BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24543_g2_i2 len=657 path=[5369:0-92 4502:93-120 4530:121-160
296:161-214 350:215-215 351:216-274 410:275-292 428:293-344
480:345-371 507:372-401 7520:402-405 541:406-642 778:643-656]

Length=657
                                                                      Score     E

ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    259   3e-80   
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   256   4e-80   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    259   6e-80   
emb|CDP10629.1|  unnamed protein product                                259   8e-80   
emb|CBI30345.3|  unnamed protein product                                256   8e-79   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    256   1e-78   Vitis vinifera
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        253   1e-77   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   1e-77   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   2e-77   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           252   2e-77   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    249   3e-76   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             249   4e-76   Populus trichocarpa [western balsam poplar]
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    249   6e-76   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    248   1e-75   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   6e-75   
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        246   8e-75   
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                245   1e-74   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    244   4e-74   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    244   4e-74   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    243   2e-73   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    242   2e-73   
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             242   2e-73   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         241   9e-73   Ricinus communis
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    240   1e-72   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   2e-72   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        239   3e-72   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   4e-72   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   4e-72   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   5e-72   
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         238   7e-72   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    237   2e-71   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    237   2e-71   
gb|EPS74090.1|  hypothetical protein M569_00662                         234   2e-70   
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        234   3e-70   
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    234   4e-70   
ref|XP_007203815.1|  hypothetical protein PRUPE_ppa005504m1g            219   8e-69   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           228   7e-68   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     226   9e-68   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     228   2e-67   Vitis vinifera
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   5e-67   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    225   6e-67   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    225   8e-67   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    224   2e-66   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             222   1e-65   
gb|KDO70538.1|  hypothetical protein CISIN_1g0106562mg                  210   3e-65   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    220   5e-65   
gb|ABR17682.1|  unknown                                                 212   5e-62   Picea sitchensis
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          207   5e-60   
emb|CDM83096.1|  unnamed protein product                                204   6e-59   
ref|XP_002438751.1|  hypothetical protein SORBIDRAFT_10g025530          194   1e-58   Sorghum bicolor [broomcorn]
gb|ABK95653.1|  unknown                                                 194   3e-58   Populus trichocarpa [western balsam poplar]
ref|NP_001136852.1|  uncharacterized protein LOC100217003               197   8e-58   Zea mays [maize]
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        201   1e-57   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   1e-57   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        199   1e-57   
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           199   2e-57   
ref|NP_001044360.1|  Os01g0767100                                       200   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    199   3e-57   
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          200   5e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75958.1|  hypothetical protein OsI_03875                          200   5e-57   Oryza sativa Indica Group [Indian rice]
dbj|BAK01568.1|  predicted protein                                      199   7e-57   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    196   8e-57   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               199   1e-56   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    198   1e-56   
gb|AFK45793.1|  unknown                                                 190   2e-56   
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         197   3e-56   Ricinus communis
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          197   4e-56   Sorghum bicolor [broomcorn]
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   4e-56   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    197   4e-56   
gb|AFW84965.1|  putative serine peptidase S28 family protein            197   4e-56   
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        196   9e-56   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   2e-55   
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         195   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    196   2e-55   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   3e-55   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             195   3e-55   
emb|CDY20293.1|  BnaC04g36630D                                          194   3e-55   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        194   3e-55   
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              194   3e-55   
emb|CDY46135.1|  BnaA04g14230D                                          194   4e-55   
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   4e-55   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   7e-55   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    193   8e-55   
gb|AIA26578.1|  serine protease                                         190   1e-54   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    193   1e-54   
gb|EMT22762.1|  Lysosomal Pro-X carboxypeptidase                        187   1e-54   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        193   1e-54   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         193   1e-54   
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         192   1e-54   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   2e-54   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             192   2e-54   
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   3e-54   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          192   3e-54   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   3e-54   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    192   3e-54   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   4e-54   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   4e-54   
emb|CBI18675.3|  unnamed protein product                                191   4e-54   
ref|XP_001776094.1|  predicted protein                                  191   4e-54   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   5e-54   
gb|ABR17702.1|  unknown                                                 191   5e-54   Picea sitchensis
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   6e-54   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   6e-54   
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            191   7e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       191   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    191   8e-54   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                191   1e-53   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   1e-53   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             190   1e-53   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   2e-53   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   3e-53   
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        186   3e-53   
gb|AFW87518.1|  putative serine peptidase S28 family protein            194   3e-53   
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        189   3e-53   
gb|EEE66119.1|  hypothetical protein OsJ_22160                          187   3e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CDY08753.1|  BnaA06g24710D                                          189   3e-53   
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   4e-53   
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   4e-53   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   6e-53   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        189   7e-53   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              189   8e-53   Zea mays [maize]
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     189   8e-53   Zea mays [maize]
gb|KDO59435.1|  hypothetical protein CISIN_1g044064mg                   184   8e-53   
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             187   1e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68714.1|  BnaC01g07390D                                          185   1e-52   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   2e-52   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             187   2e-52   
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   2e-52   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   2e-52   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              187   3e-52   
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         186   3e-52   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   4e-52   
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   5e-52   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             186   5e-52   
ref|NP_001058206.1|  Os06g0647400                                       187   5e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81080.1|  hypothetical protein OsI_23902                          187   5e-52   Oryza sativa Indica Group [Indian rice]
gb|EAZ17490.1|  hypothetical protein OsJ_33021                          180   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             186   5e-52   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         186   6e-52   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   6e-52   
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   7e-52   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             185   9e-52   
emb|CDP02648.1|  unnamed protein product                                185   1e-51   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   1e-51   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   1e-51   
emb|CDY45627.1|  BnaCnng13350D                                          185   1e-51   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        185   2e-51   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          186   2e-51   Sorghum bicolor [broomcorn]
dbj|BAJ87416.1|  predicted protein                                      185   2e-51   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    184   2e-51   
dbj|BAJ92142.1|  predicted protein                                      184   3e-51   
dbj|BAJ86079.1|  predicted protein                                      184   3e-51   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        185   4e-51   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   4e-51   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   4e-51   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    183   7e-51   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     184   8e-51   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        182   9e-51   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    182   1e-50   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   182   2e-50   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    182   2e-50   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   2e-50   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        182   2e-50   
ref|XP_008779559.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   2e-50   
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   3e-50   
dbj|BAK05623.1|  predicted protein                                      181   4e-50   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   5e-50   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   5e-50   
emb|CDP10200.1|  unnamed protein product                                180   5e-50   
ref|NP_001065793.1|  Os11g0156200                                       181   6e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EMT03389.1|  Lysosomal Pro-X carboxypeptidase                        181   7e-50   
gb|EAY80009.1|  hypothetical protein OsI_35177                          180   1e-49   Oryza sativa Indica Group [Indian rice]
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        181   1e-49   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   1e-49   
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   2e-49   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         179   2e-49   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              178   2e-49   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           179   2e-49   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   4e-49   Vitis vinifera
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   5e-49   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             177   8e-49   Populus trichocarpa [western balsam poplar]
gb|EPS59259.1|  hypothetical protein M569_15548                         176   9e-49   
gb|ABR16397.1|  unknown                                                 177   1e-48   Picea sitchensis
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   2e-48   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    176   4e-48   
gb|EYU30781.1|  hypothetical protein MIMGU_mgv1a0254691mg               167   4e-48   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   5e-48   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        176   5e-48   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   6e-48   
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   7e-48   
gb|EYU41363.1|  hypothetical protein MIMGU_mgv1a0060841mg               166   7e-48   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          175   9e-48   Sorghum bicolor [broomcorn]
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    174   2e-47   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          173   5e-47   Sorghum bicolor [broomcorn]
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   8e-47   
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   8e-47   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        172   9e-47   
ref|XP_007150129.1|  hypothetical protein PHAVU_005G1292001g            163   1e-45   
gb|AFW87519.1|  putative serine peptidase S28 family protein            169   1e-45   
emb|CBI17110.3|  unnamed protein product                                166   2e-45   
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    168   3e-45   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    167   5e-45   
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    166   6e-45   
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    165   4e-44   
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    164   5e-44   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  159   7e-44   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        163   1e-43   Vitis vinifera
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             163   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         162   3e-43   Ricinus communis
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              162   3e-43   
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           162   5e-43   
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    162   5e-43   
emb|CDP17394.1|  unnamed protein product                                162   6e-43   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    161   7e-43   Vitis vinifera
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             161   9e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        160   1e-42   Vitis vinifera
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                161   1e-42   
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             160   1e-42   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    161   1e-42   
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         160   1e-42   
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             160   2e-42   
emb|CBI17112.3|  unnamed protein product                                161   2e-42   
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    160   3e-42   
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             160   3e-42   
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    159   3e-42   
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    159   3e-42   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    159   4e-42   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        159   4e-42   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         159   4e-42   
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    159   5e-42   
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         157   5e-42   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         159   5e-42   Ricinus communis
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    159   7e-42   
emb|CAN65360.1|  hypothetical protein VITISV_036071                     159   1e-41   Vitis vinifera
emb|CDY28235.1|  BnaA01g06140D                                          149   1e-41   
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    158   1e-41   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    158   1e-41   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     157   1e-41   
emb|CAN64374.1|  hypothetical protein VITISV_018664                     157   1e-41   Vitis vinifera
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        157   2e-41   
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        157   2e-41   Vitis vinifera
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         157   2e-41   
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   2e-41   
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         157   2e-41   Ricinus communis
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   157   2e-41   
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         155   3e-41   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             156   6e-41   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    156   6e-41   
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   155   7e-41   
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   8e-41   
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   8e-41   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   8e-41   
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   9e-41   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             155   9e-41   Populus trichocarpa [western balsam poplar]
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         155   1e-40   
ref|XP_008360161.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    149   2e-40   
emb|CBI17113.3|  unnamed protein product                                155   2e-40   
emb|CBI17109.3|  unnamed protein product                                157   3e-40   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    154   3e-40   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    154   3e-40   
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    154   4e-40   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         153   7e-40   Ricinus communis
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        153   8e-40   
ref|XP_002322808.2|  hypothetical protein POPTR_0016s07530g             144   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006388623.1|  prolylcarboxypeptidase-related family protein      144   2e-39   
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   153   2e-39   
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             152   2e-39   Branchiostoma floridae
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        152   2e-39   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             152   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             150   3e-39   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    151   3e-39   
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            151   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             152   3e-39   
ref|XP_006369374.1|  hypothetical protein POPTR_0001s221001g            143   3e-39   
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     151   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     151   3e-39   
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    151   3e-39   
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    151   4e-39   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   5e-39   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   5e-39   
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   150   7e-39   
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   7e-39   
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   1e-38   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   1e-38   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     150   1e-38   
ref|XP_002530593.1|  lysosomal pro-X carboxypeptidase, putative         146   2e-38   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    149   2e-38   
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        149   2e-38   
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    149   2e-38   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     145   2e-38   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         147   3e-38   
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        149   3e-38   
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    148   4e-38   
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                    148   5e-38   
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                    148   5e-38   
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             144   6e-38   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   147   6e-38   
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   6e-38   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             147   6e-38   
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   6e-38   
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   9e-38   
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   1e-37   
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     147   1e-37   
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        147   1e-37   
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             147   2e-37   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   2e-37   
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   2e-37   
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   2e-37   
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   2e-37   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   3e-37   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   3e-37   
ref|XP_008464256.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   3e-37   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       146   3e-37   
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   3e-37   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   3e-37   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   4e-37   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      145   5e-37   
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        145   5e-37   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        145   6e-37   
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   7e-37   
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             145   7e-37   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             145   7e-37   
ref|XP_006484928.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   8e-37   
gb|EMC81816.1|  Lysosomal Pro-X carboxypeptidase                        144   1e-36   
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             144   1e-36   
emb|CDP07008.1|  unnamed protein product                                144   1e-36   
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   1e-36   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             144   1e-36   
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   2e-36   
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   2e-36   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   2e-36   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    143   2e-36   
emb|CDY09174.1|  BnaA02g06000D                                          143   3e-36   
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    143   3e-36   
gb|ELU04397.1|  hypothetical protein CAPTEDRAFT_174591                  142   4e-36   
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   5e-36   
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             142   6e-36   
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   7e-36   
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   7e-36   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   8e-36   
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        141   8e-36   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   1e-35   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             140   1e-35   
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        141   2e-35   
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   2e-35   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   2e-35   
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         140   2e-35   
ref|XP_001628070.1|  predicted protein                                  140   3e-35   
ref|XP_011024297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   4e-35   
ref|XP_009908966.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   4e-35   
ref|XP_006865042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     139   5e-35   
ref|XP_010187440.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   6e-35   
gb|KFQ24633.1|  Lysosomal Pro-X carboxypeptidase                        134   8e-35   
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   9e-35   
ref|XP_010042171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   9e-35   
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   9e-35   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   1e-34   
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   1e-34   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   1e-34   
gb|KFV63066.1|  Lysosomal Pro-X carboxypeptidase                        135   1e-34   
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   1e-34   
ref|XP_006001899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   1e-34   
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   1e-34   
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   2e-34   
ref|XP_008498766.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    138   2e-34   
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-34   
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   2e-34   
gb|ACO10617.1|  Lysosomal Pro-X carboxypeptidase precursor              137   2e-34   
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    137   2e-34   
ref|XP_009879496.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   3e-34   
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   3e-34   
ref|XP_007060650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   4e-34   
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   4e-34   
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    137   4e-34   
gb|KFV84322.1|  Lysosomal Pro-X carboxypeptidase                        136   5e-34   
ref|XP_010018717.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   5e-34   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   5e-34   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  136   6e-34   
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   6e-34   
gb|KFP06048.1|  Lysosomal Pro-X carboxypeptidase                        136   6e-34   
gb|KFV02463.1|  Lysosomal Pro-X carboxypeptidase                        136   6e-34   
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   7e-34   
ref|XP_009563433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        136   7e-34   
ref|XP_006132231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   8e-34   
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    136   8e-34   
ref|XP_004364392.1|  prolylcarboxypeptidase                             136   8e-34   
gb|EMP35010.1|  Lysosomal Pro-X carboxypeptidase                        136   8e-34   
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           136   9e-34   
gb|KGL90198.1|  Lysosomal Pro-X carboxypeptidase                        135   9e-34   
ref|XP_783661.3|  PREDICTED: lysosomal Pro-X carboxypeptidase-like      137   9e-34   
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   9e-34   
gb|EWM28137.1|  lysosomal pro-x                                         136   1e-33   
ref|XP_009877154.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_009468660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_005149846.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         135   1e-33   
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   1e-33   
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        135   1e-33   
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    135   1e-33   
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   1e-33   
ref|XP_002599211.1|  hypothetical protein BRAFLDRAFT_200045             135   1e-33   
ref|XP_009245156.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   1e-33   
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        135   2e-33   
ref|XP_008056303.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   2e-33   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-33   
ref|XP_009351278.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    128   2e-33   
gb|KFQ54980.1|  Lysosomal Pro-X carboxypeptidase                        135   2e-33   
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   2e-33   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-33   
ref|XP_009279588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-33   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    135   2e-33   
ref|XP_005287637.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   2e-33   
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-33   
ref|XP_006273509.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   2e-33   
gb|KFO79296.1|  Lysosomal Pro-X carboxypeptidase                        134   2e-33   
gb|ERE79438.1|  lysosomal Pro-X carboxypeptidase-like protein           135   2e-33   
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    135   2e-33   
ref|XP_010283636.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   2e-33   
gb|KFO13685.1|  Lysosomal Pro-X carboxypeptidase                        134   2e-33   
ref|XP_007630098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    135   2e-33   
gb|KFV12075.1|  Lysosomal Pro-X carboxypeptidase                        134   2e-33   
ref|XP_006991953.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   2e-33   
ref|XP_003507065.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    135   2e-33   
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   2e-33   
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    135   3e-33   
ref|XP_010077848.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   3e-33   
ref|XP_010175531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   3e-33   
ref|XP_005357662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   3e-33   
ref|XP_008148243.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   3e-33   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   3e-33   
ref|XP_007900913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   3e-33   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   3e-33   
gb|KFZ51659.1|  Lysosomal Pro-X carboxypeptidase                        134   3e-33   
gb|KFQ13604.1|  Lysosomal Pro-X carboxypeptidase                        134   3e-33   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   3e-33   
gb|KFP73631.1|  Lysosomal Pro-X carboxypeptidase                        134   3e-33   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   3e-33   
ref|XP_005579271.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   3e-33   
gb|ACO10272.1|  Lysosomal Pro-X carboxypeptidase precursor              134   3e-33   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   4e-33   
gb|KFR02889.1|  Lysosomal Pro-X carboxypeptidase                        134   4e-33   
ref|XP_008385479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   4e-33   
ref|XP_005323310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   4e-33   
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   4e-33   
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   4e-33   
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        134   4e-33   
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   5e-33   
ref|XP_009321727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   5e-33   
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   5e-33   
ref|XP_006882995.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   5e-33   
ref|XP_009245155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    134   5e-33   
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   6e-33   
ref|XP_009640619.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   6e-33   
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   6e-33   
gb|KFM08871.1|  Lysosomal Pro-X carboxypeptidase                        133   6e-33   
ref|NP_001072639.1|  lysosomal Pro-X carboxypeptidase precursor         134   6e-33   
gb|KFZ57497.1|  Lysosomal Pro-X carboxypeptidase                        133   6e-33   
gb|KFQ73298.1|  Lysosomal Pro-X carboxypeptidase                        133   7e-33   
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   7e-33   
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   7e-33   
ref|XP_009185280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   8e-33   
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   8e-33   
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   8e-33   
ref|XP_010139237.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   8e-33   
emb|CDY09173.1|  BnaA02g05990D                                          133   8e-33   
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   8e-33   
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         133   9e-33   
ref|XP_010629189.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   9e-33   
ref|XP_005579269.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   9e-33   
ref|XP_009967794.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   9e-33   
gb|EHH56621.1|  hypothetical protein EGM_06072                          133   9e-33   
ref|XP_005379866.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   1e-32   
ref|XP_007944471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   1e-32   
ref|NP_001013333.1|  dipeptidyl peptidase 2 precursor                   133   1e-32   
ref|XP_005171903.1|  PREDICTED: dipeptidyl peptidase 2 isoform X1       133   1e-32   
ref|XP_005379867.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   1e-32   
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   1e-32   
ref|XP_008973719.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   1e-32   
ref|XP_009070789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   1e-32   
ref|XP_007537171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   1e-32   
gb|KFW66681.1|  Lysosomal Pro-X carboxypeptidase                        132   1e-32   
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     132   1e-32   
ref|XP_005274150.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   1e-32   
ref|XP_004632660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   1e-32   
gb|AAM15096.1|  putative prolylcarboxypeptidase                         132   1e-32   
ref|NP_001099751.2|  lysosomal Pro-X carboxypeptidase precursor         132   1e-32   
ref|XP_008018495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   1e-32   
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   1e-32   
ref|XP_533994.2|  PREDICTED: lysosomal Pro-X carboxypeptidase iso...    132   1e-32   
ref|XP_004901739.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   1e-32   
ref|XP_004901738.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   1e-32   
ref|XP_008590288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   1e-32   
gb|KFP09734.1|  Lysosomal Pro-X carboxypeptidase                        132   1e-32   
ref|XP_009185279.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   2e-32   



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D  +K+Y A NI YNY+    CF+  +  D     A W WQ CTEM+MP DGNNK+SI
Sbjct  313  GKDTFEKIYGAANIYYNYTGNATCFNLNDHSD-PHGLAGWTWQACTEMVMPTDGNNKESI  371

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S+WDYN R QFCK  F +EPRPNW+TTEFGG+NIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  372  FPPSKWDYNERAQFCKSNFGVEPRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSG  431

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
             GVLK ISKS+VAI AKEGAHHVDL++S+KEDPKWLK VR +EV II  W+SQYY 
Sbjct  432  AGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLKQVREREVNIISNWLSQYYQ  487



>ref|XP_010093782.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB54615.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=400

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A NI YNY+    CFD  +  D     + W WQ CTEMI+P  GN K+SI
Sbjct  219  GNDTFAKLYGAANIYYNYTGTAKCFDLDDDSD-PHGLSGWGWQACTEMILPTSGNTKESI  277

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEW Y+GRV +CK+ + +EPR NWITTEFGG  IERVLK+FGSNIIFFNGLRDPWS 
Sbjct  278  FPASEWHYSGRVSYCKNVYGVEPRRNWITTEFGGFGIERVLKRFGSNIIFFNGLRDPWSG  337

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+IS+S+VAI AKEGAHHVDL+FSTKEDP+WLK+VR++E+ II  WISQYYH
Sbjct  338  GGVLKNISRSIVAIVAKEGAHHVDLRFSTKEDPEWLKEVRKQEINIIAGWISQYYH  393



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D  +K+Y A NI YNY+    CFD  +  D     A W WQ CTEM+MP DGNNK+SI
Sbjct  314  GKDTFEKIYEAANIYYNYTGNATCFDLNDHSD-PHGLAGWTWQSCTEMVMPTDGNNKESI  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S+WDYN R QFCK  F +EPRPNW+TTEFGG+NIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  373  FPPSKWDYNERAQFCKSIFGVEPRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSG  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
             GVLK ISKS+VAI AKEGAHHVDL++S+KEDPKWL+ VR +EV II  W+SQYY 
Sbjct  433  AGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLQQVREREVNIISNWLSQYYQ  488



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ ++KLY+A N+ YN +    CF+  +  D      +W+WQ CTEMI+P  GNN D I
Sbjct  342  GNNTLEKLYSAANVYYNSTGRATCFNLNDDSD-PHGLDEWSWQACTEMILPIGGNNADGI  400

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP SEWDY GR Q C+D F ++PRPNWITTEFGGHNI+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  401  FPPSEWDYAGRAQSCEDAFGVQPRPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRDPWSG  460

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK ISKSLVAI AKEGAHHVDL+FST EDP+WLK  RR+EV+II+ W+SQYYH
Sbjct  461  GGVLKDISKSLVAIVAKEGAHHVDLRFSTPEDPEWLKHARRREVKIIENWLSQYYH  516



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             G+D   KLY A N+ YNY+    CFD  +  D      +W WQ CTEMIMP + NN++S
Sbjct  303  QGNDTFAKLYGAANVYYNYTGTAACFDLADDSD-PHGLGEWTWQACTEMIMPVNANNEES  361

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            IFP S W+Y+ R  FCK  F IEPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGLRDPWS
Sbjct  362  IFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWS  421

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
             GGVL+SISKS+VAI AK+GAHHVDL+F+T EDP+WL+DVR++EV+II +W S+YYH
Sbjct  422  GGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYH  478



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             G+D   KLY A N+ YNY+    CFD  +  D      +W WQ CTEMIMP + NN++S
Sbjct  325  QGNDTFAKLYGAANVYYNYTGTAACFDLADDSD-PHGLGEWTWQACTEMIMPVNANNEES  383

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            IFP S W+Y+ R  FCK  F IEPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGLRDPWS
Sbjct  384  IFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWS  443

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
             GGVL+SISKS+VAI AK+GAHHVDL+F+T EDP+WL+DVR++EV+II +W S+YYH
Sbjct  444  GGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYH  500



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 7/179 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D   KLY A N+ YNYS  V CF   D  +P D       W WQ CTEMIMP  GNN+
Sbjct  324  GNDTFAKLYGAANVYYNYSGTVTCFELDDNSDPHDL----GGWYWQACTEMIMPTGGNNE  379

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            DSIFPAS+WDY  +   CK  F IEPRP WITTEFGGH IERVLK++GSNIIFFNGLRDP
Sbjct  380  DSIFPASDWDYKDQASVCKSRFGIEPRPLWITTEFGGHAIERVLKRYGSNIIFFNGLRDP  439

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            WS GGVLK+ISKS+VAI AKEGAHHVDL F + EDP+WL+DVR++E++II +WISQYYH
Sbjct  440  WSGGGVLKNISKSIVAIVAKEGAHHVDLMFKSSEDPEWLQDVRKQEIKIIAKWISQYYH  498



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 142/182 (78%), Gaps = 1/182 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D  +KLY A NI YNY+ +  C +  +  D       W WQ CTEM+MP +GNNK+SI
Sbjct  327  GNDTFEKLYGAANIYYNYTGKATCLNLNDNSD-PHGLGGWTWQACTEMVMPTNGNNKESI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP SEWDYN RV+FCK    ++PRP+WITTEFGGH+IERVLK+FGSNIIFFNGLRDPWS 
Sbjct  386  FPPSEWDYNERVRFCKLILDVKPRPDWITTEFGGHDIERVLKRFGSNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYHY*LG  113
            GGVLK ISKS+VAI AKEGAHHVDL++S+KEDP+WL++VR +E+ II +WISQYY     
Sbjct  446  GGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRAREINIISKWISQYYQTKTD  505

