BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24543_g1_i1 len=724 path=[4345:0-156 4502:157-184 5868:185-435
507:436-465 7520:466-469 5129:470-709 778:710-723]

Length=724
                                                                      Score     E

emb|CBI30345.3|  unnamed protein product                                265   5e-82   
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    265   7e-82   Vitis vinifera
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   255   3e-79   
emb|CDP10629.1|  unnamed protein product                                257   1e-78   
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             256   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    255   4e-78   
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        255   5e-78   
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           254   1e-77   
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   5e-77   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   5e-77   
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    251   1e-76   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    250   3e-76   
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    248   4e-75   
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         247   9e-75   Ricinus communis
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        247   1e-74   
ref|XP_004306148.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   1e-74   
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         244   5e-74   
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    245   5e-74   
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    244   1e-73   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    244   1e-73   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        243   2e-73   
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    243   2e-73   
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    243   2e-73   
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    243   3e-73   
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    242   4e-73   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    242   5e-73   
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                242   5e-73   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           242   6e-73   
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    241   1e-72   
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    241   2e-72   
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             241   2e-72   
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    240   3e-72   
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        237   4e-71   
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    237   6e-71   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    236   2e-70   
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             235   3e-70   
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    234   7e-70   
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    233   9e-70   
emb|CAN61013.1|  hypothetical protein VITISV_036738                     234   1e-69   Vitis vinifera
ref|XP_007203815.1|  hypothetical protein PRUPE_ppa005504m1g            218   4e-68   
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    228   2e-67   
gb|EPS74090.1|  hypothetical protein M569_00662                         227   3e-67   
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   7e-67   
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     224   2e-66   
gb|ABR17682.1|  unknown                                                 224   6e-66   Picea sitchensis
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    223   1e-65   
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          223   1e-65   
ref|NP_001044360.1|  Os01g0767100                                       219   3e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KDO70538.1|  hypothetical protein CISIN_1g0106562mg                  207   4e-64   
gb|EAY75958.1|  hypothetical protein OsI_03875                          219   6e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_002438751.1|  hypothetical protein SORBIDRAFT_10g025530          209   6e-64   Sorghum bicolor [broomcorn]
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          219   7e-64   Oryza sativa Japonica Group [Japonica rice]
gb|AFK45793.1|  unknown                                                 206   2e-62   
emb|CDM83096.1|  unnamed protein product                                214   4e-62   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        213   1e-61   
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    212   1e-61   
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    212   2e-61   
gb|AIA26578.1|  serine protease                                         207   4e-61   
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           209   9e-61   
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        207   2e-60   
ref|NP_001136852.1|  uncharacterized protein LOC100217003               204   2e-60   Zea mays [maize]
dbj|BAK01568.1|  predicted protein                                      209   4e-60   
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    209   5e-60   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             208   7e-60   
emb|CDP02648.1|  unnamed protein product                                207   7e-60   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    207   9e-60   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    207   1e-59   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    207   1e-59   
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    208   1e-59   
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               207   1e-59   
gb|EMT22762.1|  Lysosomal Pro-X carboxypeptidase                        200   2e-59   
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    203   2e-59   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    206   3e-59   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          206   3e-59   Sorghum bicolor [broomcorn]
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    206   4e-59   
gb|AFW87518.1|  putative serine peptidase S28 family protein            211   7e-59   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             204   1e-58   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    204   1e-58   
gb|AFW84965.1|  putative serine peptidase S28 family protein            204   1e-58   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    204   1e-58   
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    201   2e-58   
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   204   2e-58   
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             204   2e-58   
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    204   2e-58   
gb|ABR17702.1|  unknown                                                 203   3e-58   Picea sitchensis
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    203   3e-58   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        203   6e-58   
dbj|BAJ87416.1|  predicted protein                                      203   6e-58   
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    202   7e-58   
dbj|BAJ92142.1|  predicted protein                                      203   8e-58   
gb|ABK95653.1|  unknown                                                 194   8e-58   Populus trichocarpa [western balsam poplar]
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    202   9e-58   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        202   9e-58   
