  + G +  A 
Sbjct  231   VSNDFKSESKHCYDVLRNSWSEMYKALATDAGRARLNQTFNMCKG--NVDDIPGLVEKAL  288

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              Y +M DYPT +NFL  +P YPV+++C+AID P  G+D ++++  A+ IYYN TG +  C
Sbjct  289   IYGSMMDYPTPSNFLTSLPAYPVREICRAIDKPTSGNDTVSRIKDAMTIYYNSTGGL-AC  347

Query  711   FDLASSS--DPHGL-SGWSWQACTEMIMPLG-GSNKDSIFPASEWDYNERAQYCKEAFKI  544
             F  A +   DP+G+  GW+WQACTE+IM +  G    ++FP   ++       C     +
Sbjct  348   FPGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIGNATVFPPDPFNLTAYLAGCLATTGV  407

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP+WI + FGG++I  VLK+ GSNIIFFNGLRDPWSAGG+LK+IS S++A+   +G H
Sbjct  408   PPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRDPWSAGGILKSISNSIIALVEPKGGH  467

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             HVDLRFSTKEDP+WLK VRR+E+ II  W+ QYY
Sbjct  468   HVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>gb|EAY80009.1| hypothetical protein OsI_35177 [Oryza sativa Indica Group]
Length=511

 Score =   500 bits (1287),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 236/454 (52%), Positives = 320/454 (70%), Gaps = 10/454 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ LDHF   P S  TF+QRYL+N  +WGGA   AP+FVY GNEGD+  F  NT
Sbjct  53    YETRYFTQRLDHFNELPASNGTFRQRYLVNGTFWGGAA--APVFVYAGNEGDVALFASNT  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL-GYLSSTQVLADYATLIID  1252
             GFM++ AP F A+LVF+EHR+YG+S+PFGG + A  +  +  GYL+  Q LAD+A LI+ 
Sbjct  111   GFMWEAAPRFRAMLVFVEHRYYGESLPFGGTRAAAFADASAAGYLTPAQALADFAELILS  170

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK NLTA  +PVV+FGGSYGGMLAAW R+KYPH+ +GA+ASSAPIL    ++ PY+F +V
Sbjct  171   LKSNLTACKAPVVIFGGSYGGMLAAWMRMKYPHIVMGAVASSAPILGLNGLSDPYSFYNV  230

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DF+SES++CY V++ SW  +        G  RL ++FN+CK   +V  + G +  A 
Sbjct  231   VSNDFKSESKHCYDVLRNSWSEMYKALATDAGRARLNQTFNMCKG--NVDDIPGLVEKAL  288

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              Y +M DYPT +NFL  +P YPV+++C+AID P  G+D ++++  A+ IYYN TG +  C
Sbjct  289   IYGSMMDYPTPSNFLTSLPAYPVREICRAIDKPTSGNDTVSRIKDAMTIYYNSTGGL-AC  347

Query  711   FDLASSS--DPHGL-SGWSWQACTEMIMPLG-GSNKDSIFPASEWDYNERAQYCKEAFKI  544
             F  A +   DP+G+  GW+WQACTE+IM +  G    ++FP   ++       C     +
Sbjct  348   FPGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIGNATVFPPDPFNLTAYLADCLATTGV  407

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP+WI + FGG++I  VLK+ GSNIIFFNGLRDPWSAGG+LK+IS S++A+   +G H
Sbjct  408   PPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRDPWSAGGILKSISNSIIALVEPKGGH  467

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYY  262
             HVDLRFSTKEDP+WLK VRR+E+ II  W+ QYY
Sbjct  468   HVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>ref|XP_010419296.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=463

 Score =   497 bits (1280),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 299/417 (72%), Gaps = 7/417 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T+YF Q LDHF+FTP+SY  F Q+YLIN R+W   +   PIFVY GNEGDI+WF  NT
Sbjct  54    FETRYFPQNLDHFSFTPESYKVFHQKYLINCRFW---RKGGPIFVYTGNEGDIDWFASNT  110

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S P G  K++  S++TLGYL+S Q LAD+A LI  L
Sbjct  111   GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  168

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASS+PIL+F+ I    +F D +
Sbjct  169   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSSPILHFDKIVPLTSFYDAV  228

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NC+KVIK SW+ +  +  +  GL+ L K F  CK   S+ S   WLS A+ 
Sbjct  229   SQDFKDASINCFKVIKKSWEELDAVTNKKNGLQELSKKFRTCKGLHSIYSASNWLSGAFV  288

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPTA NF+ P+P YPV+QMCK +D    GS  L + ++A ++YYNY+G    CF
Sbjct  289   YTAMVNYPTAANFMAPLPGYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGS-EKCF  347

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   +D HGL GW +QACTEM+MP+  SN+ S+ P  E DY    + C   + ++PRP+
Sbjct  348   EMEQQTDDHGLDGWQYQACTEMVMPMSCSNQ-SMLPPYENDYEAFEEQCMSRYGVKPRPH  406

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHV  358
             WITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S+ +    +  HH 
Sbjct  407   WITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIXSFCCVQLLHHA  463



>ref|XP_002962799.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
 gb|EFJ36262.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
Length=470

 Score =   498 bits (1281),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 238/453 (53%), Positives = 315/453 (70%), Gaps = 11/453 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y   YF Q LDHF     +   F QRYL+++  W G  + APIFVY GNEGDI WF +NT
Sbjct  20    YTEHYFQQTLDHFNVG--NITLFPQRYLLHNASWSGGASGAPIFVYCGNEGDIVWFAENT  77

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFMFDIAP F ALLVF EHRFYGKS PFGG+    +  K L + S+ Q LAD+ATLI+DL
Sbjct  78    GFMFDIAPLFGALLVFPEHRFYGKSQPFGGQ----NGPKELAFCSAEQALADFATLILDL  133

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL FENI     + D++
Sbjct  134   KRNLSAQASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFENIVPYTTYYDIV  193

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  F+ E E C+++I+ SW  I + AE+  GL  L + F++C ++ +   L  WL +AY+
Sbjct  194   SNAFKREGEECFEIIRNSWTAITEAAEQQNGLRNLSQDFHMCSDFKNADELINWLESAYS  253

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP A NF  P+P YPV+++C+A+ +    S  L ++Y+ VN+YYN+TG    CF
Sbjct  254   YLAMANYPYAANFTMPLPAYPVRKVCQAMVNSPVASSILQRIYAGVNVYYNFTGAA-KCF  312

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL    DPHGLSGW+WQ+CTEM+MP+  ++  S++P  EWD    +++C E +   PRP+
Sbjct  313   DL--DDDPHGLSGWNWQSCTEMVMPMSSNSSTSMYPPFEWDGEAWSRFCWEKYGAIPRPS  370

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSL-VAITAKEGAHHVDL  352
             W+TTEFGGH+I+  L+ FGSNI+F NGL DPWS G    N S  L  ++   +GAHH+D 
Sbjct  371   WVTTEFGGHDIKSALRNFGSNIVFSNGLLDPWSGGRQAMNDSFRLRSSLIDFDGAHHLDF  430

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             R+S K+DP+WL + R  EV  I++W+S+ YHSL
Sbjct  431   RWSRKDDPQWLIEQRELEVREIKRWLSE-YHSL  462



>gb|EAZ13666.1| hypothetical protein OsJ_03583 [Oryza sativa Japonica Group]
Length=549

 Score =   496 bits (1278),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/485 (50%), Positives = 325/485 (67%), Gaps = 41/485 (8%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHT----FQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             Y+T+YF Q LDHF+F  +        FQQRYL+     G A    PIF Y GNEGDI WF
Sbjct  48    YETRYFRQRLDHFSFLEEEGEEGDGFFQQRYLVGRGG-GWAGAGGPIFFYCGNEGDIAWF  106

Query  1440  TQNTGFMFDIAPHFNALLVF--------------------------------IEHRFYGK  1357
               N+G +++ A  F AL+VF                                ++HR+YG+
Sbjct  107   AANSGLVWEAATRFAALVVFAEANLSSHLAPVSVFFLGCALIVRDPIPFTCSLQHRYYGE  166

Query  1356  SVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAA  1177
             S+PFG + +A ++SK+L YL++ Q LADYA L+ DLKKNL++  SPVV+FGGSYGGMLAA
Sbjct  167   SMPFGSKDKAYNNSKSLAYLTAEQALADYAVLLTDLKKNLSSEGSPVVLFGGSYGGMLAA  226

Query  1176  WFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQD  997
             W RLKYPH+ +GALASSAPIL FE++     F D+++ DF+ ES +C++ IK SW+ +  
Sbjct  227   WMRLKYPHIAVGALASSAPILQFEDVVPSTIFYDLVSNDFKRESLSCFQTIKDSWKALDA  286

Query  996   IAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQ  817
                   GL +L K+F++CK   + G L  WLS+AY+Y AM DYP   +F+ P+P  P+K+
Sbjct  287   QGNGQDGLLKLSKTFHLCKTIKNTGELSDWLSSAYSYLAMVDYPMPADFMMPLPGNPIKE  346

Query  816   MCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIM  637
             +C  ID+   G+  L ++Y+ VN+YYNYTG V +CFDL  + DPHG+ GW WQACTEM+M
Sbjct  347   LCTKIDNQPDGTSILERIYAGVNVYYNYTGTV-DCFDL--NDDPHGMDGWDWQACTEMVM  403

Query  636   PLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIF  457
             P+  S +DS+FPA +++Y    + C  +F +EPRP WITTEFGGHNI  VL++FGSNIIF
Sbjct  404   PMSYS-EDSMFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIF  462

Query  456   FNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKW  277
             FNGL DPWS GGVLKNIS+S+VAI A  GAHH+DLR ++K+DP WL  +R  E+ II  W
Sbjct  463   FNGLLDPWSGGGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGW  522

Query  276   ISQYY  262
             +S YY
Sbjct  523   LSDYY  527



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score =   512 bits (1319),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 322/484 (67%), Gaps = 39/484 (8%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW---GGAKNMAPIFVYMGNEGDIEWFT  1438
             +   YF Q LDHF+FTP +   F Q+YL+ND +W   GG     P+ VY+G E DIE   
Sbjct  79    FTVHYFQQELDHFSFTPNASTVFYQKYLVNDTFWRRPGGGGTAGPLLVYVGGEADIECIA  138

Query  1437  QNTGFMFDIAPHFNALLVFIEH---------------------------RFYGKSVPFGG  1339
              N GFMFDIAP F ALLVF+EH                           RFYG+S+PFG 
Sbjct  139   HNVGFMFDIAPTFGALLVFVEHIEYIFGDLNIGPQKDMARVVWWSKRKHRFYGESLPFG-  197

Query  1338  EKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKY  1159
                  +S++ LGYL+STQ LAD A LI DLK+NL+A  SPVV+FGGSYGGMLA+WFRLKY
Sbjct  198   ----NNSAQALGYLTSTQALADLAILITDLKRNLSAETSPVVIFGGSYGGMLASWFRLKY  253

Query  1158  PHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESG  979
             PHVTIGALASSAPIL F+ IT   +F DV++QD++SES NC+ VIK +W ++++      
Sbjct  254   PHVTIGALASSAPILQFDYITPWSSFYDVVSQDYKSESLNCFSVIKAAWDVLEERGSNGN  313

Query  978   GLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAID  799
             GL  L K F  CK      S+  WL TA+   AM DYPT  +FL  +P YPVK+MCK +D
Sbjct  314   GLVELSKLFRACKTVKYADSIRRWLRTAFVSIAMMDYPTPASFLENLPAYPVKEMCKIVD  373

Query  798   DPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPH--GLSGWSWQACTEMIMPLGG  625
                  +D L K+++A ++YYNYTG+   C  +    +P    L+ W WQACTE++MP+  
Sbjct  374   GFPADADILEKVFAAASLYYNYTGD-QTCNQIEDEGNPRCLNLNYWGWQACTELMMPMSS  432

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
             +N DS+FP   + Y ++A YC + F + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+
Sbjct  433   AN-DSMFPPHTFSYEDKANYCLQTFGVRPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGM  491

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDPWS GGVLKNIS S+VA+  ++GAHH+DLR +TK+DP W+ + RR+EVEII  WI QY
Sbjct  492   RDPWSRGGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQY  551

Query  264   YHSL  253
             Y  +
Sbjct  552   YRDM  555



>ref|XP_006577089.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=411

 Score =   490 bits (1262),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 278/350 (79%), Gaps = 7/350 (2%)
 Frame = -1

Query  1689  TFPFSTIINRPNGLSASSAKAADNHK----LYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             TF F  I+ R    + S+     +H     LY TK+FTQILDHF F PQS HTFQQRYLI
Sbjct  22    TFAFVPILPRFPSSAVSAELKQRSHSSQNGLYRTKFFTQILDHFNFNPQSNHTFQQRYLI  81

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             ND +WGGAKN APIFVY GNEG+IEWFTQNTGFMF+ AP F ALLVFIEHRFYGKS+PFG
Sbjct  82    NDTFWGGAKNNAPIFVYTGNEGNIEWFTQNTGFMFENAPSFQALLVFIEHRFYGKSIPFG  141

Query  1341  GEKE-AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
             G K  A +++ TLGYLSSTQ LADYATLIIDLKKNL+ATDSPVVVFGGSYGGMLAAWFR+
Sbjct  142   GNKTVAYANTSTLGYLSSTQALADYATLIIDLKKNLSATDSPVVVFGGSYGGMLAAWFRM  201

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPHV IGALASSAPIL+F  + SP  F+++ITQDFRSESENCYKVIKGSW LI D A +
Sbjct  202   KYPHVAIGALASSAPILHFMGLVSPDIFNNIITQDFRSESENCYKVIKGSWDLIDDTANK  261

Query  984   SGGLERLRKSFNICK-NYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCK  808
              GG+E LRK+F ICK +    GSLEGWL  A+ YTAMTDYPT +NFLNP+P YPVK+MC+
Sbjct  262   PGGMELLRKTFRICKSDDFGPGSLEGWLRAAWIYTAMTDYPTPSNFLNPLPAYPVKKMCE  321

Query  807   AIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQ  658
             AID    G++ LAKL++A ++YYNYTG+   CFDL  +SDPH L GW WQ
Sbjct  322   AIDSSVTGNNRLAKLHAAASVYYNYTGKA-RCFDLDDNSDPHDLGGWQWQ  370



>gb|EAY75958.1| hypothetical protein OsI_03875 [Oryza sativa Indica Group]
Length=549

 Score =   495 bits (1274),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/485 (50%), Positives = 324/485 (67%), Gaps = 41/485 (8%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHT----FQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWF  1441
             Y+T+YF Q LDHF+F  +        FQQRYL+     G A    PIF Y GNEGDI WF
Sbjct  48    YETRYFRQRLDHFSFLEEEGEEGDGFFQQRYLVGRGG-GWAGAGGPIFFYCGNEGDIAWF  106

Query  1440  TQNTGFMFDIAPHFNALLVF--------------------------------IEHRFYGK  1357
               N+G +++ A  F AL+VF                                ++HR+YG+
Sbjct  107   AANSGLVWEAATRFAALVVFAEANLSSHLAPVSVFFLGCALIVRDPIPFTCSLQHRYYGE  166

Query  1356  SVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAA  1177
             S+PFG + +A ++SK+L YL++ Q LADYA L+ DLKKNL++  SPVV+FGGSYGGMLAA
Sbjct  167   SMPFGSKDKAYNNSKSLAYLTAEQALADYAVLLTDLKKNLSSEGSPVVLFGGSYGGMLAA  226

Query  1176  WFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQD  997
             W RLKYPH+ +GALASSAPIL FE++     F D+++ DF+ ES  C++ IK SW+ +  
Sbjct  227   WMRLKYPHIAVGALASSAPILQFEDVVPSTIFYDLVSNDFKRESLICFQTIKDSWKALDA  286

Query  996   IAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQ  817
                   GL +L K+F++CK   + G L  WLS+AY+Y AM DYP   +F+ P+P  P+K+
Sbjct  287   QGNGQDGLLKLSKTFHLCKTIKNTGELSDWLSSAYSYLAMVDYPMPADFMMPLPGNPIKE  346

Query  816   MCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIM  637
             +C  ID+   G+  L ++Y+ VN+YYNYTG V +CFDL  + DPHG+ GW WQACTEM+M
Sbjct  347   LCTKIDNQPDGTSILERIYAGVNVYYNYTGTV-DCFDL--NDDPHGMDGWDWQACTEMVM  403

Query  636   PLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIF  457
             P+  S +DS+FPA +++Y    + C  +F +EPRP WITTEFGGHNI  VL++FGSNIIF
Sbjct  404   PMSYS-EDSMFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIF  462

Query  456   FNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKW  277
             FNGL DPWS GGVLKNIS+S+VAI A  GAHH+DLR ++K+DP WL  +R  E+ II  W
Sbjct  463   FNGLLDPWSGGGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGW  522

Query  276   ISQYY  262
             +S YY
Sbjct  523   LSDYY  527



>gb|EMT30656.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=485

 Score =   487 bits (1254),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 309/448 (69%), Gaps = 21/448 (5%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+  TQ LDHF   P SY TF QRYL+N  YWGG    AP+FVY GNEG+IE FT NT
Sbjct  4     YETRSHTQRLDHFNAAPASYRTFPQRYLVNGTYWGG--KTAPVFVYAGNEGNIELFTNNT  61

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM+++AP F A+LVFIEHR+YG+SVPFG E+ A  ++ T GYL++TQ +AD+ATL+  L
Sbjct  62    GFMWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFRNTSTAGYLTTTQAVADFATLVQSL  121

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL+A  +PVVVFGGSYGGMLAAW R+KYPHV IGA+ASSAPIL F  +  PYAF D+I
Sbjct  122   KANLSAPTAPVVVFGGSYGGMLAAWMRMKYPHVVIGAVASSAPILSFYGMADPYAFYDII  181

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+SES+NC+ V+  SW+ +        G  +L  +F +C+   +V ++   L TA  
Sbjct  182   SNDFKSESKNCHDVLMNSWKELDKALSNDAGRAQLNSTFKMCRGS-TVEAIPDLLDTAIV  240

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y+AMTDYPT + FL  +P YPVK+MC+AID+P  G D  +++  A+ +YYNYTG   +C 
Sbjct  241   YSAMTDYPTESGFLTHLPAYPVKEMCRAIDNPKSGKDTFSRVNDALMVYYNYTGNT-HCL  299

Query  708   DLASSSDPHGL-SGWSWQACTEMI-MPLG---------------GSNKDSIFPASEWDYN  580
               A+  DP+G+  GW +QACTEMI M  G               G    S+ P   +++ 
Sbjct  300   GDATEHDPYGMFDGWDFQACTEMILMSYGVRNGSACTEMILRSYGVRNGSVLPPEPFNFT  359

Query  579   ERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISK  400
             +    C+    + PRP WI TEFGG +I  VLK+  SNIIFFNGLRDPWS+GGVLK+IS+
Sbjct  360   KLLDGCRAPPGLPPRPYWIPTEFGGFDIANVLKRSASNIIFFNGLRDPWSSGGVLKDISR  419

Query  399   SLVAITAKEGAHHVDLRFSTKEDPKWLK  316
             S+VA+   +G+HHVDLRFS+K+DP WLK
Sbjct  420   SIVALVEPKGSHHVDLRFSSKDDPDWLK  447



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score =   476 bits (1224),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 290/370 (78%), Gaps = 4/370 (1%)
 Frame = -1

Query  1371  RFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYG  1192
             RFYG+S+PFG  KE+  S+ TLGYL+STQ LADYA LI  LK+NL+A  SPVVVFGGSYG
Sbjct  30    RFYGESMPFG--KESYKSASTLGYLTSTQALADYAVLIRSLKQNLSAEASPVVVFGGSYG  87

Query  1191  GMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSW  1012
             GMLAAWFRLKYPH+TIGALASSAPIL F+ IT   +F D +++D++ ES NC++VIKGSW
Sbjct  88    GMLAAWFRLKYPHITIGALASSAPILEFDYITPWSSFYDAVSEDYKDESINCFEVIKGSW  147

Query  1011  QLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPP  832
               +  +A + GG+  L K+F  CK+  SV S+  WL TA+ YTAM DYPTA+NFL P+P 
Sbjct  148   DELMVVAAQKGGMLELSKTFRACKSLQSVYSVRDWLWTAFVYTAMVDYPTASNFLMPLPA  207