Query  112  FS  107
            FS
Sbjct  506  FS  507



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D  +KLY A N+ YNYS +  CFD  +  D       W WQ CTEM+MP DGNNK+SI
Sbjct  327  GNDTFEKLYGAANMYYNYSGKATCFDLNDNSD-PHGLGGWTWQACTEMVMPTDGNNKESI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP SEWDYN RV+FC+    ++PR +WITTEFGG+NIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  386  FPPSEWDYNERVRFCQLILDVKPRSDWITTEFGGYNIERVLKRFGSNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK ISKS+VAI AKEGAHHVDL++S+KEDP+WL++VR +EV II  WISQYY 
Sbjct  446  GGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRGREVNIISNWISQYYQ  501



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++   KLYAA NI YNYS  V CFD  N       +  W+WQ CTEMIMP  GNN++SI
Sbjct  327  GNETFTKLYAAANIFYNYSGSVICFDISN------DSGGWDWQSCTEMIMPLGGNNEESI  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +W+    + +CK T+ I+PRP+WITTEFGGH+I RVLK++GSNIIFFNGLRDPWS 
Sbjct  381  FPAHKWELEETLSYCKQTYHIDPRPHWITTEFGGHDIGRVLKRYGSNIIFFNGLRDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+L+AI AKEGAHHVDL+FSTKEDP+WLKDVR++EV+II  WISQYY 
Sbjct  441  GGVLKNISKTLIAIVAKEGAHHVDLRFSTKEDPEWLKDVRKQEVKIITSWISQYYQ  496



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   +LY AVNI YN +    CFD  +  D     ++W WQ CTEMI+P DGN  DSI
Sbjct  327  GNDTFARLYGAVNIYYNNTGNATCFDIEDDSD-PHGLSEWTWQACTEMILPTDGNKNDSI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEWDY  R   C+  F I PRP+WITTE+GG++I RVLK+FGSNIIFFNGLRDPWS 
Sbjct  386  FPASEWDYANRATNCQFAFGINPRPHWITTEYGGYDIRRVLKRFGSNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL+SISKS++AI AKEGAHHVDL+FSTKEDP+WL+DVR++EV II++W+SQYY+
Sbjct  446  GGVLESISKSIIAIVAKEGAHHVDLRFSTKEDPEWLRDVRKREVGIIRKWLSQYYN  501



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+    KLY A ++ YNYS    CF+  +  D       W+WQ CTEMI+P  GNNKDSI
Sbjct  324  GNKTFAKLYGAASVYYNYSGNATCFNHDDDSD-PHGLGGWSWQACTEMILPTSGNNKDSI  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEW+Y+ R  FCK  F +EPRPNWIT EFGGH+I+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  383  FPASEWNYDDRASFCKAYFGVEPRPNWITAEFGGHDIKRVLKRFGSNIIFFNGLRDPWSG  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS S+VAI AK+GAHHVDL+F+T EDPKWL+DVR++EV II +W+S+YY
Sbjct  443  GGVLENISSSIVAIIAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSEYY  497



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++   KLY A ++ YNYS    CF+  +  D       W+WQ CTEMI+P  GNNKDSI
Sbjct  324  GNNTFAKLYGAASVYYNYSGTATCFNLDDDSD-PHGLGGWSWQACTEMILPTSGNNKDSI  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F ASEW+Y+ R  FCK  F +EPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  383  FTASEWNYDDRATFCKAYFGVEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSG  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS S+VAI AK+GAHHVDL+F+T EDPKWL+DVR++EV II +W+S+YY
Sbjct  443  GGVLENISSSIVAIVAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSKYY  497



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY AV + YNYS    CFDP +  D       W+WQ CTEMIM  +GN+K+SI
Sbjct  332  GNDTFAKLYGAVTVYYNYSGTTTCFDPDDNSD-PHDLGGWDWQACTEMIMQTNGNDKESI  390

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP SE  Y  +V +CK+ + +EPRPNWITTEFGGH+I+RVL+++GSNIIFFNGLRDPWS 
Sbjct  391  FPPSESQYKDQVSYCKEAYGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSG  450

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL +ISK +VAI AKEGAHHVDL+F T EDP+WLKDVR++EV+II +WIS+YYH
Sbjct  451  GGVLSNISKRIVAIVAKEGAHHVDLRFKTNEDPEWLKDVRKQEVKIIAKWISEYYH  506



>ref|XP_004306148.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=795

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KL+ A  + YNY+    CFDP +  D       W WQ CTEMIMP  GNN++S+
Sbjct  613  GNDTFAKLFGAATVYYNYTGTATCFDPNDNSD-PHDLGGWQWQACTEMIMPTSGNNEESM  671

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP SEW Y GRV +C+  + +EPRPNWITTEFGGH+I+RVL+++GSNIIFFNGLRDPWS 
Sbjct  672  FPPSEWRYQGRVSYCEGAYGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSG  731

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL +IS+S+VAI AKEGAHHVDL+F T EDP+WLKDVR++E+ II +WIS+YYH
Sbjct  732  GGVLSNISESIVAIVAKEGAHHVDLRFKTSEDPEWLKDVRKQEIGIIAKWISEYYH  787



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++  +KLY A N+ YNY+ +  CFD  +  D       W WQ CTEMI+  DGN +DSI
Sbjct  325  GNNTFEKLYGAANVYYNYTGDATCFDLADDSD-PHGLGGWTWQACTEMILLTDGNTEDSI  383

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP + + YN R  FCKD + IEPRP WI T+FG HNI RVLK+FGSNIIFFNGLRDPWS 
Sbjct  384  FPPNNYSYNDRFVFCKDNYNIEPRPTWIPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWSG  443

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK ISKSLVAI AKEGAHHVDL+FST EDPKWL+DVR +EV II +W+SQYY
Sbjct  444  GGVLKDISKSLVAIVAKEGAHHVDLRFSTSEDPKWLEDVRNREVRIISKWLSQYY  498



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++  +KLYAA +I YNY+    CF+  +  D       WNWQ CTEMI+  DGN +DSI
Sbjct  313  GNNTFEKLYAAASIYYNYTGNAKCFNLIDRSDPHGIRPGWNWQACTEMILLTDGNTEDSI  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPAS + YN R+Q+CK  + I+PRP WI TEFG  +I RVLK+FGSNIIFFNGLRDPWS 
Sbjct  373  FPASNYSYNDRLQYCKSNYDIDPRPTWIPTEFGARHIHRVLKRFGSNIIFFNGLRDPWSG  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYHY*LG  113
            GGVLK ISKS+VAI AKEGAHHVDL+FST+EDP+WL++VR++EV II  W+SQYYH    
Sbjct  433  GGVLKDISKSVVAIVAKEGAHHVDLRFSTREDPEWLREVRKREVHIISNWLSQYYHTLAD  492

Query  112  FS  107
            FS
Sbjct  493  FS  494



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D  KKLY A ++ YNYS    CFD  +  D       W+WQ CTEMIMP  GN ++SI
Sbjct  334  GNDTFKKLYGAASVYYNYSGTATCFDLDDDSD-PHDLGGWSWQACTEMIMPTSGNTEESI  392

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEW Y  R   CK +F IEPRP WITTEFGGH+IERVLK++GSNIIFFNGLRDPWS 
Sbjct  393  FPASEWKYXYRAASCKRSFGIEPRPLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWSG  452

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISKS+VAI AKEGAHHVDL+F   EDP WLK+VR++E+ II  WISQYYH
Sbjct  453  GGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPDWLKEVRKQEINIIGNWISQYYH  508



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A N+ YN++    CF+     D       W+WQ CTEMIMP DGNN+DSI
Sbjct  328  GNDSFAKLYGAANVYYNHTGTTTCFNLAYSPD-PHGLDMWSWQACTEMIMPTDGNNQDSI  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S+W Y+ R   CK  + ++PRPNWITTEFGGH+I R LK+FGSNIIF+NGLRDPWS 
Sbjct  387  FPESQWSYSQRAAVCKGYYGVDPRPNWITTEFGGHDISRALKRFGSNIIFYNGLRDPWSG  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK++VAI A++GAHHVDL+F+T +DPKWL+ VR +EV+II  WISQYYH
Sbjct  447  GGVLKNISKTIVAIVAEQGAHHVDLRFATSQDPKWLQQVREREVKIISNWISQYYH  502



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + KLYAA NI YNY+    CFD  +  D       W WQ CTEMIMP D NNK+SIFP S
Sbjct  335  LGKLYAAANIYYNYTGTAKCFDLYDNSD-PHDLGGWQWQACTEMIMPLDSNNKESIFPES  393

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            EW Y  R  +CK  + + PRPNWIT+EFGGH+IE VLK+  SNIIFFNGLRDPWS GGVL
Sbjct  394  EWSYKDRSSYCKFEYNVVPRPNWITSEFGGHDIEIVLKRSASNIIFFNGLRDPWSGGGVL  453

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            K+ISKS+VA+  KEGAHHVDL+FSTKEDPKWLKDVRR+EV+II+ WISQY+ 
Sbjct  454  KNISKSIVALVEKEGAHHVDLRFSTKEDPKWLKDVRRQEVKIIESWISQYHQ  505



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A ++ YNYS    CFD     D     ++W WQ CTEMIM   G+NKDSI
Sbjct  327  GNDVFAKLYGAASVYYNYSGTAKCFDLNGDSD-PHGLSEWGWQACTEMIMLTGGDNKDSI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F  SE DY+ R ++CK+ + ++PRPNWITTEFGGH I  VLK+F SNIIFFNGLRDPWS 
Sbjct  386  FEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+++A+  KEGAHHVDL+FSTKEDP+WLKDVRR+EVEII +WISQY+ 
Sbjct  446  GGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIIGKWISQYFQ  501



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A ++ YNYS    CFD     D     ++W WQ CTEMIM   G+NKDSI
Sbjct  327  GNDVFAKLYGAASVYYNYSGTAKCFDLNGDSD-PHGLSEWGWQACTEMIMLTGGDNKDSI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F  SE DY+ R ++CK+ + ++PRPNWITTEFGGH I  VLK+F SNIIFFNGLRDPWS 
Sbjct  386  FEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+++A+  KEGAHHVDL+FSTKEDP+WLKDVRR+EVEI+ +WISQY+ 
Sbjct  446  GGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIVGKWISQYFQ  501



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   K +AA ++ YNYS    CFD  +  D       W+WQ CTEMI+P  G+  +SI
Sbjct  327  GNDTFAKFHAAASVYYNYSGTATCFDLDDDSD-PHGLGGWDWQACTEMILPTGGSTAESI  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEWDYN RV +CK  F I+PRPNWITTEFGGHNI+  LK+F SNIIFFNGLRDPWS 
Sbjct  386  FPASEWDYNDRVTYCKLRFDIDPRPNWITTEFGGHNIKMALKRFASNIIFFNGLRDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL+ ISKSLVA+  ++GAHHVDL+F+T EDPKWL++VR+KEV+II +W+S YY 
Sbjct  446  GGVLEDISKSLVALVEEKGAHHVDLRFATSEDPKWLQEVRQKEVKIIAKWLSDYYQ  501



>ref|XP_004167790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=501

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A NI YN++  V CFD  +          W+WQ CTEMI+P  GN K+SI
Sbjct  322  GNDSFTKLYGAANIYYNFTGTVTCFDLDD-DSDPHDLGDWSWQACTEMILPTGGNTKESI  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPAS W +  R QFCK  F +EPR  WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  381  FPASTWHFADRFQFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS +++AI AKEGAHHVDL+FS  +DPKWLKDVR++EV II++W+SQYY
Sbjct  441  GGVLKNISSTIIAIVAKEGAHHVDLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYY  495



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A NI YN++  V CFD  +          W+WQ CTEMI+P  GN K+SI
Sbjct  323  GNDSFTKLYGAANIYYNFTGTVTCFDLDD-DSDPHDLGDWSWQACTEMILPTGGNTKESI  381

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPAS W +  R QFCK  F +EPR  WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  382  FPASTWHFADRFQFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSG  441

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS +++AI AKEGAHHVDL+FS  +DPKWLKDVR++EV II++W+SQYY
Sbjct  442  GGVLKNISSTIIAIVAKEGAHHVDLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYY  496



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ + KLYAA N+ YNY+ +  CFD  +  D       W WQ CTEMIMP  G+NK+SI
Sbjct  326  GNNRLAKLYAAANVYYNYTGKATCFDLDDNSD-PHDLGGWQWQACTEMIMPVGGSNKESI  384

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  EW Y  R  +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNGLRDPWSA
Sbjct  385  FPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSA  444

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK++VAI AK+GAHHVDL++S+KEDP+WLKDVR++EV II  WISQY+ 
Sbjct  445  GGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQ  500



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A N+ YNY+    CFD  +          W WQ CTEMI+P  GN K+SI
Sbjct  323  GNDTFAKLYGAANVYYNYTGTATCFDLDD-DSDPHDLGDWTWQACTEMILPTGGNTKESI  381

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPAS W +  R+ FCK  F +EPR  WI T FGGHNIERVLK+FGSNIIFFNGLRDPWS 
Sbjct  382  FPASTWHFADRLHFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSG  441

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS +++AI AKEGAHHVDL+FS+ EDPKWLKDVR++E+ II++W+SQYY
Sbjct  442  GGVLKNISSTIIAIVAKEGAHHVDLRFSSAEDPKWLKDVRQQELSIIEDWLSQYY  496



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ + KLYAA N+ YNY+ +  CFD  +  D       W WQ CTEMIMP  G+NK+SI
Sbjct  328  GNNRLAKLYAAANVYYNYTGKATCFDLDDNSD-PHDLGGWQWQACTEMIMPVGGSNKESI  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  EW Y  R  +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNGLRDPWSA
Sbjct  387  FPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSA  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK++VAI AK+GAHHVDL++S+KEDP+WLKDVR++EV II  WISQY+ 
Sbjct  447  GGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQ  502



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D  KKLY A ++ YNYS +  CFD  +  D       W+WQ CTEMIMP  GN + SI
Sbjct  334  GNDTFKKLYGAASVYYNYSGKATCFDLDDDSD-PHDLGGWSWQACTEMIMPMGGNTEVSI  392

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPASEW Y  R   C   F IEPRP WITTEFGGH+I+RVLK++GSNIIFFNGLRDPWS 
Sbjct  393  FPASEWKYKYRAASCMRNFGIEPRPLWITTEFGGHDIKRVLKRYGSNIIFFNGLRDPWSG  452

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISKS+VAI AKEGAHHVDL+F   EDP+WLK+VR++E+ II  WISQYYH
Sbjct  453  GGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPEWLKEVRKQEINIIGNWISQYYH  508



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A ++ YN+S    CFD  N  D       W+WQ CTEMI+P  GNNK+S+
Sbjct  318  GNDTFAKLYGAASVYYNHSGTATCFDLDNNSD-PHGLGGWSWQACTEMILPTGGNNKESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPAS W  N R  +C+  F I+PRPNW+  EFGGHNI+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  377  FPASSWSLNDRATYCQYAFHIQPRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRDPWSG  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+ ISKS++AI AK+GAHHVDL++++ EDPKWL+ VR++E++II +W+S+YY
Sbjct  437  GGVLEDISKSIIAIVAKKGAHHVDLRYASSEDPKWLQHVRKREIKIIAKWLSEYY  491



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A NI YNY+  V+CFD  N  D +    +W WQ CTEMI+P DGNNK+SI
Sbjct  328  GNDTFAKLYGAANIYYNYTGNVDCFDITNDSD-KHGLDEWTWQACTEMILPTDGNNKESI  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S  DYN R  +C   + ++PRP+WITTEFGG +I RVL+++ SNI+FFNG RDPWS 
Sbjct  387  FPTSNDDYNDRDLYCTSIYGVQPRPHWITTEFGGFDIHRVLRRYASNILFFNGRRDPWSG  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+IS SLVAI AKEGAHHVDL++ST+EDP WLK++R+ E+  I++W+S+YYH
Sbjct  447  GGVLKNISSSLVAIVAKEGAHHVDLRYSTEEDPNWLKEIRKTEIHHIKKWLSRYYH  502



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D   KLY A NI YNYS  V+CFD  +  D      +W WQ CTEMI+P  GN + SI
Sbjct  335  GDDDFAKLYGAANIYYNYSGGVSCFDLLDDSD-PHGLGEWAWQACTEMILPTGGNRETSI  393

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA E++YN RV  C   F + PRP WI  EFGGH+I R L++FGSNIIFFNGLRDPWS 
Sbjct  394  FPAHEYNYNDRVATCTSLFGVVPRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSG  453

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKSISKS+VAI A++GAHHVDL++ST EDP+WL+DVR+KE++II  WISQYY
Sbjct  454  GGVLKSISKSIVAIVAEKGAHHVDLRYSTNEDPEWLQDVRKKEIKIISGWISQYY  508



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 129/175 (74%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+    K+Y A N+ YNYS    CFD  +  D       W WQ CTEMI+  DGN ++SI
Sbjct  314  GNSTFAKMYGAANVYYNYSGNATCFDLADDSD-PHGVNGWYWQACTEMILITDGNREESI  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F AS + YN R ++CKD + +EPRPNW  TEFG HNI+R LK FGS+IIFFNGLRDPWS 
Sbjct  373  FTASNYSYNDRREYCKDKYGVEPRPNWAPTEFGAHNIKRALKNFGSSIIFFNGLRDPWSG  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK++S+SLVAI AKEGAHHVDL+FSTKEDPKWL DVR++E EII  W+S Y+
Sbjct  433  GGVLKNLSESLVAIVAKEGAHHVDLRFSTKEDPKWLVDVRKRETEIISTWLSHYH  487



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ + KL+AA ++ YNY+ +  CFD  +  D       W WQ CTEMIMP  G+NK+SI
Sbjct  329  GNNRLAKLHAAASVYYNYTGKARCFDLDDNSD-PHDLGGWQWQACTEMIMPVGGSNKESI  387

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  EW Y  R  +C   + ++PRP+WITTEFGGH IERVLK+  SNIIFFNGLRDPWS 
Sbjct  388  FPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSG  447

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+LVAI AK+GAHHVDL+FS+KEDP+WLKDVR+ EV II  WISQY+ 
Sbjct  448  GGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQ  503



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ + KL+AA ++ YNY+ +  CFD  +  D       W WQ CTEMIMP  G+NK+SI
Sbjct  329  GNNRLAKLHAAASVYYNYTGKARCFDLDDNSD-PHDLGGWQWQACTEMIMPVGGSNKESI  387

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  EW Y  R  +C   + ++PRP+WITTEFGGH +ERVLK+  SNIIFFNGLRDPWS 
Sbjct  388  FPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAVERVLKRSASNIIFFNGLRDPWSG  447

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+LVAI AK+GAHHVDL+FS+KEDP+WLKDVR+ EV II  WISQY+ 
Sbjct  448  GGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQ  503



>ref|XP_007203815.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
 gb|EMJ05014.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
Length=139

 Score =   219 bits (557),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  520  CTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKF  341
            CTEMIMP  G+NKDSIFPAS+WDY  +   CK  F IEPRP W+TTEFGGH+IERVLK++
Sbjct  2    CTEMIMPTSGSNKDSIFPASDWDYKDQASVCKSRFGIEPRPLWVTTEFGGHDIERVLKRY  61

Query  340  GSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEV  161
            GSNIIFFNGLRDPWS GGVLK+IS S+VAI AKEGAHHVDL F + EDP+WLKDVR++E+
Sbjct  62   GSNIIFFNGLRDPWSGGGVLKNISNSIVAIVAKEGAHHVDLMFKSSEDPEWLKDVRKQEI  121

Query  160  EIIQEWISQYYH  125
            +II +WISQYYH
Sbjct  122  KIIAKWISQYYH  133



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G + ++KLY A +I YNYS    CFD  +  D       W WQ C+EMIMP   ++K+SI
Sbjct  322  GKNTLEKLYDAASIYYNYSGTSKCFDLNDHSD-PHDLGGWQWQACSEMIMPEGASSKESI  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S+W    R  +CK  + + PRPNWIT+EFGGHNIE VLK+   NIIFFNGLRDPWS 
Sbjct  381  FPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVLK+ISK+++AI AKEGAHHVDL++STKEDPKWLKDVR++EV+II+ WISQY+ 
Sbjct  441  GGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWISQYHQ  496



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D   KLY A NI YNYS  ++CFD  +  D     + W WQ CTEM+MP DGN + SI
Sbjct  287  GDDDFAKLYGAANIYYNYSGGISCFDLMDDSD-PHGLSGWGWQACTEMVMPIDGNRETSI  345

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y   +  C     +  RP WI  EFGGH+I R L++FGSNIIFFNGLRDPWS 
Sbjct  346  FPAYKYNYTDTISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSG  405

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKSISKS+VAI A++GAHHVDL++ST EDP+WL+DVR+KE++II  WISQYY
Sbjct  406  GGVLKSISKSIVAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQYY  460



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   KLY A N+ YNY+    CFD  +  D      +W WQ CTEMIMP + NN++SI
Sbjct  315  GNDTFAKLYGAANVYYNYTGTAACFDLADDSD-PHGLGEWTWQACTEMIMPVNANNEESI  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S W+Y+ R  FCK  F IEPRPNWITTEFGGH+I+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  374  FPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSG  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDV  176
            GGVL+SISKS+VAI AK+GAHHVDL+F+T EDP+WL++ 
Sbjct  434  GGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQBA  472



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D   KLY A NI YNYS  ++CFD  +  D     + W WQ CTEM+MP DGN + SI
Sbjct  337  GDDDFAKLYGAANIYYNYSGGISCFDLMDDSD-PHGLSGWGWQACTEMVMPIDGNRETSI  395

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y   +  C     +  RP WI  EFGGH+I R L++FGSNIIFFNGLRDPWS 
Sbjct  396  FPAYKYNYTDTISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSG  455

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKSISKS+VAI A++GAHHVDL++ST EDP+WL+DVR+KE++II  WISQYY
Sbjct  456  GGVLKSISKSIVAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQYY  510



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG-NPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            G+D   +LY A+NI YNY+ +  CFD   + LD       WNWQ CTEMI+P  G +++S
Sbjct  316  GNDTFARLYGAMNIYYNYTGKATCFDVNTDSLDDTVGTDGWNWQSCTEMILPTGGRSEES  375

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FPA+++ Y+    FC+  + + PRP+WITTEFGGH+I RVLK+FGSNIIFFNGLRDPWS
Sbjct  376  MFPANKYSYDDNAGFCESYYGVAPRPHWITTEFGGHDITRVLKRFGSNIIFFNGLRDPWS  435

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVLKS++ SL A+   +GAHHVDL++STKEDP WL++VRRKE+ II  W +Q+Y
Sbjct  436  GGGVLKSLNPSLKAMVVPQGAHHVDLRYSTKEDPMWLQNVRRKEINIIAGWTNQFY  491



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = -3

Query  634  KLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEW  455
            KLYAA NI YNY+    CF   N          W+WQ CTE+IMP   NN+ S+FP  +W
Sbjct  333  KLYAAANIFYNYTGTATCFFLDNT---TAPLGGWDWQACTELIMPLGANNEGSMFPPYKW  389

Query  454  DYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKS  275
                   +CK  + I+PRP+WITTEFGGH+I+RVLK+ GSNIIFFNGLRDPWS GGVLK+
Sbjct  390  KLRDVEFYCKRVYHIQPRPHWITTEFGGHDIKRVLKRSGSNIIFFNGLRDPWSGGGVLKN  449

Query  274  ISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            IS+++VAI AKEGAHHVDL+FST EDP+WLKD+R++E++II  WISQYY 
Sbjct  450  ISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREIKIIANWISQYYQ  499



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 126/175 (72%), Gaps = 0/175 (0%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   +LY A+NI YNYS    C   G   D    A  W+WQ CTEM +   G+N +SI
Sbjct  321  GNDTFARLYGAMNIYYNYSGTETCLAAGGDSDEHGMARGWSWQSCTEMTIVEGGSNNESI  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P + ++Y  +   C++ + + PRP+WITTEFGGH+I RVLK+FGSNIIFFNGLRDPWS 
Sbjct  381  LPPATYNYTEQAVACQNYYGVAPRPHWITTEFGGHDIRRVLKRFGSNIIFFNGLRDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKS+S SL+AI A EGAHHVDL+FSTKEDPKWLK VR KE +II  W+ QYY
Sbjct  441  GGVLKSLSNSLIAIVAPEGAHHVDLRFSTKEDPKWLKTVRTKENKIIAGWLEQYY  495



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  646  DPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFP  467
            D + KLYAA ++ YNY+    CFD  +  D       W WQ CTEMIMP  G+NK SIFP
Sbjct  328  DGLGKLYAAASVYYNYTGTATCFDLDDDSD-PHDLGGWQWQACTEMIMPVGGSNKHSIFP  386

Query  466  ASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGG  287
               W Y  R   C+  + + PRP+WITTEFGGH I+ VLK+  SNIIFFNGLRDPWS GG
Sbjct  387  EYVWSYQDRASACQFFYNVTPRPHWITTEFGGHAIQTVLKRSASNIIFFNGLRDPWSGGG  446

Query  286  VLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            VLK+ISK++VAI  K GAHHVDL++S KEDPKWLKDVRR+EV II  WISQYY 
Sbjct  447  VLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWLKDVRRQEVNIIASWISQYYQ  500



>gb|KDO70538.1| hypothetical protein CISIN_1g0106562mg, partial [Citrus sinensis]
Length=137

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  520  CTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKF  341
            CTEMIM   G+NKDSIF  SE DY+ R ++CK+ + ++PRPNWITTEFGGH I  VLK+F
Sbjct  2    CTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRF  61

Query  340  GSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEV  161
             SNIIFFNGLRDPWS GGVLK+ISK+++A+  KEGAHHVDL+FSTKEDP+WLKDVRR+EV
Sbjct  62   ASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREV  121

Query  160  EIIQEWISQYYH  125
            EII +WISQY+ 
Sbjct  122  EIIGKWISQYFQ  133



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   +LY A+NI YNYS    CF      D       W WQ C EMI+P   +N +SI
Sbjct  322  GNDTFTRLYGAMNIYYNYSGTETCFVTVGS-DEHGMDDGWEWQSCMEMILPTGASNNESI  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S ++Y  +   C++ + + PRP+WITTEFGGH+I RVLK+ GSNIIFFNGLRDPWS 
Sbjct  381  FPPSTYNYTDQAVGCQEYYYVAPRPHWITTEFGGHDIRRVLKRSGSNIIFFNGLRDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKS+SKSL+AI   EGAHHVDL+FSTKEDPKWLK VR KEV+II  W+ QYY
Sbjct  441  GGVLKSLSKSLIAIVEPEGAHHVDLRFSTKEDPKWLKAVRMKEVKIISRWLEQYY  495



>gb|ABR17682.1| unknown [Picea sitchensis]
Length=501

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFD--PGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            +D + +LY   N+ YNY+   +CFD  P +P         W +Q CTEM+MP   + K S
Sbjct  321  TDLLSQLYGVANVYYNYTGRSSCFDIRPSDP----HGEDGWQFQACTEMVMPMADDPKKS  376

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP S +DY  RV  C+  + ++PR +WITT++GGH+I+RVLK F SNIIFFNGLRDPWS
Sbjct  377  MFPNSTFDYQERVDSCESAYGVQPRRHWITTQYGGHHIKRVLKNFASNIIFFNGLRDPWS  436

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL+ I++S+VAI AKEGAHHVD +F+TK+DP+WLKD R KE+ II+ W+ QYY
Sbjct  437  GGGVLEDINESVVAIVAKEGAHHVDFRFATKDDPQWLKDARTKEISIIKSWLQQYY  492



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G +  K +Y A NI YNY+ +  CF+  +  D       W +Q CTEM++   G  ++SI
Sbjct  340  GDEQFKGIYEAANIFYNYTGDSMCFNLSDNSD-RHGLNGWGFQACTEMLLATGGRTQESI  398

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   ++Y    ++C+ ++ I PRP+WITT FGGH+I+RVLK+FGSNIIFFNGLRDPWS 
Sbjct  399  FPPYTYNYTQTQEYCQQSYGINPRPHWITTHFGGHDIKRVLKRFGSNIIFFNGLRDPWSG  458

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+++S S+VA+ AKEGAHH+DL+FST+ DP WL +VR++E+ I+  W+ QYY
Sbjct  459  GGVLENLSDSIVALVAKEGAHHIDLRFSTEGDPMWLSEVRKREIHILSMWLEQYY  513



>emb|CDM83096.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 120/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  ++++YA VNI YNY+  V+CFD     D       W+WQ CTEM+MP   +   S+
Sbjct  325  GSSILERIYAGVNIYYNYTGTVDCFDLD---DDPHGMGGWDWQACTEMVMPMSSSEGLSM  381

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E+DY      C   F + PRP WI+TEFGGHNI  VL+KFGSNIIFFNGL DPWS 
Sbjct  382  FPPDEFDYELYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWSG  441

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ +TKEDP WL  +R  E+EII  W+S +Y
Sbjct  442  GGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELEIISGWLSDHY  496



>ref|XP_002438751.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
 gb|EER90118.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
Length=192

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 128/178 (72%), Gaps = 6/178 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKD  479
            +D ++K++AA ++ YNY+ +  C    D  +P   + S   W WQ CTEMIMP   +N +
Sbjct  12   ADILEKVFAAASLFYNYTGDQTCNHIEDKDSPRSLDLS--YWRWQACTEMIMPMSSSN-E  68

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            S+FP S + Y  R  +C   F + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPW
Sbjct  69   SMFPPSTFSYEDRFNYCFRFFGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPW  128

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            S GGVLK+IS S+VA+  ++GAHH+DL+ +TK+DP W+ + RR+EVEIIQ WI QYY 
Sbjct  129  SGGGVLKNISSSIVALVTEKGAHHLDLRGATKDDPDWVIEQRRQEVEIIQGWIDQYYQ  186



>gb|ABK95653.1| unknown [Populus trichocarpa]
Length=213

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++AA ++ YNYSR   CF   +  D       WNWQ CTEM+MP   + ++S+
Sbjct  32   GASKITRVFAAASLYYNYSRAEKCFKLEHGPD-AHGLHGWNWQACTEMVMPMTCS-EESM  89

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + C  TF ++PRP+WITTEFGG  I+ VLK+ G NIIF NG++DPWS 
Sbjct  90   FPTSSFSYKEFAEDCMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSR  149

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  ++GAHHVD + +TK+DP+WLK++RR+EVEIIQ WI QYY
Sbjct  150  GGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  204



>ref|NP_001136852.1| uncharacterized protein LOC100217003 [Zea mays]
 gb|ACF82763.1| unknown [Zea mays]
Length=319

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP   + + S+
Sbjct  130  GTGTLERIYAGVNVYYNYTGTVDCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEQRSM  186

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY    + C  ++ + PRP WITTEFGGHNI +VL+ FGSNIIFFNGL DPWS 
Sbjct  187  YPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSG  246

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ +T +DP WL  +R  E+EII  W+  YY
Sbjct  247  GGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  301



>ref|XP_003569899.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=512

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 117/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VNI YNY+  V+CFD     D       W WQ CTEM+MP   +   S+
Sbjct  321  GTSTLERIYAGVNIYYNYTGTVDCFDLD---DDPHGMGGWQWQACTEMVMPMSSSESLSM  377

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E+DY      C  +F + P P WITTEFGGHNI  VL+KFGSNIIFFNGL DPWS 
Sbjct  378  FPPYEFDYASYADDCVKSFGVRPSPRWITTEFGGHNISAVLEKFGSNIIFFNGLLDPWSG  437

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VAI A  GAHH+DL+ +TKEDP WL  +R  E+ II  W+S +Y
Sbjct  438  GGVLKNISGSVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELGIISGWLSDHY  492



>ref|XP_006646360.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=500

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 120/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VNI YNY+   +CFD     D       W+WQ CTEM+MP   +   S+
Sbjct  310  GTSILERIYAGVNIYYNYTGTFDCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEDGSM  366

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++DY      C  +F + PRP WITTEFGGHNI  VL++FGSNIIFFNGL DPWS 
Sbjct  367  FPAYKFDYASYENDCISSFGVRPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSG  426

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ +TK DP WL  +R+ E++II  W+  YY
Sbjct  427  GGVLKNISESVVAIVAPLGAHHIDLRPATKADPDWLVSIRKSELDIISGWLLDYY  481



>gb|KHN33176.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=420

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  520  CTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKF  341
            CTE+IMP   NN+ S+FP  +W       +CK  + I+PRP+WITTEFGGH+I+RVLK+ 
Sbjct  284  CTELIMPLGANNEGSMFPPYKWKLRDVEFYCKRVYHIQPRPHWITTEFGGHDIKRVLKRS  343

Query  340  GSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEV  161
            GSNIIFFNGLRDPWS GGVLK+IS+++VAI AKEGAHHVDL+FST EDP+WLKD+R++E+
Sbjct  344  GSNIIFFNGLRDPWSGGGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREI  403

Query  160  EIIQEWISQYYH  125
            +II  WISQYY 
Sbjct  404  KIIANWISQYYQ  415



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  520  CTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKF  341
            C+EMIMP   ++K+SIFP S+W    R  +CK  + + PRPNWIT+EFGGHNIE VLK+ 
Sbjct  331  CSEMIMPEGASSKESIFPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRS  390

Query  340  GSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEV  161
              NIIFFNGLRDPWS GGVLK+ISK+++AI AKEGAHHVDL++STKEDPKWLKDVR++EV
Sbjct  391  VGNIIFFNGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEV  450

Query  160  EIIQEWISQYYH  125
            +II+ WISQY+ 
Sbjct  451  KIIESWISQYHQ  462



>ref|NP_001044360.1| Os01g0767100 [Oryza sativa Japonica Group]
 dbj|BAD53352.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD53324.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06274.1| Os01g0767100 [Oryza sativa Japonica Group]
Length=517

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP    ++DS+
Sbjct  325  GTSILERIYAGVNVYYNYTGTVDCFDLN---DDPHGMDGWDWQACTEMVMPMS-YSEDSM  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y    + C ++F +EPRP WITTEFGGHNI  VL++FGSNIIFFNGL DPWS 
Sbjct  381  FPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ ++K+DP WL  +R  E+ II  W+S YY
Sbjct  441  GGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  495



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + + +AA ++ YNYSR  NCF+  + +D       W+WQ CTEM+MP   + K+S+
Sbjct  320  GATKLSRSFAAASLYYNYSRAENCFEIEHEVD-THGLHGWDWQTCTEMVMPMTCS-KESM  377

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S +DY    + C+  +++ PRP+WITTEFGG  I++VLKKFGSNIIF NG++DPWS 
Sbjct  378  FPPSGFDYEEFAEQCQMKYEVLPRPHWITTEFGGERIQKVLKKFGSNIIFSNGMQDPWSR  437

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHHVD + +TK+DP WL + RR+EVEIIQ+W+++YY
Sbjct  438  GGVLKNISASIIALVTKKGAHHVDFRSATKDDPDWLVEQRRQEVEIIQKWLNEYY  492



>gb|EAZ13666.1| hypothetical protein OsJ_03583 [Oryza sativa Japonica Group]
Length=549

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP    ++DS+
Sbjct  357  GTSILERIYAGVNVYYNYTGTVDCFDLN---DDPHGMDGWDWQACTEMVMPMS-YSEDSM  412

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y    + C ++F +EPRP WITTEFGGHNI  VL++FGSNIIFFNGL DPWS 
Sbjct  413  FPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSG  472

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ ++K+DP WL  +R  E+ II  W+S YY
Sbjct  473  GGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>gb|EAY75958.1| hypothetical protein OsI_03875 [Oryza sativa Indica Group]
Length=549

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP    ++DS+
Sbjct  357  GTSILERIYAGVNVYYNYTGTVDCFDLN---DDPHGMDGWDWQACTEMVMPMS-YSEDSM  412

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y    + C ++F +EPRP WITTEFGGHNI  VL++FGSNIIFFNGL DPWS 
Sbjct  413  FPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSG  472

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ ++K+DP WL  +R  E+ II  W+S YY
Sbjct  473  GGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            S  ++++YA VNI YNY+  V+CFD     D       W+WQ CTEM+MP   +   S+F
Sbjct  325  SSILERIYAGVNIYYNYTGTVHCFDLD---DDPHGMGGWDWQACTEMVMPMSSSEGLSMF  381

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P  E+DY      C   F + PRP WI+TEFGGHNI  VL+KF SNIIFFNGL DPWS G
Sbjct  382  PPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFSSNIIFFNGLLDPWSGG  441

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GVLK+IS S+VAI A  GAHH+DL+ +TKEDP WL  +R  E+EII  W+S +Y
Sbjct  442  GVLKNISDSVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELEIISGWLSDHY  495



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             G+  + K+++A ++ YNYS + +CFD  N  D       W+WQ CTEM+MP   +N +S
Sbjct  222  QGASKLTKVFSAASLYYNYSGDQSCFDIENGTD-PHGLHGWDWQACTEMVMPMICSN-ES  279

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP+S +DY+     C   + + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS
Sbjct  280  MFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWS  339

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL++IS S++A+  ++GAHH+DL+++TK+DPKWL + R++E++IIQ WI QY+
Sbjct  340  RGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYH  395



>gb|AGT17295.1| hypothetical protein SHCRBa_168_J15_F_160 [Saccharum hybrid cultivar 
R570]
Length=523

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V CFD     D       W+WQ CTEM+MP   +   S+
Sbjct  334  GTSTLERIYAGVNVYYNYTGTVGCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEVRSM  390

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY    + C  ++ + PRP WITTEFGGHNI +VL+KFGSNIIFFNGL DPWS 
Sbjct  391  YPPYKFDYPSYAEDCIKSYGVRPRPRWITTEFGGHNITKVLEKFGSNIIFFNGLLDPWSG  450

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S++AI A  GAHH+DL+ +T +DP WL  +R  E++II  W+S YY
Sbjct  451  GGVLKNISESVIAIVAPLGAHHIDLRPATPDDPDWLVALRESELKIISGWLSDYY  505



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  +++++  V++ YNY+ EV+CF      D       WNWQ CTEM+MP   +   S+
Sbjct  330  GSSILERIFNGVSVYYNYTGEVDCFQLD---DDPHGMDGWNWQACTEMVMPMSSDRNTSM  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++DY+   + C+  F++ PRP WITTEFGGH+IE VLK FGSNIIF NGL DPWS 
Sbjct  387  FPAYDYDYSAFQEECRRDFQVTPRPRWITTEFGGHDIEHVLKFFGSNIIFSNGLLDPWSG  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS+++VA+  +EGAHH+DL+ ST EDP WL + R  E+E+I+ W+  Y
Sbjct  447  GGVLKNISQTIVALVTEEGAHHIDLRASTTEDPDWLVEQRETEIELIEGWLDNY  500



>gb|AFK45793.1| unknown [Lotus japonicus]
Length=212

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+ E  CF+     D     + WNWQ CTEM+MP   + + S+
Sbjct  32   GTSILERIYEGVNVYYNYTGEAKCFELD---DDPHGLSGWNWQACTEMVMPMSSSQESSM  88

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y   ++ C  +F +EPRP WITTEFGGHNI   LKKFGSNIIF N L DPWS 
Sbjct  89   FPPYEYNYTSYLEDCIKSFGVEPRPKWITTEFGGHNILAPLKKFGSNIIFSNSLLDPWSG  148

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL++I +S+V +  KEGAHH++L+ ST  DP WL + R  E+++IQ WIS YY
Sbjct  149  GSVLQNIFESIVFLVTKEGAHHINLRASTGNDPDWLVEQRATEIKLIQGWISDYY  203



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  V +++AA ++ YNYSR   CF   N  D       WNWQ CTEM+MP   + K+S+
Sbjct  319  GASKVSRVFAAASLYYNYSRGEKCFQLENVPD-AHGLHGWNWQACTEMVMPMTCS-KESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S +DY    + CK  F + PR +WITTEFGG  I++VLK+FGSNIIF NG+ DPWS 
Sbjct  377  FPPSGYDYKEFAEECKKKFGVMPRQHWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++AI  K+GAHHVD + +TK+DP WLK++R++E++II  WI +YY
Sbjct  437  GGVLKNISSSIIAIVTKKGAHHVDFRSATKDDPNWLKEMRKQEIQIIGRWIDEYY  491



>ref|XP_002458558.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
 gb|EES03678.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
Length=518

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V CFD     D       W+WQ CTEM+MP   +   S+
Sbjct  329  GTSTLERIYAGVNVYYNYTGTVGCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEGRSM  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY      C  ++ + PRP WITTEFGGHNI  VL+KFGSNIIFFNGL DPWS 
Sbjct  386  YPPYKFDYPSYADGCIKSYGVRPRPRWITTEFGGHNITTVLEKFGSNIIFFNGLLDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S++AI A  GAHH+DL+ +T +DP WL  +R  E++II  W+S YY
Sbjct  446  GGVLKNISESVIAIVAPLGAHHIDLRPATPDDPDWLVALRESELKIISGWLSDYY  500



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            +++ +AA ++ YNYS  V CFD  N  D       W WQ CTEM+MP   +N+    P  
Sbjct  325  LERAFAAASLYYNYSGSVTCFDMENHTD-SHGLNGWGWQACTEMVMPMSCSNQTMFRPFE  383

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
              D     ++C   + ++PRPNWITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVL
Sbjct  384  SDDEKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVL  443

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            K+IS S++A+  ++GAHH DL+ +TK+DP+WLK  RR+EV II++WIS+YY+
Sbjct  444  KNISSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYN  495



>ref|XP_008654499.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654500.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654501.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654502.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654503.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654504.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654505.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 gb|AFW84964.1| putative serine peptidase S28 family protein [Zea mays]
Length=517

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP   + + S+
Sbjct  328  GTGTLERIYAGVNVYYNYTGTVDCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEQRSM  384

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY    + C  ++ + PRP WITTEFGGHNI +VL+ FGSNIIFFNGL DPWS 
Sbjct  385  YPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSG  444

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ +T +DP WL  +R  E+EII  W+  YY
Sbjct  445  GGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  499



>gb|AFW84965.1| putative serine peptidase S28 family protein [Zea mays]
Length=515

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V+CFD     D       W+WQ CTEM+MP   + + S+
Sbjct  326  GTGTLERIYAGVNVYYNYTGTVDCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEQRSM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY    + C  ++ + PRP WITTEFGGHNI +VL+ FGSNIIFFNGL DPWS 
Sbjct  383  YPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSG  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S+VAI A  GAHH+DL+ +T +DP WL  +R  E+EII  W+  YY
Sbjct  443  GGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  497



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 127/171 (74%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + + +AA ++ YNYSR  NCF   + +D       W+WQ CTEM+MP   + K+S+FP S
Sbjct  321  LSRAFAAASLYYNYSRSENCFKIEHEVD-GHGLHGWDWQTCTEMVMPMTCS-KESMFPPS  378

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
             +DY    + C+  + + PRP+WITTEFGG  I++VLK+FGSNIIF NG++DPWS GGVL
Sbjct  379  GFDYEEFAEQCRMKYCVSPRPHWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGVL  438

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S++A+  ++GAHHVD + +TK+DPKWL  +R++EVEIIQ+W+++YY
Sbjct  439  KNISSSIIALVTEKGAHHVDFRSATKKDPKWLIQLRKQEVEIIQKWLNEYY  489



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++AA ++ YNYS    CFD G+  D     + W WQ CTEM+MP   ++ + +
Sbjct  325  GASDLERVFAAASLYYNYSGSEKCFDIGHEED-AHGLSGWGWQACTEMVMPMSCSD-ECM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F   E DY G  + C   F ++PRP+WITTEFGG  IE+VLK+FGSNIIF NG++DPWS 
Sbjct  383  FQPFEEDYKGFEENCVFRFGVKPRPHWITTEFGGQRIEKVLKRFGSNIIFSNGMQDPWSR  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+  T+EDP WLK+ RR+EV IIQ+WI +YY
Sbjct  443  GGVLKNISSSIIALVTKQGAHHADLRRETEEDPDWLKEQRRQEVAIIQKWIDEYY  497



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D + K+++A ++ YNYS   +CFD  N  D       W+WQ CTEM+MP   +N +S+
Sbjct  329  GEDILIKVFSAASLYYNYSSTNSCFDIENGSD-PHGLHGWDWQACTEMVMPMTSSN-ESM  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S +DY      C   +++ PRP+WITTE+GG+ IE VLK+FGSNIIF NG+RDPWS 
Sbjct  387  FPPSTYDYKEFGDQCMTKYEVRPRPHWITTEYGGNKIELVLKRFGSNIIFSNGMRDPWSR  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+    GAHH+D + +TK+DPKWLK+ R  EV+IIQ WI QYY
Sbjct  447  GGVLKNISSSIIALVTPLGAHHLDFRAATKDDPKWLKEQRETEVKIIQAWIDQYY  501



>ref|XP_004970093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=565

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 119/175 (68%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++YA VN+ YNY+  V CFD     D       W+WQ CTEM+MP   +   S+
Sbjct  376  GTSILERIYAGVNVYYNYTGTVGCFDLN---DDPHGMGGWDWQACTEMVMPMSYSEDRSM  432

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  ++DY    + C  ++ + PRP WITT FGGHNI  VL+KFGSNIIFFNGL DPWS 
Sbjct  433  YPPYKFDYASYAENCIKSYGVRPRPRWITTNFGGHNITTVLEKFGSNIIFFNGLLDPWSG  492

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS+S++AI A  GAHH+DL+ +T +DP WL  +R  E++II  W+S YY
Sbjct  493  GGVLKNISESVIAIVAPLGAHHIDLRPATSDDPDWLVSLRESELKIISGWLSDYY  547



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++AA ++ YNYSR   CF   +  D       WNWQ CTEM+MP   + ++S+
Sbjct  319  GASKITRVFAAASLYYNYSRAEKCFKLEHGPD-AHGLHGWNWQACTEMVMPMTCS-EESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + C  TF ++PRP+WITTEFGG  I+ VLK+ G NIIF NG++DPWS 
Sbjct  377  FPTSSFSYKEFAEDCMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  ++GAHHVD + +TK+DP+WLK++RR+EVEIIQ WI QYY
Sbjct  437  GGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             G+  + K+++A ++ YNYS + +CFD  N  D       W+WQ CTEM+MP   +N +S
Sbjct  347  QGASKLTKVFSAASLYYNYSGDQSCFDIENGTD-PHGLHGWDWQACTEMVMPMICSN-ES  404

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP+S +DY+     C   + + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS
Sbjct  405  MFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWS  464

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL++IS S++A+  ++GAHH+DL+++TK+DPKWL + R++E++IIQ WI QY+
Sbjct  465  RGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYH  520



>ref|XP_011017986.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Populus 
euphratica]
Length=410

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++AA ++ YNYSR   CF   +  D       WNWQ CTEM+MP    +++S+
Sbjct  229  GASKITRVFAAASLYYNYSRAEKCFKLEHGPD-AHGLHGWNWQACTEMVMPMT-CSEESM  286

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + C  TF ++PR +WITTEFGG  I+ VLK+ G NIIF NG++DPWS 
Sbjct  287  FPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSR  346

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  ++GAHHVD + +TK+DP+WLK++RR+EVEIIQ WI QYY
Sbjct  347  GGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  401



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 119/170 (70%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + ++YA V++ YNY+  ++CF+     D       WNWQ CTEM+MP   +  +S+FPA 
Sbjct  337  LDRIYAGVSVYYNYTGNIDCFELD---DDPHGLDGWNWQACTEMVMPMSSSQGNSMFPAD  393

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C +TF++ PRP W+TTEFGGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  394  DFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGLLDPWSGGSVL  453

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S S++A+  KEGAHH+DL+ ST EDPKWL D R  E+ +IQ WI  Y
Sbjct  454  KNLSNSIIALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  503



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+   P D +     W +Q CTEM+MP   +N+ S+
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTD-DHGLDGWGYQACTEMVMPMSCSNQ-SM  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  373  FPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIESVLKRFGSNIIFSNGMQDPWSR  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ +TK DP+WLK+ RR+EV II++WIS+YY
Sbjct  433  GGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYY  487