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        202   1e-57   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              202   1e-57   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        202   1e-57   
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        197   1e-57   
dbj|BAJ86079.1|  predicted protein                                      202   2e-57   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    201   2e-57   
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   2e-57   
emb|CDY20293.1|  BnaC04g36630D                                          201   2e-57   
emb|CDY46135.1|  BnaA04g14230D                                          201   2e-57   
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        201   2e-57   
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        201   3e-57   
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        200   4e-57   
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              200   5e-57   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   5e-57   
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    200   6e-57   
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   8e-57   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         199   1e-56   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              200   1e-56   Zea mays [maize]
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            199   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     200   1e-56   Zea mays [maize]
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       199   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         199   1e-56   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         199   1e-56   
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             199   1e-56   
emb|CDY08753.1|  BnaA06g24710D                                          199   1e-56   
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        199   2e-56   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          200   2e-56   Sorghum bicolor [broomcorn]
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        198   3e-56   Vitis vinifera
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         197   5e-56   Ricinus communis
gb|EEE66119.1|  hypothetical protein OsJ_22160                          195   6e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   9e-56   
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   9e-56   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           196   1e-55   
emb|CDY45627.1|  BnaCnng13350D                                          196   1e-55   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        195   1e-55   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    197   1e-55   
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   1e-55   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             196   2e-55   
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   2e-55   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             196   2e-55   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   2e-55   
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        196   2e-55   
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             196   2e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CBI18675.3|  unnamed protein product                                196   3e-55   
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          196   3e-55   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   3e-55   
gb|EMT03389.1|  Lysosomal Pro-X carboxypeptidase                        196   4e-55   
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             195   4e-55   Populus trichocarpa [western balsam poplar]
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        195   4e-55   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         195   5e-55   
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    195   5e-55   
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   5e-55   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        195   6e-55   
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   7e-55   
ref|NP_001058206.1|  Os06g0647400                                       195   9e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         194   9e-55   Populus trichocarpa [western balsam poplar]
gb|EEC81080.1|  hypothetical protein OsI_23902                          195   9e-55   Oryza sativa Indica Group [Indian rice]
emb|CDX68714.1|  BnaC01g07390D                                          191   9e-55   
ref|XP_001776094.1|  predicted protein                                  194   1e-54   
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   1e-54   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    193   2e-54   
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    191   2e-54   
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    193   3e-54   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        194   3e-54   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   4e-54   
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   4e-54   
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        192   5e-54   
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   5e-54   
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        194   7e-54   
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        191   1e-53   
gb|KDO59435.1|  hypothetical protein CISIN_1g044064mg                   187   1e-53   
gb|EPS59259.1|  hypothetical protein M569_15548                         190   2e-53   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             190   2e-53   
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    190   2e-53   
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         190   2e-53   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    190   2e-53   
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   3e-53   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        190   3e-53   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   3e-53   
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          191   4e-53   Sorghum bicolor [broomcorn]
gb|EAZ17490.1|  hypothetical protein OsJ_33021                          184   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        190   4e-53   
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    190   4e-53   
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     190   5e-53   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              188   8e-53   
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-52   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    188   1e-52   
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        188   2e-52   
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   2e-52   
gb|EYU30781.1|  hypothetical protein MIMGU_mgv1a0254691mg               179   3e-52   
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                186   1e-51   
gb|AFW87519.1|  putative serine peptidase S28 family protein            186   1e-51   
dbj|BAK05623.1|  predicted protein                                      186   1e-51   
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   2e-51   
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   2e-51   
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   3e-51   
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          185   5e-51   Sorghum bicolor [broomcorn]
emb|CDP10200.1|  unnamed protein product                                184   6e-51   
ref|NP_001065793.1|  Os11g0156200                                       184   7e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007150129.1|  hypothetical protein PHAVU_005G1292001g            177   1e-50   