Query  831   YPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQAC  652
             YP+K+MC+ ID    G+  L K++SA ++YYNY+G+  +CFD+ + +DPHGL GW WQAC
Sbjct  208   YPIKEMCRIIDGFPQGASKLTKVFSAASLYYNYSGD-QSCFDIENGTDPHGLHGWDWQAC  266

Query  651   TEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFG  472
             TEM+MP+  SN +S+FP+S +DY+E    C   + + PRP+WITTE+GG+ I+ VLK+FG
Sbjct  267   TEMVMPMICSN-ESMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFG  325

Query  471   SNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVE  292
             SNIIF NG+RDPWS GGVL+NIS S++A+  ++GAHH+DLR++TK+DPKWL + R++E++
Sbjct  326   SNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEID  385

Query  291   IIQKWISQYY  262
             IIQ WI QY+
Sbjct  386   IIQSWIDQYH  395



>gb|AAL77662.1| AT5g65760/MPA24_11 [Arabidopsis thaliana]
Length=491

 Score =   479 bits (1233),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 301/441 (68%), Gaps = 7/441 (2%)
 Frame = -1

Query  1692  PTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDR  1513
             P FP  T  NR   +     +   N   Y+TK+F+Q LDHF+F       F QRYLIN  
Sbjct  32    PRFPRYTFQNREARIQ--QFRGDRNEYRYETKFFSQQLDHFSFA--DLPKFSQRYLINSD  87

Query  1512  YWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEK  1333
             +W GA  + PIF+Y GNEGDIEWF  N+GF++DIAP F ALLVF EHR+YG+S+P+G  +
Sbjct  88    HWLGASALGPIFLYCGNEGDIEWFATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSRE  147

Query  1332  EAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPH  1153
             EA  ++ TL YL++ Q LAD+A  + DLK+NL+A   PVV+FGGSYGGMLAAW RLKYPH
Sbjct  148   EAYKNATTLSYLTTEQALADFAVFVTDLKRNLSAEACPVVLFGGSYGGMLAAWMRLKYPH  207

Query  1152  VTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGL  973
             + IGALASSAPIL FE++  P  F D+ + DF+ ES +C+  IK SW  I    ++  GL
Sbjct  208   IAIGALASSAPILQFEDVVPPETFYDIASNDFKRESSSCFNTIKDSWDAIIAEGQKENGL  267

Query  972   ERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDP  793
              +L K+F+ C+   S   L  WL +AY+Y AM DYP   +F+ P+P +P++++C+ ID  
Sbjct  268   LQLTKTFHFCRVLNSTDDLSDWLDSAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGA  327

Query  792   NHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKD  613
                +  L ++Y+ +++YYNYTG V +CF L    DPHGL GW+WQACTEM+MP+  + ++
Sbjct  328   GSNASILDRIYAGISVYYNYTGNV-DCFKL--DDDPHGLDGWNWQACTEMVMPMSSNQEN  384

Query  612   SIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  433
             S+FP   ++Y+   + C   F++ PRP W+TTEFGGH+I   LK FGSNIIF NGL DPW
Sbjct  385   SMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPW  444

Query  432   SAGGVLKNISKSLVAITAKEG  370
             S G VLKN+S ++VA+  KEG
Sbjct  445   SGGSVLKNLSDTIVALVTKEG  465



>ref|XP_002438753.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
 gb|EER90120.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
Length=569

 Score =   478 bits (1230),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 254/507 (50%), Positives = 330/507 (65%), Gaps = 42/507 (8%)
 Frame = -1

Query  1650  LSASSAKAADNH--KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW------GGAK  1495
             ++A++A A  N   + + T YF Q LDHFTFTP +   F+Q+YL+ND +W       G  
Sbjct  60    VTAAAADAGTNSTAQPFTTHYFPQELDHFTFTPNASMVFRQKYLVNDTFWRRPSGGNGTA  119

Query  1494  NMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEH-----------------RF  1366
                P+FVY GNEGDIEWF  NTGFMFDIAP F ALLVFIE                  + 
Sbjct  120   GAGPLFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIECLNAENMIQSKIFSFCFLKS  179

Query  1365  YGKSVPFGGEK-----------EAKSSSKTLGYLSSTQV---LADYATLIIDLKKNLTAT  1228
              G   P  G +           +A+S++   G  ++ +    LAD+A LI  LK+NL+A 
Sbjct  180   RGPRCPEPGPRPPLALPLPLARQARSAAGLRGLPTAGRAAVALADFAILITSLKQNLSAK  239

Query  1227  DSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSE  1048
              +PVVVFGGSYGGMLA+WFRLKYPHV IGALASSAPIL F+ IT   +FSD I+QD++SE
Sbjct  240   TAPVVVFGGSYGGMLASWFRLKYPHVAIGALASSAPILQFDYITPWSSFSDAISQDYKSE  299

Query  1047  SENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDY  868
             S NC+ VIK +W ++ +      GL  L K F  CK      S+ GWL TA+ YTAM DY
Sbjct  300   SLNCFSVIKATWDVLDERGANDRGLLELSKLFRACKTLKYADSIAGWLQTAFVYTAMVDY  359

Query  867   PTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE--VNNCFDLASS  694
             PT  NFL  +P YPVK+MCK ID     +D L K+++A ++YYN+TG+   N       S
Sbjct  360   PTPANFLKNLPAYPVKEMCKIIDGFPANADILEKVFAAASLYYNFTGDQTCNQIEYDDDS  419

Query  693   SDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTE  514
             S   GLSGW WQACTEMIMP+  SN +S+FP   + Y + +  C + + + PRP+WITTE
Sbjct  420   SSSLGLSGWGWQACTEMIMPMSDSN-ESMFPPDTFSYEDTSNTCFQLYGVRPRPHWITTE  478

Query  513   FGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKE  334
             +GG+ I++VLK+FGSNIIF NGLRDPWS GGVLK+IS S+VA+  ++GAHH+DLR +TK+
Sbjct  479   YGGYKIDKVLKRFGSNIIFSNGLRDPWSRGGVLKDISSSIVALVTEKGAHHLDLRSATKD  538

Query  333   DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             DP W+ + RR+EVEII  WI QY+  +
Sbjct  539   DPDWVIEQRRQEVEIIHGWIDQYHQDM  565



>gb|KDO78803.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78804.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78805.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
Length=474

 Score =   473 bits (1218),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 294/411 (72%), Gaps = 5/411 (1%)
 Frame = -1

Query  1605  DTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTG  1426
             +T+YF Q LDHF+F      TF QRYLIN  +W G   + PIF+Y GNEGDIEWF  N+G
Sbjct  69    ETRYFEQRLDHFSFA--DLPTFSQRYLINTDHWVGPNRLGPIFLYCGNEGDIEWFAVNSG  126

Query  1425  FMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLK  1246
             F++DIAP F A+LVF EHR+YG+S+P+G  + A  ++ TL YL++ Q LAD+A  I +LK
Sbjct  127   FVWDIAPRFGAMLVFPEHRYYGESMPYGSTEVAYQNATTLSYLTAEQALADFAVFITNLK  186

Query  1245  KNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVIT  1066
             +NL+A  SPVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F ++++
Sbjct  187   QNLSAEASPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYNIVS  246

Query  1065  QDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTY  886
              DF+ ES +C+  IK SW  +  + ++  GL  L K+F++C+   S   L  WL +AY+Y
Sbjct  247   SDFKRESASCFNTIKESWGELVSVGQKENGLLELTKTFHLCRELNSTEDLADWLESAYSY  306

Query  885   TAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFD  706
              AM DYP  ++F+ P+P YP++++CK ID+    +  L +++  V++YYNYTG V +CF 
Sbjct  307   LAMVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGNV-DCFQ  365

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
             L    DPHGL GW+WQACTEM+MP+  S   S+FPA +++Y+   + C   F + PRP W
Sbjct  366   L--DDDPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIPRPRW  423

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKE  373
             ITTEFGGH+I+ VLK FGSNIIF NGL DPWS G VL+N+S+++VA+  +E
Sbjct  424   ITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEE  474



>ref|XP_007155791.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27785.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=444

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 214/396 (54%), Positives = 282/396 (71%), Gaps = 5/396 (1%)
 Frame = -1

Query  1611  LYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             LY+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y GNEGDIEWF QN
Sbjct  53    LYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLYCGNEGDIEWFAQN  110

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IAP F A++VF EHR+YG+S+PFG  KEA   + TL YL++ Q LAD++ LI D
Sbjct  111   TGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTAEQALADFSVLITD  170

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+N +A D PVV+FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FE+I  P  F D+
Sbjct  171   LKQNFSAKDCPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDIVPPETFYDI  230

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ +F+ ES  C+  IK SW  I    +   GLERL K+FN+C+   S   L  WL +AY
Sbjct  231   VSNNFKRESSTCFNYIKQSWDEITSTGQTYNGLERLTKTFNLCQKLKSTVDLYDWLESAY  290

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM +YP  ++FL  +P +P++++CK ID    G++ L ++Y  VN+YYNYTG+   C
Sbjct  291   SYLAMVNYPYPSDFLMTLPGHPIREVCKKIDGVPAGTNILERIYEGVNVYYNYTGK-EKC  349

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             F+L    DPHG+SGW WQACTEM+MP+  +   S+FP  E++Y    + C   + ++PRP
Sbjct  350   FEL--DDDPHGMSGWDWQACTEMVMPMSSNQDSSMFPPYEYNYTSFQEECLNDYGVKPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
              WITTEFGGH+I   LKKFGSNIIF NGL DPWS G
Sbjct  408   KWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGG  443



>ref|XP_006663226.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Oryza 
brachyantha]
Length=420

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 301/423 (71%), Gaps = 11/423 (3%)
 Frame = -1

Query  1524  INDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPF  1345
             +N  +WGG    AP+FVY GNEG+IE F  NTG M++ AP F A+LVF+EHR+YG S+P 
Sbjct  1     VNGTFWGG--RAAPVFVYAGNEGEIELFANNTGLMWETAPRFRAMLVFVEHRYYGDSMP-  57

Query  1344  GGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRL  1165
                  A S+S T GYL++TQ LAD+A LI+ LK NL+A  +PVVVFGGSYGGMLAAW R+
Sbjct  58    ---AAAYSNSTTTGYLTTTQALADFAELILSLKANLSAHAAPVVVFGGSYGGMLAAWMRM  114

Query  1164  KYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEE  985
             KYPH+ +GA+ASSAPIL F  ++ PY+F DVI+ DF+SES++CY V++ SW  +      
Sbjct  115   KYPHIVMGAVASSAPILGFYGLSDPYSFYDVISNDFKSESQHCYDVLRSSWSELDKALAT  174

Query  984   SGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKA  805
               G  +L  +FN+CK   +V ++ G L  A  Y AMTDYPT ++FL  +P YPV+Q+C+A
Sbjct  175   DAGRAQLTHTFNMCKG--NVDAIPGLLENALVYVAMTDYPTPSSFLTSLPAYPVRQICRA  232

Query  804   IDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHG-LSGWSWQACTEMIMPLG  628
             ID P  G++ LA++  A+ IYYN+TG +  CF  A   DP+G L+GW+WQACTEM++ + 
Sbjct  233   IDQPTSGNETLARIKEAMAIYYNHTGGL-ACFGGAGDEDPYGMLAGWNWQACTEMVLTMS  291

Query  627   -GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFN  451
              G +  SIFP   +++ +    C+    + PRP WI   FGG +I  VLK+  SNIIFFN
Sbjct  292   YGVSGSSIFPPEPFNFTDVLAGCRAYTGLPPRPYWIEAHFGGFDIVNVLKRSASNIIFFN  351

Query  450   GLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWIS  271
             GLRDPWSAGGVLK+ISKS++A+   EG HHVDLRFSTKEDP+WLK VRRKE+ II  W+ 
Sbjct  352   GLRDPWSAGGVLKSISKSIIALVEPEGGHHVDLRFSTKEDPEWLKKVRRKEMRIIADWLR  411

Query  270   QYY  262
             QYY
Sbjct  412   QYY  414



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   468 bits (1204),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 306/457 (67%), Gaps = 18/457 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+  Y+ Q LDHF + P+SY TFQQ+Y+IN  YWGGA + APIFVY+G+E  I+   + T
Sbjct  59    YNVYYYNQTLDHFNYRPESYTTFQQKYVINSNYWGGANSSAPIFVYLGDESAIDDDIRTT  118

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ + AP FNAL+VFIEHR+YGKSVPFG   EA   + TLGY SS+Q LADYA +I+ +
Sbjct  119   GFLSENAPKFNALIVFIEHRYYGKSVPFGSRDEAFRDASTLGYFSSSQALADYAEIILAI  178

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KKNL+A  SPV+V GGSYGGMLAAWFRLKYPH+ +GALASSAPILYF++IT    +  V+
Sbjct  179   KKNLSAERSPVIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFDDITPQDGYYSVV  238

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE+CY  I+ SW  I  ++ E  GL  L K F  C    S   L+ +L   Y 
Sbjct  239   TKDFRDASESCYNTIRQSWSEIDRVSSEPNGLSILSKQFMTCNPITSASQLKDYLEYMYC  298

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A   +P+  + L         ++C AID  ++ +D + K+ + V    +Y G  ++C+
Sbjct  299   EAAQYAFPSDDSVL---------KICNAIDGTSNNTDIIGKVVAGV---VSYNGN-SSCY  345

Query  708   DLASSSDPHGL-----SGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKI  544
             DL +S++P         GW WQ C+EM+MP+G  + D++F A+ +D     Q CK A+ +
Sbjct  346   DLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSNDTMFEAAPFDLEAFIQGCKSAYSV  405

Query  543   EPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAH  364
              PRP+WITT+FGGH+I+ +L++FGSNIIF NGLRDP+S+ GVL +IS SL+AI   EG H
Sbjct  406   SPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRDPYSSAGVLTSISDSLLAIYTNEGCH  465

Query  363   HVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +D+  S+ +DP WL   RR+E+EII  WI QYY  L
Sbjct  466   CLDIVQSSPDDPNWLVMQRRREIEIISDWIKQYYADL  502



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score =   461 bits (1187),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 286/395 (72%), Gaps = 6/395 (2%)
 Frame = -1

Query  1422  MFDIAPHFNALL--VFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             MFDIAP F ALL  +  +HRFYG+S PFG   E+ SS + LGYL+STQ LAD+A LI  L
Sbjct  1     MFDIAPSFGALLHDLSKQHRFYGESKPFG--NESNSSPEKLGYLTSTQALADFAVLITSL  58

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K NL+A  SPVVVFGGSYGGMLA+WFRLKYPHVTIGA+ASSAPIL F+ IT   +F + +
Sbjct  59    KHNLSAVSSPVVVFGGSYGGMLASWFRLKYPHVTIGAVASSAPILQFDYITPWSSFYEAV  118

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QD++SES NC+ VIK +W LI +      GL +L K+F  CK   SV S   WL TA+ 
Sbjct  119   SQDYKSESFNCFSVIKAAWDLIDERGSTDAGLLQLSKTFRACKTVKSVYSFRNWLWTAFV  178

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM DYPT  NFL  +P YP+K+MCK I     G+D + K ++A ++YYNYTG+   CF
Sbjct  179   YTAMVDYPTPANFLMNLPAYPIKEMCKIIHGFPAGADIVDKAFAAASLYYNYTGD-QTCF  237

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
              L    DPHGLSGW WQACTEM+MP+  SN +S+FP   + Y  ++  C +++ + PRP+
Sbjct  238   QLEDGEDPHGLSGWGWQACTEMVMPMTISN-ESMFPPFTFTYEGKSDDCFQSYGVRPRPH  296

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS GGVLKNIS S++A+  ++GAHH+D R
Sbjct  297   WITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFR  356

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              +TK+DP W+ + RR+EV+IIQ WI QY   L  +
Sbjct  357   SATKDDPDWVVEQRRQEVKIIQGWIDQYNEDLAQI  391



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   466 bits (1198),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/452 (51%), Positives = 304/452 (67%), Gaps = 21/452 (5%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y T  + Q LDHFTF P  Y TF QRYL+N  YWGG +N +PIFV +GNE DI       
Sbjct  78    YTTNQYMQTLDHFTFRPDGYRTFPQRYLVNKTYWGGPQNNSPIFVCLGNEEDIITQLPYF  137

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             G M + A  F AL+VFIEHR+YG S+PFG + E+ +++ TLGY S++Q LADYA +I DL
Sbjct  138   GIMTEHAADFRALIVFIEHRYYGTSMPFGSQDESYANASTLGYYSASQALADYAIVITDL  197

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KKNL+A D PVVVFGGSYGGMLAAW RLKYPH+TIGALASS+PILYFE++T   A+  V+
Sbjct  198   KKNLSADDCPVVVFGGSYGGMLAAWLRLKYPHITIGALASSSPILYFEDMTPHDAYDRVV  257

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  S+ CY+ IK SW  ++ +A + GGL++L K FN C++  S   L  W+  A  
Sbjct  258   TKDFRDASDICYRRIKESWAEMEKVASQPGGLQKLAKLFNTCQSLSSWTDLFYWIYPALQ  317

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
              +A  ++              VK +C+ I+    G+D L +L +       Y  E   C 
Sbjct  318   VSAQYNFA------------EVKAICRVINSQARGTDILTRLAAGA----EYANEGLGCL  361

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L+++     LSGW WQ C+EM++PL  +   ++FP++ +D       C + + + PRP 
Sbjct  362   NLSTT-----LSGWDWQTCSEMVIPLAPNANTTMFPSAPFDLKSYFSGCFKTYGVLPRPY  416

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITTEFGGHNI+RVLK+FGSNIIF NGLRDP+S+GGVLKNIS S+VAITAKEG H  D+R
Sbjct  417   WITTEFGGHNIKRVLKRFGSNIIFSNGLRDPYSSGGVLKNISDSIVAITAKEGVHCEDIR  476

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              ST +DP WLK+ R+KE+ II+KWI  Y  S+
Sbjct  477   SSTNDDPNWLKEQRQKEINIIRKWIIDYKMSM  508



>emb|CDX68714.1| BnaC01g07390D [Brassica napus]
Length=390

 Score =   459 bits (1182),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/391 (56%), Positives = 278/391 (71%), Gaps = 9/391 (2%)
 Frame = -1

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             M DIAP F A+LVFIEHRFYG+S P          + TLG+L+S Q LADYA LI  LK 
Sbjct  1     MLDIAPKFQAILVFIEHRFYGESKP-------HKLANTLGFLNSQQALADYAILIRSLKH  53

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
             NLT+  SPV+VFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+NI    +F D ++Q
Sbjct  54    NLTSEASPVIVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILNFDNIVPSSSFYDTVSQ  113

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DF++ S NC++VIK SW  ++  +    GL+ L K F  CK   SV S+ GWL TA+  T
Sbjct  114   DFKNVSANCFEVIKRSWGEMEVFSTIKDGLQELSKMFRTCKTLHSVDSVSGWLETAFIET  173

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             AM +YPT  NF+ P+P YPV+QMCK +D+    +  L + ++A ++YY+Y+G   +CFD+
Sbjct  174   AMVNYPTPANFMAPLPAYPVEQMCKIMDELPLDASNLERAFAAASLYYSYSGS-ESCFDM  232

Query  702   ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWI  523
              + +D HGL+GW WQACTEM+MP+  SN     P    D     +YC   + ++PRP+WI
Sbjct  233   ENHTDSHGLNGWGWQACTEMVMPMSCSNHTMFRPFESDDEKANQEYCLREYGVKPRPHWI  292

Query  522   TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVA-ITAKEGAHHVDLRF  346
             T EFGG  IE VLK+FGSNIIF NGL+DPWS GGVLKNIS S++A +T K GAHH DLR 
Sbjct  293   TAEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVLKNISSSIIALVTRKAGAHHTDLRA  352

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             +TK+DP+WLK  RR+EV II+KWIS+YY+ L
Sbjct  353   ATKDDPEWLKQQRRQEVAIIEKWISEYYNDL  383



>ref|XP_008798889.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Phoenix 
dactylifera]
Length=478

 Score =   460 bits (1183),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 296/451 (66%), Gaps = 37/451 (8%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLIN-DRYWGGAKNMAPIFVYMGNEGDIEWFTQN  1432
             Y+T+YF Q LDHF+F      +FQQRYL+    +W  A+   PIF Y GNEGDIEWF  N
Sbjct  56    YETRYFRQRLDHFSFA--ELPSFQQRYLVGPSDHW--ARPAGPIFFYCGNEGDIEWFASN  111