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + K++AA ++ YNYS    CF+  N  D     + W+WQ CTEM+MP   +N+ S+FP S
Sbjct  321  LDKVFAAASLYYNYSHGEKCFNVENGPDL-HGLSGWDWQACTEMVMPMTCSNQ-SMFPPS  378

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            E+DY      CK  + + PRP+WITTEFGG  IE VLK+FGSN+IF NG++DPWS GGVL
Sbjct  379  EFDYEEFATDCKKKYGVSPRPHWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGVL  438

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            ++IS S++AI  ++GAHHVD + +TK+DP WL + R++EVEII +WI++YY
Sbjct  439  RNISTSIIAIVTEKGAHHVDFRSATKDDPDWLVEQRKQEVEIIHQWINEYY  489



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+   P D +     W WQ CTEM+MP   +N+ S+
Sbjct  317  GSSNLDRAFAAASLYYNYSGSKKCFEMEQPTD-DHGLDGWGWQACTEMVMPMSISNQ-SM  374

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  + DY      C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  375  FPPYDNDYEAFQDQCMGRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSR  434

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK+DP+WLK+ R +EV II++WI+QYY
Sbjct  435  GGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRMQEVTIIEQWITQYY  489



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+   P D +     W +Q CTEM+MP   +N+ S+
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTD-DHGLDGWGYQACTEMVMPMSCSNQ-SM  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  373  FPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKKIETVLKRFGSNIIFSNGMQDPWSR  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ +TK DP+WLK+ RR+EV II++WIS+YY
Sbjct  433  GGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYY  487



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+   P D +     W +Q CTEM+MP   +N+ S+
Sbjct  347  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTD-DHGLDGWGYQACTEMVMPMSCSNQ-SM  404

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NGL+DPWS 
Sbjct  405  FPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGLQDPWSR  464

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ +TK DP+WLK+ RR+EV I+++WIS+YY
Sbjct  465  GGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIVEKWISEYY  519



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKD  479
            +D ++K++AA ++ YNY+ +  C    D GNP     +   W WQ CTE++MP    N D
Sbjct  352  ADILEKVFAAASLYYNYTGDQTCNQIEDEGNPRCLNLN--YWGWQACTELMMPMSSAN-D  408

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            S+FP   + Y  +  +C  TF + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPW
Sbjct  409  SMFPPHTFSYEDKANYCLQTFGVRPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPW  468

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            S GGVLK+IS S+VA+  ++GAHH+DL+ +TK+DP W+ + RR+EVEII  WI QYY
Sbjct  469  SRGGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYY  525



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + ++ AA ++ YNYSR   CF   N  D       W+WQ CTEM+MP   + KDS+FP S
Sbjct  319  LSRVVAAASLYYNYSRTEKCFKIENATD-AHGLHGWDWQACTEMVMPMTCS-KDSMFPPS  376

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
             +DY    + C   + + PRP+WITTEFGG+ IE+VLK+FGSNIIF NG++DPWS G VL
Sbjct  377  TFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGSVL  436

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S++A+  ++GAHHVD + +TKEDP WL + RR+EVEIIQ WI++Y+
Sbjct  437  KNISASIIALATEKGAHHVDFRSATKEDPDWLVEQRRQEVEIIQRWINEYH  487



>gb|AIA26578.1| serine protease [Cicer arietinum]
Length=379

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+ E  CF+     D       WNWQ CTEM+MP   + + S+
Sbjct  199  GTSILERIYEGVNVYYNYTGEAKCFELD---DDPHGLDGWNWQACTEMVMPMSSSQESSM  255

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y    + C   F ++PRP WITTEFGGHNI   LKKFGSNIIF NGL DPWS 
Sbjct  256  FPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWSG  315

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+V++  +EGAHH+DL+ ST+ DP WL + R  E+++I+ WI++YY 
Sbjct  316  GSVLQNISESIVSLVTQEGAHHLDLRASTENDPDWLIEQRATEIKLIEGWINEYYQ  371



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
             S  +++ +AA ++ YNYS    CFD  N  D     A W WQ CTEM+MP   +N+ S+
Sbjct  316  ASSNLERAFAAASLYYNYSGSEICFDMENQTD-PHGLAFWGWQACTEMVMPMSSSNQ-SM  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E D  G  + C   + ++ RP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  374  FPPFENDDEGEQELCMLAYGVKSRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSR  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ +TK DP+WLK+ RR+EV II++WI++YY
Sbjct  434  GGVLKNISNSIIALVTKKGAHHTDLRAATKYDPEWLKEQRRQEVAIIEKWINEYY  488



>gb|EMT22762.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=269

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V+K +AA ++ YNY+ +  CF      D     + W+WQ CTEM+MP   +N +S+
Sbjct  32   GADVVEKAFAAASLYYNYTGDQKCFQVEGGDD-PHGLSGWDWQACTEMVMPTTVSN-ESM  89

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y  R + C  ++ + PR +WITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  90   FPPFNFSYEERSERCLASYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  149

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EVEII  WI QY
Sbjct  150  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  203



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G   + + +AA ++ YNYS+  NCF+    +D       W+WQ CTEM+MP   +N +S+
Sbjct  323  GETKLSRAFAAASLYYNYSQTENCFEVEYEVD-PHGLHGWHWQTCTEMVMPMTCSN-ESM  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S +DY    + C+  + + PRP+WITTEFGG  IE+VLK+FGSNIIF NG++DPWS 
Sbjct  381  FPPSGFDYKRFAEQCRMKYGVLPRPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSR  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS +++A+  ++GAHHVD + +TK+DP WL   RR+EVEIIQ W+ +YY
Sbjct  441  GGVLRNISATIIALVTEKGAHHVDFRAATKDDPDWLIQQRRQEVEIIQRWLDEYY  495



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 122/173 (71%), Gaps = 9/173 (5%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            + +++A +++ YNY+  V+CF   D  + LD       WNWQ CTEM+MP   N + S+F
Sbjct  333  LDRIFAGISVYYNYTGNVDCFKLDDDPHGLD------GWNWQACTEMVMPMSSNQEKSMF  386

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            PA +++Y+   + C +TF++ PRP W+TTEFGGH+IE  LK FGSNIIF NG+ DPWS G
Sbjct  387  PAYDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGMLDPWSGG  446

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             VLK++S ++VA+  KEGAHH+DL+ ST EDPKWL D R  E+++IQ WI  Y
Sbjct  447  SVLKNLSNTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIQLIQGWIETY  499



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLNGWQYQACTEMVMPMSCSNQ-SM  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  + DY    + C  T+ ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  373  LPPYDNDYEAFQEQCMSTYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSR  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK+DP+WLK+ RR+EV II++WIS+YY
Sbjct  433  GGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVSIIEKWISEYY  487



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + K +AA ++ YNYS    CF+  N  D     + WNWQ CTEM+MP   +N+ S+FP S
Sbjct  321  LNKAFAAASLYYNYSHGEKCFNVENGPDL-HGLSGWNWQACTEMVMPMTCSNQ-SMFPPS  378

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            ++DY      CK  + + PRP+WITTE+GG  IE VLK+FGSNIIF NG++DPWS GGVL
Sbjct  379  KFDYEEFATDCKKKYGVSPRPHWITTEYGGERIEEVLKRFGSNIIFSNGMQDPWSRGGVL  438

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            ++IS S+VA+  ++GAHHVD + +TK+DP WL + RR+EVEII +WI+++Y
Sbjct  439  RNISTSIVALVTEKGAHHVDFRSATKDDPDWLVEQRRQEVEIIHQWINEHY  489



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+   P D +     W WQ CTEM+MP   +N+ S+
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTD-DHGLDGWGWQACTEMVMPMSCSNQ-SM  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  + DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  373  FPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSR  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ ++K DP+WLK+ RR+EV II++WIS+Y+
Sbjct  433  GGVLKNISSSIIALVTKKGAHHADLRAASKGDPEWLKEQRRQEVAIIEKWISEYH  487



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + ++YA V++ YNY+  V+CF+     D       WNWQ CTEM+MP   + ++S+FPA 
Sbjct  328  LDRIYAGVSVYYNYTGNVDCFELD---DDPHGLDGWNWQACTEMVMPMSSSQENSMFPAD  384

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C DTF++ PRP W TTEFGGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  385  DFNYSSYKEECWDTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVL  444

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  KEGAHH+DL+ ST  DPKWL D R  E+ +I+ WI  Y
Sbjct  445  KNLSDTIVALVTKEGAHHLDLRPSTPNDPKWLVDQREAEIGLIEGWIETY  494



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 2/173 (1%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            +D + K++AA ++ YNYS    CFD  N  D       WNWQ CTEM+MP   + +  +F
Sbjct  317  TDTLVKVFAAASVYYNYSSTKKCFDMENASD-AHGLHGWNWQACTEMVMPMSCSQQ-GMF  374

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P S + Y      C   + ++ RP+WITTEFGGHNIE VLK+FGSNIIF NG+ DPWS G
Sbjct  375  PPSTFSYKEIEDDCMKKYGVKARPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSRG  434

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GVLK+IS S+VA+  ++GAHH+D +F+T++DP+WL + RR+E+E+IQ WI +Y
Sbjct  435  GVLKNISSSIVALVTEKGAHHLDFRFATRQDPRWLVEQRRQEIELIQGWIHEY  487



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+ E  CF+     D     + W WQ CTEM+MP   + + S+
Sbjct  333  GTSILERIYEGVNVYYNYTGEAKCFELD---DDPHGMSGWEWQACTEMVMPMSSSQESSM  389

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y      C   F ++PRP WITTEFGGH+I   LKKFGSNIIF NGL DPWS 
Sbjct  390  FPPYEYNYTSIQAECLKKFGVKPRPRWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSG  449

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL++IS+S+V++  +EGAHH+DL+ STK DP WL + R  E+++I+ WIS Y+ 
Sbjct  450  GGVLQNISESVVSLVTEEGAHHIDLRSSTKNDPDWLVEQRETEIKLIEGWISDYHQ  505



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++AA ++ YNYSR   CF   +  D       WNWQ CTEM+MP    +++S+
Sbjct  319  GASKITRVFAAASLYYNYSRAEKCFKLEHGPD-AHGLHGWNWQACTEMVMPMT-CSEESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + C  TF ++PR +WITTEFGG  I+ VLK+ G NIIF NG++DPWS 
Sbjct  377  FPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  ++GAHHVD + +TK+DP+WLK++RR+EVEIIQ WI QYY
Sbjct  437  GGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++A V+I YNY+  V+CFD     D     + WNWQ CTEM+MP   + ++S+
Sbjct  318  GTTVLERIFAGVSIYYNYTGNVDCFDLE---DDPHGLSGWNWQACTEMVMPMSSSQENSM  374

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++DY      C   + + PRP WITTEFGGH+I+  LKKFGSNIIF NGL DPWS 
Sbjct  375  FPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSG  434

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL+++S+S++A+  + GAHH+DL+ STKEDP WL + R  E+ +I+ W+  YY 
Sbjct  435  GSVLQNVSESIIALVTELGAHHIDLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQ  490



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++A V+I YNY+  V+CFD     D     + WNWQ CTEM+MP   + ++S+
Sbjct  320  GTTVLERIFAGVSIYYNYTGNVDCFDLE---DDPHGLSGWNWQACTEMVMPMSSSQENSM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++DY      C   + + PRP WITTEFGGH+I+  LKKFGSNIIF NGL DPWS 
Sbjct  377  FPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSG  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL+++S+S++A+  + GAHH+DL+ STKEDP WL + R  E+ +I+ W+  YY 
Sbjct  437  GSVLQNVSESIIALVTELGAHHIDLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQ  492



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            HG+  V + +AA ++ YNYS    CFD  N  D       W+WQ CTEM+MP   +N +S
Sbjct  324  HGATNVSRAFAAASLYYNYSGTEKCFDLENGKD-AHGLHGWDWQACTEMVMPLTCSN-ES  381

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP S ++Y      C   + + PRP+WITTEFGG  IE+VLK+  SNIIF NG++DPWS
Sbjct  382  MFPPSSFEYKEFADECTRKYGVMPRPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPWS  441

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             G VLK+IS S+VA+  K+GAHHVD +F+TKEDP WL + RR+EVEI+Q+WI  Y
Sbjct  442  RGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKWIHDY  496



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 121/175 (69%), Gaps = 1/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQ-ICTEMIMPADGNNKDS  476
            GSD + +++A  ++ YNYS +  CF P +P + +     W+WQ  CTEMIMP   N+ +S
Sbjct  311  GSDILSRIFAGASVYYNYSGQAECFQPSDPGNDDLGVTGWDWQQACTEMIMPMSSNSSNS  370

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F   +WD  G +Q+C  T+ + PRPNWITT +GG +I+ VLK FGSNI+F NGL DPWS
Sbjct  371  MFQPYDWDLEGNIQYCMKTYGVRPRPNWITTNYGGKDIKAVLKDFGSNIVFSNGLLDPWS  430

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             GGVL++IS S++A+ A EGAHH+DL+ STK DP WL + R  EV  I +WI+ Y
Sbjct  431  GGGVLENISSSIIALVAPEGAHHLDLRASTKIDPDWLVEQRATEVAYITKWIAAY  485



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 117/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + ++YA V++ YNY+  V+CF+     D       WNWQ CTEM+MP   + ++S+FPA 
Sbjct  324  LDRIYAGVSVYYNYTGNVDCFELD---DDPHGLDGWNWQACTEMVMPMSSSQENSMFPAD  380

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
             ++Y+   + C  TF++ PRP W TTEFGGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  381  GFNYSSYKEECWKTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVL  440

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  KEGAHH+DL+ ST +DPKWL D R  E+ +IQ WI  Y
Sbjct  441  KNLSDTIVALVTKEGAHHLDLRPSTPDDPKWLVDQREAEIRLIQGWIETY  490



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            +G+D + +++A V++ YNY+ E  CFD     D       WNWQ CTEM+MP   N + S
Sbjct  327  NGTDVLDRIFAGVSVYYNYTGEEKCFDVN---DDPHGENGWNWQACTEMVMPMSSNPESS  383

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            IFP   +D     + C + F +EPRP+WITTEFGG +I+RVLK +GSNIIF NGL DPWS
Sbjct  384  IFPQFTFDIESYTKNCLNMFGVEPRPHWITTEFGGQDIKRVLKNYGSNIIFSNGLLDPWS  443

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
             GGVL++IS S+VA+  + GAHH+DL+ +T+ DP WL + R  E++II +W+++YY 
Sbjct  444  GGGVLQNISNSIVALVTELGAHHLDLRAATENDPLWLVEQRNAEMKIINKWMNEYYQ  500



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            HG+  V + +AA ++ YNYS    CFD  N  D       W+WQ CTEM+MP   +N +S
Sbjct  310  HGATNVSRAFAAASLYYNYSGTEKCFDLENGKD-AHGLHGWDWQACTEMVMPLTCSN-ES  367

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP S ++Y      C   + + PRP+WITTEFGG  IE+VLK+  SNIIF NG++DPWS
Sbjct  368  MFPPSSFEYKEFADECTRKYGVMPRPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPWS  427

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             G VLK+IS S+VA+  K+GAHHVD +F+TKEDP WL + RR+EVEI+Q+WI  Y
Sbjct  428  RGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKWIHDY  482



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V K ++A ++ YNY+ +  CFD     D     + W WQ CTEM+MP   +NK S+
Sbjct  356  GADIVDKAFSAASLYYNYTGDQKCFDVEGGDD-PHGLSGWGWQACTEMVMPMTVSNK-SM  413

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y  + + C  ++ + PR +WITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  414  FPPSSFSYEEKSEGCLASYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  473

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EVEIIQ WI QY
Sbjct  474  GGVLKNISSSIIALVTEKGAHHLDFRTATKDDPDWVIEQRRQEVEIIQGWIDQY  527



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 119/173 (69%), Gaps = 9/173 (5%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            + ++YA +++ YNY+  V+CF   D  + LD       WNWQ CTEM+MP   N ++S+F
Sbjct  334  LDRIYAGISVYYNYTGNVDCFKLDDDPHGLD------GWNWQACTEMVMPMSSNQENSMF  387

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P   ++Y+   + C +TF++ PRP W+TTEFGGH+I   LK FGSNIIF NGL DPWS G
Sbjct  388  PGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSGG  447

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             VLK++S ++VA+  KEGAHH+DL+ ST EDPKWL D R  E+ +IQ WI  Y
Sbjct  448  SVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  500



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 119/173 (69%), Gaps = 9/173 (5%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            + ++YA +++ YNY+  V+CF   D  + LD       WNWQ CTEM+MP   N ++S+F
Sbjct  348  LDRIYAGISVYYNYTGNVDCFKLDDDPHGLD------GWNWQACTEMVMPMSSNQENSMF  401

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P   ++Y+   + C +TF++ PRP W+TTEFGGH+I   LK FGSNIIF NGL DPWS G
Sbjct  402  PGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSGG  461

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             VLK++S ++VA+  KEGAHH+DL+ ST EDPKWL D R  E+ +IQ WI  Y
Sbjct  462  SVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  514



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 122/173 (71%), Gaps = 9/173 (5%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            + ++YA +++ YNY+ +V+CF   D  + LD       W+WQ CTEM+MP   + ++S+F
Sbjct  332  LDRIYAGISVYYNYTGDVDCFKLDDDPHGLD------GWDWQACTEMVMPMSSSQENSMF  385

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            PA +++Y+   + C +TF++ PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G
Sbjct  386  PADDFNYSSYKEECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGG  445

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             VLK++S ++VA+  KEGAHH+DL+ ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  446  SVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVEQREAEIRLIQGWIETY  498



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + +++ A ++ YNYSR   CF+  N  D +     WNWQ CTEM+MP   +N +S+FP  
Sbjct  327  LSRVFEAASLYYNYSRTEKCFELENEND-DHGLHGWNWQACTEMVMPMSISN-ESMFPPY  384

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            ++ Y      C   + + PRP+WITTEFGG NIE+VLK+FGSNIIF NGL+DPWS G VL
Sbjct  385  QFSYKDFSDDCLKNYGVRPRPHWITTEFGGTNIEQVLKRFGSNIIFSNGLQDPWSRGSVL  444

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S+VA+ A++GAHH DL+ +T++DP WL + R++E+EIIQ+WIS YY
Sbjct  445  KNISTSIVALVAEKGAHHTDLRRATRKDPDWLIEQRKQEIEIIQKWISDYY  495



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G   + K +AA ++ YNYS+   CFD  +  D       W+WQ CTEM+MP   ++ +S+
Sbjct  325  GETKLSKAFAAASLYYNYSQTEKCFDIEHGSD-AHGLHGWDWQACTEMVMPMSCSS-ESM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F    ++Y+   + C   + + PRP+WI TEFGG  IE++LK+FGSNIIF NG++DPWS 
Sbjct  383  FTPYSYNYSAFAEQCMKNYGVTPRPHWIATEFGGKQIEKILKRFGSNIIFSNGMQDPWSR  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  +EGAHHVD +F+TK+DP WL + R++EV+IIQ WI +YY
Sbjct  443  GGVLKNISASIVALVTEEGAHHVDFRFATKDDPNWLVEQRKQEVDIIQSWIDEYY  497



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  316  GSSNLDRAFAAASLYYNYSGSKKCFEMEQQSD-DHGLNGWQYQACTEMVMPMSCSNQ-SM  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  E DY    + C   + ++PRP+WITTEFGG +IE VLK+FGSNIIF NGL+DPWS 
Sbjct  374  LPPYENDYEAFKEQCMSRYGVKPRPHWITTEFGGKSIETVLKRFGSNIIFSNGLQDPWSR  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+  K+GAHH DL+ +TK DP+WLK+ RR+EV II+ WIS+YY
Sbjct  434  GGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIENWISEYY  488



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+ E  CF+     D       WNWQ CTEM+MP   + + S+
Sbjct  328  GTSILERIYEGVNVYYNYTGEAKCFELD---DDPHGLDGWNWQACTEMVMPMSSSQESSM  384

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y    + C   F ++PRP WITTEFGGHNI   LKKFGSNIIF NGL DPWS 
Sbjct  385  FPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWSG  444

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+V++  +EGAHH+DL+ ST+ DP WL + R  E+++I+ WI++YY 
Sbjct  445  GSVLQNISESIVSLVTQEGAHHLDLRASTENDPDWLIEQRATEIKLIEGWINEYYQ  500



>ref|XP_006663226.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Oryza 
brachyantha]
Length=420

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPAD-GNNKDS  476
            G++ + ++  A+ I YN++  + CF      D     A WNWQ CTEM++    G +  S
Sbjct  239  GNETLARIKEAMAIYYNHTGGLACFGGAGDEDPYGMLAGWNWQACTEMVLTMSYGVSGSS  298

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            IFP   +++   +  C+    + PRP WI   FGG +I  VLK+  SNIIFFNGLRDPWS
Sbjct  299  IFPPEPFNFTDVLAGCRAYTGLPPRPYWIEAHFGGFDIVNVLKRSASNIIFFNGLRDPWS  358

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            AGGVLKSISKS++A+   EG HHVDL+FSTKEDP+WLK VRRKE+ II +W+ QYY
Sbjct  359  AGGVLKSISKSIIALVEPEGGHHVDLRFSTKEDPEWLKKVRRKEMRIIADWLRQYY  414



>gb|EMT33353.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=347

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             GS  ++++YA VNI YNY+  V+CFD     D       W+WQ CTEM+MP   +   S
Sbjct  174  EGSSILERIYAGVNIYYNYTGTVDCFDLD---DDPHGMGGWDWQACTEMVMPMSSSEGLS  230

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP  E+DY      C   F + PRP WI+TEFGGHNI  VL+KFGSNIIFFNGL DPWS
Sbjct  231  MFPPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWS  290

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWL  185
             GGVLK+IS+S+VAI A  GAHH+DL+ +TKEDP WL
Sbjct  291  GGGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWL  327



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKD  479
            +D ++K++AA ++ YNY+ +  C    D GNP     +   W WQ CTE++MP    N D
Sbjct  379  ADILEKVFAAASLYYNYTGDQTCNQIEDEGNPRCLNLN--YWGWQACTELMMPMSSAN-D  435

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            S+FP   + Y  +  +C  TF + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPW
Sbjct  436  SMFPPHTFSYEDKANYCLQTFGVRPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPW  495

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            S GGVLK+IS S+VA+  ++GAHH+DL+ +TK+DP W+ + RR+EVEII  WI QYY
Sbjct  496  SRGGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYY  552



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            ++++YA V++ YNY+ +V CF+     D       WNWQ CTEM+MP   + K+S+F A 
Sbjct  325  LERIYAGVSVYYNYTGKVGCFELD---DDPHGLDGWNWQACTEMVMPMSSSQKNSMFTAY  381

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C +TF++ PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  382  DFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVL  441

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  KEG HH+DL+ ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  442  KNLSSTIVALVTKEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V K +AA ++ YNY+ +  CF   +  D     + W WQ CTEM+MP   +N +S+
Sbjct  213  GADIVDKAFAAASLYYNYTGDQTCFQLEDGED-PHGLSGWGWQACTEMVMPMTISN-ESM  270

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y G+   C  ++ + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS 
Sbjct  271  FPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSR  330

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EV+IIQ WI QY
Sbjct  331  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  384



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            ++++YA V++ YNY+ +V CF+     D       WNWQ CTEM+MP   + K+S+F A 
Sbjct  325  LERIYAGVSVYYNYTGKVGCFELD---DDPHGLDGWNWQACTEMVMPMSSSQKNSMFTAY  381

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C +TF++ PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  382  DFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVL  441

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  KEG HH+DL+ ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  442  KNLSSTIVALVTKEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 124/177 (70%), Gaps = 8/177 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D V K +AA ++ YNY+ +  CF   D G+P       + W WQ CTEM+MP   +N 
Sbjct  352  GADIVDKAFAAASLYYNYTGDQTCFELEDGGDP----HGLSGWGWQACTEMVMPMTISN-  406

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP   + Y G+   C  ++ + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDP
Sbjct  407  ESMFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNKIDLVLKRFGSNIIFSNGMRDP  466

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            WS GGVLK+IS S+ A+  ++GAHH+D + +TK+DP W+ + RR+EVEIIQ WI QY
Sbjct  467  WSRGGVLKNISSSIFALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIQGWIDQY  523