gb|EAY80009.1|  hypothetical protein OsI_35177                          183   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_008779559.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    173   2e-50   
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   9e-50   
gb|ABR16397.1|  unknown                                                 181   1e-49   Picea sitchensis
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   8e-49   
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   9e-49   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   1e-48   
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        177   1e-48   
gb|EYU41363.1|  hypothetical protein MIMGU_mgv1a0060841mg               169   1e-48   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   1e-48   Vitis vinifera
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   2e-48   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         176   7e-48   
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   7e-48   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   1e-47   
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  169   2e-47   
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   2e-47   
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             174   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    174   3e-47   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         173   4e-47   
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                174   4e-47   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             174   5e-47   Populus trichocarpa [western balsam poplar]
emb|CDP17394.1|  unnamed protein product                                173   7e-47   
emb|CBI17110.3|  unnamed protein product                                171   8e-47   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              172   8e-47   
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             172   9e-47   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         171   9e-47   
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             172   9e-47   
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   2e-46   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    172   2e-46   Vitis vinifera
ref|XP_010493392.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    168   2e-46   
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         169   4e-46   
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    171   4e-46   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     171   4e-46   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    171   4e-46   
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    171   6e-46   
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             169   8e-46   
emb|CBI17112.3|  unnamed protein product                                171   1e-45   
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         169   1e-45   Ricinus communis
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    169   1e-45   
emb|CAN65360.1|  hypothetical protein VITISV_036071                     171   1e-45   Vitis vinifera
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             169   2e-45   
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    169   3e-45   
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    168   4e-45   
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    168   4e-45   
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         166   5e-45   
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    168   6e-45   
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    167   9e-45   
emb|CAN64374.1|  hypothetical protein VITISV_018664                     167   1e-44   Vitis vinifera
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        167   1e-44   Vitis vinifera
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            167   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     167   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             166   2e-44   Populus trichocarpa [western balsam poplar]
gb|KFK27606.1|  hypothetical protein AALP_AA8G405500                    166   3e-44   
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        166   3e-44   
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   165   4e-44   
gb|KFK27605.1|  hypothetical protein AALP_AA8G405500                    166   4e-44   
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    166   4e-44   
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         165   6e-44   
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    165   6e-44   
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             161   6e-44   
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    164   2e-43   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         164   2e-43   Ricinus communis
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             162   2e-43   
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    163   2e-43   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         163   3e-43   Ricinus communis
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         163   4e-43   Ricinus communis
emb|CBI17109.3|  unnamed protein product                                166   4e-43   
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           163   4e-43   
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        163   4e-43   Vitis vinifera
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    162   4e-43   
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    163   4e-43   
ref|XP_008360161.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    157   4e-43   
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        163   4e-43   
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             162   5e-43   
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    162   5e-43   
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   164   5e-43   
emb|CDY28235.1|  BnaA01g06140D                                          153   5e-43   
ref|XP_006484928.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   6e-43   
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             162   6e-43   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             162   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    162   7e-43   
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    162   8e-43   
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    161   9e-43   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    161   1e-42   
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             161   1e-42   
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        162   1e-42   
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             161   1e-42   
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    161   1e-42   
ref|XP_006388623.1|  prolylcarboxypeptidase-related family protein      152   2e-42   
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   161   2e-42   
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         160   3e-42   
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    160   3e-42   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    160   4e-42   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    160   4e-42   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    160   4e-42   
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        160   5e-42   
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             160   6e-42   
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     156   6e-42   
emb|CDP07008.1|  unnamed protein product                                160   6e-42   
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        160   6e-42   