Query  1431  TGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
             TGF+++IAP F+AL+VF EHR+YG+S+P+G    A  ++++L YL++ Q LAD+A L+ D
Sbjct  112   TGFVWEIAPLFSALVVFAEHRYYGESMPYGSRDRAYENAESLSYLTTEQALADFAVLLTD  171

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             LK+NL+A DSPVV+FGGSYGGMLAAW RLKYPHV IGALASSAPIL FE+I  P  F D+
Sbjct  172   LKRNLSAEDSPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPILQFEDIVPPETFYDM  231

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             ++ DFR ES +C+K IK SW  ++D  +    L  L + F +C+   +   L  WLS+AY
Sbjct  232   VSSDFRRESLSCFKAIKESWDALEDQGQGHDNLVNLSRKFRLCRELNNTAELSNWLSSAY  291

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             +Y AM DYP  ++FL P+P  P+K++C+ ID    G+D L ++++               
Sbjct  292   SYLAMVDYPYPSDFLMPLPANPIKEVCRKIDSYPDGTDLLDRIFAG--------------  337

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
                               ACTEM+MP+  S ++S+FP   + Y      C   + + PRP
Sbjct  338   ------------------ACTEMVMPMSSSQENSMFPTYNFSYAAYQDECVHNYGVRPRP  379

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              W+TTEFGGH+I+  LK+FGSNIIF NGL DPWS G VL+NIS+S++A+  + GAHH+DL
Sbjct  380   RWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHIDL  439

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYH  259
             R ST EDP WL + R+ E+ +I+ WI  YY 
Sbjct  440   RPSTNEDPDWLIEQRKSEISLIRGWIYDYYQ  470



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   460 bits (1183),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 315/469 (67%), Gaps = 22/469 (5%)
 Frame = -1

Query  1629  AADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
              +++ K  +T Y+ Q+LDHF + P+SY+TF QRYLIN +YWGGA + APIFVY G E  I
Sbjct  48    VSNDPKDVETFYYKQVLDHFNYNPESYNTFNQRYLINFKYWGGANSSAPIFVYFGPEQPI  107

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
             +   ++ GFM + AP F ALLV+IEHR+YGKSVPFG  +EA  ++ TLGY +S Q LADY
Sbjct  108   DGSPKSIGFMVEKAPTFKALLVYIEHRYYGKSVPFGSREEAFKNANTLGYFNSAQALADY  167

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A +IID+KK L A +SPVV+ GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF++ITSP
Sbjct  168   AEVIIDIKKTLHAQNSPVVLIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDDITSP  227

Query  1089  YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEG  910
              A+ DV+++DF+  SE CY+ I  SW  I  +A +  GL  L + FN C+       L  
Sbjct  228   NAYFDVVSRDFKEVSETCYETILNSWSEIDKVASQPNGLSILSQRFNTCRPLNHSFELSE  287

Query  909   WLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYY-NY  733
              L + YT  A  ++P         P YPV  +C  ID  + G++ L K+YS V  Y  N 
Sbjct  288   DLESMYTSAAQYNHP---------PDYPVTVICSGIDKASFGNNILDKIYSGVVAYKGNG  338

Query  732   TGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEA  553
             T +VNN  +++ +       GW WQ C+EM+MP    N D++F  S +D     + CK+ 
Sbjct  339   TCKVNNPKNISETD-----VGWRWQTCSEMVMPFAIGN-DTMFQPSPFDLKRFVERCKKK  392

Query  552   FKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVA-----  388
             + + PRP+WITT +GGH+I+RVL+KFGSNIIF NGL+DP+S+ GVL ++SKSLVA     
Sbjct  393   YGVSPRPHWITTYYGGHDIKRVLQKFGSNIIFSNGLKDPYSSAGVLHDLSKSLVAVPTIN  452

Query  387   -ITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              I +  G+H +D+  S + DPKWL + R KEV+IIQ+WI+QYY  L  L
Sbjct  453   DINSIAGSHCLDILPSKESDPKWLIEQRNKEVKIIQEWIAQYYIDLGAL  501



>ref|XP_007011978.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY29597.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=420

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 271/377 (72%), Gaps = 7/377 (2%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             +   YF Q LDHFTF P+S   F Q+YLIN  YW      APIFVY GNEGDIEWF  NT
Sbjct  51    FKVHYFPQTLDHFTFQPKSSKIFYQKYLINSHYWHKG---APIFVYTGNEGDIEWFAANT  107

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM DIAP F ALLVFIEHRFYG+S PFG  KE+  S+KTLGYL+S Q LAD+A LI +L
Sbjct  108   GFMLDIAPKFKALLVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALADFAVLIRNL  165

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL++  SPVVVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F+ I    +F D +
Sbjct  166   KQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDKIIPWSSFYDAV  225

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +QDF+  S NCY+VIKGSW+ ++ ++ +   L  L K+F  CK+  S  S   WL TA+ 
Sbjct  226   SQDFKDVSWNCYEVIKGSWEELEAMSTQKEALAELSKAFRTCKSLHSTASARDWLWTAFV  285

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             YTAM +YPT  NFL P+P YPV++MCK ID    G+  L++ ++A ++YYNY+    NCF
Sbjct  286   YTAMVNYPTEANFLKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYS-RAENCF  344

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++    D HGL GW WQ CTEM+MP+  S K+S+FP S +DY E A+ C+  +++ PRP+
Sbjct  345   EIEHEVDTHGLHGWDWQTCTEMVMPMTCS-KESMFPPSGFDYEEFAEQCQMKYEVLPRPH  403

Query  528   WITTEFGGHNIERVLKK  478
             WITTEFGG  I++VLKK
Sbjct  404   WITTEFGGERIQKVLKK  420



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   454 bits (1169),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 296/446 (66%), Gaps = 14/446 (3%)
 Frame = -1

Query  1596  YFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMF  1417
             ++ Q LDHF + P+SY TF+QRY+IN ++WGGA + APIFVY+G E  ++ +    GF+ 
Sbjct  66    FYEQTLDHFNYRPESYATFKQRYVINYKFWGGANSSAPIFVYLGEESPLDNYIDAIGFLT  125

Query  1416  DIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNL  1237
             D AP FNAL+VFIEHR+YG+SVPFG  +EA  ++ TLGY SS+Q LADYA +I+ +KK+L
Sbjct  126   DHAPKFNALVVFIEHRYYGQSVPFGSMEEAFQNASTLGYFSSSQALADYAEVILYIKKSL  185

Query  1236  TATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDF  1057
             +A   PVVV GGSYGGMLAAWFRLKYPH+ +GALASSAPILYFE+IT    +  ++T+DF
Sbjct  186   SAESCPVVVIGGSYGGMLAAWFRLKYPHIALGALASSAPILYFEDITPQNGYYSIVTKDF  245

Query  1056  RSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAM  877
             R  SENCY  I+ SW  I   A +  GL  L K F  C        L+ +L T Y   A 
Sbjct  246   RETSENCYNTIRQSWSEIDKTASQPNGLSVLTKKFKTCFPLNLSSELKDYLETIYNSAAQ  305

Query  876   TDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLAS  697
              D P         P +PV  +C AID+ + G+D L+K+++ +     Y G   +C+D   
Sbjct  306   YDRP---------PTFPVSAICSAIDNTSKGADLLSKVFAGL---VAYKGN-QSCYDTKE  352

Query  696   -SSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWIT  520
                      GW+WQ C+EM+MP+G  + D++F A+ ++     Q CK  + I PR NWIT
Sbjct  353   FKYSTETKRGWNWQRCSEMVMPIGRGSNDTMFQAAPFNLTNFKQRCKRLYGISPRSNWIT  412

Query  519   TEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFST  340
             T+FGGH+IE VLK+FG NIIF NGLRDP+S+G VLKNIS SLVAI   +G+H +D+    
Sbjct  413   TQFGGHDIELVLKRFGGNIIFSNGLRDPYSSGSVLKNISDSLVAIYTTQGSHCMDILPEL  472

Query  339   KEDPKWLKDVRRKEVEIIQKWISQYY  262
              +DPKWL   R +E++II +WI QYY
Sbjct  473   PDDPKWLVMQRNQEIKIIGQWIKQYY  498



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   452 bits (1164),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 227/469 (48%), Positives = 309/469 (66%), Gaps = 19/469 (4%)
 Frame = -1

Query  1650  LSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVY  1471
             ++ S+++ AD    Y   Y  Q LDHF + P+SY TF+QRY++N +YWGGA   APIFVY
Sbjct  17    MAESTSQWAD----YKVYYHNQTLDHFNYRPESYTTFRQRYVMNAKYWGGANTSAPIFVY  72

Query  1470  MGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSS  1291
             +G+E  +++   + GF+ D AP F ALLV+IEHR+YGKS+PF   +EA S++ TLGY SS
Sbjct  73    LGDEAALDFQIGSAGFLSDNAPKFKALLVYIEHRYYGKSIPFSSREEAFSNASTLGYFSS  132

Query  1290  TQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILY  1111
             +Q +ADYA +I+ +KKNL+A  SPV+V GGSYGGMLAAWFRLKYPH+ +GALASSAPILY
Sbjct  133   SQAIADYAEIILHIKKNLSAEKSPVIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILY  192

Query  1110  FENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYI  931
             F++IT    +  V+++DFR +SENCY  +K SW  I  +A +  GL  L K F  C    
Sbjct  193   FDDITPQDGYYSVVSKDFREKSENCYNTLKQSWSEIDRVASQPNGLSILSKQFMTCSPIT  252

Query  930   SVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA-  754
             S   L+ +L + Y   A    P+            V ++C AID  ++ +D L K++   
Sbjct  253   SASQLKDYLDSNYCEAAQYASPSGDG---------VSRICNAIDGTSNHTDILGKIFKGL  303

Query  753   VNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNER  574
             V+   N+T    N F+  S +D     GWSWQ C+EM+MP+   N D++F A  +D +  
Sbjct  304   VSFNGNWTCYDVNAFNNPSETD----EGWSWQTCSEMVMPIAHGN-DTMFQAESFDLDAF  358

Query  573   AQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSL  394
              Q CK A+ + PRP+WIT EFGG +I+ +L++FGSNIIF NGL+DP+S+GGVLK+ISKSL
Sbjct  359   VQDCKNAYGVSPRPHWITAEFGGDDIKLILERFGSNIIFSNGLKDPYSSGGVLKSISKSL  418

Query  393   VAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              AI   EG+H +D+  S   DPKWL   RR+EVEII  W  QYY  L +
Sbjct  419   PAIYTTEGSHCLDILPSLPNDPKWLIKQRRREVEIISNWFRQYYTDLAN  467



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 304/451 (67%), Gaps = 12/451 (3%)
 Frame = -1

Query  1605  DTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTG  1426
             +T Y+ Q+LDHF + P+SYH F+QRY +N +YWGGA + APIF Y+G E  I+ +    G
Sbjct  59    ETFYYKQVLDHFNYRPESYHKFEQRYFMNFKYWGGANSSAPIFAYLGAEDSIDTYPTGIG  118

Query  1425  FMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLK  1246
             FM D A  F ALLV+IEHR+YGKSVPFG  K+A  ++ TLGY +S Q +ADYA ++I +K
Sbjct  119   FMTDNAATFKALLVYIEHRYYGKSVPFGSRKKAFRNASTLGYFNSAQAIADYAAVLIHIK  178

Query  1245  KNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVIT  1066
             K L A +SP++V GGSYGGMLA+WFRLKYPH+TIGALASSAPILYF+NIT   A+ D+++
Sbjct  179   KTLHAHNSPIIVLGGSYGGMLASWFRLKYPHLTIGALASSAPILYFDNITPHNAYMDLVS  238

Query  1065  QDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTY  886
             ++F+  SE CY+ I  SW  I+ I+ +S GL  L + FN C+       L  +L + YT 
Sbjct  239   REFKEVSETCYETILKSWSEIERISSQSDGLSILSERFNTCRPLKQYSDLSEYLESMYTA  298

Query  885   TAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFD  706
                 + PT++          V ++C+ ID  + G+D L+K+YS + + Y   G     + 
Sbjct  299   AVQYNGPTSSR---------VSEICRGIDGASFGNDILSKIYSGL-VAYEGNGTCKINYA  348

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
              ++ SD     GWSWQ C+EM+MP+G  N D++F    ++     + CK+ + + PRP+W
Sbjct  349   PSNISD-EVYEGWSWQRCSEMVMPIGTGN-DTMFQPDPFNLKRYVEECKKQYGVSPRPHW  406

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             +TT +GGHNI+ VL+KFGSNIIF NGL+DP+S GGVL N+S SL+A+    G+H +D+  
Sbjct  407   VTTYYGGHNIKLVLQKFGSNIIFSNGLKDPYSTGGVLSNLSDSLIAVYTTNGSHCLDILQ  466

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             + + DPKWL   R+KEVEII++WI QYY  L
Sbjct  467   TRQSDPKWLIQQRKKEVEIIKRWIEQYYSDL  497



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   452 bits (1162),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/446 (49%), Positives = 291/446 (65%), Gaps = 15/446 (3%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             T ++ Q LDHF + P+SY TFQQRY++N  YWGGA + +PIFVY G+E  I       GF
Sbjct  50    TYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAVAAFAGF  109

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             + ++A  FN LL++IEHR+YG SVPFG + EA S++ TLGY +STQ LADYA LI +LKK
Sbjct  110   IVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAELITNLKK  169

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
             NL+A + PV+  GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF++IT   A+  ++T+
Sbjct  170   NLSAENCPVIAIGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPGNAYHVIVTK  229

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DFR  SE+CY  I+ SW  I  +A E  GL  L + F  C+   S   L+ +L+  Y  +
Sbjct  230   DFRETSESCYSTIRDSWSEIDKVAAEPNGLANLSQIFMTCEPLNSSQELKYYLALCYVVS  289

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             A  D P         P YPVK++C AID    G+D + ++ + +N        V      
Sbjct  290   AQNDNP---------PAYPVKKVCDAIDGAPEGTDIIGRVAAGLN------ASVGPPCHF  334

Query  702   ASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWI  523
                  P   S W+WQ CTEM+MP+G    D++F A  +D N   + C++ F + PRP+WI
Sbjct  335   VYDFKPSNRSEWTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWI  394

Query  522   TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFS  343
             TTEFGGH+I+ V+  F SNIIF NGLRDP+SAGGVL++IS S+VAI   +GAH +DL   
Sbjct  395   TTEFGGHDIKSVVGNFASNIIFSNGLRDPYSAGGVLQDISDSVVAIYTDKGAHCLDLSTP  454

Query  342   TKEDPKWLKDVRRKEVEIIQKWISQY  265
             T  DP WL   + KEV+II  W+++Y
Sbjct  455   TATDPDWLVSQQEKEVKIIGLWLAEY  480



>ref|XP_006380821.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|ERP58618.1| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=463

 Score =   449 bits (1156),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/395 (53%), Positives = 281/395 (71%), Gaps = 5/395 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y++KYF Q LDHF+F   +   F QRYLIN  +W G +   PIF+Y GNEGDIEWF  NT
Sbjct  63    YESKYFYQQLDHFSFL--NLPKFPQRYLINTDHWAGPERRGPIFLYCGNEGDIEWFAVNT  120

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP F A+++F EHR+YG+S+P+G  +EA  ++ TL YL++ Q LAD+A LI DL
Sbjct  121   GFVWEIAPLFGAMVLFPEHRYYGESMPYGSREEAYKNASTLSYLTAEQALADFAVLITDL  180

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL+A   PVV+FGGSYGGMLAAW RLKYPHV IGALASSAPIL FE+I  P  F +++
Sbjct  181   KRNLSAQACPVVLFGGSYGGMLAAWMRLKYPHVAIGALASSAPILQFEDIVPPETFYNIV  240

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DF+ ES +C+  IK SW  +     +  GL +L K+F++C+   S   L  WL +AY+
Sbjct  241   SNDFKRESTSCFNTIKESWDALLSEGLKKNGLVQLTKTFHLCRELKSTEDLANWLDSAYS  300

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P YP+ ++CK ID    G+  L +++  ++IYYNYTGE+ +CF
Sbjct  301   YLAMVDYPYPSSFMMPLPGYPIGEVCKRIDGCPDGTSILERIFEGISIYYNYTGEL-HCF  359

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L    DPHGL GW+WQACTEM+MP+  S+  S+FP  +++Y+   + C E F + PRP 
Sbjct  360   EL--DDDPHGLDGWNWQACTEMVMPMSSSHNASMFPTYDFNYSSYQEGCWEEFGVIPRPR  417

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
             WITTEFGG +I+  L+ FGSNIIF NGL DPWS G
Sbjct  418   WITTEFGGQDIKTALETFGSNIIFSNGLLDPWSGG  452



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   449 bits (1154),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 302/462 (65%), Gaps = 16/462 (3%)
 Frame = -1

Query  1626  ADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIE  1447
             A N +   T YF Q+LDHF + P+SY TFQQRYLIN +YWGGA + APIF Y G E  I+
Sbjct  16    AINTEEVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYFGAESPID  75

Query  1446  WFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYA  1267
                   GF+ D A  FNALLV+IEHR+YGKSVPFG  +EA  ++ T+GY +S Q LADYA
Sbjct  76    NSPNGVGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYA  135

Query  1266  TLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPY  1087
             +++  +KK L A +SPV+V GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF+ IT   
Sbjct  136   SILKHVKKTLHAKNSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDKITPQN  195

Query  1086  AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGW  907
              +   +T+D+R  SE CY+ +  SW  I+ IA +  GL  L + FN C        L  +
Sbjct  196   GYYSTVTRDYREASETCYETVLKSWSEIRRIASQPNGLVTLSQRFNTCHTLNQSYELIDY  255

Query  906   LSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA-VNIYYNYT  730
             L + Y Y A  + P         P YPV  +C  ID  + GSD L+K+Y+  V +  N T
Sbjct  256   LRSTYVYAAQYNQP---------PRYPVSMICGGIDGESLGSDILSKIYAGIVALRGNST  306

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
              +VN   +++ ++      GW WQ C+EM++P+G  N D++F    ++    A+ CKE +
Sbjct  307   CKVNGPTNVSETT-----VGWRWQTCSEMVIPIGIGN-DTMFEPIPFNLTRYAEGCKEQY  360

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP+W+TT +GGHNI+ VL++ GSNIIF NGLRDP+S GGVL NIS S+VA+    G
Sbjct  361   GVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDNISDSIVAVHTVNG  420

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             +H +DL  + + DP WL + R+KEV+II++WI+QYY  L  L
Sbjct  421   SHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDAL  462



>ref|XP_011017986.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Populus 
euphratica]
Length=410

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 208/381 (55%), Positives = 281/381 (74%), Gaps = 4/381 (1%)
 Frame = -1

Query  1395  ALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPV  1216
             +L V  +HRFYG+S+PFG   ++  S++TLGYL+S Q LAD+A LI  LK NL++  SPV
Sbjct  28    SLNVIFQHRFYGESMPFG--NKSYKSAETLGYLNSQQALADFALLIRSLKHNLSSEASPV  85

Query  1215  VVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENC  1036
             VVFGGSYGGMLAAWFRLKYPH+ IGALASSAPIL F++IT   +F D ++QDF+  S NC
Sbjct  86    VVFGGSYGGMLAAWFRLKYPHIAIGALASSAPILQFDDITPWSSFYDAVSQDFKEASSNC  145

Query  1035  YKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTAT  856
             Y+VIKGSW  ++ ++ +  GL  L ++F  C++  S+ S+  WL +A+ YTAM +YPT  
Sbjct  146   YEVIKGSWAELEALSAQKEGLAELSRTFRACQDLHSLDSVWEWLWSAFVYTAMVNYPTEA  205

Query  855   NFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL  676
             NF+ P+P YPV+ MCK ID    G+  + ++++A ++YYNY+     CF L    D HGL
Sbjct  206   NFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYS-RAEKCFKLEHGPDAHGL  264

Query  675   SGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNI  496
              GW+WQACTEM+MP+  S ++S+FP S + Y E A+ C + F ++PR +WITTEFGG  I
Sbjct  265   HGWNWQACTEMVMPMTCS-EESMFPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRI  323

Query  495   ERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLK  316
             + VLK+ G NIIF NG++DPWS GGVLKNIS S++A+  ++GAHHVD R +TK+DP+WLK
Sbjct  324   DLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLK  383