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLNGWQYQACTEMVMPMSCSNQ-SM  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  + DY    + CK  + ++PRP+WITTEFGG  IE VLK+FGSNIIF NGL+DPWS 
Sbjct  374  LPPYDNDYEAFEEQCKSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSR  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK DP+WLK+ R +EV II++WIS+YY
Sbjct  434  GGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488



>ref|XP_010910623.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=370

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A V++ YNY+  V+CFD     D     + W+WQ CTEM+MP   + ++S+
Sbjct  190  GTDLLDRIFAGVSVYYNYTGTVDCFDLE---DDPHGMSGWDWQACTEMVMPMSSSQENSM  246

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA  + Y      C   + ++PRP W+TTEFGGH+I+  L KFGSNIIF NGL DPWS 
Sbjct  247  FPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWSG  306

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S++A+  + GAHH+DL+ ST EDP WL + R+ E+ +I+ WI  +Y 
Sbjct  307  GSVLQNISESIIALVTELGAHHIDLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQ  362



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V+K + A ++ YNY+ +  CF+     D     + W WQ CTEM+MP   +N +S+
Sbjct  361  GADVVEKAFTAASLYYNYTGDQKCFEMEGGDD-PHGLSGWGWQACTEMVMPMTVSN-ESM  418

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y  + + C  ++++ PR NWITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  419  FPPSGFSYEEKSEGCFASYEVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  478

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EVEII  WI QY
Sbjct  479  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  532



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D ++K +AA ++ YNY+ +  C    D  +P   +     W WQ CTEMIMP   +N 
Sbjct  362  GADVLEKAFAAASLYYNYTGDQACNKIEDGDDPHGLDG----WQWQACTEMIMPMTISN-  416

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP S + Y+ R   C  ++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDP
Sbjct  417  ESMFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDP  476

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            WS GGVLK+IS S++A+  ++GAHH+DL+ STK DP WL + RR+EVEIIQ WI QY+ 
Sbjct  477  WSRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQ  535



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D ++K +AA ++ YNY+ +  C    D  +P   +     W WQ CTEMIMP   +N 
Sbjct  362  GADVLEKAFAAASLYYNYTGDQACNKIEDGDDPHGLDG----WQWQACTEMIMPMTISN-  416

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP S + Y+ R   C  ++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDP
Sbjct  417  ESMFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDP  476

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            WS GGVLK+IS S++A+  ++GAHH+DL+ STK DP WL + RR+EVEIIQ WI QY+ 
Sbjct  477  WSRGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQ  535



>gb|KDO59435.1| hypothetical protein CISIN_1g044064mg [Citrus sinensis]
Length=338

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 8/174 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G   + +++A  ++ YNYS+   CF   D  +P   +     W WQ CTEM+MP   +N 
Sbjct  169  GVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDG----WRWQTCTEMVMPMTCSN-  223

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP S +DY    + C  T+ + PR +WITTEFGG  IE VLK+FGSNIIF NG++DP
Sbjct  224  NSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDP  283

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWI  140
            WS GGVLK+IS S++A+  K+GAHHVD +  TK+DP WL ++RR+EVEIIQ+W+
Sbjct  284  WSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWV  337



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLDGWQYQACTEMVMPMSCSNQ-SM  372

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  E D     + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS 
Sbjct  373  LPPYENDSEAFQEQCMTRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSR  432

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK+DP+WLK+ RR+EV II++WIS+YY
Sbjct  433  GGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYY  487



>emb|CDX68714.1| BnaC01g07390D [Brassica napus]
Length=390

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            +++ +AA ++ Y+YS   +CFD  N  D       W WQ CTEM+MP   +N     P  
Sbjct  210  LERAFAAASLYYSYSGSESCFDMENHTD-SHGLNGWGWQACTEMVMPMSCSNHTMFRPFE  268

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
              D     ++C   + ++PRP+WIT EFGG  IE VLK+FGSNIIF NGL+DPWS GGVL
Sbjct  269  SDDEKANQEYCLREYGVKPRPHWITAEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVL  328

Query  280  KSISKSLVA-ITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            K+IS S++A +T K GAHH DL+ +TK+DP+WLK  RR+EV II++WIS+YY+
Sbjct  329  KNISSSIIALVTRKAGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYN  381



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 126/178 (71%), Gaps = 8/178 (4%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFE---QSAAQWNWQICTEMIMPADGNNKD  479
            +D ++K +AA ++ YNY+ ++ C    NP++ E        W WQ CTEMIMP   +N +
Sbjct  365  TDILEKAFAAASLYYNYTGDLTC----NPIEDEDDPHGLDGWQWQACTEMIMPMTVSN-E  419

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            S+FP S + Y  R   C  ++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDPW
Sbjct  420  SMFPPSSFSYKDRSDGCFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPW  479

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            S GGVLK+IS S++A+  ++GAHH+D + +TK DP W+ + RR+EVEIIQ WI QY+ 
Sbjct  480  SRGGVLKNISSSIIALVTEKGAHHLDFRSATKGDPDWVIEQRRQEVEIIQGWIDQYHQ  537



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ ++++Y  VN+ YNY+ +  CF+     D     + W+WQ CTEM+MP   N   S+
Sbjct  326  GTNILERIYEGVNVYYNYTGKEKCFELD---DDPHGMSGWDWQACTEMVMPMSSNQDSSM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y    + C + + ++PRP WITTEFGGH+I   LKKFGSNIIF NGL DPWS 
Sbjct  383  FPPYEYNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSG  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+V++  +EGAHH+DL+ ST+ DP WL + R  E+++I+ WIS Y+ 
Sbjct  443  GSVLQNISESVVSLVTEEGAHHIDLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + K +AA ++ YNY++   CF+     D       W+WQ CTEM+MP   +N +S+
Sbjct  320  GASKLSKAFAAASLYYNYTQTEKCFNLEGGTD-SHGLHGWDWQACTEMVMPMTCSN-ESM  377

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    Q CK  + ++PRP+WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS 
Sbjct  378  FPPSSFSYKEFSQDCKKQYGVKPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSR  437

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  ++GAHHVD +  TK DP WL   R++EV II++W+ +YY
Sbjct  438  GGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKWLEEYY  492



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLNGWQYQACTEMVMPMSCSNQ-SM  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  + DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NGL+DPWS 
Sbjct  374  LPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSR  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK DP+WLK+ R +EV II++WIS+YY
Sbjct  434  GGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488



>gb|KEH31545.1| serine carboxypeptidase S28 family protein [Medicago truncatula]
Length=527

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+ E  CF+     D     + WN+Q CTEM+MP   + K S+
Sbjct  347  GTSILERIYEGVNVYYNYTGEAKCFELD---DDPHGLSGWNFQACTEMVMPMSSSRKSSM  403

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y+   + C   F ++PRP  ITT FGGHNI   L+KFGSNIIF NGL DPWS 
Sbjct  404  FPPYEYNYSSFQEDCLKNFGVKPRPKQITTVFGGHNIHLALRKFGSNIIFSNGLLDPWSG  463

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+V++  +EGAHH+DL+ ST+ DP WL + R  EV++IQ WIS YY 
Sbjct  464  GSVLQNISESIVSLVTEEGAHHIDLRASTENDPDWLVEQRATEVKLIQGWISDYYQ  519



>gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++AA ++ YNYS    CF+  N  D       WNWQ CTEM+MP   + K+S+
Sbjct  319  GASKISRVFAAASLYYNYSHGEKCFELENEHD-AHGLHGWNWQACTEMVMPMTCS-KESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S +DY    + CK  + + PRP+WITTE+GG  I++VLK+ G NIIF NG++DPWS 
Sbjct  377  FPPSGFDYKEFSKGCKKKYGVMPRPHWITTEYGGKRIDQVLKRSGGNIIFSNGMQDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S++A+   +GAHHVD + S K+DP WL+++R +EVEII +WI +YY
Sbjct  437  GGVLKNISSSIIALVTDKGAHHVDFRSSMKDDPYWLRELRSQEVEIISKWIDEYY  491



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 123/177 (69%), Gaps = 9/177 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+  + +++A V++ YNY+  V CF   D  + LD       W++Q CTEM+MP   + +
Sbjct  335  GTSILDRIFAGVSVYYNYTGNVGCFKLDDDPHGLD------GWDFQACTEMVMPMSSSKE  388

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP  +++Y+   + C D F++ PRP WITTEFGGH IE +LK FGSNIIF NGL DP
Sbjct  389  NSMFPTYDFNYSSYKEECWDMFRVIPRPRWITTEFGGHGIETILKMFGSNIIFSNGLLDP  448

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            WS G +LK+IS+++VA+  KEGAHH+DL+ ST EDP+WL + R  E+ +IQ WI+ Y
Sbjct  449  WSGGSILKNISETIVALVTKEGAHHLDLRPSTPEDPQWLVEQREAEIRVIQGWINSY  505



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 122/175 (70%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + + +AA ++ YNY++   CF+     D       W+WQ CTEM+MP   +N +S+
Sbjct  319  GASKISRAFAAASLYYNYTQTEKCFNLEGGND-AHGLHGWDWQACTEMVMPMTCSN-ESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + CK  + +EPRP+WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS 
Sbjct  377  FPPSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  ++GAHHVD +  TK DP WL   R++E+ IIQ+W+ +YY
Sbjct  437  GGVLKNISASIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEMAIIQKWLEEYY  491



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 117/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + +++A +++ YNY+ +V+CF+     D       WNWQ CTEM+MP   + ++S+FPA 
Sbjct  345  LDRIFAGISVYYNYTGDVDCFELD---DDPHGLDGWNWQACTEMVMPMSSSEENSMFPAY  401

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
             ++Y+     C +TF++ PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  402  AFNYSSYKDECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVL  461

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  +EG HH+DL+ ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  462  KNLSNTIVALVTQEGGHHLDLRPSTPEDPKWLVEQREAEIRLIQGWIRTY  511



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V K +AA ++ YNY+ +  CF   +  D     + W WQ CTEM+MP   +N +S+
Sbjct  359  GADIVDKAFAAASLYYNYTGDQTCFQLEDGED-PHGLSGWGWQACTEMVMPMTISN-ESM  416

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y G+   C  ++ + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS 
Sbjct  417  FPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSR  476

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EV+IIQ WI QY
Sbjct  477  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  530



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V K +AA ++ YNY+ +  CF   +  D     + W WQ CTEM+MP   +N +S+
Sbjct  359  GADIVDKAFAAASLYYNYTGDQTCFQLEDGED-PHGLSGWGWQACTEMVMPMTISN-ESM  416

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y G+   C  ++ + PRP+WITTE+GG+ I+ VLK+FGSNIIF NG+RDPWS 
Sbjct  417  FPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSR  476

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EV+IIQ WI QY
Sbjct  477  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  530



>gb|EAZ17490.1| hypothetical protein OsJ_33021 [Oryza sativa Japonica Group]
Length=259

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQ---WNWQICTEMIMPAD-GNN  485
            G+D V ++  A+ I YN +  + CF PG   + +        W WQ CTE+IM    G  
Sbjct  72   GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  130

Query  484  KDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRD  305
              ++FP   ++    +  C  T  + PRP+WI + FGG++I  VLK+ GSNIIFFNGLRD
Sbjct  131  NATVFPPDPFNLTAYLAGCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  190

Query  304  PWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            PWSAGG+LKSIS S++A+   +G HHVDL+FSTKEDP+WLK VRR+E+ II +W+ QYY
Sbjct  191  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  249



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            +++++  V++ YNY+ +V+CF      D       WNWQ CTEM+MP   +   S+FPA 
Sbjct  341  LERIFEGVSVYYNYTGDVDCFQLD---DDPHGLDGWNWQACTEMVMPMSSSRDKSMFPAY  397

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C + F + PRP WITTEFGGH+I+ VLK FGSNIIF NGL DPWS G VL
Sbjct  398  DYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVL  457

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +++S+++VA+  +EGAHH+DL+ ST EDP WLK  R  E+++I++WI  YY
Sbjct  458  QNLSETIVALVTEEGAHHLDLRPSTNEDPDWLKKQRETEIKLIEDWIDNYY  508



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + + +AA ++ YNYS   NCFD  N  D       W WQ CTEM+MP   +N+ S+F   
Sbjct  319  LDRAFAAASLYYNYSGSENCFDIENQTD-PHGLNGWYWQACTEMVMPISCSNQ-SMFQPF  376

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            E+D     + C   + ++PRP+WITTEFGGH IE VLK+FGSNIIF NG++DPWS  GVL
Sbjct  377  EYDEKVDQEDCLKEYGVKPRPHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGVL  436

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S++A   K+GAHH DL+ +TK+DP+WLK+ RR+EV  I++WIS+YY
Sbjct  437  KNISSSIIAFVTKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKWISEYY  487



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G   + K +AA ++ YNY++   CF+     D       W+WQ CTEM+MP   +N +S+
Sbjct  320  GGSKLSKAFAAASLYYNYTQTEKCFNLEGGTD-SHGLHGWDWQACTEMVMPMTCSN-ESM  377

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + CK  F ++PRP+WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS 
Sbjct  378  FPPSSFSYKEFSKDCKKQFGVKPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSR  437

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  ++GAHHVD +  TK DP WL   R++EV II++W+ +YY
Sbjct  438  GGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKWLEEYY  492



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + + +AA ++ YNY++   CF+     D       W+WQ CTEM+MP   +N +S+
Sbjct  319  GASKISRAFAAASLYYNYTKREKCFNLEGGDD-AHGLHGWDWQACTEMVMPMTCSN-ESM  376

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y    + CK  + +EPRP+WITTEFGG+ IE+VLK+FGSN+IF NG++DPWS 
Sbjct  377  FPPSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSR  436

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  ++GAHHVD +  TK DP WL   R++E  IIQ+W+ +YY
Sbjct  437  GGVLKNISASIVALVTQKGAHHVDFRSETKNDPGWLIMQRKQEAAIIQKWLEEYY  491



>ref|XP_006285773.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
 gb|EOA18671.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
Length=483

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + + +AA ++ YNYS    CFD  N  D       W WQ CTEM+MP   +N+ S+F   
Sbjct  304  LDRAFAAASLYYNYSGSEKCFDIENETD-PHGVNGWYWQACTEMVMPISCSNQ-SMFQPF  361

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            E D  G  ++C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS  G+L
Sbjct  362  ENDDKGDQEYCLREYGVKPRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGIL  421

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S++A+  K+GAHH DL+ +TKEDP+WLK+ RR+EV  +++WIS+YY
Sbjct  422  KNISSSIIALVTKKGAHHADLRAATKEDPEWLKEQRRQEVAEMEKWISEYY  472



>emb|CDP02648.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 120/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++Y  VN+ YNY+  V+CF   N  D       W+WQ CTEM+MP   +    +
Sbjct  323  GTSTLQRVYEGVNVYYNYTGTVDCF---NLDDDPHGMIGWDWQACTEMVMPFASSKNTGM  379

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E++Y    + C   + ++PRP WI+TEFGGH+++ VLKKFGSNIIF NGL DPWS 
Sbjct  380  FPEFEYNYADDEERCLKDYNVKPRPTWISTEFGGHDLKNVLKKFGSNIIFSNGLLDPWSG  439

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ +S+++VA+  ++GAHH+DL+ +T EDP WL D R  EV++I++W+ +YY
Sbjct  440  GSVLEDVSETIVALVTEKGAHHLDLRAATDEDPDWLVDQRESEVKLIKKWLQEYY  494



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLDGWQYQACTEMVMPMSCSNQ-SM  373

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NGL+DPWS 
Sbjct  374  LPPYENDYEAFEEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSR  433

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK+IS S+VA+  K+GAHH DL+ +TK DP+WLK+ R +EV II++WIS+YY
Sbjct  434  GGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488


 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 121/183 (66%), Gaps = 10/183 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + + +AA ++ YNYS    CF+     D +     W +Q CTEM+MP   +N+ S+
Sbjct  623  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTD-DHGLDGWQYQACTEMVMPMSCSNQ-SM  680

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P  E DY    + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NGL+DPWS 
Sbjct  681  LPPYENDYEAFEEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSR  740

Query  292  GG--------VLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWIS  137
            GG        VLK+IS S+VA+  K+GAHH DL+ +TK DP+WLK+ R +EV II++WIS
Sbjct  741  GGSVLTSNFRVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWIS  800

Query  136  QYY  128
            +YY
Sbjct  801  EYY  803



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A V+I YNY+  V+CFD     D     + W WQ CTEM+MP   + ++S+
Sbjct  327  GTDLLDRIFAGVSIYYNYTGTVDCFDLE---DDPHGMSGWGWQACTEMVMPMSSSQENSM  383

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y      C   + + PRP W+TTEFGGH+I+  LK+FGSNIIF NGL DPWS 
Sbjct  384  FPTYNFSYAAYQDECVHNYGVRPRPRWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWSG  443

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S++A+  + GAHH+DL+ ST EDP WL + R+ E+ +I+ WI  YY 
Sbjct  444  GSVLQNISESIIALVTELGAHHIDLRPSTNEDPDWLIEQRKSEISLIRGWIYDYYQ  499



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 117/170 (69%), Gaps = 3/170 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            ++++YA V++ YNY+ +V CF+     D       WNWQ CTEM+MP   + ++S+F A 
Sbjct  325  LERIYAGVSVYYNYTGKVGCFELD---DDPHGLDGWNWQACTEMVMPMSSSQENSMFTAY  381

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C +TF + PRP W+TTE GGH+IE  LK FGSNIIF NGL DPWS G VL
Sbjct  382  DFNYSSYKEDCWNTFGVNPRPRWVTTELGGHDIETALKSFGSNIIFSNGLLDPWSGGSVL  441

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            K++S ++VA+  +EG HH+DL+ ST EDPKWL + R  E+ +IQ WI  Y
Sbjct  442  KNLSSTIVALVTEEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A V++ YNY+  V+CFD     D     + W+WQ CTEM+MP   + ++S+
Sbjct  329  GTDLLDRIFAGVSVYYNYTGTVDCFDLE---DDPHGMSGWDWQACTEMVMPMSSSQENSM  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA  + Y      C   + ++PRP W+TTEFGGH+I+  L KFGSNIIF NGL DPWS 
Sbjct  386  FPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S++A+  + GAHH+DL+ ST EDP WL + R+ E+ +I+ WI  +Y 
Sbjct  446  GSVLQNISESIIALVTELGAHHIDLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQ  501



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCF---DPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D ++K +AA ++ YNY+ +  C    D  +P   +     W WQ CTEMIMP   +N 
Sbjct  378  GADILEKAFAAASLYYNYTGDQTCNKIEDGDDPHGLDG----WQWQACTEMIMPMTVSN-  432

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP S + Y+ R   C  ++ + PRP+WITTE+GG+ I++VLK+FGSNIIF NG+RDP
Sbjct  433  ESMFPPSSFSYDERSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDP  492

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            WS GGVLK+IS S++A+  ++GAHH+D + STK DP W+ + RR+EV+IIQ WI QY+ 
Sbjct  493  WSRGGVLKNISSSIIALVTEKGAHHLDFRSSTKGDPDWVIEQRRQEVDIIQGWIDQYHQ  551



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K +AA ++ YNY+ +  CF      D       W+WQ CTEM+MP   +N +S+
Sbjct  346  GADIIDKAFAAASLYYNYTGDQKCFQVEGDDD-PHGLDGWDWQACTEMVMPMIVSN-ESM  403

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y      C   + + PR NWITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  404  FPPSSFSYENNSDACLADYGVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  463

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D +  TK+DP W+ + RR+EVEII  WI QY
Sbjct  464  GGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGWIDQY  517



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++A V++ YNY+  V+CFD G   + +  A  W+WQ CTEM+MP   +   S+
Sbjct  336  GTSTLERIFAGVSVYYNYTGVVDCFDLGES-NQDLGADGWDWQACTEMVMPMSSSQSTSM  394

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F A +++Y+     C   F I+PR  WITTEFGGHN+   LK FGSNIIF NGL DPWS 
Sbjct  395  FTAYDFNYSSYQDECFKHFGIKPRSRWITTEFGGHNLLTDLKTFGSNIIFSNGLLDPWSG  454

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL+++S+++ A+  KEGAHH+DL+ S  EDP WL + R  EV++I  WI++YY 
Sbjct  455  GGVLQNVSETITALVTKEGAHHIDLRPSIDEDPDWLVEQRASEVKLITGWINKYYQ  510



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K +AA ++ YNY+ +  CF      D       W+WQ CTEM+MP   +N +S+
Sbjct  357  GADIIDKAFAAASLYYNYTGDQKCFQVEGDDD-PHGLDGWDWQACTEMVMPMIVSN-ESM  414

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y      C   + + PR NWITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  415  FPPSSFSYENNSDACLADYGVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  474

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D +  TK+DP W+ + RR+EVEII  WI QY
Sbjct  475  GGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGWIDQY  528



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D V+K +AA ++ YNY+ +  CF+     D     + W WQ CTEM+MP   +N +S+
Sbjct  348  GADVVEKAFAAASLYYNYTGDQKCFEVEGGDD-PHGLSGWGWQACTEMVMPMTVSN-ESM  405

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S + Y  + + C   + + PR +WITTE+GGH I++VLK+FGSNIIF N +RDPWS 
Sbjct  406  FPPSGFSYEEKSEGCIAAYDVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNEMRDPWSR  465

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVLK+IS S++A+  ++GAHH+D + +TK+DP W+ + RR+EVEII  WI QY
Sbjct  466  GGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  519



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 124/177 (70%), Gaps = 8/177 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFD---PGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D V K +AA ++ YNY+ +  CF      +P D +     W WQ CTEM+MP   +N 
Sbjct  388  GADVVDKAFAAASLYYNYTGDQKCFQVEGDDDPHDLDG----WGWQACTEMVMPMTVSN-  442

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+FP   ++Y    + C   + + PR +WITTE+GGH I++VLKKFGSNIIF NG+RDP
Sbjct  443  ESMFPPDSFNYENMSEDCLLYYGVRPRMHWITTEYGGHKIDKVLKKFGSNIIFSNGMRDP  502

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            WS GGVLK+IS S++A+  ++GAHH+DL+ +TK+DP W+ + RR+EVEII+ WI QY
Sbjct  503  WSRGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIRGWIDQY  559



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  V++ YNY+ +V+CFD     D     A W+WQ CTEM+MP   N   S+
Sbjct  337  GTSILERVFEGVSVYYNYTGKVDCFDL---YDDPHGMAGWDWQSCTEMVMPMSSNPHTSM  393

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  ++D +   ++C+  +K+ PRP WITTEFGG +I   LK FGSNIIF NGL DPWS 
Sbjct  394  FPRYDFDLSADKEYCRTEYKVNPRPEWITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWSG  453

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G V K++S S+VA+  +EGAHH+DL+ +T  DP WL + R  E+++I++W+  YY 
Sbjct  454  GSVTKNVSDSIVALNTQEGAHHLDLRAATAHDPDWLVEQRATEIKLIRKWLRDYYQ  509



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            +++++  V++ YNY+  V+CF      D       WNWQ CTEM+MP   +   S+FPA 
Sbjct  344  LERIFEGVSVYYNYTGNVDCFQLD---DDPHGLDGWNWQACTEMVMPMSSSRDKSMFPAY  400

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            +++Y+   + C + F + PRP WITTEFGGH+I+ VLK FGSNIIF NGL DPWS G VL
Sbjct  401  DYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVL  460

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +++S+++VA+  +EGAHH+DL+ ST EDP WLK  R  E+++I+ WI  YY
Sbjct  461  QNLSETIVALVTEEGAHHLDLRPSTNEDPDWLKKQRETEIKLIEGWIDNYY  511



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 117/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  ++I YNY+ +V+CFD     D     + W+WQ CTEMIMP   N   S+
Sbjct  340  GASVLQRIFEGISIYYNYTGKVDCFDLN---DDPHGMSGWDWQACTEMIMPMASNRTTSM  396

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D     + C   F ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  397  FPEFYYDPKSNEEQCLKDFHVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSG  456

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ +S+++VA+T K+GAHH+DL+ +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  457  GSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHY  511



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  V++ YNY+ +V+CFD     D     A W+WQ CTEM+MP   N   S+
Sbjct  372  GTSILERVFEGVSVYYNYTGKVDCFDL---YDDPHGMAGWDWQSCTEMVMPMSSNPHTSM  428

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  ++D +   ++C+  +K+ PRP WITTEFGG +I   LK FGSNIIF NGL DPWS 
Sbjct  429  FPRYDFDLSADKEYCRTEYKVNPRPEWITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWSG  488