ref|XP_006369374.1|  hypothetical protein POPTR_0001s221001g            150   7e-42   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   159   9e-42   
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    158   1e-41   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    159   1e-41   
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        159   1e-41   
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        158   2e-41   
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    158   2e-41   
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   3e-41   
ref|XP_002530593.1|  lysosomal pro-X carboxypeptidase, putative         154   3e-41   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    157   5e-41   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             155   5e-41   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             157   6e-41   
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    156   9e-41   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        157   9e-41   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    156   9e-41   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         156   1e-40   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  155   1e-40   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       156   1e-40   
ref|XP_002322808.2|  hypothetical protein POPTR_0016s07530g             147   1e-40   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    156   1e-40   
emb|CDY09174.1|  BnaA02g06000D                                          155   2e-40   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   2e-40   
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             155   2e-40   
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   3e-40   
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    155   4e-40   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    154   4e-40   
emb|CBI17113.3|  unnamed protein product                                155   4e-40   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    154   9e-40   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     154   1e-39   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      153   1e-39   
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     153   1e-39   
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         153   1e-39   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    153   2e-39   
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   2e-39   
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   2e-39   
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   2e-39   
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   2e-39   
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             152   3e-39   
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   152   3e-39   
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   3e-39   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             152   3e-39   
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   4e-39   
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    151   5e-39   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    151   8e-39   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    150   2e-38   
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        150   2e-38   
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    149   3e-38   
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    149   6e-38   
ref|XP_008842482.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   1e-37   
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    147   2e-37   
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   3e-37   
ref|XP_003706326.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   3e-37   
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        146   5e-37   
ref|XP_008498766.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    146   5e-37   
ref|XP_006132231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   6e-37   
ref|XP_008464256.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   6e-37   
emb|CDY09173.1|  BnaA02g05990D                                          145   7e-37   
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   7e-37   
ref|XP_009879496.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   1e-36   
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   1e-36   
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        144   1e-36   
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   1e-36   
ref|XP_007490949.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    145   1e-36   
gb|KFQ24633.1|  Lysosomal Pro-X carboxypeptidase                        140   1e-36   
ref|XP_010187440.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   1e-36   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    148   1e-36   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   1e-36   
gb|KFP06048.1|  Lysosomal Pro-X carboxypeptidase                        144   1e-36   
ref|XP_003507068.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    144   1e-36   
ref|XP_002599211.1|  hypothetical protein BRAFLDRAFT_200045             143   2e-36   
gb|EMC81816.1|  Lysosomal Pro-X carboxypeptidase                        143   2e-36   
ref|XP_009908966.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   2e-36   
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        143   3e-36   
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        144   3e-36   
gb|KFV02463.1|  Lysosomal Pro-X carboxypeptidase                        143   3e-36   
ref|XP_010042171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   4e-36   
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        143   4e-36   
ref|XP_005149846.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        143   4e-36   
emb|CDP14439.1|  unnamed protein product                                143   4e-36   
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     143   5e-36   
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        143   5e-36   
ref|XP_009877154.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   6e-36   
gb|KGL90198.1|  Lysosomal Pro-X carboxypeptidase                        142   6e-36   
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   7e-36   
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        142   7e-36   
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   7e-36   
gb|KFV63066.1|  Lysosomal Pro-X carboxypeptidase                        139   7e-36   
gb|ELU04397.1|  hypothetical protein CAPTEDRAFT_174591                  142   8e-36   
ref|XP_005357662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   9e-36   
ref|XP_009245156.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    141   1e-35   
ref|XP_010018717.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   1e-35   
ref|XP_006865042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    142   1e-35   
gb|KFZ51659.1|  Lysosomal Pro-X carboxypeptidase                        141   1e-35   
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   1e-35   
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    142   1e-35   
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   1e-35   
ref|XP_010175531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   1e-35   
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   1e-35   
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        141   1e-35   
ref|XP_006991953.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   1e-35   
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   1e-35   
ref|XP_008385479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-35   
ref|XP_009563433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        142   1e-35   