Query  315   DVRRKEVEIIQKWISQYYHSL  253
             ++RR+EVEIIQ WI QYY  L
Sbjct  384   ELRRQEVEIIQGWIDQYYPDL  404



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 310/475 (65%), Gaps = 17/475 (4%)
 Frame = -1

Query  1674  TIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAK  1495
             +++   + L   S   ++N   + T ++ Q LDHF + P+SY TFQ RY++N  YWGGA+
Sbjct  41    SVLEGSSSLRTVSVNLSEN---FQTFFYPQTLDHFNYRPESYTTFQHRYMVNFNYWGGAR  97

Query  1494  NMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSS  1315
             + A IFVY+G E D++    + GF+ D    F ALLV+IEHR+YGKS PFG  +++  ++
Sbjct  98    SAAQIFVYLGEESDLDKDINSIGFLVDNGARFGALLVYIEHRYYGKSNPFGSMQKSLQNA  157

Query  1314  KTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGAL  1135
                GY +S Q LADYA +II+LKKNL+A  SPV+V GGSYGG+LAAWFRLKYPHV +GAL
Sbjct  158   SRRGYFNSGQALADYAEVIINLKKNLSADSSPVIVVGGSYGGLLAAWFRLKYPHVALGAL  217

Query  1134  ASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKS  955
             ASSAPILYF++IT    +  ++T+DFR  SE+CY  IK SW  I   A E+ GL  L K 
Sbjct  218   ASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEIDKAAAEANGLLNLSKK  277

Query  954   FNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDP  775
             F  CK   S   L+ +L T Y+  A  D P         P YPV  +C  ID    G+D 
Sbjct  278   FRTCKPLESASQLKDYLETMYSIAAQYDRP---------PMYPVTVVCNGIDGGLQGTDI  328

Query  774   LAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSIFPA  598
             L +++S +      +    +C+D+  SS P     GW+WQ C+E+++P+G  + D++FPA
Sbjct  329   LDRIFSGIVA----SRGNKSCYDMGQSSFPSETEEGWNWQVCSELVIPIGRGSNDTMFPA  384

Query  597   SEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  418
             + +D+ E A  CK ++ + PRP+WIT+ +GGHNI+ +LK+FGSNIIF NGLRDP+S+GGV
Sbjct  385   APFDFKEYADSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGV  444

Query  417   LKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             L++IS S++A+    G+H +D+  ST++DP WL   R  E+EII  W+ +YY  L
Sbjct  445   LEDISHSIIAVHTPRGSHCLDILPSTEDDPNWLVLQRNVEIEIIHGWLLKYYEDL  499



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   447 bits (1151),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 308/465 (66%), Gaps = 15/465 (3%)
 Frame = -1

Query  1647  SASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYM  1468
             SAS A ++  H L  T Y+ Q LDHF + P S+  FQQRY+IN +YWGGA + APIFVY 
Sbjct  56    SASFAASSIYHNL-QTFYYNQTLDHFNYRPDSFDMFQQRYVINSKYWGGAISNAPIFVYF  114

Query  1467  GNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSST  1288
             G E  +E+   + G + + A  F AL V+IEHR+YGKS+PFG   EA  ++ TLGY +S 
Sbjct  115   GEEAPLEYDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAFKNASTLGYFNSA  174

Query  1287  QVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYF  1108
             Q LADYA +II +K+   A  SPV+V G SYGGMLA+WFRLKYPH+ +GALASSAPILYF
Sbjct  175   QALADYAEIIIHVKEKFHAQRSPVIVVGASYGGMLASWFRLKYPHIALGALASSAPILYF  234

Query  1107  ENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYIS  928
              +IT  +A+  ++T+DFR +S++C+  IK SW +I  IA +  GL  L K F  CK   +
Sbjct  235   TDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASKPDGLSILSKKFKTCKPLNN  294

Query  927   VGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVN  748
                L+ +L+  Y   A  D P         P YPV  +C++ID+P+ G+D L ++++ + 
Sbjct  295   SSELKDYLAGIYMAAAQYDAP---------PSYPVTVICRSIDEPSFGNDILGRIFAGM-  344

Query  747   IYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQ  568
                 Y GE+  C+    + +     GWSWQ C +M++P G SN DS+F    +D N    
Sbjct  345   --VAYRGEL-PCYVNKPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPFDLNVYIN  400

Query  567   YCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVA  388
              CK+ + + PRP+W+TT FGGH+I+ +LK+FGSNIIF NGLRDP+S+GGVL+NIS+S+VA
Sbjct  401   DCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISESVVA  460

Query  387   ITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             IT  +G+H +D+  +TK DP+WL   R++EV II+KWI  Y+  L
Sbjct  461   ITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDL  505



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 300/452 (66%), Gaps = 16/452 (4%)
 Frame = -1

Query  1596  YFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMF  1417
             +F Q LDHF + P+SY TFQQRYLIN +YWGGA + APIF Y+G E  I+      GF+ 
Sbjct  51    FFKQTLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYLGAEAPIDNSPNTIGFLI  110

Query  1416  DIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNL  1237
             D AP FNALLV+IEHR+YGKSVPFG  +EA  ++ T+GY +S Q LADYA ++  +KK L
Sbjct  111   DNAPSFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYAAVLNHIKKTL  170

Query  1236  TATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDF  1057
              A +SPV+V GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF+NIT    +  V+T+D+
Sbjct  171   HAQNSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDNITPQNGYYSVVTRDY  230

Query  1056  RSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAM  877
             R  SE CYK I+ SW  I+ +A +  GL  L + FN C +   V SL  +L   Y   A 
Sbjct  231   REASETCYKTIQQSWSEIRRVASQPNGLVTLSQIFNTCHSLNQVESLIDYLRLMYASAAQ  290

Query  876   TDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA-VNIYYNYTGEVNNCFDLA  700
              ++P         P YPV  +C  ID  + GSD L+K+Y+  V +  N T  +N   +++
Sbjct  291   YNHP---------PKYPVNVICGGIDGASDGSDILSKIYAGVVALKGNTTCTINGPTNVS  341

Query  699   SSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWIT  520
              ++      GW WQ C+EM++P+ G  KD++F  + +      + CK  F + PRP+W+T
Sbjct  342   ETT-----VGWRWQTCSEMVIPI-GIEKDTMFEPNPFSLKRYVEGCKTTFGVSPRPHWVT  395

Query  519   TEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFST  340
             T +G HNI+ VL +FGSNIIF NGL+DP+S GGVL+NIS ++VAI    G+H +D+  + 
Sbjct  396   TYYGAHNIKLVLGRFGSNIIFSNGLKDPYSIGGVLENISDNIVAIHTVNGSHCLDILRAN  455

Query  339   KEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             + DP+WL   R+KE++I+++WI++YY  L  L
Sbjct  456   ESDPEWLVKQRKKEIKIMKRWITKYYADLHAL  487



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   446 bits (1147),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 301/462 (65%), Gaps = 16/462 (3%)
 Frame = -1

Query  1626  ADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIE  1447
             A N +   T YF Q+LDHF + P+SY TFQQRYLIN +YWGGA + APIF Y G E  I+
Sbjct  48    AINTEEVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYFGAESPID  107

Query  1446  WFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYA  1267
                   GF+ D A  FNALLV+IEHR+YGKSV FG  +EA  ++ T+GY +S Q LADYA
Sbjct  108   NSPNGVGFLTDNAASFNALLVYIEHRYYGKSVQFGSREEALKNASTIGYFNSAQALADYA  167

Query  1266  TLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPY  1087
             +++  +KK L A +SPV+V GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF+ IT   
Sbjct  168   SILKHVKKTLHAKNSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDKITPQN  227

Query  1086  AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGW  907
              +   +T+D+R  SE CY+ +  SW  I+ IA +  GL  L + FN C        L  +
Sbjct  228   GYYSTVTRDYREASETCYETVLKSWSEIRRIASQPNGLVTLSQRFNTCHTLNQSYELIDY  287

Query  906   LSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA-VNIYYNYT  730
             L + Y Y A  + P         P YPV  +C  ID  + GSD L+K+Y+  V +  N T
Sbjct  288   LRSTYVYAAQYNQP---------PRYPVSMICGGIDGESLGSDILSKIYAGIVALRGNST  338

Query  729   GEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
              +VN   +++ ++      GW WQ C+EM++P+G  N D++F    ++    A+ CKE +
Sbjct  339   CKVNGPTNVSETT-----VGWRWQTCSEMVIPIGIGN-DTMFEPIPFNLTRYAEGCKEQY  392

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              + PRP+W+TT +GGHNI+ VL++ GSNIIF NGLRDP+S GGVL NIS S+VA+    G
Sbjct  393   GVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDNISDSIVAVHTVNG  452

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             +H +DL  + + DP WL + R+KEV+II++WI+QYY  L  L
Sbjct  453   SHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYYADLDAL  494



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   446 bits (1146),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/487 (44%), Positives = 319/487 (66%), Gaps = 18/487 (4%)
 Frame = -1

Query  1701  KTTPTFPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             + +P    + I+  P+ + ++SA + D    + T +++Q LDHF + PQSY TF+QRY++
Sbjct  30    RLSPHNKEALILRNPDDVISTSAISKD----FKTHFYSQTLDHFNYAPQSYATFRQRYVV  85

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N +YWGG  + +PIF Y+G E  ++   +  GF+ D APHF +L V+IEHRFYGKSVPFG
Sbjct  86    NSKYWGGPTSNSPIFAYLGAEAPLDEDQEVIGFLNDNAPHFKSLSVYIEHRFYGKSVPFG  145

Query  1341  GEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLK  1162
               ++A  ++   GY SS Q +ADYA +++ +K    A  SP++V GGSYGG LA+WFRLK
Sbjct  146   KMEDAMKNATLRGYFSSAQAIADYAEILLHVKHKFAAHYSPIIVVGGSYGGKLASWFRLK  205

Query  1161  YPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEES  982
             YPH+ +GALASSAP+LYF+NIT    +  ++T+DF   S+NCY+ IK SW  I  +A + 
Sbjct  206   YPHIALGALASSAPVLYFDNITPQNGYYSIVTKDFEEVSKNCYQTIKNSWAEIDKVASKP  265

Query  981   GGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAI  802
              GL  L + F  C +  +   L+ +L T Y+  A  ++P         P YPV  +CK I
Sbjct  266   KGLSILSQRFKTCSHLNNSDELKDFLDTMYSVAAQYNHP---------PTYPVTVVCKGI  316

Query  801   DDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGG  625
             D    G+D + ++++ V    +Y G    C+D  + + P   S GW WQ C+E+++P+G 
Sbjct  317   DGAPAGTDVIGRIFAGV---VSYRGN-RTCYDTNAYNYPSETSVGWEWQTCSEIVIPIGR  372

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
                D++FPA+ +D +E A+ CK+ + + PRP+WITT +GGH+I+ VL +FGSNIIF NGL
Sbjct  373   GENDTMFPAAPFDLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGL  432

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             RDP+S+GGVL+++S+S+VA+T  +G+H +D+ +S K DP WL   R++E+EII+ W+  Y
Sbjct  433   RDPYSSGGVLEDLSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGWLKTY  492

Query  264   YHSLTDL  244
             Y  L  L
Sbjct  493   YSDLQAL  499



>gb|AIA26578.1| serine protease [Cicer arietinum]
Length=379

 Score =   441 bits (1134),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 269/378 (71%), Gaps = 7/378 (2%)
 Frame = -1

Query  1392  LLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVV  1213
             ++VF EHR+YG+SVP+G + EA  ++ TL +L++ Q LAD++ L+ DLK+N +A D PVV
Sbjct  1     MIVFPEHRYYGESVPYGSKDEAYKNATTLSFLTAEQALADFSVLLTDLKRNYSAIDCPVV  60

Query  1212  VFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCY  1033
             +FGGSYGGMLAAW RLKYPH+ +GALASSAPIL FENI  P  F D+++ DF+ ES  C+
Sbjct  61    LFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFENIVPPKTFYDIVSNDFKRESSTCF  120

Query  1032  KVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATN  853
               IK SW  I    + S GLE L K+F  C+       L  WL +AY+Y AM +YP  + 
Sbjct  121   NYIKQSWDEIASKGQTSNGLELLTKTFKFCQ----TDDLLDWLESAYSYLAMVNYPYPSE  176

Query  852   FLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLS  673
             F+ P+P YP+K++C+ ID    G+  L ++Y  VN+YYNYTGE   CF+L    DPHGL 
Sbjct  177   FMMPLPGYPIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEAK-CFEL--DDDPHGLD  233

Query  672   GWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIE  493
             GW+WQACTEM+MP+  S + S+FP  E++Y    + C + F ++PRP WITTEFGGHNI 
Sbjct  234   GWNWQACTEMVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIH  293

Query  492   RVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKD  313
               LKKFGSNIIF NGL DPWS G VL+NIS+S+V++  +EGAHH+DLR ST+ DP WL +
Sbjct  294   AALKKFGSNIIFSNGLLDPWSGGSVLQNISESIVSLVTQEGAHHLDLRASTENDPDWLIE  353

Query  312   VRRKEVEIIQKWISQYYH  259
              R  E+++I+ WI++YY 
Sbjct  354   QRATEIKLIEGWINEYYQ  371



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 303/465 (65%), Gaps = 15/465 (3%)
 Frame = -1

Query  1647  SASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYM  1468
             SAS A ++  H L  T Y+ Q LDHF + P S+  FQQRY+IN +YWGGA + APIFVY 
Sbjct  52    SASFAASSIYHNL-QTFYYNQTLDHFNYRPDSFDMFQQRYVINSKYWGGANSNAPIFVYF  110

Query  1467  GNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSST  1288
             G E  +E    + G + + A  F AL V+IEHR+YGKS+PFG   EA  ++ TLGY +S 
Sbjct  111   GEEAPLENDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAFKNASTLGYFNSA  170

Query  1287  QVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYF  1108
             Q LADYA +II + +      SPV+V G SYGGMLA+WFRLKYPH+ +GALASSAPILYF
Sbjct  171   QALADYAEIIIHVNEKFHVQRSPVIVVGASYGGMLASWFRLKYPHIALGALASSAPILYF  230

Query  1107  ENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYIS  928
              +IT  +A+  ++T+DFR +S++C+  IK SW +I  IA E  GL  L K F  CK   +
Sbjct  231   TDITPAHAYVSIVTKDFREDSQSCHDTIKKSWTVIDKIASEPDGLSILSKKFETCKPLNN  290

Query  927   VGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVN  748
                L  +L+  Y   A  D P         P YPV  +CK+ID+P+ G+D L ++++ + 
Sbjct  291   SSELTDYLAGIYMAAAQYDAP---------PSYPVTMVCKSIDEPSFGNDILGRIFAGM-  340

Query  747   IYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQ  568
                 Y GE+  C+    + +     GWSWQ C +M++P G SN DS+F    +D N    
Sbjct  341   --VAYQGEL-PCYVNEPTKETETDVGWSWQTCADMVIPFGISN-DSMFQPYPFDLNAYIN  396

Query  567   YCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVA  388
              CK+ + + PRP+W+TT FGGH+I+ +LK+FGSNIIF NGLRDP+S+GGVL+NIS S+VA
Sbjct  397   DCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISDSVVA  456

Query  387   ITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             IT  +G+H +D+  +TK DP+WL   R++EV II+KWI  Y+  L
Sbjct  457   ITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYFSDL  501



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 219/484 (45%), Positives = 315/484 (65%), Gaps = 15/484 (3%)
 Frame = -1

Query  1698  TTPTFPFSTIINRPNGLSASSAKAADNHKL-YDTKYFTQILDHFTFTPQSYHTFQQRYLI  1522
             T    P   +  +   ++ S+AK +   K    T ++TQ LDHF + P+SY TFQQRY+I
Sbjct  30    TQSKMPNLDVFRKSRMVNPSAAKPSSTSKDDLQTFFYTQTLDHFNYRPESYTTFQQRYMI  89

Query  1521  NDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFG  1342
             N +YWGG  ++APIFV++G E  ++   ++ GF+ D AP FNAL+V+IEHR+YGKSVPF 
Sbjct  90    NFKYWGGVNSIAPIFVFLGEESSLDDDIESIGFLTDHAPRFNALIVYIEHRYYGKSVPFE  149

Query  1341  GEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLK  1162
               +++  +++TLGY +S Q LADYA +IIDLKKNL+A   PV+V GGSYGGMLA+WFRLK
Sbjct  150   SWEKSFQNTETLGYFNSAQALADYAEVIIDLKKNLSAEFCPVIVMGGSYGGMLASWFRLK  209

Query  1161  YPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEES  982
             YPHV +GALASSAPILYF++IT    +  ++T+D+R  SE+C+  I+ SW  I  +A ++
Sbjct  210   YPHVALGALASSAPILYFDDITPHNGYYSIVTKDYREASESCHDTIRESWSEIDKVASQA  269

Query  981   GGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAI  802
              GL  L + F  C    +   L+ +L + Y  TA  + P         P   V ++C  I
Sbjct  270   DGLSVLSQKFKTCSPLNTSFELKDYLDSIYAETAQFNRP---------PENIVNKICDVI  320

Query  801   DDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDP-HGLSGWSWQACTEMIMPLGG  625
             D    G+D L+++++ V  Y        +C+D    + P  G  GW WQ C+E++MP+G 
Sbjct  321   DGAPKGTDILSRVFAGVVAYMGN----RSCYDTNYYNYPTQGYFGWRWQTCSELVMPIGR  376

Query  624   SNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGL  445
              + D++FP+S +D     + C++ + + PRP+WITT+FGGH+I  VL+KF SNIIF NGL
Sbjct  377   GSNDTMFPSSPFDLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGL  436

Query  444   RDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQY  265
             +DP+S+GGVL NIS S+VAI   EG+H +DL  ++  DPKWL   R+ E+E I+ WI +Y
Sbjct  437   KDPYSSGGVLANISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGWIEKY  496

Query  264   YHSL  253
             Y  L
Sbjct  497   YVEL  500



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   443 bits (1140),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 301/458 (66%), Gaps = 18/458 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T Y+ Q LDHF + P+SY TFQQRY++N +YWGGA   APIF Y+G E D+++     
Sbjct  60    FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGAEADLDYDLSGI  119

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ D A  F ALLV+IEHR+YGKS+P+G  +EA  ++ TLGY +S Q +ADYA ++I +
Sbjct  120   GFLTDNAHQFKALLVYIEHRYYGKSIPYGSREEAFKNASTLGYFNSAQAIADYAEVLIYI  179

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK L A +SPV+V G SYGGMLA+WFRLKYPHV +GALASSAPILYF++IT    +  ++
Sbjct  180   KKKLLAENSPVIVVGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIV  239

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE+CYK I  SW  I  +A E  GL  L K F IC    +   L+ +L   Y+
Sbjct  240   TKDFREASESCYKTISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYS  299

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  D P         P YPV  +C  ID    GSD L+++++ V     + G + +C+
Sbjct  300   IAAQYDAP---------PSYPVTVVCGGIDGAPEGSDILSRIFAGV---VAFRGNM-SCY  346

Query  708   DLASSSD--PHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
               ++++D     + GW WQ C+E+++P+G    D++FP + ++    +Q C   + + PR
Sbjct  347   YTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPR  406

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITT +GGH+IE +L++F SNIIF NGLRDP+S GGVLKNIS S++AI    G+H +D
Sbjct  407   PHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLD  466

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYY---HSLT  250
             L  +   DP+WL   R+ EVEII+ WI+QYY   H++T
Sbjct  467   LLPAASTDPEWLVMQRKAEVEIIEGWIAQYYVDLHAIT  504



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   442 bits (1138),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 313/478 (65%), Gaps = 22/478 (5%)
 Frame = -1

Query  1665  NRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAK-NM  1489
             +RP G  A SA A  + K Y   ++ Q LDHF + PQSY TF+QRY++N +YWGG   N 
Sbjct  54    SRPGG--AISANALLDFKTY---FYRQTLDHFNYAPQSYATFRQRYVVNSKYWGGQSFNN  108

Query  1488  APIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKT  1309
             +PIF Y+G E  I+      GF+ D AP FN+L+VFIEHR+YGKS+PFG  +EA  +  T
Sbjct  109   SPIFAYLGAEAPIDNDLSVVGFLNDNAPSFNSLIVFIEHRYYGKSIPFGTMEEAMKNETT  168