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G V K++S S+VA+  +EGAHH+DL+ +T  DP WL + R  E+++I++W+  YY 
Sbjct  489  GSVTKNVSDSIVALNTQEGAHHLDLRAATAHDPDWLVEQRATEIKLIRKWLRDYYQ  544



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 119/173 (69%), Gaps = 2/173 (1%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            +D + K +AA ++ YNY+ +  CF+     D       W WQ CTEM+MP   +N +S+F
Sbjct  282  ADVIGKAFAAASLYYNYTGDQKCFEVEGGDD-PHGLHGWGWQACTEMVMPMTVSN-ESMF  339

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P S +    R + C   + + PR +WITTE+GGH I++VLK+FGSNIIF NG+RDPWS G
Sbjct  340  PPSSFSDEKRSEGCHLVYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRG  399

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GVLK+IS S++A+  ++GAHH+DL+ +TK+DP WL + RR+EV II  WI QY
Sbjct  400  GVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWLVEQRRQEVGIIHGWIDQY  452



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  ++I YNY+ +V+CF   N  D     + W+WQ CTEMIMP   N   S+
Sbjct  308  GASVLQRIFEGISIYYNYTGKVDCF---NLNDDPHGMSGWDWQACTEMIMPMASNMTTSM  364

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D     + C   F+++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  365  FPEFYYDPKSNEEQCLKDFRVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSG  424

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ +S+++VA+T K+GAHH+DL+ +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  425  GSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHY  479



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 123/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  +++ YNY+ +V CF      D       WNWQ CTEM+MP   ++  S+
Sbjct  335  GTSTLEQIFEGISVFYNYTGDVECFQLD---DDPHGMDGWNWQACTEMVMPT-SSSWGSM  390

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  +++ +   + C + F ++PRP WITTEFGGH+I+  L++FGSNIIFFNGL DPWS 
Sbjct  391  FPRYDFNLSAYEEQCWNDFGVKPRPRWITTEFGGHDIKADLERFGSNIIFFNGLLDPWSG  450

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            GGVL++IS+S+VA+   EGAHH+DL+ STKEDP WL ++R  E+++I+ WI  YY 
Sbjct  451  GGVLQNISESIVALVTIEGAHHIDLRASTKEDPDWLVELRETEIKLIKGWIDNYYQ  506



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  ++I YNY+ +V+CF   N  D     + W+WQ CTEMIMP   N   S+
Sbjct  324  GASVLQRIFEGISIYYNYTGKVDCF---NLNDDPHGMSGWDWQACTEMIMPMASNMTTSM  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D     + C   F+++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  381  FPEFYYDPKSNEEQCLKDFRVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSG  440

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ +S+++VA+T K+GAHH+DL+ +T EDP WL D R  E+++I+ W+ ++Y
Sbjct  441  GSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHY  495



>ref|XP_010432914.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=499

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + + +AA N+ YNYS   NCFD  N  D       W WQ CTEM+MP   +N+ S+F   
Sbjct  321  LDRAFAAANLYYNYSSSENCFDIENETD-PHGLNGWYWQACTEMVMPISCSNQ-SMFQPF  378

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
            E +     + C   + ++PRP+WITTEFGG  IE VLK+FGSNIIF NG++DPWS  GVL
Sbjct  379  ESNDKRDQEACLREYGVKPRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGVL  438

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S++A+  K+GAHH DL+ +TK+DP+WLK+ RR+EV  +++WIS+YY
Sbjct  439  KNISSSIIALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAEMEKWISEYY  489



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 120/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++   V++ YNY+ +V+CFD     D       WNWQ CTEM+MP   +   S+
Sbjct  338  GTSIIQRIVEGVSVYYNYTGKVDCFDLD---DDPHGMNGWNWQACTEMVMPTSSSKDASM  394

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA +++Y    ++C + ++++PRP WI+TEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  395  FPAYDYNYTSDEEWCWENYRVKPRPTWISTEFGGHGFKHTLKNFGSNIIFSNGLLDPWSG  454

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ IS+++VA+  ++GAHH+DL+ +T EDP WL + R  EV++IQ W+ +Y+
Sbjct  455  GSVLEDISETIVALVTEKGAHHLDLRPATAEDPDWLVEQRAAEVKLIQGWLDEYF  509



>ref|XP_008779559.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=147

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -3

Query  526  QICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLK  347
            Q CTEM+MP   +N +S+FP+S +DYN     C   + + PRP+WITTE+GG+ I+ VLK
Sbjct  11   QACTEMVMPMTCSN-ESMFPSSSYDYNEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLK  69

Query  346  KFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRK  167
            +FGSNIIF NG+RDPWS GGVL++IS S++A+  ++GAHH+DL+F+TK+DPKWL + R++
Sbjct  70   RFGSNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRFATKDDPKWLLEQRKQ  129

Query  166  EVEIIQEWISQYY  128
            E++IIQ WI QY+
Sbjct  130  EIDIIQSWIDQYH  142



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 125/180 (69%), Gaps = 11/180 (6%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAA----QWNWQICTEMIMPADGNN  485
            G+  +++++  V+I YNY+ +  CF+       E ++A     WNWQ CTEM+MP    +
Sbjct  341  GTSTLERVFEGVSIFYNYTGQAECFE------LEDTSAVGTDGWNWQACTEMVMPMSSRD  394

Query  484  KDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRD  305
              S+FP  +++ +   + C   + ++PRP WITTE+GGH+I+  LK FGSNIIF NGL D
Sbjct  395  A-SMFPTYDFNLSSFEEECLKNYNVKPRPTWITTEYGGHDIKATLKAFGSNIIFSNGLLD  453

Query  304  PWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            PWS G VL+++S+++VA+ A+EGAHH+DL+FSTK+DPKWL + R  E+++I+ WI ++Y 
Sbjct  454  PWSGGSVLQNVSETIVALVAEEGAHHLDLRFSTKDDPKWLIEQRETEIKLIEGWIEKFYQ  513



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 114/175 (65%), Gaps = 0/175 (0%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D   ++  A+ + YNY+   +CF   +  D       W+WQ CTEMI+ + G    S+
Sbjct  330  GKDTFSRIKDALTVYYNYTGNAHCFGDASEDDPYGMFNGWDWQACTEMILMSYGVRNRSV  389

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
             P   +++   +  C+ +  + PRP WI TEFGG +I  VLK+  SNIIFFNGLRDPWS+
Sbjct  390  LPPEPFNFTKLLDGCRASTGLPPRPYWIPTEFGGFDIANVLKRSASNIIFFNGLRDPWSS  449

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLK IS+S++A+   +G+HHVDL+FS+K+DP WLK VR KE  II  W++QYY
Sbjct  450  GGVLKDISRSILALVEPKGSHHVDLRFSSKDDPHWLKQVREKETRIIAHWLNQYY  504



>ref|XP_004288288.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  +++ YNYS   +CF+  +  D       WNWQ CTEM+MP   +   S+
Sbjct  328  GTSTLERVFEGISVYYNYSGNADCFELEDTSDVGTDG--WNWQACTEMVMPMSSSRDRSM  385

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F   +++++    +C      +PRP WITTEFGGH+I+  LK FGSNIIF NGL DPWS 
Sbjct  386  FKTYDYNFSSFQDWCWKELNAKPRPTWITTEFGGHDIKATLKNFGSNIIFSNGLLDPWSG  445

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+VA+  +EGAHH+DL+FSTK DP WL + R  E+++IQ W+ ++Y 
Sbjct  446  GSVLQNISQSIVALVTEEGAHHIDLRFSTKGDPDWLVEQRESEIKLIQGWLDEFYQ  501



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 114/175 (65%), Gaps = 0/175 (0%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D   ++  A+++ YN++    C       D       W+WQ CTEMI+   G    ++
Sbjct  335  GNDTFARIKGALDVYYNHTGAEPCLGDATESDPYGMFDGWDWQACTEMILMTYGVRNGTV  394

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +++   +  C+ +  + PRP WI TEFGG +I+ VL++  SNIIFFNGLRDPWS+
Sbjct  395  FPPEPFNFTDLLAGCRASTGLPPRPYWIPTEFGGFDIKHVLRRSASNIIFFNGLRDPWSS  454

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVLKSIS S++A+   +G+HHVDL+FSTKEDP+WLK VR KE  II  W+ QYY
Sbjct  455  GGVLKSISNSIIALVEPKGSHHVDLRFSTKEDPEWLKQVRIKETRIIAHWLRQYY  509



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + +  AA ++ YNYS+   CF   +  D +     WNWQ CTEM+MP   +N  S+FP S
Sbjct  322  LSRAVAAASLYYNYSKTEKCFKLEDE-DNDHGLQGWNWQACTEMVMPMTCSN-GSMFPPS  379

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVL  281
             + Y      C   F + PR +WITTEFGG  I  VLK+FGSNIIF NG++DPWS GGVL
Sbjct  380  PYSYKEFADDCNRQFGVWPREHWITTEFGGMRINLVLKRFGSNIIFSNGMQDPWSRGGVL  439

Query  280  KSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            K+IS S+VA+  ++GAHHVD + +T +DP+WL D RR+EVEIIQ+W+ +YY
Sbjct  440  KNISSSIVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKWLQEYY  490



>ref|NP_001065793.1| Os11g0156200 [Oryza sativa Japonica Group]
 gb|AAX92949.1| At2g24280/F27D4.19 [Oryza sativa Japonica Group]
 gb|ABA91540.1| Serine carboxypeptidase S28 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27638.1| Os11g0156200 [Oryza sativa Japonica Group]
Length=511

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQ---WNWQICTEMIMPAD-GNN  485
            G+D V ++  A+ I YN +  + CF PG   + +        W WQ CTE+IM    G  
Sbjct  324  GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  382

Query  484  KDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRD  305
              ++FP   ++    +  C  T  + PRP+WI + FGG++I  VLK+ GSNIIFFNGLRD
Sbjct  383  NATVFPPDPFNLTAYLAGCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  442

Query  304  PWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            PWSAGG+LKSIS S++A+   +G HHVDL+FSTKEDP+WLK VRR+E+ II +W+ QYY
Sbjct  443  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>gb|EMT03389.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=536

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 8/177 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFD---PGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D + K +AA ++ YNY+    CF      +P  F+     W WQ CTEM+MP   +N 
Sbjct  299  GADVIDKAFAAASVYYNYTGNQKCFQVEGGDDPHGFKG----WGWQACTEMVMPMTVSN-  353

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +S+F  S + Y    + C   + + PR +WIT+E+GGH I++VLK+FGSNIIF NG+RDP
Sbjct  354  ESMFRPSSFSYEKMSENCLAGYGVRPRMHWITSEYGGHKIDKVLKRFGSNIIFSNGMRDP  413

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            WS GGVLK+IS S++A+  ++GAHH+DL+ +TK+DP W+ + RR+EVEII  WI QY
Sbjct  414  WSGGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIHGWIDQY  470



>gb|EAY80009.1| hypothetical protein OsI_35177 [Oryza sativa Indica Group]
Length=511

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQ---WNWQICTEMIMPAD-GNN  485
            G+D V ++  A+ I YN +  + CF PG   + +        W WQ CTE+IM    G  
Sbjct  324  GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  382

Query  484  KDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRD  305
              ++FP   ++    +  C  T  + PRP+WI + FGG++I  VLK+ GSNIIFFNGLRD
Sbjct  383  NATVFPPDPFNLTAYLADCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  442

Query  304  PWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            PWSAGG+LKSIS S++A+   +G HHVDL+FSTKEDP+WLK VRR+E+ II +W+ QYY
Sbjct  443  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>gb|EMS49104.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=614

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             GS  ++++YA VNI YNY+  V+CFD     D       W+WQ CTEM+MP   +   S
Sbjct  174  EGSSILERIYAGVNIYYNYTGTVDCFDLD---DDPHGMGGWDWQACTEMVMPMSSSEGLS  230

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F   E+DY      C   F + PRP WI+TEFGGHNI  VL+KFGSNIIFFNGL DPWS
Sbjct  231  MFLPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWS  290

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLK  182
             GGVLK+IS+S+VAI A  GAHH+DL+ +TKEDP WL+
Sbjct  291  GGGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWLE  328



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 125/182 (69%), Gaps = 12/182 (7%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNW-------QICTEMIMPAD  494
            G+D ++K++AA N+ YNY+ +  C    N ++ +   +  +        Q CTEMIMP  
Sbjct  350  GADILEKVFAAANLYYNYTGDQAC----NQIESDSDDSSSSLGLSGWGWQACTEMIMPMS  405

Query  493  GNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  314
             +N  S+FP S + Y      C  +  + PRP+WITTE+GG+ I++VLK+FGSNIIF NG
Sbjct  406  TSNA-SMFPPSSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNG  464

Query  313  LRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQ  134
            +RDPWS GGVLK+IS S+VA+  ++GAHH+DL+F+T EDP W+ + RR+EVEII+ WI Q
Sbjct  465  MRDPWSRGGVLKNISSSIVALVTEKGAHHLDLRFATDEDPDWVTEQRRQEVEIIEGWIDQ  524

Query  133  YY  128
            Y+
Sbjct  525  YH  526



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 114/175 (65%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  +N+ YNY+  V+CF   N  D       W+WQ CTEM+MP   N   S+
Sbjct  331  GASVLQRIFEGINVYYNYTGTVDCF---NLDDDPHGMGGWDWQACTEMVMPMASNRTTSM  387

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D     + C   F ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  388  FPEFYYDPTSNEEQCLKDFHVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSG  447

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+++SK++VA+T ++GAHH+DL+  T  DP WL + R  E+++I+ W+ +YY
Sbjct  448  GSVLENVSKTIVALTTEKGAHHLDLRAGTASDPDWLLEQRSSEIKLIRGWLDKYY  502



>gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G++ +++++  V+I YNY+ +V+CF+     D       WNWQ CTEM+MP   +   S+
Sbjct  334  GTNILERIFEGVSIYYNYTGDVDCFELD---DDPHGLDGWNWQACTEMVMPMASSKDASM  390

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F   +++Y    + C   F +EPRP WITTEFGGH+I+  L+ FGSNIIF NGL DPWS 
Sbjct  391  FLTYDFNYTSFKEECLKNFGVEPRPRWITTEFGGHDIKTALESFGSNIIFSNGLLDPWSG  450

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            G VL+++S+++VA+  KEGAHH+DL+ ST EDP WL + R  E+++I+ WI+ Y
Sbjct  451  GSVLQNLSETVVALVTKEGAHHIDLRSSTPEDPDWLVEQRATEIKLIEGWINGY  504



>ref|XP_002962483.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
 gb|EFJ35946.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
Length=474

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 118/185 (64%), Gaps = 12/185 (6%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
             S  ++++YA VN+ YN++    CFD     D     + WNWQ CTEM+MP   N+  S+
Sbjct  288  ASSILQRIYAGVNVYYNFTGAAKCFDLD---DDPHGLSGWNWQSCTEMVMPMSSNSNTSM  344

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  EWD     +FC + +   PRP+W+TTEFGGH+I+ VL+ FGSNI+F NGL DPWS 
Sbjct  345  YPPFEWDGEAWSRFCWENYGAIPRPSWVTTEFGGHDIKSVLRNFGSNIVFSNGLLDPWSG  404

Query  292  GG---------VLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWI  140
            G          VL+SIS +++A   KEGAHH+D ++S K+DP+WL + R  EV  I+ W+
Sbjct  405  GRQAMNDSFRFVLESISSTILAFVTKEGAHHLDFRWSRKDDPQWLIEQRESEVREIKRWL  464

Query  139  SQYYH  125
            S+Y+ 
Sbjct  465  SEYHQ  469



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++ +Y  VN+  NY+ +  CF+     D     + W+WQ CTEM+MP   N   S+
Sbjct  326  GTSILEGIYEGVNVYCNYTGKRKCFEVD---DDRHGMSGWDWQACTEMVMPMSSNQDSSM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  E +Y    + C + + ++PRP WITTEFGGH+I   LKKFGS+IIF NGL DPWS 
Sbjct  383  FPPYECNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSDIIFSNGLLDPWSG  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+S+V++  +EGAHH+DL+ ST+ DP WL + R  E+++I+ WIS Y+ 
Sbjct  443  GSVLQNISESVVSLVTEEGAHHIDLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>ref|XP_002263389.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI29519.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  V++ YNY+ +V CF      D       WNWQ CTEM+MP   + + S+
Sbjct  330  GTSVLERIFEGVSVYYNYTGKVECFQLD---DDPHGMDGWNWQACTEMVMPMASSRESSM  386

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  +++Y+   + C   F ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  387  FPTYDYNYSSFQEECWKDFSVKPRPTWITTEFGGHEFKTTLKVFGSNIIFSNGLLDPWSG  446

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL++IS+++VA+  +EGAHH+DL+ ST EDP WL + R  EV++I+ WI  Y+ 
Sbjct  447  GSVLQNISETVVALVTEEGAHHIDLRSSTAEDPDWLVEQRAFEVKLIKGWIEDYHQ  502



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 6/177 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICY-NYSREVN---CFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            +D V K+ A V+    N S + N      PGN    E +A  WNWQ CTEM+MP  G   
Sbjct  326  TDIVGKIIAGVSAYKGNVSSKSNVPSALAPGNVQLNENTA--WNWQTCTEMVMPIGGGIN  383

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
             ++FP   +D N R++ CK  + + PRP+WITT FGGH+I+RVLK+FGSNIIF NGLRDP
Sbjct  384  ATLFPVPPFDLNSRIETCKSFYGVSPRPHWITTYFGGHDIKRVLKRFGSNIIFSNGLRDP  443

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            +S  GVL+S+S SLVA+  K+G+H +DL  ++ +DP WL   R +EV II  WI+QY
Sbjct  444  YSVAGVLRSLSHSLVALITKQGSHCLDLLPASPDDPHWLTAQRSREVRIIARWITQY  500



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  ++I YNY+ E++CF+     D       WNWQ CTEM+MP   ++  S+
Sbjct  335  GTSILERIFEGISIYYNYTGELHCFELD---DDPHGLDGWNWQACTEMVMPMSSSHNASM  391

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  +++Y+   + C + F + PRP WITTEFGG +I+  L+ FGSNIIF NGL DPWS 
Sbjct  392  FPTYDFNYSSYQEGCWEEFGVIPRPRWITTEFGGQDIKTALETFGSNIIFSNGLLDPWSG  451

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            G VL++IS+++VA+  +EGAHH+DL+ ST EDP WL + R  EV++I+ WI  Y
Sbjct  452  GSVLQNISETVVALVTEEGAHHIDLRPSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            +G+D +++++  V++ YN++  V+CF      D       WNWQ CTEM+MP     K S
Sbjct  294  NGTDILRRIFEGVSVYYNFTGNVDCFKLD---DDPHGMNGWNWQACTEMVMPLSSGTK-S  349

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP  ++D +    +C  +F++ PRP WITTEFGGH  +  L+ FGSNI+F NGL DPWS
Sbjct  350  MFPGYDFDLDSDAYWCFQSFRVTPRPTWITTEFGGHGFKNALRWFGSNIVFSNGLLDPWS  409

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             G VL+++S ++VA+  ++GAHH+DL+ +T EDP WL D R  E+++IQ W+ +YY
Sbjct  410  GGSVLENVSDTIVALVTEKGAHHLDLRPATVEDPDWLLDQREIEMKLIQGWLDEYY  465



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  562  LDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITT  383
            L+   + + W+WQ C+EM++P   N   ++FP++ +D       C  T+ + PRP WITT
Sbjct  361  LNLSTTLSGWDWQTCSEMVIPLAPNANTTMFPSAPFDLKSYFSGCFKTYGVLPRPYWITT  420

Query  382  EFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTK  203
            EFGGHNI+RVLK+FGSNIIF NGLRDP+S+GGVLK+IS S+VAITAKEG H  D++ ST 
Sbjct  421  EFGGHNIKRVLKRFGSNIIFSNGLRDPYSSGGVLKNISDSIVAITAKEGVHCEDIRSSTN  480

Query  202  EDPKWLKDVRRKEVEIIQEWISQY  131
            +DP WLK+ R+KE+ II++WI  Y
Sbjct  481  DDPNWLKEQRQKEINIIRKWIIDY  504



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 1/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + ++ AA+++ YN++    CF      D       WNWQ CTEM++   G + DSI
Sbjct  338  GNGTLARVRAAMDVYYNHTGAAACFRGEEEDDPYGMYDGWNWQACTEMVLMTYGLSNDSI  397

Query  472  F-PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
              P   +++   +  C++   + PRP WI TEFGG++I  VLK+  SNIIFFNGLRDPWS
Sbjct  398  LQPPWPFNFTDVIASCRNATGLPPRPFWIETEFGGYDIGNVLKRSASNIIFFNGLRDPWS  457

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVLKSIS S++A+   +GAHHVDL+FS+++DP WLK VR KE  II  W+ QYY
Sbjct  458  TGGVLKSISDSIIALVEPKGAHHVDLRFSSEDDPDWLKQVRAKETRIIARWLKQYY  513



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 122/205 (60%), Gaps = 36/205 (18%)
 Frame = -3

Query  640  VKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPAS  461
            + ++ AA ++ YNYSR   CF   N  D       W+WQ CTEM+MP   + KDS+FP S
Sbjct  319  LSRVVAAASLYYNYSRTEKCFKIENATD-AHGLHGWDWQACTEMVMPMTCS-KDSMFPPS  376

Query  460  EWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG---  290
             +DY    + C   + + PRP+WITTEFGG+ IE+VLK+FGSNIIF NG++DPWS G   
Sbjct  377  TFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGRFQ  436

Query  289  -------------------------------GVLKSISKSLVAITAKEGAHHVDLKFSTK  203
                                            VLK+IS S++A+  ++GAHHVD + +TK
Sbjct  437  GKSFSEMKCEALSLFVFFFLEKNGTVMECPLSVLKNISASIIALATEKGAHHVDFRSATK  496

Query  202  EDPKWLKDVRRKEVEIIQEWISQYY  128
            EDP WL + RR+EVEIIQ WI++Y+
Sbjct  497  EDPDWLVEQRRQEVEIIQRWINEYH  521



>gb|EYU30781.1| hypothetical protein MIMGU_mgv1a0254691mg, partial [Erythranthe 
guttata]
Length=175

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            +G+  +++++  V+I YNY+ +V CFD     D       WNWQ CTEM+MP   +   S
Sbjct  14   NGTSILQRIFKGVSIYYNYTGKVECFDLD---DDPHGTNGWNWQACTEMVMPTSSSKNTS  70

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FPA ++DY    ++C + + ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS
Sbjct  71   MFPAYDYDYASDEEWCLENYGVKPRPTWITTEFGGHGFKHALKNFGSNIIFSNGLLDPWS  130

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKW  188
             G VL+ IS+++VA+  ++GAHH+DL+ +T EDP W
Sbjct  131  GGSVLEDISETIVALVTEKGAHHLDLRAATAEDPDW  166



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 120/176 (68%), Gaps = 2/176 (1%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  V+I YNY+ +  CF+  +  D +     WNWQ CTEM+MP   +   S+
Sbjct  336  GTSTLERIFEGVSIFYNYTGQAKCFELID--DSDVGTDGWNWQACTEMVMPMSCSQDASM  393

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F   +++ +   + C   + ++PRP  ITTEFGGH+I+  LK FGSNIIF NGL DPWS 
Sbjct  394  FQTYDYNLSSFQEECWKDYNVKPRPTRITTEFGGHDIKATLKSFGSNIIFSNGLLDPWSG  453

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G VL+++S+++VA+  +EGAHH+DL+FS KEDP+WL D R  E+++I+ W+ ++Y 
Sbjct  454  GSVLQNVSETIVALVTEEGAHHIDLRFSKKEDPEWLVDQRATEIKLIEGWLEKFYQ  509



>gb|EMT13135.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=515

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 120/184 (65%), Gaps = 12/184 (7%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K +AA ++ YNYS +  CF+     D       W WQ CTEM+MP   +N +S+
Sbjct  327  GADVIDKAFAAASLYYNYSGDQKCFEMEGGDD-PHGLDGWGWQACTEMVMPMIVSN-ESM  384

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   + Y    + C   + + PR +WITTE+GGH I++VLK+FGSNIIF NG+RDPWS 
Sbjct  385  FPPFSFSYENNSEGCLAYYGVRPRIHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  444