gb|AAM15096.1|  putative prolylcarboxypeptidase                         142   1e-35   
gb|KFP73631.1|  Lysosomal Pro-X carboxypeptidase                        141   2e-35   
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   2e-35   
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    142   2e-35   
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    142   2e-35   
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           141   2e-35   
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    142   2e-35   
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    141   2e-35   
ref|XP_010676045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   2e-35   
ref|XP_009468660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   2e-35   
ref|XP_001628070.1|  predicted protein                                  140   2e-35   
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    141   2e-35   
ref|XP_011024297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   2e-35   
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   2e-35   
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   2e-35   
ref|XP_004901739.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   2e-35   
ref|XP_007060650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   2e-35   
ref|XP_783661.3|  PREDICTED: lysosomal Pro-X carboxypeptidase-like      142   3e-35   
ref|XP_004901733.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   3e-35   
gb|KFQ54980.1|  Lysosomal Pro-X carboxypeptidase                        140   3e-35   
ref|XP_003393594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   3e-35   
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    141   3e-35   
ref|XP_004901738.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   3e-35   
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   3e-35   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    141   3e-35   
ref|XP_009279588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   3e-35   
gb|KFO13685.1|  Lysosomal Pro-X carboxypeptidase                        140   3e-35   
gb|KFO79296.1|  Lysosomal Pro-X carboxypeptidase                        140   3e-35   
ref|XP_005579271.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   3e-35   
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        141   3e-35   
ref|XP_010629189.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   3e-35   
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   3e-35   
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             140   4e-35   
ref|XP_010629188.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   4e-35   
gb|KFV84322.1|  Lysosomal Pro-X carboxypeptidase                        140   4e-35   
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
ref|XP_005074171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   4e-35   
ref|XP_009070789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   4e-35   
ref|XP_010675578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   4e-35   
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   4e-35   
ref|XP_009245155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   4e-35   
gb|KFV12075.1|  Lysosomal Pro-X carboxypeptidase                        139   4e-35   
gb|KFQ13604.1|  Lysosomal Pro-X carboxypeptidase                        140   4e-35   
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   5e-35   
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg             140   5e-35   
ref|XP_010077848.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   5e-35   
gb|EMP35010.1|  Lysosomal Pro-X carboxypeptidase                        140   5e-35   
ref|XP_004473934.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   5e-35   
ref|XP_004364392.1|  prolylcarboxypeptidase                             140   5e-35   
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   5e-35   
ref|XP_004019472.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   5e-35   
gb|KFR02889.1|  Lysosomal Pro-X carboxypeptidase                        139   5e-35   
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   5e-35   
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   5e-35   
ref|XP_005612064.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   6e-35   
gb|KFZ57497.1|  Lysosomal Pro-X carboxypeptidase                        139   6e-35   
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   6e-35   
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   6e-35   
ref|XP_010283636.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   6e-35   
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   6e-35   
ref|XP_009640619.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   6e-35   
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   6e-35   
ref|XP_006001899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   6e-35   
ref|XP_008056303.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   7e-35   
ref|XP_009185280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   7e-35   
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   7e-35   
ref|XP_008973719.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   7e-35   
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   7e-35   
ref|XP_009351278.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   8e-35   
gb|KFM08871.1|  Lysosomal Pro-X carboxypeptidase                        139   8e-35   
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    140   8e-35   
ref|XP_005274150.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    138   9e-35   
ref|XP_004295648.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   9e-35   
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        139   9e-35   
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   9e-35   
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   9e-35   
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         139   9e-35   
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   1e-34   
ref|XP_005579269.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   1e-34   
gb|EHH56621.1|  hypothetical protein EGM_06072                          139   1e-34   
ref|XP_009967794.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   1e-34   
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   1e-34   
ref|XP_005287637.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   1e-34   
ref|XP_004324072.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   1e-34   
ref|XP_005379867.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   1e-34   
ref|XP_004093164.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    139   1e-34   
ref|XP_005379866.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   1e-34   
ref|XP_005485885.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   2e-34   
ref|XP_009321727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        138   2e-34   
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   2e-34   
ref|XP_009185279.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   2e-34   
ref|XP_004621226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   2e-34   
gb|KFW73852.1|  Lysosomal Pro-X carboxypeptidase                        138   2e-34   
gb|KFQ73298.1|  Lysosomal Pro-X carboxypeptidase                        138   2e-34   
pdb|3N2Z|B  Chain B, The Structure Of Human Prolylcarboxypeptidas...    138   2e-34   
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   2e-34   
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g            139   2e-34   
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   2e-34   
dbj|BAG52417.1|  unnamed protein product                                139   2e-34   
ref|XP_003697693.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-34   
ref|XP_004051943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    139   2e-34   