Query  1308  LGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALAS  1129
              GY +S Q +ADYA ++  +K   +A DSP++V GGSYGGMLA+WFRLKYPH+ +GALAS
Sbjct  169   RGYFNSAQAIADYAAILSHIKHQFSAHDSPIIVVGGSYGGMLASWFRLKYPHIALGALAS  228

Query  1128  SAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFN  949
             SAPILYF+NIT    +  ++T+DF+  S+NCYK I+ SW  I  +A +  GL+ L + F 
Sbjct  229   SAPILYFDNITPQNGYYSIVTKDFKEVSDNCYKTIRRSWAEIDRVASKPNGLDILSQRFK  288

Query  948   ICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGS--DP  775
              C    +   L+ +L T Y   A  + P         P YPV  +C+ ID  ++GS  D 
Sbjct  289   TCSKLNNAEELKDYLETIYAVAAQYNRP---------PNYPVTMVCRGIDGVHNGSDGDV  339

Query  774   LAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGGSNKDSIFPA  598
             + ++++ V    +Y G    C+D+ + + P   S GW WQ C+EM+MP+G    +++FPA
Sbjct  340   IGRIFAGV---VSYKGN-KTCYDMNTYNYPSETSIGWQWQTCSEMVMPIGRGQNETMFPA  395

Query  597   SEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  418
             + ++ +E  + C E + + PRP+WITT +GGH+I+  L +FGSNIIF NGLRDP+S+GGV
Sbjct  396   APFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNGLRDPYSSGGV  455

Query  417   LKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             L+++S+S+VA+T + G+H +D+  +TK DP+WL   R  E++IIQ W++ YY  L  L
Sbjct  456   LEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGWLTTYYADLKSL  513



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 303/475 (64%), Gaps = 19/475 (4%)
 Frame = -1

Query  1665  NRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMA  1486
             N P  +S S     D  K + T ++TQ LDHF + P SY TFQQRY+IN ++WGG+ + A
Sbjct  40    NEPKAMSPS-----DQFKDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSA  94

Query  1485  PIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTL  1306
             PIFVY+G EG ++      GF+ D AP F ALLV+IEHR+YGKSVPFG  +EA  ++ TL
Sbjct  95    PIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTL  154

Query  1305  GYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASS  1126
             GY +S Q +ADYA +++ +KK  +A  SP +V GGSYGGMLAAWFRLKYPH+ +GALASS
Sbjct  155   GYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASS  214

Query  1125  APILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNI  946
             APILYF +      +  ++T+DF+  S++CY+ ++ SW  I+ +A    GL  L K F  
Sbjct  215   APILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRT  274

Query  945   CKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAK  766
             CK       LE +L + YT  A  D P         P YP+  +C  ID    G D L K
Sbjct  275   CKPLKKTSELEDFLDSLYTDVAQYDDP---------PTYPLSIVCGGIDGAPKGIDVLGK  325

Query  765   LYSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGGSNKDSIFPASEW  589
             ++  V  Y        +C+D+     P   + GW WQ C+EM+MP+G  +KD++FP + +
Sbjct  326   IFKGVVAYKGN----RSCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPF  381

Query  588   DYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKN  409
             D N   + C+  F ++P+P+W+TT +GG +++ +L +FGSNIIF NGLRDP+S GGVL N
Sbjct  382   DLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGN  441

Query  408   ISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             IS S+VAI+   G+H +D+   +K DP+WL   R+ E++II++WI++Y + L + 
Sbjct  442   ISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLLEF  496



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   442 bits (1136),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 302/464 (65%), Gaps = 17/464 (4%)
 Frame = -1

Query  1644  ASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMG  1465
             A S+  +D+ K   T Y+ Q LDHF + P+SY  F  RY+IN +YWGGA + API  Y+G
Sbjct  46    AISSSISDDFK---TFYYNQSLDHFNYRPESYTCFPHRYIINFKYWGGANSSAPILAYLG  102

Query  1464  NEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQ  1285
              EG +E      GFM D A  F+ALLV+IEHR+YGKS+PFG  +EA  ++ TLGY SS Q
Sbjct  103   AEGPLEGDLNAIGFMTDNAVRFDALLVYIEHRYYGKSMPFGSREEALKNASTLGYFSSAQ  162

Query  1284  VLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFE  1105
              +ADYA +++ LK+   A DSPV+V GGSYGGMLAAWFRLKYPHV +GALASSAPILYFE
Sbjct  163   AIADYAAVLLHLKQKYHAKDSPVIVLGGSYGGMLAAWFRLKYPHVALGALASSAPILYFE  222

Query  1104  NITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISV  925
             +IT    +  + T+DFR  SE CY+ I+ SW  I+ IA +  GL  L K F  C    S 
Sbjct  223   DITPHNGYYSIATKDFREVSETCYETIRDSWSKIETIASKPNGLSILSKEFKTCSPLNSS  282

Query  924   GSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNI  745
               LE +L + Y   A  ++P         P YPV ++C  ID  + GS  ++K+ + V  
Sbjct  283   SQLEDYLWSMYAGAAQYNHP---------PRYPVTRICGGIDGASPGSGIISKVAAGV--  331

Query  744   YYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQY  565
              + Y G +  C+++   +D     GW WQ C+EM+MP+  SN D++FP   +D      Y
Sbjct  332   -FAYKGNL-PCYNIGPRNDTETDVGWRWQRCSEMVMPMSTSN-DTMFPPITFDLRSFIDY  388

Query  564   CKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAI  385
             C + + + PRP+W+TT +GG++I+ +L++FGSNIIF NGLRDP+S+GGVL+N+S SL+A+
Sbjct  389   CYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNLSDSLLAV  448

Query  384   TAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
                 G+H +D+  + + DP+WL + R KEV II+ WISQYY  L
Sbjct  449   HTLNGSHCLDILRANETDPQWLVEQREKEVSIIEGWISQYYADL  492



>ref|XP_007205162.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06361.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=461

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 276/395 (70%), Gaps = 4/395 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YF Q LDHF+F+      FQQRYLIN  +W G + + PIF Y GNEGDIEWF +NT
Sbjct  70    YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF++++AP F A+++F EHR+YG+S+P+G + EA  ++ TL +L++ Q LAD+A LI +L
Sbjct  128   GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+NL A   PVV+FGGSYGGMLAAW RLKYPH+ IGALASSAPIL FE+I  P  F D++
Sbjct  188   KRNLRAEGCPVVLFGGSYGGMLAAWMRLKYPHIAIGALASSAPILQFEDIVPPETFYDIV  247

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             +  FR ES +C+  IK SW  +    ++  GL +L K+F++C+   S   L  WL +AY+
Sbjct  248   SNSFRRESSSCFNTIKESWDTLVTEGKKQNGLRQLTKTFHLCRELNSTDDLANWLESAYS  307

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM +YP A  F+ P+P +P+K++C+ ID    G+  L +++  V+I+YNYTG+   CF
Sbjct  308   YLAMVNYPYAAEFVMPLPGHPIKEVCRKIDCCPDGTSTLERIFEGVSIFYNYTGQA-KCF  366

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +L   SD  G  GW+WQACTEM+MP+  S   S+F   +++ +   + C +   ++PRP 
Sbjct  367   ELEDESDV-GTDGWNWQACTEMVMPMSSSRDASMFQTYDYNLSSFQEECWKDHNVKPRPT  425

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
             WITTEFGGH+I+  LK FGSNIIF NGL DPWS G
Sbjct  426   WITTEFGGHDIKATLKSFGSNIIFSNGLLDPWSGG  460



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   441 bits (1134),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 297/460 (65%), Gaps = 13/460 (3%)
 Frame = -1

Query  1626  ADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIE  1447
             A + + + T Y+ Q LDHF + P+SY TFQ RY+++ ++W G   MAPIFVY+G E  + 
Sbjct  58    APSDQEFRTFYYNQTLDHFNYRPESYKTFQHRYVVSFKHWRGPDTMAPIFVYLGEESSLN  117

Query  1446  WFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYA  1267
                   G + D A  F AL V+IEHRFYG+S+PF   +EA   +   GY SS Q LADYA
Sbjct  118   DDLGYIGILSDNAARFGALQVYIEHRFYGESIPFVSREEALKDANLRGYFSSAQTLADYA  177

Query  1266  TLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPY  1087
              +I+ +KK  +A  SPV+VFGGSYGGMLAAWFRLKYPHV +GALASSAP+LYF+NIT   
Sbjct  178   EVILHIKKKHSADSSPVIVFGGSYGGMLAAWFRLKYPHVALGALASSAPVLYFDNITPSN  237

Query  1086  AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGW  907
              +  V+T+DF+  SE+CYK IK SW  I  +A ++ GL  L+K FN CK   +   L+ +
Sbjct  238   GYYTVVTKDFKESSESCYKTIKQSWFEIDKVAAKADGLSILQKKFNTCKPLEAATELKNF  297

Query  906   LSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTG  727
             L + ++  A  D P         P YPV  +CK ID    GSD L +++S +  Y+    
Sbjct  298   LDSLFSVAAQYDRP---------PRYPVDLVCKGIDSAPEGSDVLDRIFSGIVAYFG---  345

Query  726   EVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFK  547
                 C++L +      L GW+WQ C+E+++P+G  + D++FPA  +D  E  + CK AF 
Sbjct  346   -KKPCYNLDAFFSSETLEGWTWQTCSELVIPIGRGSNDTMFPAEPFDLKEYIEECKSAFG  404

Query  546   IEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGA  367
             + PRP+WITT +GGH+ + VL++FGSNIIF NGLRDP+S+GGVL+NIS S++A+   +GA
Sbjct  405   VPPRPHWITTYYGGHHFKEVLRRFGSNIIFSNGLRDPYSSGGVLENISDSILAVYTTKGA  464

Query  366   HHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
             H +D+  +T  DP W+   R  E+EII  WI +YY  L +
Sbjct  465   HCMDILPATIGDPDWVVLQRNIEIEIINGWILKYYQDLLE  504



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   438 bits (1127),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 208/462 (45%), Positives = 300/462 (65%), Gaps = 14/462 (3%)
 Frame = -1

Query  1626  ADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIE  1447
             +D  + + T ++TQ LDHF + P SY TFQQRY+IN ++WGG+ + APIFVY+G EG ++
Sbjct  4     SDQSQDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLD  63

Query  1446  WFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYA  1267
                   GF+ D AP F ALLV+IEHR+YGKSVPFG  +EA  ++ TLGY +S Q +ADYA
Sbjct  64    EDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYA  123

Query  1266  TLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPY  1087
              +++ +KK  +A  SP +V GGSYGGMLAAWFRLKYPH+ +GALASSAPILYF +     
Sbjct  124   GVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQV  183

Query  1086  AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGW  907
              +  ++T+DF+  SE+CY+ ++ SW  I+ +A    GL  L K+F  CK       L+ +
Sbjct  184   GYYTIVTKDFKETSESCYETVRKSWDEIRKVASRPNGLSMLSKTFRTCKPLKETSELKDF  243

Query  906   LSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTG  727
             L + YT  A  D P         P YP+  +C  ID    G D L K++  V  Y     
Sbjct  244   LDSLYTDVAQYDDP---------PTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGN--  292

Query  726   EVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAF  550
                +C+D+     P   + GW WQ C+EM+MP+G  +KD++FP + +D N   + C+  F
Sbjct  293   --RSCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTF  350

Query  549   KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEG  370
              ++P+P+W+TT +GG +++ +L +FGSNIIF NGLRDP+S GGVL NIS S+VAI+   G
Sbjct  351   GVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNG  410

Query  369   AHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             +H +D+   +K DP+WL   R+ E++II++WI++Y + L + 
Sbjct  411   SHCLDILPESKSDPQWLVMQRKSEIKIIEEWIAKYENDLLEF  452



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   439 bits (1128),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/454 (48%), Positives = 294/454 (65%), Gaps = 20/454 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++  Y+TQ LDHF + P+SY TFQQRY++N +YWGGA N +PIFVY G E D+   T + 
Sbjct  51    FEIHYYTQTLDHFNYKPESYDTFQQRYILNYKYWGGANNSSPIFVYTGEEDDV---TYDV  107

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
               + D+A  F  LL++IEHR+YG+S+PFG E +A  +S TLGY SS Q LADYA ++ D+
Sbjct  108   DAITDLAARFKGLLLYIEHRYYGESMPFGSEDQAFQNSSTLGYFSSEQALADYAQVVTDV  167

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KKNL+A + P +  G SYGGMLA+WFRLKYPH+ IGALASS+PILYF++IT    +  V+
Sbjct  168   KKNLSAENCPAIAVGASYGGMLASWFRLKYPHIVIGALASSSPILYFDDITPQNGYHVVV  227

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DF+  SE+CY  I  SW  I  +A E  GL  L   FN C+   S   L+  L+ +Y 
Sbjct  228   TKDFKETSESCYNTIIQSWPEIDRVAAEPNGLLTLSNKFNTCRTLNSSKELKDRLAISYI  287

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGE-VNNC  712
               A  D P         P YPV+ +C AID    G+D L ++ + +   + Y G+   N 
Sbjct  288   SAAQYDNP---------PYYPVQNICHAIDGAPEGTDILGRVAAGL---HRYPGQGCVNI  335

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             F    S+     SGW WQ CTE++MP+G  + +++F A  +D     + C   F + PRP
Sbjct  336   FSFELSNK----SGWDWQTCTEIVMPIGYGDNETMFQAEPFDLKNYTRDCVNCFGVVPRP  391

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +W+TTEFGGH+I+ VL  F SNIIF NGLRDPWS+GGVL++IS S+VAI  + GAH  DL
Sbjct  392   HWVTTEFGGHDIKTVLGNFASNIIFSNGLRDPWSSGGVLEDISDSVVAIHTEYGAHCADL  451

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLT  250
               S+ +DP WL + R KEV+II  WI++YY  L+
Sbjct  452   FPSSPDDPVWLVEQREKEVKIIAVWIAEYYAKLS  485



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   439 bits (1128),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 219/456 (48%), Positives = 302/456 (66%), Gaps = 18/456 (4%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             T Y+ Q+LDHF + P+SY TFQQRYLIN +YWGGA + APIF Y+G E  I+   +  GF
Sbjct  62    TFYYKQVLDHFNYRPESYKTFQQRYLINFKYWGGANSSAPIFAYLGAEEPIDGSPELIGF  121

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             + D A  FNAL+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S Q +ADYA+++I +KK
Sbjct  122   LTDNAASFNALIVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQAIADYASVLIHIKK  181

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
              L A  SPV+V GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF+NIT    +  V+++
Sbjct  182   TLHAQKSPVIVIGGSYGGMLASWFRLKYPHLAIGALASSAPILYFDNITPQDGYYSVVSR  241

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DFR  SE CY+ I  SW  I  +A +  GL  L + FN C+       L+ +L   Y  +
Sbjct  242   DFREASETCYQTILKSWSEIDRVASQPKGLSILSQRFNTCRPLNESSELKDYLINMYASS  301

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSA-VNIYYNYTGEVNNCFD  706
             A  ++P         P YPV  +C  ID  + GSD L+K+Y+  V +  N T +VN    
Sbjct  302   AQYNHP---------PRYPVTVICGGIDRASFGSDILSKIYAGLVALRGNTTCKVNGPII  352

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
             ++ ++      GW WQ C+EM++P+G  N +++F    +     A+ CK+ F + PRP+W
Sbjct  353   VSETT-----LGWRWQTCSEMVIPIGIGN-NTMFQPDPFSLKSYAKDCKKQFGVSPRPHW  406

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL--  352
             +TT +GGH+IE VL+KFGSNIIF NGLRDP+S+GGVLKNIS SLVAI    G+H +D+  
Sbjct  407   VTTYYGGHSIELVLQKFGSNIIFSNGLRDPYSSGGVLKNISDSLVAIHTVNGSHCLDILG  466

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
               +   DP+WL +  ++E+ +++ WI+QYY  L  L
Sbjct  467   ANANHSDPEWLVEQWKREIMVMKGWIAQYYDDLVAL  502



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   442 bits (1137),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 301/458 (66%), Gaps = 18/458 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T Y+ Q LDHF + P+SY TFQQRY++N +YWGGA   APIF Y+G E D+++     
Sbjct  179   FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANASAPIFAYLGAEADLDYDLSGI  238

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ D A  F ALLV+IEHR+YGKS+P+G  +EA  ++ TLGY +S Q +ADYA ++I +
Sbjct  239   GFLTDNAHQFKALLVYIEHRYYGKSIPYGSREEAFKNASTLGYFNSAQAIADYAEVLIYI  298

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK L A +SPV+V G SYGGMLA+WFRLKYPHV +GALASSAPILYF++IT    +  ++
Sbjct  299   KKKLLAENSPVIVVGASYGGMLASWFRLKYPHVALGALASSAPILYFDDITPHNGYFSIV  358

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE+CYK I  SW  I  +A E  GL  L K F IC    +   L+ +L   Y+
Sbjct  359   TKDFREASESCYKTISESWSEIDRVASEPNGLSILSKKFRICGQLNNSDELKEFLERTYS  418

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  D P         P YPV  +C  ID    GSD L+++++ V     + G + +C+
Sbjct  419   IAAQYDAP---------PSYPVTVVCGGIDGAPEGSDILSRIFAGV---VAFRGNM-SCY  465

Query  708   DLASSSD--PHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
               ++++D     + GW WQ C+E+++P+G    D++FP + ++    +Q C   + + PR
Sbjct  466   YTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPR  525

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITT +GGH+IE +L++F SNIIF NGLRDP+S GGVLKNIS S++AI    G+H +D
Sbjct  526   PHWITTYYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLD  585

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYY---HSLT  250
             L  +   DP+WL   R+ EVEII+ WI+QYY   H++T
Sbjct  586   LLPAASTDPEWLVMQRKAEVEIIEGWIAQYYVDLHAIT  623


 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -1

Query  660  QACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLK  481
            Q C E +MPL   + D++FP   ++     Q C   + + P P+W TT +GGHNIE +L 
Sbjct  2    QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  480  KFGSNIIFFNGLRDPWSAGG  421
            +F SNIIF NGLRDP++  G
Sbjct  62   RFASNIIFSNGLRDPYAVPG  81



>ref|XP_010031431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   437 bits (1124),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 226/472 (48%), Positives = 302/472 (64%), Gaps = 27/472 (6%)
 Frame = -1

Query  1647  SASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYM  1468
             SA SA   D+   ++T +F Q LDHF++TPQSY TF+QRY I+ RYWGGA + APIFVY+
Sbjct  42    SAVSASITDD---FETFFFDQTLDHFSYTPQSYATFKQRYFIDSRYWGGANSSAPIFVYL  98

Query  1467  GNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGE-KEAKSSSKTLGYLSS  1291
             G E  ++      GF+ D A  F ALLV+IEHR+YG+S+P G   +EA  ++   GY SS
Sbjct  99    GAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGMSFEEALENADIRGYFSS  158

Query  1290  TQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILY  1111
              Q LADY  +I+ +K+   A  SPV+V GGSYGGMLA+W RLKYPHV +GALASSAP+LY
Sbjct  159   AQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHVALGALASSAPVLY  218

Query  1110  FENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYI  931
             FE+IT   A+  V+ +DF+  SE C++ I  SW  I  +A+E  GL  L K FN C+   
Sbjct  219   FEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLSNLSKIFNTCRPLE  278

Query  930   SVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHG-SDPLAKLYSA  754
             S  +L+ +L   YT  A  D P         P YPV+ +CK ID  N   +D L K+ + 
Sbjct  279   SGATLKSFLKGLYTKAAQHDNP---------PTYPVRLICKGIDGANTTENDILGKISAG  329

Query  753   VNIYY-NYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNE  577
             V  YY N T  VN          P   SGWSWQ C+EM+MPLG +N +S+FP + +  ++
Sbjct  330   VVAYYWNSTCYVNPLL-------PVTPSGWSWQRCSEMVMPLGITN-NSMFPRAPFVLDD  381

Query  576   RAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKS  397
               + C+  + + PRP+W+TT +GGH+IE +L++FGSNIIF NGLRDPWS  GVLKNIS+S
Sbjct  382   FMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISES  441

Query  396   LVAITAKEGAHHVDLRFSTKE----DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             ++A+   +G+H VD+   +      DP WL   R+ EVEII+ WI QYY  L
Sbjct  442   IIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADL  493



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   437 bits (1123),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/474 (44%), Positives = 302/474 (64%), Gaps = 14/474 (3%)
 Frame = -1