Query  292  GGVLKSISKSLVAITAK----------EGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEW  143
            GGVLK+IS S++A+  +          +GAHH+D + +TK+DP+W+ + RR+EVEII  W
Sbjct  445  GGVLKNISSSIIALVTENGKHEFKENMQGAHHLDFRSATKDDPEWVVEQRRQEVEIIHGW  504

Query  142  ISQY  131
            I QY
Sbjct  505  IDQY  508



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 115/175 (66%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  +N+ YNY+ +V+CF   N  D     + W+WQ CTEM+MP   N   S+
Sbjct  331  GASVLQRIFEGINVYYNYTGKVDCF---NLDDDPHGMSGWDWQACTEMVMPMASNKTTSM  387

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D     + C   F ++PRP WITT FGGH  +  LK FGSNIIF NGL DPWS 
Sbjct  388  FPEFYYDPKLNEEQCLKDFHVKPRPTWITTAFGGHAFKSALKAFGSNIIFSNGLLDPWSG  447

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VL+ +S+++VA+  ++GAHH+DL+ +T EDP WL + R  E+++I+ W+ +YY
Sbjct  448  GSVLEDVSETIVALITEKGAHHLDLRAATAEDPDWLLEQRSSEIKLIRGWLDKYY  502



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 120/178 (67%), Gaps = 7/178 (4%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFD---PGNPLDF-EQSAAQWNWQICTEMIMPADGNNK  482
            +D + K+ A V    +Y+   +C+D     NP D  E++   W+WQ C+EM+MP    + 
Sbjct  325  TDIIGKVVAGV---VSYNGNSSCYDLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSN  381

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            D++F A+ +D    +Q CK  + + PRP+WITT+FGGH+I+ +L++FGSNIIF NGLRDP
Sbjct  382  DTMFEAAPFDLEAFIQGCKSAYSVSPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRDP  441

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +S+ GVL SIS SL+AI   EG H +D+  S+ +DP WL   RR+E+EII +WI QYY
Sbjct  442  YSSAGVLTSISDSLLAIYTNEGCHCLDIVQSSPDDPNWLVMQRRREIEIISDWIKQYY  499



>gb|EYU41363.1| hypothetical protein MIMGU_mgv1a0060841mg, partial [Erythranthe 
guttata]
Length=164

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 103/155 (66%), Gaps = 7/155 (5%)
 Frame = -3

Query  583  CFDPGNPLDFEQSAAQWNWQ----ICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTF  416
            CFD     D  Q    WNWQ     CTEM+MP   +   S+FPA ++DY    ++C + +
Sbjct  3    CFDLD---DDPQGTNGWNWQGQFFACTEMVMPTSSSKNTSMFPAYDYDYASDEEWCLENY  59

Query  415  KIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEG  236
             ++PRP WITTEFGGH  +  LK FGSNIIF NGL DPWS G VL+ IS+++VA+  ++G
Sbjct  60   GVKPRPTWITTEFGGHGFKHALKNFGSNIIFSNGLLDPWSGGSVLEDISETIVALVTEKG  119

Query  235  AHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            AHH+DL+ +T EDP WL + R  EV++IQ W+ QY
Sbjct  120  AHHLDLRAATAEDPDWLVEQRAAEVKLIQSWLDQY  154



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 0/165 (0%)
 Frame = -3

Query  622  AVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNG  443
            A+N+ YN++    CF      D       WNWQ CTE+++ A G    ++   + +++  
Sbjct  382  AMNVYYNHTGGAACFRAEEDDDPYGLYDGWNWQACTEVMVMAYGVRDGTVLQPAPFNFTE  441

Query  442  RVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKS  263
             V  C++   + PRP WI TEFGG++I  VLKK  SNIIFFNGLRDPWS GGVLKSIS S
Sbjct  442  VVDDCRNVTGLPPRPFWIETEFGGYDIANVLKKSASNIIFFNGLRDPWSTGGVLKSISDS  501

Query  262  LVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            ++A+   +GAHHVDL+FS+KEDP+WLK VR KE  II  W+ QYY
Sbjct  502  IIALVEPKGAHHVDLRFSSKEDPEWLKKVRVKETRIIARWLKQYY  546



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  ++++   V + YN++ EVNCF+     D       WNWQ CTEM+MP   +   S+
Sbjct  341  GTSILERVSEGVGVYYNHTGEVNCFELD---DDPHGMNGWNWQACTEMVMPLSSSPDTSM  397

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  +++++   + C   FK+ PRP WITTEFGG +I   LK FGSNIIF NG  DPWS 
Sbjct  398  FPTYDFNFSAFQEECWTDFKVNPRPRWITTEFGGKDIMTDLKTFGSNIIFSNGFLDPWSG  457

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            G V +++S S+VA+  +EGAHH+DL+ +T EDP WL + R  E+ +I++W+S YY 
Sbjct  458  GSVTQNVSDSIVALNTQEGAHHLDLRAATAEDPNWLVEQRATEIRVIKKWLSDYYQ  513



>ref|XP_002438753.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
 gb|EER90120.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
Length=569

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 11/181 (6%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNW------QICTEMIMPADGN  488
            +D ++K++AA ++ YN++ +  C    N ++++  ++          Q CTEMIMP   +
Sbjct  388  ADILEKVFAAASLYYNFTGDQTC----NQIEYDDDSSSSLGLSGWGWQACTEMIMPMSDS  443

Query  487  NKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLR  308
            N +S+FP   + Y      C   + + PRP+WITTE+GG+ I++VLK+FGSNIIF NGLR
Sbjct  444  N-ESMFPPDTFSYEDTSNTCFQLYGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGLR  502

Query  307  DPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            DPWS GGVLK IS S+VA+  ++GAHH+DL+ +TK+DP W+ + RR+EVEII  WI QY+
Sbjct  503  DPWSRGGVLKDISSSIVALVTEKGAHHLDLRSATKDDPDWVIEQRRQEVEIIHGWIDQYH  562

Query  127  H  125
             
Sbjct  563  Q  563



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  V++ YNY+ EV+CF+     D       WNWQ CTEM+MP   +   S+
Sbjct  337  GTSILERVFEGVSVYYNYTGEVDCFELD---DDPHGMDGWNWQACTEMVMPMSSSPDASM  393

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP  +++++   + C   FK+ PRP WITT FGG +I   LK FGSNIIF NG  DPWS 
Sbjct  394  FPTYDFNFSAFQEECWTDFKVIPRPTWITTHFGGKDIMTTLKTFGSNIIFSNGFLDPWSG  453

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
              V +++S SLVA+  +EGAHH+DL+ +T EDP WL + R  E++++++W+S YY 
Sbjct  454  YSVTQNVSDSLVALNTQEGAHHIDLRAATAEDPDWLVEQRAAEIKLMKKWLSDYYQ  509



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 0/165 (0%)
 Frame = -3

Query  622  AVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNG  443
            A+++ YN++    CF      D       WNWQ CTE+++ A G     +   S +++  
Sbjct  363  AMDVYYNHTGAAACFRAEEDDDPHGMYDGWNWQACTEVMVMAYGIRDGGVLQPSPFNFTD  422

Query  442  RVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKS  263
             V  C++   + PRP WI TEFGG +I  VLKK  SNI+FFNGLRDPWS GGVLKSIS S
Sbjct  423  VVDSCRNYTGLPPRPFWIETEFGGFDIGNVLKKSASNIVFFNGLRDPWSTGGVLKSISDS  482

Query  262  LVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            ++A+   +G+HHVDL+FS+KEDP+WLK VR KE  II  W+ QYY
Sbjct  483  IIALVEPKGSHHVDLRFSSKEDPEWLKQVRVKETRIIARWLKQYY  527



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  +++++  ++I YNY+ E++CF+     D       WNWQ CTEM+MP   ++  S+
Sbjct  335  GTSILERIFEGISIYYNYTGELHCFELD---DDPHGLDGWNWQACTEMVMPMSSSHDASM  391

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F   +++Y+   + C + F + PRP WIT EFGG +I+  L+ FGSNIIF NGL DPWS 
Sbjct  392  FSTYDFNYSSYQEGCWEEFGVIPRPRWITMEFGGQDIKTALETFGSNIIFSNGLLDPWSG  451

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            G VL++IS+++VA+  +EGAHH+DL+ ST EDP WL + R  EV++I+ WI  Y
Sbjct  452  GSVLQNISETVVALVTEEGAHHIDLRPSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>ref|XP_007150129.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
 gb|ESW22123.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
Length=243

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            +GSD + K+Y+ +        +  CF         +++  W WQ C+E++ P  G   ++
Sbjct  48   YGSDVLSKIYSGL---VALRGDGICFVNPPSTTVSETSEGWGWQTCSEIVFPI-GIGSNT  103

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FPA  +++N     C+  + + PRP+W+TT +GGH+I+ +L KFGSNIIF+NGLRDP+S
Sbjct  104  MFPAQPYNFNSFATSCEKRYAVSPRPHWVTTYYGGHSIKLILNKFGSNIIFYNGLRDPYS  163

Query  295  AGGVLKSISKSLVAITAKEGAHHVDL-KFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +GGVL+ +S SLVAI A +G+H +DL   +   DPKWL D+R KEV II+ WI+QYY
Sbjct  164  SGGVLEDLSDSLVAIQAAQGSHCLDLVPQNLTSDPKWLVDLRNKEVSIIKGWIAQYY  220



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 125/198 (63%), Gaps = 28/198 (14%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNW-------QICTEMIMPAD  494
            G+D ++K++AA N+ YNY+ +  C    N ++ +   +  +        Q CTEMIMP  
Sbjct  353  GADILEKVFAAANLYYNYTGDQAC----NQIESDSDDSSSSLGLSGWGWQACTEMIMPMS  408

Query  493  GNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNG  314
             +N  S+FP S + Y      C  +  + PRP+WITTE+GG+ I++VLK+FGSNIIF NG
Sbjct  409  TSNA-SMFPPSSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNG  467

Query  313  LRDPWSAGGVLKSISKSLVAITAKEG----------------AHHVDLKFSTKEDPKWLK  182
            +RDPWS GGVLK+IS S+VA+  ++G                AHH+DL+F+T EDP W+ 
Sbjct  468  MRDPWSRGGVLKNISSSIVALVTEKGEHGNLRRKKKKKKKKWAHHLDLRFATDEDPDWVT  527

Query  181  DVRRKEVEIIQEWISQYY  128
            + RR+EVEII+ WI QY+
Sbjct  528  EQRRQEVEIIEGWIDQYH  545



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG-NPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + +++A V     Y    +C+    NP    +++  W WQ C+EM+MP    + D+
Sbjct  228  GSDILSRIFAGV---VAYGGNSSCYTTSHNP---TETSEGWAWQTCSEMVMPIGRGDNDT  281

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP + ++    +Q C   + + PRP+W+TT +GGHNIE +L++F SNIIF NGLRDP+S
Sbjct  282  MFPPAPFNLTTFIQECTSIYGVSPRPHWVTTYYGGHNIELILRRFASNIIFSNGLRDPYS  341

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +GGVLK+IS S++AI    G+H +D+  +T  DP+WL   R+ EVE+I+ WI+QYY
Sbjct  342  SGGVLKNISDSVLAILTVNGSHCLDILPATSTDPEWLVMQRKAEVEVIESWIAQYY  397



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 120/175 (69%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A V + Y  +R   C+D        +++  W WQ C+E+++P      D++
Sbjct  322  GTDVIGRIFAGV-VSYRGNR--TCYDTNAYNYPSETSVGWEWQTCSEIVIPIGRGENDTM  378

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA+ +D +   + CKD + + PRP+WITT +GGH+I+ VL +FGSNIIF NGLRDP+S+
Sbjct  379  FPAAPFDLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGLRDPYSS  438

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+ +S+S+VA+T  +G+H +D+ +S K DP WL   R++E+EII+ W+  YY
Sbjct  439  GGVLEDLSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGWLKTYY  493



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 109/174 (63%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+  + +++  V + YNYS  V+CF      D     + W WQ CTEM+MP   + K S+
Sbjct  314  GTSVLDRIFNGVTVYYNYSGTVDCFKLD---DDPHGMSGWQWQACTEMVMPMSSDPKTSM  370

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   ++Y    + C  ++ ++PR  WITTEFGGH+ +   K+ GSNIIF +GL DPWS 
Sbjct  371  FPTFTFNYTYEQERCMKSYGVKPRGRWITTEFGGHDFKTTWKESGSNIIFASGLLDPWSG  430

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            G VL+++S++LVA+  +EGAHH+DL+ ST  DP WL   R  E+ +IQ WI  Y
Sbjct  431  GSVLQNVSETLVALVTEEGAHHLDLRASTPNDPDWLVQQRASEIRLIQGWIDDY  484



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 113/162 (70%), Gaps = 12/162 (7%)
 Frame = -3

Query  610  CYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMP-ADGNNKDSIFPASEWDYNGRVQ  434
            CY    +VN F+  NP + ++    W+WQ C+EM+MP A GN  D++F A  +D +  VQ
Sbjct  312  CY----DVNAFN--NPSETDEG---WSWQTCSEMVMPIAHGN--DTMFQAESFDLDAFVQ  360

Query  433  FCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVA  254
             CK+ + + PRP+WIT EFGG +I+ +L++FGSNIIF NGL+DP+S+GGVLKSISKSL A
Sbjct  361  DCKNAYGVSPRPHWITAEFGGDDIKLILERFGSNIIFSNGLKDPYSSGGVLKSISKSLPA  420

Query  253  ITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            I   EG+H +D+  S   DPKWL   RR+EVEII  W  QYY
Sbjct  421  IYTTEGSHCLDILPSLPNDPKWLIKQRRREVEIISNWFRQYY  462



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K++A +     Y    +C+D        ++   WNWQ C+EM+MP    + D++
Sbjct  327  GADLLSKVFAGL---VAYKGNQSCYDTKEFKYSTETKRGWNWQRCSEMVMPIGRGSNDTM  383

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F A+ ++     Q CK  + I PR NWITT+FGGH+IE VLK+FG NIIF NGLRDP+S+
Sbjct  384  FQAAPFNLTNFKQRCKRLYGISPRSNWITTQFGGHDIELVLKRFGGNIIFSNGLRDPYSS  443

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G VLK+IS SLVAI   +G+H +D+     +DPKWL   R +E++II +WI QYY
Sbjct  444  GSVLKNISDSLVAIYTTQGSHCMDILPELPDDPKWLVMQRNQEIKIIGQWIKQYY  498



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A V + Y  +R  +C+D        Q    W WQ C+E++MP    + D++
Sbjct  326  GTDILSRVFAGV-VAYMGNR--SCYDTNYYNYPTQGYFGWRWQTCSELVMPIGRGSNDTM  382

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP+S +D     + C+D + + PRP+WITT+FGGH+I  VL+KF SNIIF NGL+DP+S+
Sbjct  383  FPSSPFDLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGLKDPYSS  442

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL +IS S+VAI   EG+H +DL  ++  DPKWL   R+ E+E I+ WI +YY
Sbjct  443  GGVLANISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGWIEKYY  497



>gb|KDO44733.1| hypothetical protein CISIN_1g0127112mg, partial [Citrus sinensis]
Length=264

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 121/181 (67%), Gaps = 3/181 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D + K++  V + Y  +R  +C+D    +   ++   W WQ C+EM+MP    +KD++
Sbjct  81   GIDVLGKIFKGV-VAYKGNR--SCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTM  137

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP + +D N   + C+ TF ++P+P+W+TT +GG +++ +L +FGSNIIF NGLRDP+S 
Sbjct  138  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYST  197

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYHY*LG  113
            GGVL +IS S+VAI+   G+H +D+   +K DP+WL   R+ E++II+EWI++Y +  L 
Sbjct  198  GGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLLE  257

Query  112  F  110
            F
Sbjct  258  F  258



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = -3

Query  586  NCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIE  407
            +C+D G      ++   WNWQ+C+E+++P    + D++FPA+ +D+      CK ++ + 
Sbjct  344  SCYDMGQSSFPSETEEGWNWQVCSELVIPIGRGSNDTMFPAAPFDFKEYADSCKYSYGVT  403

Query  406  PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHH  227
            PRP+WIT+ +GGHNI+ +LK+FGSNIIF NGLRDP+S+GGVL+ IS S++A+    G+H 
Sbjct  404  PRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGVLEDISHSIIAVHTPRGSHC  463

Query  226  VDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +D+  ST++DP WL   R  E+EII  W+ +YY
Sbjct  464  LDILPSTEDDPNWLVLQRNVEIEIIHGWLLKYY  496



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A +     Y  E+ C+    P    ++   W+WQ C +M++P  G + DS+
Sbjct  329  GNDILGRIFAGM---VAYQGELPCY-VNEPTKETETDVGWSWQTCADMVIPF-GISNDSM  383

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F    +D N  +  CKD + + PRP+W+TT FGGH+I+ +LK+FGSNIIF NGLRDP+S+
Sbjct  384  FQPYPFDLNAYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSS  443

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS S+VAIT  +G+H +D+  +TK DP+WL   R++EV II++WI  Y+
Sbjct  444  GGVLQNISDSVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYF  498



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -3

Query  541  AQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNI  362
              W+WQ CTEM+ P    + +++F  S +D N   + C   F I+PRP+W+TTEFGGH+I
Sbjct  346  GSWDWQTCTEMVFPIGYGDNETMFQPSPFDINNYKKECLQVFGIKPRPHWVTTEFGGHDI  405

Query  361  ERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLK  182
            + VL  F SNIIF NGLRDPWSAGGVL+ IS S+VA+  + GAH +DL  ST +DP WL 
Sbjct  406  KTVLGNFASNIIFANGLRDPWSAGGVLEDISDSIVAVYTEHGAHCLDLYPSTPDDPNWLV  465

Query  181  DVRRKEVEIIQEWISQYY  128
            + R KE++II  W+++YY
Sbjct  466  EQREKEIKIIAAWLAEYY  483



>ref|XP_002962799.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
 gb|EFJ36262.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
Length=470

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 111/176 (63%), Gaps = 4/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
             S  ++++YA VN+ YN++    CFD     D     + WNWQ CTEM+MP   N+  S+
Sbjct  288  ASSILQRIYAGVNVYYNFTGAAKCFDLD---DDPHGLSGWNWQSCTEMVMPMSSNSSTSM  344

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            +P  EWD     +FC + +   PRP+W+TTEFGGH+I+  L+ FGSNI+F NGL DPWS 
Sbjct  345  YPPFEWDGEAWSRFCWEKYGAIPRPSWVTTEFGGHDIKSALRNFGSNIVFSNGLLDPWSG  404

Query  292  GGVLKSISKSL-VAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            G    + S  L  ++   +GAHH+D ++S K+DP+WL + R  EV  I+ W+S+Y+
Sbjct  405  GRQAMNDSFRLRSSLIDFDGAHHLDFRWSRKDDPQWLIEQRELEVREIKRWLSEYH  460



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 124/184 (67%), Gaps = 17/184 (9%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICY--NYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMP-ADGNNK  482
            G++ + K+Y+ V + Y  N + +VN     NP +  ++   W WQ C+EM+MP A GN  
Sbjct  320  GNNILDKIYSGV-VAYKGNGTCKVN-----NPKNISETDVGWRWQTCSEMVMPFAIGN--  371

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            D++F  S +D    V+ CK  + + PRP+WITT +GGH+I+RVL+KFGSNIIF NGL+DP
Sbjct  372  DTMFQPSPFDLKRFVERCKKKYGVSPRPHWITTYYGGHDIKRVLQKFGSNIIFSNGLKDP  431

Query  301  WSAGGVLKSISKSLVA------ITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWI  140
            +S+ GVL  +SKSLVA      I +  G+H +D+  S + DPKWL + R KEV+IIQEWI
Sbjct  432  YSSAGVLHDLSKSLVAVPTINDINSIAGSHCLDILPSKESDPKWLIEQRNKEVKIIQEWI  491

Query  139  SQYY  128
            +QYY
Sbjct  492  AQYY  495



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + +++A +     Y  E+ C+    P    ++   W+WQ C +M++P  G + DS+
Sbjct  333  GNDILGRIFAGM---VAYRGELPCY-VNKPTKETETDVGWSWQTCADMVIPF-GISNDSM  387

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F    +D N  +  CKD + + PRP+W+TT FGGH+I+ +LK+FGSNIIF NGLRDP+S+
Sbjct  388  FQPYPFDLNVYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYSS  447

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS+S+VAIT  +G+H +D+  +TK DP+WL   R++EV II++WI  Y+
Sbjct  448  GGVLQNISESVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYF  502



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 117/175 (67%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + + +A V    +Y ++ +C+D        ++   W WQ C+EM+MP    + D++
Sbjct  327  GTDILGRTFAGV---VSYKKDESCYDMLEYARSTETNVGWQWQTCSEMVMPIGRGSNDTM  383

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP S ++    ++ CK ++ + PRP+WITT +GGH+++ V ++FGSNIIF NGL+DP+S+
Sbjct  384  FPPSPFNLPDFIKNCKSSYGVSPRPHWITTYYGGHDMKLVFQRFGSNIIFSNGLKDPYSS  443

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGV +++S SL+AI   +G+H +D+  + + DP WL   R+ EVEII+EWI QYY
Sbjct  444  GGVRENLSSSLLAIYTVKGSHCLDILAAKESDPSWLVAQRKLEVEIIEEWIKQYY  498



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQ-WNWQICTEMIMPADGNNKDS  476
            GSD + +++A V     +   ++C+   N  D+     Q W WQ C+E+++P      D+
Sbjct  325  GSDILSRIFAGV---VAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDT  381

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP + ++     Q C   + + PRP+WITT +GGH+IE +L++F SNIIF NGLRDP+S
Sbjct  382  MFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYS  441

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVLK+IS S++AI    G+H +DL  +   DP+WL   R+ EVEII+ WI+QYY
Sbjct  442  IGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYY  497



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 109/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + ++ A VN     +   +C          +SA+ W WQ CTEM+ P      +++
Sbjct  315  GTDILGRVAAGVNASVFGN---SCHSASGSGLSRKSASAWEWQTCTEMVFPMGYGENETM  371

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F +   D N   + C D F I+PRP+WITTEFGGH+I+ VL  F SNIIF NGLRDPWSA
Sbjct  372  FQSDPLDINNYTKECVDVFGIKPRPHWITTEFGGHDIKTVLGNFASNIIFSNGLRDPWSA  431

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+ IS S+VA+  ++G+H +DL   T  DP WL  +R KE +II  W+++YY
Sbjct  432  GGVLEDISDSVVALYTEQGSHCLDLYPPTSSDPDWLLALRDKENKIIAYWLAEYY  486



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = -3

Query  559  DFEQS-AAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITT  383
            DF+ S  ++W WQ CTEM+MP      D++F A  +D N   + C+D F + PRP+WITT
Sbjct  337  DFKPSNRSEWTWQTCTEMVMPIGHGANDTMFQAWPFDLNNHTKTCQDLFGVTPRPHWITT  396

Query  382  EFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTK  203
            EFGGH+I+ V+  F SNIIF NGLRDP+SAGGVL+ IS S+VAI   +GAH +DL   T 
Sbjct  397  EFGGHDIKSVVGNFASNIIFSNGLRDPYSAGGVLQDISDSVVAIYTDKGAHCLDLSTPTA  456

Query  202  EDPKWLKDVRRKEVEIIQEWISQY  131
             DP WL   + KEV+II  W+++Y
Sbjct  457  TDPDWLVSQQEKEVKIIGLWLAEY  480



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = -3

Query  646  DPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFP  467
            D + +++A V    +Y     C+D        +++  W WQ C+EM+MP      +++FP
Sbjct  338  DVIGRIFAGV---VSYKGNKTCYDMNTYNYPSETSIGWQWQTCSEMVMPIGRGQNETMFP  394

Query  466  ASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGG  287
            A+ ++ +  ++ C + + + PRP+WITT +GGH+I+  L +FGSNIIF NGLRDP+S+GG
Sbjct  395  AAPFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNGLRDPYSSGG  454

Query  286  VLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            VL+ +S+S+VA+T + G+H +D+  +TK DP+WL   R  E++IIQ W++ YY
Sbjct  455  VLEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGWLTTYY  507



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D + K++  V + Y  +R  +C+D    +   ++   W WQ C+EM+MP    +KD++
Sbjct  275  GIDVLGKIFKGV-VAYKGNR--SCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTM  331

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP + +D N   + C+ TF ++P+P+W+TT +GG +++ +L +FGSNIIF NGLRDP+S 
Sbjct  332  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYST  391