Query  1662  RPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAP  1483
             R   +S+SS+   DNH    T Y+TQ LDHF + P SYHTFQQRY+I+ +YWGG K+ AP
Sbjct  39    REAQMSSSSSDLGDNHDHLKTFYYTQRLDHFNYRPDSYHTFQQRYIIDFKYWGGPKSSAP  98

Query  1482  IFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLG  1303
             IF + G EG ++      GF+ D AP F+AL+V+IEHR+YGKS+PFG  +EA  ++ T G
Sbjct  99    IFAFFGAEGPVDDDIHYVGFLRDNAPQFSALIVYIEHRYYGKSIPFGSREEAMRNASTRG  158

Query  1302  YLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSA  1123
             Y +S Q +ADYA +++ +KK L+  +SP++V GGSYGGMLA+WFRLKYPH+ +GALASSA
Sbjct  159   YFNSAQAIADYAAVLLHIKKTLSVQNSPIIVIGGSYGGMLASWFRLKYPHIALGALASSA  218

Query  1122  PILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNIC  943
             PILYF  I     +  ++T+DF+  SE CY+ I  SW  I  +AE+  GL  L K F  C
Sbjct  219   PILYFNGIAPKAGYYYIVTKDFKETSETCYQTISKSWSEIDRVAEKPNGLSILSKRFKTC  278

Query  942   KNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKL  763
             +       L+ +L + YT  A  ++P+           PVK +C AID     +D L ++
Sbjct  279   EKLSKSFELKDYLDSLYTDAAQYNFPSEN---------PVKVICSAIDAAAKKTDILGQI  329

Query  762   YSAVNIYYNYTGEVNNCFDLASSSDPHGLS-GWSWQACTEMIMPLGGSNKDSIFPASEWD  586
             +  V  +  +    ++C+D+   + P   + GW WQ C+EM+MP+G    DS+FP + ++
Sbjct  330   FEGVVAFMRH----HSCYDMNGYNHPTETNLGWRWQTCSEMVMPIGHERNDSMFPPAPFN  385

Query  585   YNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNI  406
                    C+  + + P+P+W+TT +GG +++ +L +F SNIIF NGLRDP+S+GGVL++I
Sbjct  386   MKRFVHECRSLYGVLPQPHWVTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGGVLESI  445

Query  405   SKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             S S+VA+T   G H +D++     DP+WL   R KEV+II+ WI++Y   L  L
Sbjct  446   SDSVVAVTTVNGCHCLDIQSRKTNDPEWLVRQRNKEVKIIKGWIAEYQADLIAL  499



>gb|KCW50722.1| hypothetical protein EUGRSUZ_J00400 [Eucalyptus grandis]
Length=535

 Score =   437 bits (1125),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/472 (48%), Positives = 302/472 (64%), Gaps = 27/472 (6%)
 Frame = -1

Query  1647  SASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYM  1468
             SA SA   D+   ++T +F Q LDHF++TPQSY TF+QRY I+ RYWGGA + APIFVY+
Sbjct  80    SAVSASITDD---FETFFFDQTLDHFSYTPQSYATFKQRYFIDSRYWGGANSSAPIFVYL  136

Query  1467  GNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGE-KEAKSSSKTLGYLSS  1291
             G E  ++      GF+ D A  F ALLV+IEHR+YG+S+P G   +EA  ++   GY SS
Sbjct  137   GAESSLDGAPTLIGFLRDNAAQFKALLVYIEHRYYGQSIPLGMSFEEALENADIRGYFSS  196

Query  1290  TQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILY  1111
              Q LADY  +I+ +K+   A  SPV+V GGSYGGMLA+W RLKYPHV +GALASSAP+LY
Sbjct  197   AQALADYVAVIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHVALGALASSAPVLY  256

Query  1110  FENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYI  931
             FE+IT   A+  V+ +DF+  SE C++ I  SW  I  +A+E  GL  L K FN C+   
Sbjct  257   FEDITPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLSNLSKIFNTCRPLE  316

Query  930   SVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHG-SDPLAKLYSA  754
             S  +L+ +L   YT  A  D P         P YPV+ +CK ID  N   +D L K+ + 
Sbjct  317   SGATLKSFLKGLYTKAAQHDNP---------PTYPVRLICKGIDGANTTENDILGKISAG  367

Query  753   VNIYY-NYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNE  577
             V  YY N T  VN          P   SGWSWQ C+EM+MPLG +N +S+FP + +  ++
Sbjct  368   VVAYYWNSTCYVNPLL-------PVTPSGWSWQRCSEMVMPLGITN-NSMFPRAPFVLDD  419

Query  576   RAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKS  397
               + C+  + + PRP+W+TT +GGH+IE +L++FGSNIIF NGLRDPWS  GVLKNIS+S
Sbjct  420   FMEQCRCQYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISES  479

Query  396   LVAITAKEGAHHVDLRFSTKE----DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             ++A+   +G+H VD+   +      DP WL   R+ EVEII+ WI QYY  L
Sbjct  480   IIAVITDQGSHCVDIYPESHNPQYPDPDWLVKQRKTEVEIIKGWIDQYYADL  531



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 297/459 (65%), Gaps = 15/459 (3%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ  1435
             K + T +++Q LDHF + P+SY TF QRY++N +YW GA   API V+ G E  ++    
Sbjct  56    KDFKTFFYSQTLDHFNYRPESYTTFPQRYVVNSKYWSGANTSAPILVFFGEETSLDNDLS  115

Query  1434  NTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLII  1255
             + GF+ D AP F ALLV+IEHRFYGKS+PFG  + A  ++   GY +S Q +ADYA +I+
Sbjct  116   DIGFLTDNAPRFKALLVYIEHRFYGKSIPFGSREAALRNASIRGYFTSAQAIADYAAIIL  175

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
              +KK   A +SPV+V GGSYGGMLAAWFRLKYPHV +GALASSAPILYF+++     +  
Sbjct  176   HIKKTFFAKNSPVIVIGGSYGGMLAAWFRLKYPHVALGALASSAPILYFDDLAPQVGYYA  235

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             ++T+DF+  SE+CY+ I+ SW  I  +A +S GL  L   F  CK       L+ +L + 
Sbjct  236   IVTKDFKETSESCYETIRESWDEIDKVASKSNGLSILSMKFKTCKKLKRTFDLKDYLDSI  295

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNN  715
             Y+  A  D+P         P YP+  +C  ID    G+D L ++++ V     Y G   +
Sbjct  296   YSEAAQYDHP---------PTYPLSIVCGGIDGAPKGTDILGRIFAGV---VAYVGN-KS  342

Query  714   CFDLASSSDPHGLS--GWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIE  541
             C+D+ + + P   +  GW WQ C+EM+MP+G  N DS+FP + ++ N   + CK  F ++
Sbjct  343   CYDMNAYNHPSDETYMGWRWQTCSEMVMPIGHGNNDSMFPPAPFNLNRFIRKCKSLFGVQ  402

Query  540   PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHH  361
             P+P+W+TT +GGH+++ +L +F SNIIF NGLRDP+S+GGVL+NIS S+VA+    G+H 
Sbjct  403   PQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRDPYSSGGVLENISDSVVAVHTIHGSHC  462

Query  360   VDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             +D+    K DP+WL   R+ EV+II+ W+++YY  L + 
Sbjct  463   LDILPEKKSDPQWLVKQRKTEVQIIEAWLAKYYTDLLEF  501



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   439 bits (1128),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 221/517 (43%), Positives = 322/517 (62%), Gaps = 24/517 (5%)
 Frame = -1

Query  1674  TIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAK  1495
             +++   + L   S   ++N   + T ++ Q LDHF + P+SY TFQ RY++N  YWGGA+
Sbjct  41    SVLEGSSSLRTVSVNLSEN---FQTFFYPQTLDHFNYRPESYTTFQHRYMVNFNYWGGAR  97

Query  1494  NMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSS  1315
             + A IFVY+G E D++    + GF+ +    F ALLV+IEHR+YGKS PFG  +++  ++
Sbjct  98    SAAXIFVYLGEESDLDKDINSIGFLVENGARFGALLVYIEHRYYGKSNPFGSMQKSLQNA  157

Query  1314  KTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGAL  1135
                GY +S Q LAD+A +II+LKKNL+A  SPV+V GGS GG+LAAWFRLKYPHV +GAL
Sbjct  158   GQRGYFNSGQALADFAEVIINLKKNLSADSSPVIVVGGSDGGLLAAWFRLKYPHVALGAL  217

Query  1134  ASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKS  955
             ASSAPILYF++IT    +  ++T+DFR  SE+CY  IK SW  I   A E+ GL  L K 
Sbjct  218   ASSAPILYFDDITPQDGYYSLVTKDFRDFSESCYNTIKDSWAEIDKAAAEANGLLNLSKK  277

Query  954   FNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDP  775
             F  CK   S   L+ +L T Y+  A  D P         P YPV  +C  ID    G+D 
Sbjct  278   FRTCKPLESASQLKDYLETMYSIAAQYDRP---------PMYPVTIVCNGIDGGLQGTDI  328

Query  774   LAKLYSAVNIYYNYTGEVNNCFDLASSSDPHGL-SGWSWQACTEMIMPLGGSNKDSIFPA  598
             L +++S +      +    +C+D+  SS P     GW+WQ C+E+++P+G  + D++FPA
Sbjct  329   LGRIFSGIVA----SRGNKSCYDMGQSSFPSETEEGWNWQVCSELVIPIGRGSNDTMFPA  384

Query  597   SEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  418
             + +D+ E    CK ++ + PRP+WIT+ +GGHNI+ +LK+FGSNIIF NGLRDP+S+GGV
Sbjct  385   APFDFKEYDDSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGV  444

Query  417   LKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDLI*  238
             L++IS S++A+    G+H +D+  S ++DP WL   R  E+EI+  W+ +YY  L   + 
Sbjct  445   LEDISHSIIAVHTPRGSHCLDILPSREDDPNWLVLQRNVEIEILHGWLLKYYEDLLQTLG  504

Query  237   NFDCLNFFFGGYVETHNNYSRCTQVEHCSYVISNNII  127
                 +      Y+ + N       + H   V+SNNI+
Sbjct  505   RCPLVRMAREIYILSQNE-----SINHS--VLSNNIL  534



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 291/454 (64%), Gaps = 18/454 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++   +TQ LDHF F P+SY TFQQRY++N +YWGGA   +PIFVY+G E D+   TQN 
Sbjct  52    FEVHNYTQSLDHFNFKPESYATFQQRYILNYKYWGGANTSSPIFVYLGAEIDV---TQNL  108

Query  1428  GF-MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIID  1252
                + D+A  F  LL++IEHR+YG S+PFG E EA  +S T GYLSS Q LADYA +I+D
Sbjct  109   DLSIVDLAARFKGLLLYIEHRYYGVSMPFGSEDEAFQNSSTFGYLSSEQALADYAQVIVD  168

Query  1251  LKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDV  1072
             +KK+L+A + P +  GGSYGGMLA+WFRLKYPH+ IG+LASSAPILYF++IT    +  +
Sbjct  169   VKKDLSAENCPAIAIGGSYGGMLASWFRLKYPHIVIGSLASSAPILYFDDITPQNGYHVI  228

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +++DFR  SE+CY  I+ SW  I  +A E+ GL  L   F  C    S   L+ +   AY
Sbjct  229   VSKDFRDTSESCYNTIQQSWAEIDRVASETNGLLNLSNIFTTCSPLNSSKDLKVYTEIAY  288

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
              + A  D P         P YPV ++C AID    G+D L ++ + VN     +   N+C
Sbjct  289   MWAAQLDNP---------PSYPVNKICSAIDGAPSGTDILGRVAAGVNA----SVFGNSC  335

Query  711   FDLASSS-DPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPR  535
                + S       S W WQ CTEM+ P+G    +++F +   D N   + C + F I+PR
Sbjct  336   HSASGSGLSRKSASAWEWQTCTEMVFPMGYGENETMFQSDPLDINNYTKECVDVFGIKPR  395

Query  534   PNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVD  355
             P+WITTEFGGH+I+ VL  F SNIIF NGLRDPWSAGGVL++IS S+VA+  ++G+H +D
Sbjct  396   PHWITTEFGGHDIKTVLGNFASNIIFSNGLRDPWSAGGVLEDISDSVVALYTEQGSHCLD  455

Query  354   LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
             L   T  DP WL  +R KE +II  W+++YY  L
Sbjct  456   LYPPTSSDPDWLLALRDKENKIIAYWLAEYYAKL  489



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   437 bits (1123),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 301/477 (63%), Gaps = 19/477 (4%)
 Frame = -1

Query  1671  IINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKN  1492
             I+  P+ LS  SA  +D+ + +   Y+ Q LDHF + PQSY TFQQRY++N +YWGGA N
Sbjct  77    IMEDPDLLS--SAAVSDDLQTF---YYPQTLDHFNYQPQSYATFQQRYVMNFKYWGGANN  131

Query  1491  MAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSK  1312
              API  Y+G E  ++      GF+ D A  F ALLV+IEHR+YGKS+PFG  +EA  ++ 
Sbjct  132   NAPILAYLGAEAPLDGSPTAIGFLNDNAVSFTALLVYIEHRYYGKSIPFGSREEAFKNAS  191

Query  1311  TLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALA  1132
             TLGY +S Q +ADYA +I+ +K  L A  SPV+V GGSYGGMLA+W RLKYPHV +GALA
Sbjct  192   TLGYFNSAQAIADYAEIIMHIKNKLRAFYSPVIVVGGSYGGMLASWLRLKYPHVALGALA  251

Query  1131  SSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSF  952
             SSAPILYF+ IT   A+  V+T+DFR  SE+CY+ I+ SW +I  IA +  GL  L   F
Sbjct  252   SSAPILYFDKITPRGAYFSVVTKDFREASESCYQTIRNSWSVIDKIASQPNGLSSLSMIF  311

Query  951   NICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPL  772
               CK       L+  L   Y   A  D P         P YPV  +C+ ID  N   D L
Sbjct  312   KTCKPLNKSSELKNALENMYASAAQYDSP---------PRYPVTVVCRGIDGANEKQDIL  362

Query  771   AKLYSAVNIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASE  592
             +K+++ V  Y        +C+    +++     GW WQ C+EM++P+G  N+ ++F    
Sbjct  363   SKIFAGVVAYRGN----RSCYINPPTNESETTVGWRWQTCSEMVIPIGIGNR-TMFQPEP  417

Query  591   WDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLK  412
             +D N   Q CK  F + PRP+W+T+ +GGH+I+ +L++FGSNIIF NGLRDP+S GGVL+
Sbjct  418   FDLNSFIQQCKTIFGVPPRPHWVTSYYGGHDIKLILQRFGSNIIFSNGLRDPYSRGGVLE  477

Query  411   NISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDLI  241
             NIS+S++A+    G+H +D+      DP+WL   R+ EVEI++ WI+QYY  L  ++
Sbjct  478   NISESILAVKTVNGSHCLDILAQNASDPEWLVKQRQTEVEIMKGWIAQYYADLKAIL  534



>ref|XP_010245641.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=435

 Score =   433 bits (1113),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 198/371 (53%), Positives = 266/371 (72%), Gaps = 3/371 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y GNEGDIEWF  NT
Sbjct  64    YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP FNA++VF EHR+YGKS+PFG    A  ++ +L YL++ Q LAD+A LI DL
Sbjct  122   GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N++A   PVV+FGGSYGGMLAAW R+KYPH+ IGALASSAPIL FENI  P  F D++
Sbjct  182   KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAPILQFENIVPPETFYDIV  241

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW  I+   +   GL RL + F++C+N  S   LE WL +AY+
Sbjct  242   SNDFRRESVSCFNTIKKSWDAIEAEGQTEEGLLRLTEEFHLCRNLRSTQDLEDWLESAYS  301

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P  P+K++C+ ID    G+  L ++++ V++YYNYTG V +CF
Sbjct  302   YLAMVDYPYPSDFMMPLPGNPIKEVCRKIDSFPDGTSTLERIFAGVSVYYNYTGVV-DCF  360

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL  S+   G  GW WQACTEM+MP+  S   S+F A +++Y+     C + F I+PR  
Sbjct  361   DLGESNQDLGADGWDWQACTEMVMPMSSSQSTSMFTAYDFNYSSYQDECFKHFGIKPRSR  420

Query  528   WITTEFGGHNI  496
             WITTEFGGH +
Sbjct  421   WITTEFGGHEL  431



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   435 bits (1118),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 294/452 (65%), Gaps = 14/452 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T Y+ Q LDHF + P+SY  F  RY+IN +YWGGA + API  Y+G EG +E      
Sbjct  55    FKTFYYNQTLDHFNYRPESYTCFPHRYIINFKYWGGANSSAPILAYLGAEGPLEGDLNAI  114

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM D A  F+ALLV+IEHR+YGKS+PFG  +EA  ++ TLGY SS Q +ADYA ++I L
Sbjct  115   GFMTDNAARFDALLVYIEHRYYGKSMPFGSREEALKNASTLGYFSSAQAIADYAAVLIHL  174

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+   A DSPV+V GGSYGGMLAAWFRLKYPHV +GALASSAPILYFE+IT    +  + 
Sbjct  175   KQKYHAKDSPVIVLGGSYGGMLAAWFRLKYPHVALGALASSAPILYFEDITPHNGYYSIA  234

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE CY+ I+ SW  I+ I  +  GL  L K F  C    S   LE +L + Y 
Sbjct  235   TKDFREVSETCYETIRDSWSKIEIIGSKPNGLSILSKEFKTCSPLNSSSQLEDYLWSMYA  294

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  ++P         P YPV ++C  ID  + GS  ++K+ + V   + Y G + +C+
Sbjct  295   GAAQYNHP---------PRYPVTRICGGIDGASPGSGIISKVAAGV---FAYKGNL-SCY  341

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             ++   S+     GW WQ C+EM+MPL  +N D++FP   +D      YC + + +  RP+
Sbjct  342   NIGPRSETETDVGWRWQRCSEMVMPLSTTN-DTMFPPITFDLKSFVDYCYQLYGVSSRPH  400

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             W+TT +GG++I+ +L++FGSNIIF NGLRDP+S+GGVL+N+S SL+A+   +G+H +D+ 
Sbjct  401   WVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNLSDSLLAVHTPKGSHCLDIL  460

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              + + DP+WL   R  EV II+ WIS+YY  L
Sbjct  461   RANETDPQWLVKQRETEVRIIEGWISKYYADL  492



>ref|XP_010245642.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Nelumbo 
nucifera]
Length=431

 Score =   432 bits (1111),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 265/369 (72%), Gaps = 3/369 (1%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y GNEGDIEWF  NT
Sbjct  64    YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+++IAP FNA++VF EHR+YGKS+PFG    A  ++ +L YL++ Q LAD+A LI DL
Sbjct  122   GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             K+N++A   PVV+FGGSYGGMLAAW R+KYPH+ IGALASSAPIL FENI  P  F D++
Sbjct  182   KRNMSAEACPVVLFGGSYGGMLAAWMRIKYPHIAIGALASSAPILQFENIVPPETFYDIV  241

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             + DFR ES +C+  IK SW  I+   +   GL RL + F++C+N  S   LE WL +AY+
Sbjct  242   SNDFRRESVSCFNTIKKSWDAIEAEGQTEEGLLRLTEEFHLCRNLRSTQDLEDWLESAYS  301

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
             Y AM DYP  ++F+ P+P  P+K++C+ ID    G+  L ++++ V++YYNYTG V +CF
Sbjct  302   YLAMVDYPYPSDFMMPLPGNPIKEVCRKIDSFPDGTSTLERIFAGVSVYYNYTGVV-DCF  360

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             DL  S+   G  GW WQACTEM+MP+  S   S+F A +++Y+     C + F I+PR  
Sbjct  361   DLGESNQDLGADGWDWQACTEMVMPMSSSQSTSMFTAYDFNYSSYQDECFKHFGIKPRSR  420

Query  528   WITTEFGGH  502
             WITTEFGGH
Sbjct  421   WITTEFGGH  429



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   436 bits (1120),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 290/453 (64%), Gaps = 15/453 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T Y+ Q LDHF + P S+ TFQQRYLIN +YWG +   API  Y+G E  I+      
Sbjct  62    FETFYYKQTLDHFNYRPDSFSTFQQRYLINSKYWGSSNVSAPILAYLGAEEPIDDDLSVI  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ + A    AL +FIEHR+YGKS+PFG  +EA  ++ TLGY +S Q +ADYA ++I +
Sbjct  122   GFLSENANQLQALQIFIEHRYYGKSIPFGSREEAFQNASTLGYFNSAQAIADYAEILIHV  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP-YAFSDV  1072
             KK L A  SPV+V GGSYGGMLA+WFRLKYPHV +GALASSAPILYF+NI  P   +  +
Sbjct  182   KKQLRAEHSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSI  241

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
              T+DFR  SE CY+ IK SW  I +IA +  GL  L + F  C   +    LE +L   Y
Sbjct  242   ATKDFREVSETCYQTIKKSWSEIDEIASQPEGLSVLSRKFQTCSQLLKSSVLEDYLMLMY  301

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             T  A  + P         P YPV  +C  ID  +HG+D L+K+++ V  Y        +C
Sbjct  302   TGAAQYNRP---------PRYPVTVVCGGIDGASHGNDTLSKIFAGVVAYRGN----ESC  348

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             +     +      GW WQ C++M+MP+G SN DS+FPA+++D  E  + CK  + + PRP
Sbjct  349   YVNPPKNKSETDVGWRWQTCSDMVMPIGISN-DSMFPANQFDLKEYVESCKAQYGVPPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +W TT FGGH+I+ VL +F SNIIF NGLRDP+S+GGVL+NIS ++VA+  K G+H +D+
Sbjct  408   HWATTYFGGHDIKLVLSRFASNIIFSNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDI  467

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
               +   DP WL + R+ EV+II+ W+S YY  L
Sbjct  468   VGANTTDPDWLVNQRKVEVKIIKGWLSNYYAEL  500



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   435 bits (1119),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 292/453 (64%), Gaps = 15/453 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             ++T Y+ Q LDHF F P S+ TFQQRYLIN +YWGG+   API  Y+G E  ++    + 
Sbjct  62    FETFYYKQTLDHFNFRPDSFSTFQQRYLINSKYWGGSNVSAPILAYLGAEDAVDNSLSSI  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF+ + A    AL +FIEHR+YGKS+PF   +EA  ++ TLGY +S Q +ADYA ++I +
Sbjct  122   GFLSENANQLQALQIFIEHRYYGKSIPFRSREEAFQNASTLGYFNSAQAIADYAEILIHV  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP-YAFSDV  1072
             KK L A  SPV+V GGSYGGMLA+WFRLKYPHV +GALASSAPILYF+NI  P   +  +
Sbjct  182   KKQLHAEHSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDNIIPPEKGYYSI  241

Query  1071  ITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAY  892
             +T+DFR  SE CY+ IK SW  I +IA +  GL  L + F  C   ++   LE +L   Y
Sbjct  242   VTKDFREVSETCYQTIKKSWSEIDEIASQPEGLSILSRKFQTCSQLLTSSVLENYLMLMY  301

Query  891   TYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
             T  A  + P         P YPV  +C  ID  +HG+D L+K+++ V  Y        +C
Sbjct  302   TGAAQYNRP---------PRYPVTVVCGGIDGASHGNDTLSKIFAGVVAYRGN----KSC  348

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             +     +      GW WQ C++M++P+G SN DS+FPA+E+D N+  + CK  + + PRP
Sbjct  349   YVNEPKNKSETDVGWGWQTCSDMVIPIGISN-DSMFPANEFDLNDYIETCKAQYGVPPRP  407

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
             +W TT FGGH+I+  L  F SNIIF NGLRDP+S+GGVL+NIS ++VA+  K G+H +D+
Sbjct  408   HWATTYFGGHDIKLALSGFASNIIFSNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDI  467

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
               +   DP WL + R+ EV+II+ W+ +YY  L
Sbjct  468   VGANTTDPDWLVNQRKVEVKIIKGWLDKYYAEL  500



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 305/480 (64%), Gaps = 21/480 (4%)
 Frame = -1

Query  1680  FSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGG  1501
                I+   N LS SS    +    ++T ++TQ LDHF + P+SY TF+QRY+IN +YWGG
Sbjct  39    LKNILKDSNTLSNSSTNLPNE---FETYFYTQTLDHFNYGPKSYSTFKQRYIINSKYWGG  95

Query  1500  AKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKS  1321
             + + +PIF Y+G E  I+    N GF+ D AP F ALLV++EHR+YG+S+P G  +EA  
Sbjct  96    SNSSSPIFAYLGAESSIDNDPLNIGFLTDFAPRFKALLVYMEHRYYGQSIPLGKIEEALK  155

Query  1320  SSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIG  1141
                T GY +S Q +ADYA L++ +K+  +A +SP++V GGSYGGMLA+WFRLKYPH+ IG
Sbjct  156   DQDTRGYFNSAQAIADYAELLLHVKEQFSAPNSPIIVIGGSYGGMLASWFRLKYPHIAIG  215

Query  1140  ALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLR  961
             ALASSAPILYF++IT    +  ++T+DFR  SE+CY+ I+ SW +I  IA    GL  L 
Sbjct  216   ALASSAPILYFDDITPQNGYYSIVTKDFREASESCYQTIRDSWSIIDKIASTKDGLSYLS  275

Query  960   KSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGS  781
             + F  C    +   L+G+L + Y   A  D P         P YPV  +C  ID   +GS
Sbjct  276   QKFKTCSPLNNSSDLKGYLDSTYAVAAQYDDP---------PRYPVTLICGGIDGATNGS  326

Query  780   DPLAKLYSAVNIYYNYTGEVN-NCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIF  604
             D L ++++ +  Y     E N +C+++          GW WQ C+EM+MP+G    D++F
Sbjct  327   DVLDRIFAGIVAY-----EGNKSCYNILPGQPDL---GWDWQTCSEMVMPIGRGENDTMF  378

Query  603   PASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  424
              +S ++ ++  + CK  + + PRP+W+TT +GGH+I+ +L +F SNIIF NGLRDP+S+ 
Sbjct  379   YSSPFNLDQFIEDCKSDYGVSPRPHWVTTYYGGHDIKLILHRFASNIIFSNGLRDPYSSA  438

Query  423   GVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             GVL+++S SL+A+T + G+H +D+  S   DP+WL   R +EVEII+ WI+ Y   L  L
Sbjct  439   GVLQDLSDSLLAVTTRNGSHCLDILTSQPNDPEWLTLQRNREVEIIEGWITTYCADLKVL  498



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 289/452 (64%), Gaps = 14/452 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T ++ Q LDHF + P+SY+TFQQRY++N +YWGGA   APIF Y+G E  +++     
Sbjct  62    FQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYLGAEAALDFDLTGV  121

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF  D A  F ALLV+IEHR+YG+S+PFG  +EA  ++ T GY +S Q +ADYA ++  +
Sbjct  122   GFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSAQAIADYAEVLEYI  181

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK L A +SPV+V GGSYGGMLA+WFRLKYPHV +GALASSAPILYF++IT    +  ++
Sbjct  182   KKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDITPQNGYYSIV  241

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE+CY  I+ SW  I  +A E  GL  L K F  C        L+ +L T Y 
Sbjct  242   TKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNKSNELKDYLETMYA  301

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  ++P         P YPV  +C  ID    GSD L+++++ V  Y   +   N   
Sbjct  302   VAAQYNHP---------PRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCYNTSV  352

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +   +S+     GW WQ C+EM+MP+G  + D++FP S ++     Q C   + + PRP+
Sbjct  353   NPTETSE-----GWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPH  407

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITT +GGH+I+ +L +F SNIIF NGLRDP+S+ GVLKNIS +++AI    G+H +D+ 
Sbjct  408   WITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDIL  467

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +   DP+WL   R+ EVEII+ WI+QY+  L
Sbjct  468   PAKSTDPEWLIMQRKTEVEIIESWIAQYHADL  499



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 289/452 (64%), Gaps = 14/452 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T ++ Q LDHF + P+SY+TFQQRY++N +YWGGA   APIF Y+G E  +++     
Sbjct  54    FQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYLGAEAALDFDLTGV  113

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GF  D A  F ALLV+IEHR+YG+S+PFG  +EA  ++ T GY +S Q +ADYA ++  +
Sbjct  114   GFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSAQAIADYAEVLEYI  173

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK L A +SPV+V GGSYGGMLA+WFRLKYPHV +GALASSAPILYF++IT    +  ++
Sbjct  174   KKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDITPQNGYYSIV  233

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  SE+CY  I+ SW  I  +A E  GL  L K F  C        L+ +L T Y 
Sbjct  234   TKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNKSNELKDYLETMYA  293

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  ++P         P YPV  +C  ID    GSD L+++++ V  Y   +   N   
Sbjct  294   VAAQYNHP---------PRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCYNTSV  344

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
             +   +S+     GW WQ C+EM+MP+G  + D++FP S ++     Q C   + + PRP+
Sbjct  345   NPTETSE-----GWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPH  399

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             WITT +GGH+I+ +L +F SNIIF NGLRDP+S+ GVLKNIS +++AI    G+H +D+ 
Sbjct  400   WITTYYGGHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDIL  459

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +   DP+WL   R+ EVEII+ WI+QY+  L
Sbjct  460   PAKSTDPEWLIMQRKTEVEIIESWIAQYHADL  491



>gb|EMS59622.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=420

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/440 (49%), Positives = 278/440 (63%), Gaps = 65/440 (15%)
 Frame = -1

Query  1578  DHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHF  1399
             DHF   P SY TF QRYL+N  YWGG    AP+FVY GNEG+IE FT NTGFM+++AP F
Sbjct  38    DHFNAAPASYRTFPQRYLVNGTYWGG--KTAPVFVYAGNEGNIELFTNNTGFMWELAPRF  95

Query  1398  NALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSP  1219
              A+LVFIEHR+YG+SVPFG E+ A  ++ T G                    NL+A  +P
Sbjct  96    RAMLVFIEHRYYGRSVPFGSEEAAFRNTSTAG-------------------ANLSAPLAP  136

Query  1218  VVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDFRSESEN  1039
             VVVFGGSYGGMLAAW R+KYPHV IGA+ASSAPIL F  +  PYAF D+I+ DF+SES+N
Sbjct  137   VVVFGGSYGGMLAAWMRMKYPHVVIGAVASSAPILSFYGMADPYAFYDIISNDFKSESKN  196

Query  1038  CYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTA  859
             C+ V+  SW+ +        G  +L  +F +C+   +V ++   L TA  Y+AMTDYPT 
Sbjct  197   CHDVLMNSWKELDKALSNDAGRAQLNSTFKMCRGS-TVEAIPDLLDTAIVYSAMTDYPTE  255

Query  858   TNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHG  679
             + FL P+P YPVK+MC+AID+P  G D  +++  A+ +YYNYTG   +C   A+  DP+G
Sbjct  256   SGFLTPLPAYPVKEMCRAIDNPKSGKDTFSRIKDALGVYYNYTGNA-HCLGDATEHDPYG  314

Query  678   L-SGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNWITTEFGGH  502
             +  GW +QACTEMI+   G                                         
Sbjct  315   MFDGWDFQACTEMILMSYG-----------------------------------------  333

Query  501   NIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRFSTKEDPKW  322
             +I  VLK+  SNIIFFNGLRDPWS+GGVLK+IS+S+VA+   +G+HHVDLRFS+K+DP W
Sbjct  334   DIANVLKRSASNIIFFNGLRDPWSSGGVLKDISRSIVALVEPKGSHHVDLRFSSKDDPDW  393

Query  321   LKDVRRKEVEIIQKWISQYY  262
             LK VR KE  II  W++QYY
Sbjct  394   LKQVREKETRIIGHWLNQYY  413



>ref|XP_007203816.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
 gb|EMJ05015.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
Length=318

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 243/291 (84%), Gaps = 10/291 (3%)
 Frame = -1

Query  1686  FPFSTIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYW  1507
             FP S I   P  +SAS+      +KLY TKYFTQILDHF F P+SY TFQQRYLI+D +W
Sbjct  37    FPSSLIT--PEKVSASA-----QNKLYRTKYFTQILDHFNFYPKSYQTFQQRYLISDTFW  89

Query  1506  GGAKNMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKE-  1330
             GGAKN APIFVY GNEG+IEWF QN GF+++ APHF AL+VFIEHRFYGKS+P+GG+K  
Sbjct  90    GGAKNNAPIFVYTGNEGNIEWFAQNVGFLYETAPHFKALVVFIEHRFYGKSIPYGGKKSV  149

Query  1329  AKSSSKTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHV  1150
             A S++ TLG+LSSTQ LADYA+LI DLKKNL+ATDSPVVVFGGSYGGMLAAWFRLKYPHV
Sbjct  150   AYSNATTLGHLSSTQALADYASLITDLKKNLSATDSPVVVFGGSYGGMLAAWFRLKYPHV  209

Query  1149  TIGALASSAPILYFENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLE  970
             TIGALASSAP+L FENITSPY+F +++TQDF+S SENCYKVIKGSW  I++ A + GGLE
Sbjct  210   TIGALASSAPLLNFENITSPYSFRNIVTQDFKSVSENCYKVIKGSWDQIENTANQPGGLE  269

Query  969   RLRKSFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQ  817
              LRKSF +CKN  SV  LE WLSTAY YTAMTDYPT +NFL+P+P +PVK+
Sbjct  270   LLRKSFKLCKN--SVEYLEDWLSTAYAYTAMTDYPTPSNFLSPLPAFPVKK  318



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   433 bits (1114),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/454 (45%), Positives = 295/454 (65%), Gaps = 14/454 (3%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGF  1423
             T Y+TQ LDHF + P SYHTFQQRY++N +YWGGAK+ APIF + G EG ++   +  GF
Sbjct  57    TFYYTQRLDHFNYRPDSYHTFQQRYMVNFKYWGGAKSSAPIFAFFGAEGPVDEDAKYIGF  116

Query  1422  MFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKK  1243
             + D AP FNAL+VFIEHR+YGKS+PFG  +EA  ++ T GY +S Q +ADYA +++ +KK
Sbjct  117   LRDNAPQFNALIVFIEHRYYGKSIPFGSSEEAMRNASTRGYFNSAQAIADYAAVLLHIKK  176

Query  1242  NLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQ  1063
              L+A +SP++V GGSYGGMLA+WFRLKYPH+ +GALASSAPILYF  I     +  ++T+
Sbjct  177   TLSAQNSPIIVIGGSYGGMLASWFRLKYPHIALGALASSAPILYFNGIAPQAGYYYIVTK  236

Query  1062  DFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYT  883
             DF+  SE+CY+ I+ SW  I  +A++  GL  L K F  C        L+ +L + YT  
Sbjct  237   DFKETSESCYQTIRKSWSEIDRVAKKPNGLSILSKRFKTCDKLNKSFDLKDYLDSLYTDA  296

Query  882   AMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFDL  703
             A  +YP+          +PVK +C AID     +D L +++  V  Y  +     +C+D+
Sbjct  297   AQYNYPSE---------HPVKIVCGAIDAAAKKTDILGQIFEGVVAYKQH----RSCYDM  343

Query  702   ASSSDP-HGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
                + P     GW WQ C+E+IMP+G    DS+FP + ++     Q C+  + + P+P+W
Sbjct  344   NEYNHPTESFLGWRWQTCSEIIMPIGHEKNDSMFPPAPFNMKTFVQECRSLYGVLPQPHW  403

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             +TT +GG +++ +L +F SNIIF NGLRDP+S+GGVL++IS ++VA+T   G H +D++ 
Sbjct  404   VTTYYGGPDLKLILHRFASNIIFSNGLRDPYSSGGVLESISNTVVAVTTVNGCHCLDIQS  463

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
                 DP+WL   R  EV+II+ WI++Y   L  L
Sbjct  464   RKANDPQWLVTQRNTEVKIIKGWIAEYKADLIAL  497



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score =   432 bits (1111),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 302/470 (64%), Gaps = 25/470 (5%)
 Frame = -1

Query  1644  ASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMG  1465
             A SA   D+   ++T +F Q LDHF++ PQSY TF+QRY IN  YWGGAK+ APIFVY+G
Sbjct  43    AVSASTTDD---FETFFFDQTLDHFSYRPQSYATFKQRYFINSSYWGGAKSSAPIFVYLG  99

Query  1464  NEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGE-KEAKSSSKTLGYLSST  1288
              E +++    + GF+ D A  F ALLV+IEHR+YG+S+P G   +EA  ++   GY SS 
Sbjct  100   AESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGMSFEEALENADIRGYFSSA  159

Query  1287  QVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYF  1108
             Q LADY  +I+ +K+   A  SPV+V GGSYGGMLA+W RLKYPHV +GALASSAP+LYF
Sbjct  160   QALADYVAIIMHVKRERNAIKSPVIVVGGSYGGMLASWLRLKYPHVALGALASSAPVLYF  219

Query  1107  ENITSPYAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYIS  928
             E++T   A+  V+ +DF+  SE C++ I  SW  I  +A+E  GL  L + FN C+   S
Sbjct  220   EDMTPQDAYYSVVAKDFKETSETCHQAIANSWSEIDRVAKELDGLSNLSQIFNTCRPLES  279

Query  927   VGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDP-LAKLYSAV  751
               +L+ +L   YT  A  D P         P YPV ++C+ ID  N   +  L K+ + V
Sbjct  280   GATLKSFLKDMYTTAAQQDNP---------PTYPVTRICEGIDGANTTENGILGKISAGV  330

Query  750   NIYYNYTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERA  571
               YY      N C +   +  P    GWSWQ C+EM+MPLG + ++S+FP + +  ++  
Sbjct  331   VAYY---WNSNCCLNTPLTVSP---DGWSWQKCSEMVMPLGIT-RNSMFPPAPFLLDDFM  383

Query  570   QYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLV  391
             ++C+  + + PRP+W+TT +GGH+IE +L++FGSNIIF NGLRDPWS  GVLKNIS+S++
Sbjct  384   EHCRCEYGVVPRPHWVTTHYGGHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISESII  443

Query  390   AITAKEGAHHVDLRFSTKE----DPKWLKDVRRKEVEIIQKWISQYYHSL  253
             A+   +G+H VD+   + +    DP WL   R+ EVEII+ WI QYY  L
Sbjct  444   AVITDQGSHCVDIYPESHDTQCPDPDWLVKQRKTEVEIIKGWIDQYYADL  493



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score =   432 bits (1111),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 218/447 (49%), Positives = 287/447 (64%), Gaps = 18/447 (4%)
 Frame = -1

Query  1602  TKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ-NTG  1426
             T Y+TQ LDHF + P+SY TFQQRY++N +YWGG    +PIFVY G E +I        G
Sbjct  44    TLYYTQTLDHFNYKPESYETFQQRYILNSKYWGGPNTSSPIFVYAGAECNITLVIPPGGG  103

Query  1425  FMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLK  1246
             FM  +A  FNALL++IEHRFYG+S PFG    +  ++ TLGYLSS Q LADYA LI+D+K
Sbjct  104   FMAHLASRFNALLLYIEHRFYGESNPFG--PSSLQNATTLGYLSSAQALADYAQLILDVK  161

Query  1245  KNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVIT  1066
             KNL+A  SPV+V GGSYGGMLA+WFRLKYPH+ IGALASSAPILYF++IT    F  V +
Sbjct  162   KNLSAESSPVIVVGGSYGGMLASWFRLKYPHIVIGALASSAPILYFDDITPQDGFFVVAS  221

Query  1065  QDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTY  886
             +DF+  SE+CY  IK SW  I  +A +  GLE LR  F++C    SVG L+  L   Y Y
Sbjct  222   KDFKDTSESCYNTIKQSWSEIDKVAAQQNGLETLRSIFSLCDRLHSVGMLKFILRRVYLY  281

Query  885   TAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCFD  706
             +A  D P         P + V+++C AI+    G+D L ++ + +N        + +C  
Sbjct  282   SAQYDNP---------PYFYVEKVCGAINGAPEGTDTLGRIAAGLN------ASIFSCHS  326

Query  705   LASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
               +         W WQ CTE++MP+G  N +++F A  +D N     C+  F I PRP+W
Sbjct  327   NPTWKSIVDEDLWLWQVCTELVMPIGLDNNNTMFEALPFDMNRHVNMCQSIFGISPRPHW  386

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             ITTE+GGH+I+ VL  F SNIIF NGLRDP+S GGVL++IS S+VAI  ++GAH +DL  
Sbjct  387   ITTEYGGHDIKSVLGNFASNIIFSNGLRDPFSVGGVLEDISDSVVAIKTEKGAHCLDLYT  446