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVL +IS S+VAI+   G+H +D+   +K DP+WL   R+ E++II+EWI++Y
Sbjct  392  GGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKSEIKIIEEWIAKY  445



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCF-DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKD  479
            HG+D + K++A V     Y    +C+ +P  P +  ++   W WQ C++M+MP  G + D
Sbjct  327  HGNDTLSKIFAGV---VAYRGNESCYVNP--PKNKSETDVGWRWQTCSDMVMPI-GISND  380

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            S+FPA+++D    V+ CK  + + PRP+W TT FGGH+I+ VL +F SNIIF NGLRDP+
Sbjct  381  SMFPANQFDLKEYVESCKAQYGVPPRPHWATTYFGGHDIKLVLSRFASNIIFSNGLRDPY  440

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            S+GGVL++IS ++VA+  K G+H +D+  +   DP WL + R+ EV+II+ W+S YY
Sbjct  441  SSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLSNYY  497



>gb|KDP43936.1| hypothetical protein JCGZ_05403 [Jatropha curcas]
Length=503

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K++  V + Y  +R   C+   +P +  +++  W WQ C+EM++P  G   D++
Sbjct  326  GNDTLSKIFGGV-VAYRGNR--TCYI-NSPTNVSETSVGWRWQTCSEMVIPI-GRGNDTM  380

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D N  VQ CK ++ + PRP W+TT +GGH+I+ +L++FGSNIIF NGLRDP+S+
Sbjct  381  FPPDPFDLNAYVQDCKASYGVPPRPRWVTTYYGGHSIKLILQRFGSNIIFSNGLRDPYSS  440

Query  292  GGVLKSISKSLVAITAKEGAHHVD-LKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL +IS ++VA+   EG+H +D L+ +   DP+WL   R  E+ II +WI++YY
Sbjct  441  GGVLANISDTIVAVYTSEGSHCLDILQANKTTDPEWLVAQRNTEINIIDQWINKYY  496



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            HG+D + K++A V + Y  ++     +P N     ++   W WQ C++M++P  G + DS
Sbjct  327  HGNDTLSKIFAGV-VAYRGNKSCYVNEPKNK---SETDVGWGWQTCSDMVIPI-GISNDS  381

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FPA+E+D N  ++ CK  + + PRP+W TT FGGH+I+  L  F SNIIF NGLRDP+S
Sbjct  382  MFPANEFDLNDYIETCKAQYGVPPRPHWATTYFGGHDIKLALSGFASNIIFSNGLRDPYS  441

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +GGVL++IS ++VA+  K G+H +D+  +   DP WL + R+ EV+II+ W+ +YY
Sbjct  442  SGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLDKYY  497



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQ-WNWQICTEMIMPADGNNKDS  476
            GSD + +++A V     +   ++C+   N  D+     Q W WQ C+E+++P      D+
Sbjct  444  GSDILSRIFAGV---VAFRGNMSCYYTSNTTDYPIETIQGWGWQTCSEIVIPIGRGVNDT  500

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP + ++     Q C   + + PRP+WITT +GGH+IE +L++F SNIIF NGLRDP+S
Sbjct  501  MFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLRDPYS  560

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVLK+IS S++AI    G+H +DL  +   DP+WL   R+ EVEII+ WI+QYY
Sbjct  561  IGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYY  616


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  526  QICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLK  347
            Q C E +MP    + D++FP   ++    +Q C   + + P P+W TT +GGHNIE +L 
Sbjct  2    QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  346  KFGSNIIFFNGLRDPWSAGGVLKS  275
            +F SNIIF NGLRDP++  G  KS
Sbjct  62   RFASNIIFSNGLRDPYAVPGNWKS  85



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G D + K++  V + Y  +R  +C+D    +   ++   W WQ C+EM+MP    +KD++
Sbjct  319  GIDVLGKIFKGV-VAYKGNR--SCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTM  375

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP + +D N   + C+ TF ++P+P+W+TT +GG +++ +L +FGSNIIF NGLRDP+S 
Sbjct  376  FPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYST  435

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
            GGVL +IS S+VAI+   G+H +D+   +K DP+WL   R+ E++II+EWI++Y
Sbjct  436  GGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKY  489



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K++A V     +S   +C+    P +  ++   W+WQ C++M++P    + DS+
Sbjct  324  GNDTLTKIFAGV---VAFSGNTSCY-VNQPRNLTETDMGWSWQTCSDMVIPMASVSNDSM  379

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++D    ++ CK  + + PRP+W+TT FGGH+I+  L++F SNIIF NGLRDP+S+
Sbjct  380  FPAYQFDLKDYIKSCKAQYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRDPYSS  439

Query  292  GGVLKSISKSLVAITAKEGAHHVD-LKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+ IS ++VA+ AK G+H +D L      DP WL + R+ EV+II+ WI++YY
Sbjct  440  GGVLEDISDTIVAVHAKNGSHCLDILNADNITDPDWLVNQRKIEVKIIKRWIARYY  495



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GS  + K+ A V   + Y   + C++ G P +  ++   W WQ C+EM+MP   +N D++
Sbjct  320  GSGIISKVAAGV---FAYKGNLPCYNIG-PRNDTETDVGWRWQRCSEMVMPMSTSN-DTM  374

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FP   +D    + +C   + + PRP+W+TT +GG++I+ +L++FGSNIIF NGLRDP+S+
Sbjct  375  FPPITFDLRSFIDYCYQLYGVSPRPHWVTTYYGGNDIKLILQRFGSNIIFSNGLRDPYSS  434

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+++S SL+A+    G+H +D+  + + DP+WL + R KEV II+ WISQYY
Sbjct  435  GGVLQNLSDSLLAVHTLNGSHCLDILRANETDPQWLVEQREKEVSIIEGWISQYY  489



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -3

Query  601  YSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKD  422
            Y   ++C+D  N  +++    +W WQ C+E++MP  G+  +S+FP + ++    ++ CK 
Sbjct  333  YMGNISCYD-MNAFNYQDKTEEWRWQTCSELVMPI-GHESNSMFPPAPFNLKNYIKDCKS  390

Query  421  TFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAK  242
             F + P+P WITT +GGH+++ +L +FGSNIIF NGLRDP+S GGVL +IS S+VA++A 
Sbjct  391  LFGVLPQPRWITTYYGGHDLKLILHRFGSNIIFSNGLRDPYSGGGVLNNISDSIVAVSAV  450

Query  241  EGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             G+H +D++ ++  DP WL   R+ EV+II+ WIS+YY
Sbjct  451  NGSHCLDIQRASPSDPHWLVTQRKIEVKIIEGWISKYY  488



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAA-VNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + K+YA  V +  N + +VN      P +  ++   W WQ C+EM++P  G   D+
Sbjct  260  GSDILSKIYAGIVALRGNSTCKVN-----GPTNVSETTVGWRWQTCSEMVIPI-GIGNDT  313

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F    ++     + CK+ + + PRP+W+TT +GGHNI+ VL++ GSNIIF NGLRDP+S
Sbjct  314  MFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYS  373

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL +IS S+VA+    G+H +DL  + + DP WL + R+KEV+II+ WI+QYY
Sbjct  374  IGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  429



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAA-VNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + K+YA  V +  N + +VN      P +  ++   W WQ C+EM++P  G   D+
Sbjct  287  GSDILSKIYAGIVALRGNSTCKVN-----GPTNVSETTVGWRWQTCSEMVIPI-GIGNDT  340

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F    ++     + CK+ + + PRP+W+TT +GGHNI+ VL++ GSNIIF NGLRDP+S
Sbjct  341  MFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYS  400

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL +IS S+VA+    G+H +DL  + + DP WL + R+KEV+II+ WI+QYY
Sbjct  401  IGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  456



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG---NPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D + +++A V     Y    +C+D     +P D  ++   W WQ C+EM+MP    N 
Sbjct  323  GTDILGRIFAGV---VAYVGNKSCYDMNAYNHPSD--ETYMGWRWQTCSEMVMPIGHGNN  377

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            DS+FP + ++ N  ++ CK  F ++P+P+W+TT +GGH+++ +L +F SNIIF NGLRDP
Sbjct  378  DSMFPPAPFNLNRFIRKCKSLFGVQPQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRDP  437

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +S+GGVL++IS S+VA+    G+H +D+    K DP+WL   R+ EV+II+ W+++YY
Sbjct  438  YSSGGVLENISDSVVAVHTIHGSHCLDILPEKKSDPQWLVKQRKTEVQIIEAWLAKYY  495



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAA-VNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + K+YA  V +  N + +VN      P +  ++   W WQ C+EM++P  G   D+
Sbjct  319  GSDILSKIYAGIVALRGNSTCKVN-----GPTNVSETTVGWRWQTCSEMVIPI-GIGNDT  372

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F    ++     + CK+ + + PRP+W+TT +GGHNI+ VL++ GSNIIF NGLRDP+S
Sbjct  373  MFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPYS  432

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
             GGVL +IS S+VA+    G+H +DL  + + DP WL + R+KEV+II+ WI+QYY
Sbjct  433  IGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  488



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 117/177 (66%), Gaps = 3/177 (2%)
 Frame = -3

Query  655  HGSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
             G+D + K++        ++ + +C+DP      +++   WNWQ+C+++++P   ++  +
Sbjct  212  QGTDILDKIFLGF---VAFAGKKDCYDPNTLFWSQETTEGWNWQVCSDLVIPMGIDSNRT  268

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +F    +      + CK+++ + PRP+W+TT +GG +I+ VL++FGSNIIF NGLRDP+S
Sbjct  269  MFQHDPFVMEIFTESCKESYGVLPRPHWVTTYYGGQHIKEVLRRFGSNIIFSNGLRDPYS  328

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYYH  125
            +GGVL+ IS S+VA+T +EG+H +D+ ++TK+DP+WL   R   +EII  WI  YY 
Sbjct  329  SGGVLEDISDSIVALTTREGSHCMDILYATKDDPEWLVLQRNTALEIISGWILTYYQ  385



>ref|XP_002523752.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38692.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 120/175 (69%), Gaps = 8/175 (5%)
 Frame = -3

Query  646  DPVKKLYAAVNICYNYSREVNCF-DPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            D + K++A V + Y  +R  +C+ +P  P +  +++  W WQ C+EM++P  G   D++F
Sbjct  324  DTLDKIFAGV-VAYRGNR--SCYINP--PTNLSETSVGWRWQTCSEMVIPI-GRGNDTMF  377

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P S +D NG VQ C   + + PRP+W+TT +GGH+I+ +L++FGSNIIF NG+RDP+S+G
Sbjct  378  PPSPFDLNGYVQDCNAIYGVRPRPHWVTTYYGGHSIKLILQRFGSNIIFSNGIRDPYSSG  437

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTK-EDPKWLKDVRRKEVEIIQEWISQYY  128
            GVL+ IS +++A+    G+H +D+  + +  DP+WL   R+ E+ II+ WIS+YY
Sbjct  438  GVLEDISDTILAVHTANGSHCLDILIANETTDPEWLVAQRKTEINIIKGWISKYY  492



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICY--NYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKD  479
            G+D + K+Y+ + + Y  N + ++N + P N  D  +    W+WQ C+EM+MP  G   D
Sbjct  323  GNDILSKIYSGL-VAYEGNGTCKIN-YAPSNISD--EVYEGWSWQRCSEMVMPI-GTGND  377

Query  478  SIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPW  299
            ++F    ++    V+ CK  + + PRP+W+TT +GGHNI+ VL+KFGSNIIF NGL+DP+
Sbjct  378  TMFQPDPFNLKRYVEECKKQYGVSPRPHWVTTYYGGHNIKLVLQKFGSNIIFSNGLKDPY  437

Query  298  SAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            S GGVL ++S SL+A+    G+H +D+  + + DPKWL   R+KEVEII+ WI QYY
Sbjct  438  STGGVLSNLSDSLIAVYTTNGSHCLDILQTRQSDPKWLIQQRKKEVEIIKRWIEQYY  494



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 106/153 (69%), Gaps = 0/153 (0%)
 Frame = -3

Query  586  NCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIE  407
            +C+D G      ++   WNWQ+C+E+++P    + D++FPA+ +D+      CK ++ + 
Sbjct  344  SCYDMGQSSFPSETEEGWNWQVCSELVIPIGRGSNDTMFPAAPFDFKEYDDSCKYSYGVT  403

Query  406  PRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHH  227
            PRP+WIT+ +GGHNI+ +LK+FGSNIIF NGLRDP+S+GGVL+ IS S++A+    G+H 
Sbjct  404  PRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPYSSGGVLEDISHSIIAVHTPRGSHC  463

Query  226  VDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +D+  S ++DP WL   R  E+EI+  W+ +YY
Sbjct  464  LDILPSREDDPNWLVLQRNVEIEILHGWLLKYY  496



>emb|CDY28235.1| BnaA01g06140D [Brassica napus]
Length=135

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = -3

Query  454  DYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKS  275
            D     ++C   + ++PRPNWITTEFGG  IE VLK+FGSNIIF NGL+DPWS GGVLK+
Sbjct  9    DEKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVLKN  68

Query  274  ISKSLVA-ITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            IS S++A +T K GAHH DL+ +TK+DP+WLK  RR+EV II++WIS+YY
Sbjct  69   ISSSIIALVTIKAGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYY  118



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            G+D + K++A V     +S   +C+   +P +  ++   W+WQ C++M++P    + DS+
Sbjct  324  GNDTLTKIFAGV---VAFSGNTSCY-VNHPRNLTETDMGWSWQTCSDMVIPMTSVSNDSM  379

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            FPA ++D    ++ C+  + + PRP+W TT FGGH+I+  L++F SNIIF NGLRDP+S+
Sbjct  380  FPAYQFDLKDYIKSCQAQYGVPPRPHWATTYFGGHDIKLALERFASNIIFSNGLRDPYSS  439

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTK-EDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL+ IS ++VA+ AK G+H +DL  +    DP WL + R+ EV+II+ WI++YY
Sbjct  440  GGVLEDISDTVVAVHAKNGSHCLDLLNANNITDPDWLVNQRKIEVKIIKRWIAKYY  495



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = -3

Query  640  VKKLYAA-VNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPA  464
            ++K++A  V I  N +  VN    G    F Q+   W+WQ CTEM++P  G  ++++FP 
Sbjct  331  LQKIFAGLVAINGNLTCYVNAPPSGT---FAQTLLGWSWQTCTEMVIPM-GITRNTMFPP  386

Query  463  SEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  284
              ++ N     CK  F + PRP+W+TT FGGH+I+ +L +F SNIIF NGL+DP+S+GGV
Sbjct  387  KPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGV  446

Query  283  LKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            LK+IS ++VAI   +G+H +D+  + K DP WL + R+ EV+I+++W+++YY
Sbjct  447  LKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYY  498



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = -3

Query  640  VKKLYAA-VNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIFPA  464
            ++K++A  V I  N +  VN    G    F Q+   W+WQ CTEM++P  G  ++++FP 
Sbjct  325  LQKIFAGLVAINGNLTCYVNAPPSGT---FAQTLLGWSWQTCTEMVIPM-GITRNTMFPP  380

Query  463  SEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGV  284
              ++ N     CK  F + PRP+W+TT FGGH+I+ +L +F SNIIF NGL+DP+S+GGV
Sbjct  381  KPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGV  440

Query  283  LKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            LK+IS ++VAI   +G+H +D+  + K DP WL + R+ EV+I+++W+++YY
Sbjct  441  LKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYY  492



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 114/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG-NPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + +++A V     Y    +C++   NP    +++  W WQ C+EM+MP    + D+
Sbjct  319  GSDILSRIFAGV---VAYRGNSSCYNTSVNP---TETSEGWRWQTCSEMVMPIGRGDNDT  372

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP S ++    +Q C   + + PRP+WITT +GGH+I+ +L +F SNIIF NGLRDP+S
Sbjct  373  MFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYS  432

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            + GVLK+IS +++AI    G+H +D+  +   DP+WL   R+ EVEII+ WI+QY+
Sbjct  433  SAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYH  488



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSIF  470
            +D V ++YA V   +N S   +C D  N     +S   ++WQ C+EM+MP  G +K S+F
Sbjct  324  TDIVSRIYAGVLDYFN-STHHDCVDT-NYFQIGESIVGYDWQTCSEMVMPI-GTSKWSMF  380

Query  469  PASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAG  290
            P   ++    +Q CK+ + + PRP+WIT+ +GGH+++ +  +FGSNIIF NGL+DP+S+ 
Sbjct  381  PPQPFNLRDFIQDCKNKYNVMPRPHWITSYYGGHDMKLIFGRFGSNIIFSNGLQDPYSSA  440

Query  289  GVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GVL ++S S++A+ A +G+H VD++ + K+DP+WL ++R  E+EII  WI +YY
Sbjct  441  GVLYNLSDSIIAVYATQGSHCVDIQHAKKDDPEWLINMRNTEIEIISGWIRKYY  494



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 114/176 (65%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG-NPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            GSD + +++A V     Y    +C++   NP    +++  W WQ C+EM+MP    + D+
Sbjct  327  GSDILSRIFAGV---VAYRGNSSCYNTSVNP---TETSEGWRWQTCSEMVMPIGRGDNDT  380

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP S ++    +Q C   + + PRP+WITT +GGH+I+ +L +F SNIIF NGLRDP+S
Sbjct  381  MFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPYS  440

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            + GVLK+IS +++AI    G+H +D+  +   DP+WL   R+ EVEII+ WI+QY+
Sbjct  441  SAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYH  496



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = -3

Query  568  NPLDFEQS-AAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNW  392
            N   FE S  + W+WQ CTE++MP    + +++F A  +D     + C + F + PRP+W
Sbjct  334  NIFSFELSNKSGWDWQTCTEIVMPIGYGDNETMFQAEPFDLKNYTRDCVNCFGVVPRPHW  393

Query  391  ITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKF  212
            +TTEFGGH+I+ VL  F SNIIF NGLRDPWS+GGVL+ IS S+VAI  + GAH  DL  
Sbjct  394  VTTEFGGHDIKTVLGNFASNIIFSNGLRDPWSSGGVLEDISDSVVAIHTEYGAHCADLFP  453

Query  211  STKEDPKWLKDVRRKEVEIIQEWISQYY  128
            S+ +DP WL + R KEV+II  WI++YY
Sbjct  454  SSPDDPVWLVEQREKEVKIIAVWIAEYY  481



>ref|XP_010651835.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=376

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 3/146 (2%)
 Frame = -3

Query  559  DFEQS-AAQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTF--KIEPRPNWI  389
            DF+ S  + W WQ CTEM+MP      D++F AS +D N   + C+D F   + PRP+WI
Sbjct  224  DFQPSNMSGWLWQTCTEMVMPFGRGENDTMFQASPFDLNNYTKTCQDIFGASVTPRPHWI  283

Query  388  TTEFGGHNIERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFS  209
            TTEFGGHNI+ VL  F SNIIF NGLRDP+S GGVL+ IS+S+VA+   +GAH +DL   
Sbjct  284  TTEFGGHNIKSVLGNFASNIIFSNGLRDPYSIGGVLQDISESVVAVYTLKGAHCLDLGTP  343

Query  208  TKEDPKWLKDVRRKEVEIIQEWISQY  131
               DP WL   R KE++I+  W+++Y
Sbjct  344  MPSDPDWLVAQRDKEIKIVALWLAEY  369



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = -3

Query  541  AQWNWQICTEMIMPADGNNKDSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNI  362
            + W+WQ CTEM+ P      +++F  S +D N   + C   F I+PRP W TTEFGGH+I
Sbjct  348  SAWDWQTCTEMVFPIGYGYNETMFQPSPFDINNYTEACVQVFGIKPRPQWATTEFGGHDI  407

Query  361  ERVLKKFGSNIIFFNGLRDPWSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLK  182
            + VL  F SNIIF NGLRDPWSAGGVL+ IS ++VA+  + GAH +DL   T  DP WL 
Sbjct  408  KTVLGNFASNIIFANGLRDPWSAGGVLEDISDTVVAVYTEYGAHCLDLYPPTPNDPDWLV  467

Query  181  DVRRKEVEIIQEWISQYY  128
            + R KE++II  WI++YY
Sbjct  468  EQRDKEIKIIAAWIAEYY  485



>ref|XP_010100142.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81593.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=544

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -3

Query  649  SDPVKKLYAAVNICYNYSREVNCFD-PGNPLDFEQSAAQWNWQICTEMIMP-ADGNNKDS  476
            +D + KL+A V+    Y    +C++  GN L  +Q    W WQ C+EM+MP A G+++DS
Sbjct  330  TDTLGKLFAGVSA---YRGNRSCYNISGNNLS-DQLLDGWYWQSCSEMVMPIAHGSDEDS  385

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP   +D       CK  + + PRP+W+TT +GGH+I+ V  +F SNIIF NGLRDP+S
Sbjct  386  MFPKDHFDLESYTNDCKRLYGVVPRPHWVTTYYGGHDIKLVFHEFASNIIFSNGLRDPYS  445

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQY  131
             GGVL++I++S+VA+T   G+H +DL  S   DP+WL   R+ E+EII+ WI++Y
Sbjct  446  RGGVLENITESVVAVTTDNGSHCLDLLSSRPSDPQWLVMQRKNEIEIIEGWIAKY  500



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 118/178 (66%), Gaps = 9/178 (5%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPG---NPLDFEQSAAQWNWQICTEMIMPADGNNK  482
            G+D + +++A V     Y    +C+D     +P D  Q++  W WQ C+E++MP  G+++
Sbjct  238  GTDILGRIFAGV---VAYMGHKSCYDMNEFNDPTD--QTSLAWRWQTCSELVMPI-GHDR  291

Query  481  DSIFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDP  302
            +++FP + ++    ++ CK  F I P+P+W+TT +GG +++ +L +F SNIIF NGLRDP
Sbjct  292  NTMFPPAPFNLKSYIKECKSLFGILPQPHWVTTYYGGQDLKLILHRFASNIIFSNGLRDP  351

Query  301  WSAGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +S GGVL++IS S+VAI+   G+H +D++     DP WL   R+ EVEIIQ WIS+YY
Sbjct  352  YSTGGVLENISDSIVAISTVNGSHCLDIQKEKPSDPNWLVMQRKTEVEIIQGWISKYY  409



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 113/175 (65%), Gaps = 5/175 (3%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICYNYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDSI  473
            GSD + K+YA V           C   G P +  ++   W WQ C+EM++P  G  KD++
Sbjct  312  GSDILSKIYAGV---VALKGNTTCTING-PTNVSETTVGWRWQTCSEMVIPI-GIEKDTM  366

Query  472  FPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWSA  293
            F  + +     V+ CK TF + PRP+W+TT +G HNI+ VL +FGSNIIF NGL+DP+S 
Sbjct  367  FEPNPFSLKRYVEGCKTTFGVSPRPHWVTTYYGAHNIKLVLGRFGSNIIFSNGLKDPYSI  426

Query  292  GGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            GGVL++IS ++VAI    G+H +D+  + + DP+WL   R+KE++I++ WI++YY
Sbjct  427  GGVLENISDNIVAIHTVNGSHCLDILRANESDPEWLVKQRKKEIKIMKRWITKYY  481



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -3

Query  652  GSDPVKKLYAAVNICY-NYSREVNCFDPGNPLDFEQSAAQWNWQICTEMIMPADGNNKDS  476
            G+D + K++A V   Y N S  VN      P +  ++   W+WQ C+++++P  G + +S
Sbjct  329  GNDTLSKIFAGVVAYYGNRSCYVN-----EPRNLSETDVGWSWQTCSDLVIPM-GVSNES  382

Query  475  IFPASEWDYNGRVQFCKDTFKIEPRPNWITTEFGGHNIERVLKKFGSNIIFFNGLRDPWS  296
            +FP  ++D    +  CK  + + PRP+W TT FGGH+I+  L +F SNIIF NGLRDP+S
Sbjct  383  MFPPYQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRDPYS  442

Query  295  AGGVLKSISKSLVAITAKEGAHHVDLKFSTKEDPKWLKDVRRKEVEIIQEWISQYY  128
            +GGVL++IS ++VA+ AK G+H +D+  S   DP WL + R+ EV+II+ W+++YY
Sbjct  443  SGGVLENISDTVVAVLAKNGSHCLDVLLSDSTDPDWLVEQRKTEVKIIEGWLAEYY  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947515357384