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQY  265
             +T  D  WL   R +E+ II  WI +Y
Sbjct  447   ATPNDSDWLVAQREEEINIIAHWIDEY  473



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 288/454 (63%), Gaps = 18/454 (4%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             Y+  Y+TQ LDHF + PQSY TFQQRY++N +YWGGA   +PIFVY G E D+   T + 
Sbjct  53    YEIHYYTQTLDHFNYNPQSYATFQQRYILNFKYWGGANTSSPIFVYTGEEVDV---TYDV  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
               +  +A  F ALL++IEHR+YG+S+PFG E +A  +S TLGYLSS Q LADYA ++ D+
Sbjct  110   DTILHLAARFKALLLYIEHRYYGESMPFGSEDQAFQNSSTLGYLSSEQALADYAQVVTDV  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK L+A + P +  G SYGGMLAAWFRLKYPH+ IG+LASS+PILYF++IT    +  V+
Sbjct  170   KKKLSAENCPAIAVGASYGGMLAAWFRLKYPHIVIGSLASSSPILYFDDITPQNGYHVVV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+D+R  SE+CY  IK SW  I  +A +  GL  L   FN C    S   L  +L   Y 
Sbjct  230   TKDYRDTSESCYNTIKQSWSEIDRVAAQPNGLLTLSNMFNTCSPLNSSTELREYLEILYV  289

Query  888   YTAMTDYPTATNFLNPMPPY-PVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNC  712
               A  D           PPY PV+  C+ ID    G+D L ++ + +    +     ++C
Sbjct  290   SAAQYD----------NPPYNPVQNTCRGIDGAPPGTDILGRIVAGLK---SRIPSWSSC  336

Query  711   FDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRP  532
             +D+  + D    S W WQ CTEM+ P+G    +++F  S +D N   + C + F I+PRP
Sbjct  337   YDVP-TWDLSNKSAWDWQTCTEMVFPIGYGYNETMFQPSPFDINNYTEACVQVFGIKPRP  395

Query  531   NWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDL  352
              W TTEFGGH+I+ VL  F SNIIF NGLRDPWSAGGVL++IS ++VA+  + GAH +DL
Sbjct  396   QWATTEFGGHDIKTVLGNFASNIIFANGLRDPWSAGGVLEDISDTVVAVYTEYGAHCLDL  455

Query  351   RFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLT  250
                T  DP WL + R KE++II  WI++YY  L+
Sbjct  456   YPPTPNDPDWLVEQRDKEIKIIAAWIAEYYAKLS  489



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   431 bits (1108),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/451 (49%), Positives = 297/451 (66%), Gaps = 17/451 (4%)
 Frame = -1

Query  1596  YFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNTGFMF  1417
             Y+TQ LDHF + P+SY TFQQ+Y+++ +YWGGA   APIF Y+G E  +   +  TG + 
Sbjct  61    YYTQTLDHFNYRPESYRTFQQKYVVSFKYWGGANASAPIFAYLGYEAPLYDQSPATGLIL  120

Query  1416  DIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDLKKNL  1237
             D AP F+AL++ IEHRFYG+S+PF    EA  +S TLGY +S Q LADYA +I+DLKKNL
Sbjct  121   DNAPRFHALVIHIEHRFYGESIPFESRDEALRNSSTLGYFNSAQALADYAEIILDLKKNL  180

Query  1236  TATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVITQDF  1057
             +A  SPV+  GGSYGGMLAAWFRLKYPHVT+GALASSAPILYF++IT    +  ++++ F
Sbjct  181   SAETSPVIAVGGSYGGMLAAWFRLKYPHVTVGALASSAPILYFDDITPENGYYSIVSKGF  240

Query  1056  RSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYTYTAM  877
             R  SE+CYK IK SW  I ++A +S GL  L + F  C        L+G+L   YT  A 
Sbjct  241   RESSESCYKTIKQSWSEIDELASQSNGLSLLSQKFQTCSALNKSSELKGYLEYVYTDAAQ  300

Query  876   TDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVN-NCFDLA  700
              + P         P YPV ++C AID  + G+D L+++++ V         VN +C+D  
Sbjct  301   YNAP---------PEYPVDRICSAIDGASEGTDILSRIFAGV-----VASRVNSSCYDTN  346

Query  699   SSSDP-HGLSGWSWQACTEMIMPLG-GSNKDSIFPASEWDYNERAQYCKEAFKIEPRPNW  526
               + P     GW WQ C+EM+ P+  G +  S+FPAS +   +  + C  ++ + PRP+W
Sbjct  347   EYNYPTETFVGWDWQTCSEMVFPIDHGRDPTSMFPASTFVLRDYIEDCNRSYGVPPRPHW  406

Query  525   ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLRF  346
             ITTEFGGH+I+ VLK+F SNIIF NGLRDP+S GGVL+NIS S+VA+    G+H +D+  
Sbjct  407   ITTEFGGHDIKLVLKRFASNIIFSNGLRDPYSIGGVLQNISDSVVALATVNGSHCLDILS  466

Query  345   STKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              +  DPKWL   R+ E+EII+ WI +YY  L
Sbjct  467   ESPNDPKWLSMQRQSEIEIIEGWIEKYYADL  497



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 300/465 (65%), Gaps = 25/465 (5%)
 Frame = -1

Query  1614  KLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQ  1435
             K ++T Y+ Q LDHF++ P+S+ TF+QRY IN +YWGGA + API  ++G EG I++   
Sbjct  62    KDFETLYYPQTLDHFSYGPESFTTFKQRYAINSKYWGGANSSAPILAFLGAEGPIDYDVG  121

Query  1434  NTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLII  1255
               GF+ + AP   AL V+IEHR+YGKSVPFG  K+A  ++   GY ++ Q +ADYA +++
Sbjct  122   YIGFLNENAPRLKALQVYIEHRYYGKSVPFGSVKKAMKNASIRGYFNTDQAIADYAVVLL  181

Query  1254  DLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSD  1075
              +KK L+A +SP++V GGSYGGMLAAWFRLKYPHV IGALASSAPILYF++IT    +  
Sbjct  182   HVKKKLSAHNSPIIVVGGSYGGMLAAWFRLKYPHVAIGALASSAPILYFDDITPESGYYS  241

Query  1074  VITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTA  895
             V+T+DF+  SE+CY+ I+ SW  I  +A E  GL  L + F  C    +   L+ +L T 
Sbjct  242   VVTKDFKDTSESCYETIRKSWAEIDRVASEPSGLSILSRKFKTCGKLKTSADLKDYLDTV  301

Query  894   YTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIY------YNY  733
             Y   A  + P+           P+  +C AID   + +D L KL++ V+ Y      YN 
Sbjct  302   YCGAAQYNGPSTR---------PLSHLCNAIDGAPNNTDTLGKLFAGVSAYRGNRSCYNI  352

Query  732   TGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLG-GSNKDSIFPASEWDYNERAQYCKE  556
             +G  NN  D         L GW WQ+C+EM+MP+  GS++DS+FP   +D       CK 
Sbjct  353   SG--NNLSD-------QLLDGWYWQSCSEMVMPIAHGSDEDSMFPKDHFDLESYTNDCKR  403

Query  555   AFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAK  376
              + + PRP+W+TT +GGH+I+ V  +F SNIIF NGLRDP+S GGVL+NI++S+VA+T  
Sbjct  404   LYGVVPRPHWVTTYYGGHDIKLVFHEFASNIIFSNGLRDPYSRGGVLENITESVVAVTTD  463

Query  375   EGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDLI  241
              G+H +DL  S   DP+WL   R+ E+EII+ WI++Y    +++I
Sbjct  464   NGSHCLDLLSSRPSDPQWLVMQRKNEIEIIEGWIAKYRADSSNII  508



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/479 (45%), Positives = 305/479 (64%), Gaps = 22/479 (5%)
 Frame = -1

Query  1674  TIINRPNGLSASSAKAADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAK  1495
             TI N P  +SAS +K       Y T  +TQ LDHF + P SY TFQQRYLIN +YW GA 
Sbjct  39    TIQNEPILMSASESKD------YKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGAN  92

Query  1494  NMAPIFVYMGNEGDIEWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSS  1315
               APIFV  G E  I++     GF+ + APHF ALLV+IEHR+YGKSVPFG ++EA  ++
Sbjct  93    TSAPIFVLFGGEESIDYDRDINGFLPENAPHFKALLVYIEHRYYGKSVPFGTKEEAMKNA  152

Query  1314  KTLGYLSSTQVLADYATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGAL  1135
              TLGY +S Q +ADYA +++ +K+  +A   PV+V GGSYGGMLA+WFRLKYPH+ +GAL
Sbjct  153   STLGYCNSAQAIADYAAVLLHIKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIALGAL  212

Query  1134  ASSAPILYFENITSP-YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRK  958
             ASS+PILYF+ +  P   +  ++T+DF+  SE+CY+ I+ SW  I ++     GL  L K
Sbjct  213   ASSSPILYFDGVVDPQVGYYTIVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLSILSK  272

Query  957   SFNICKNYISVGSLEGWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSD  778
              F  C    S   L+ +L + YT  A  D P         P YPV ++C AID    G+D
Sbjct  273   KFRTCNPLNSTSELKDYLDSLYTDAAQYDEP---------PKYPVSRVCGAIDGA-EGTD  322

Query  777   PLAKLYSAVNIYYNYTGEVNNCFDLASSSDPHG-LSGWSWQACTEMIMPLGGSNKDSIFP  601
              L K+++AV  Y   T    +C+D+     P      ++WQ CTE++ P+G  + D++FP
Sbjct  323   TLDKIFAAVVTYMGNT----SCYDMKEFGSPTSTFDMFTWQVCTELVFPIGHGHNDTMFP  378

Query  600   ASEWDYNERAQYCKEAFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGG  421
              + +D +  ++ C+  F ++P+P+W+TT +GG +I+ +L  F SNIIF NGLRDP+S+GG
Sbjct  379   LAPFDLSSFSKTCEGLFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRDPYSSGG  438

Query  420   VLKNISKSLVAITAKEGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
             VLKNIS S+VA+    G+H +D+  + + DP WL   R+ EVEII+ W+++Y+  L + 
Sbjct  439   VLKNISDSVVALNTVNGSHCLDILPAKESDPLWLIMQRKAEVEIIEGWLAKYHADLLEF  497



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   429 bits (1103),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 291/454 (64%), Gaps = 15/454 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T YF Q LDHF + P+SY TF QRY+IN +YWGGA + API  Y+G E  I+      
Sbjct  50    FKTFYFNQTLDHFNYRPESYTTFPQRYIINFKYWGGANSSAPILAYLGPEAPIDSAMNVI  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM D A  FNALLV+IEHR+YGKS+PFG  KEA  ++ TLGY +S Q LADYA ++I +
Sbjct  110   GFMTDNAVKFNALLVYIEHRYYGKSIPFGSRKEALRNASTLGYFNSAQALADYAAILIHV  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK  +A  SPV+V GGSYGGMLA WFRLKYPHV +GALASSAPILYF +IT    +  ++
Sbjct  170   KKEFSAKYSPVIVIGGSYGGMLATWFRLKYPHVALGALASSAPILYFNDITPENGYYVIV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  S+ CY+ I+ SW  I+ +A +S GL  L K F  C    S   LE +L   Y 
Sbjct  230   TKDFREVSQTCYESIRESWSEIETVASQSNGLSVLDKVFKTCSPLRSSTQLENYLWFMYA  289

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  ++P+          YPV ++C AID   + +  L K+ + V   + Y GE+ +C+
Sbjct  290   SAAQYNHPSR---------YPVNRICDAIDQ-TYSNGTLGKIAAGV---FAYRGEL-SCY  335

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
                  +      GW WQ C+EM+MP+   N D++FP+  +D+   + YC + + + PRP+
Sbjct  336   INEPINTTETTVGWQWQRCSEMVMPISTGN-DTMFPSETFDHESFSIYCNQLYGVTPRPH  394

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             W+TT +GGH+I  +L +F SNIIF NGL+DP+S GGVL NIS SL+A+    G+H +D+ 
Sbjct  395   WVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHNISDSLLAVYTANGSHCLDIL  454

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              + + DP+WL   R+ EV II++WI +YY  L +
Sbjct  455   TANRMDPEWLVTQRKTEVGIIKEWIDEYYADLAN  488



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   429 bits (1104),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 299/462 (65%), Gaps = 18/462 (4%)
 Frame = -1

Query  1629  AADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
             AAD    ++T Y+ Q LDHF F P S++TFQQRYLIN ++WGG+   APIF Y+G E  I
Sbjct  52    AADPINDFETFYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNVSAPIFAYLGEEEAI  111

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
             +      GF+ + A  F AL +FIEHR+YGKSVPFG  +EA  ++ TLGY +S Q LADY
Sbjct  112   DVDLSIVGFLSENAHQFQALQIFIEHRYYGKSVPFGSREEAFQNADTLGYFNSAQALADY  171

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A ++I +KK L A  SPV+V G SYGGMLA+WFRLKYPHV +GALASSAPILYF+NI  P
Sbjct  172   AEVLIHVKKKLHAQHSPVIVIGASYGGMLASWFRLKYPHVALGALASSAPILYFDNIVPP  231

Query  1089  Y-AFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLE  913
                +  ++T+DFR  SE CY+ IK SW  I  IA +  GL  L + F+ C+       L+
Sbjct  232   EDGYYSIVTKDFREASETCYQTIKKSWSDIDAIASQPEGLSFLSEKFHTCRPLKKSSELK  291

Query  912   GWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYY-N  736
              +L   Y   A  + P         P YPV  +C AID  + G+D L K+++ V  +  N
Sbjct  292   NYLDNLYCNAAQYNSP---------PSYPVTVVCGAIDGAS-GNDTLTKIFAGVVAFSGN  341

Query  735   YTGEVNNCFDLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKE  556
              +  VN   +L  +       GWSWQ C++M++P+   + DS+FPA ++D  +  + CK 
Sbjct  342   TSCYVNQPRNLTETD-----MGWSWQTCSDMVIPMASVSNDSMFPAYQFDLKDYIKSCKA  396

Query  555   AFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAK  376
              + + PRP+W+TT FGGH+I+  L++F SNIIF NGLRDP+S+GGVL++IS ++VA+ AK
Sbjct  397   QYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRDPYSSGGVLEDISDTIVAVHAK  456

Query  375   EGAHHVD-LRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSL  253
              G+H +D L      DP WL + R+ EV+II++WI++YY  L
Sbjct  457   NGSHCLDILNADNITDPDWLVNQRKIEVKIIKRWIARYYADL  498



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/464 (45%), Positives = 298/464 (64%), Gaps = 16/464 (3%)
 Frame = -1

Query  1629  AADNHKLYDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDI  1450
             +A   K Y T  +TQ LDHF + P SY TFQQRYLIN +YW GA   APIFV  G E  I
Sbjct  2     SASESKDYKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANTSAPIFVLFGGEESI  61

Query  1449  EWFTQNTGFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADY  1270
             ++     GF+ + APHF ALLV+IEHR+YGKSVPFG ++EA  ++ TLGY +S Q +ADY
Sbjct  62    DYDRDINGFLPENAPHFKALLVYIEHRYYGKSVPFGSKEEAMKNASTLGYCNSAQAIADY  121

Query  1269  ATLIIDLKKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSP  1090
             A +++ +K+  +A   PV+V GGSYGGMLA+WFRLKYPH+ +GALASS+PILYF+ +  P
Sbjct  122   AAVLLHIKQKYSAEKCPVIVIGGSYGGMLASWFRLKYPHIALGALASSSPILYFDGVVDP  181

Query  1089  -YAFSDVITQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLE  913
                +  ++T+DF+  SE+CY+ I+ SW  I ++     GL  L K F  C    S   L+
Sbjct  182   QVGYYTIVTKDFKETSESCYETIRKSWGEIDEVGSRPNGLSILSKKFRTCNPLNSTSELK  241

Query  912   GWLSTAYTYTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNY  733
              +L + YT  A  D P         P YPV ++C AID    G+D L K+++AV  Y   
Sbjct  242   DYLDSLYTDAAQYDEP---------PKYPVSRVCGAIDGA-EGTDTLDKIFAAVVTYMGN  291

Query  732   TGEVNNCFDLASSSDPHG-LSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKE  556
             T    +C+D+     P      ++WQ CTE++ P+G  + D++FP + +D +  ++ C+ 
Sbjct  292   T----SCYDMKEFGSPTSTFDMFTWQVCTELVFPIGHGHNDTMFPLAPFDLSSFSKTCEG  347

Query  555   AFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAK  376
              F ++P+P+W+TT +GG +I+ +L  F SNIIF NGLRDP+S+GGVLKNIS S+VA+   
Sbjct  348   LFGVQPKPHWVTTYYGGQDIKLILHNFASNIIFSNGLRDPYSSGGVLKNISDSVVALNTV  407

Query  375   EGAHHVDLRFSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTDL  244
              G+H +D+  + + DP WL   R+ EVEII+ W+++Y+  L + 
Sbjct  408   NGSHCLDILPAKESDPLWLIMQRKAEVEIIEGWLAKYHADLLEF  451



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 291/454 (64%), Gaps = 15/454 (3%)
 Frame = -1

Query  1608  YDTKYFTQILDHFTFTPQSYHTFQQRYLINDRYWGGAKNMAPIFVYMGNEGDIEWFTQNT  1429
             + T YF Q LDHF + P+SY TF QRY+IN +YWGGA + API  Y+G E  I+      
Sbjct  50    FKTFYFNQTLDHFNYRPESYTTFPQRYIINFKYWGGAYSSAPILAYLGPEAPIDSAMNVI  109

Query  1428  GFMFDIAPHFNALLVFIEHRFYGKSVPFGGEKEAKSSSKTLGYLSSTQVLADYATLIIDL  1249
             GFM D A  FNALLV+IEHR+YGKS+PFG  KEA  ++ TLGY +S Q +ADYA ++I +
Sbjct  110   GFMTDNAVKFNALLVYIEHRYYGKSIPFGSRKEALRNASTLGYFNSAQAIADYAAILIHV  169

Query  1248  KKNLTATDSPVVVFGGSYGGMLAAWFRLKYPHVTIGALASSAPILYFENITSPYAFSDVI  1069
             KK  +A  SPV+V GGSYGGMLA WFRLKYPHV +GALASSAPILYF +IT    +  ++
Sbjct  170   KKEFSAKYSPVIVIGGSYGGMLATWFRLKYPHVALGALASSAPILYFNDITPENGYYVIV  229

Query  1068  TQDFRSESENCYKVIKGSWQLIQDIAEESGGLERLRKSFNICKNYISVGSLEGWLSTAYT  889
             T+DFR  S+ CY+ I+ SW  I+ +A +S GL  L K F  C    S   LE +L   Y 
Sbjct  230   TKDFREVSQTCYESIRESWSEIETVASQSNGLSVLDKEFKTCSPLRSSTQLENYLWFMYA  289

Query  888   YTAMTDYPTATNFLNPMPPYPVKQMCKAIDDPNHGSDPLAKLYSAVNIYYNYTGEVNNCF  709
               A  ++P+          YPV ++C AID   + +  L K+ + V   + Y GE+ +C+
Sbjct  290   SAAQYNHPSR---------YPVNRICDAIDQ-TYSNGTLGKIAAGV---FAYRGEL-SCY  335

Query  708   DLASSSDPHGLSGWSWQACTEMIMPLGGSNKDSIFPASEWDYNERAQYCKEAFKIEPRPN  529
                  +      GW WQ C+EM+MP+   N D++FP+  +D+   + YC + + + PRP+
Sbjct  336   INEPINTTETTVGWQWQRCSEMVMPISTGN-DTMFPSETFDHESFSIYCNQLYGVTPRPH  394

Query  528   WITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKNISKSLVAITAKEGAHHVDLR  349
             W+TT +GGH+I  +L +F SNIIF NGL+DP+S GGVL NIS SL+A+    G+H +D+ 
Sbjct  395   WVTTYYGGHDIHLILHRFASNIIFSNGLKDPYSIGGVLHNISDSLLAVYTANGSHCLDIL  454

Query  348   FSTKEDPKWLKDVRRKEVEIIQKWISQYYHSLTD  247
              + + DP+WL   R+ EV II++WI +YY  L +
Sbjct  455   TANRMDPEWLVTQRKTEVGIIKEWIDEYYADLAN  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5658462699372