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+D   KLY A N++YNYTG   CFD     +    +G +W WQ CTE+I+PV A++++
Sbjct  303  QGNDTFAKLYGAANVYYNYTGTAACFDLADDSDP-HGLG-EWTWQACTEMIMPVNANNEE  360

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFP S WNYS  A FCK AF+IEPRPNWITTEFG H+IKRVLKRFGSNIIFFNGLRDPW
Sbjct  361  SIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPW  420

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            S GGVLE+ISKSIVAIVAK+GAHHVDLRF+T EDP+WL+DVR++EVKII KW S+YYH
Sbjct  421  SGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYH  478



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+D   KLY A N++YNYTG   CFD     +    +G +W WQ CTE+I+PV A++++
Sbjct  325  QGNDTFAKLYGAANVYYNYTGTAACFDLADDSDP-HGLG-EWTWQACTEMIMPVNANNEE  382

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFP S WNYS  A FCK AF+IEPRPNWITTEFG H+IKRVLKRFGSNIIFFNGLRDPW
Sbjct  383  SIFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPW  442

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            S GGVLE+ISKSIVAIVAK+GAHHVDLRF+T EDP+WL+DVR++EVKII KW S+YYH
Sbjct  443  SGGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQDVRKREVKIITKWFSEYYH  500



>ref|XP_010093782.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB54615.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=400

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A NI+YNYTG   CFD +   +     G  W WQ CTE+I+P   ++K+S
Sbjct  219  GNDTFAKLYGAANIYYNYTGTAKCFDLDDDSDPHGLSG--WGWQACTEMILPTSGNTKES  276

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEW+YS    +CKN + +EPR NWITTEFG   I+RVLKRFGSNIIFFNGLRDPWS
Sbjct  277  IFPASEWHYSGRVSYCKNVYGVEPRRNWITTEFGGFGIERVLKRFGSNIIFFNGLRDPWS  336

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NIS+SIVAIVAKEGAHHVDLRFSTKEDP+WLK+VR++E+ II  WISQYYH
Sbjct  337  GGGVLKNISRSIVAIVAKEGAHHVDLRFSTKEDPEWLKEVRKQEINIIAGWISQYYH  393



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 8/180 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF---DPEKPLEVLSRIGVQWRWQTCTEIIIPVGASS  549
            G++ LEKLY+A N++YN TG   CF   D   P  +      +W WQ CTE+I+P+G ++
Sbjct  342  GNNTLEKLYSAANVYYNSTGRATCFNLNDDSDPHGL-----DEWSWQACTEMILPIGGNN  396

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
             D IFP SEW+Y+  A+ C++AF ++PRPNWITTEFG HNI+RVLKRFGSNIIFFNGLRD
Sbjct  397  ADGIFPPSEWDYAGRAQSCEDAFGVQPRPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRD  456

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            PWS GGVL++ISKS+VAIVAKEGAHHVDLRFST EDP+WLK  RR+EVKII  W+SQYYH
Sbjct  457  PWSGGGVLKDISKSLVAIVAKEGAHHVDLRFSTPEDPEWLKHARRREVKIIENWLSQYYH  516



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+    KLY A +++YNY+G   CF+ +   +     G  W WQ CTE+I+P   ++KDS
Sbjct  324  GNKTFAKLYGAASVYYNYSGNATCFNHDDDSDPHGLGG--WSWQACTEMILPTSGNNKDS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEWNY + A FCK  F +EPRPNWIT EFG H+IKRVLKRFGSNIIFFNGLRDPWS
Sbjct  382  IFPASEWNYDDRASFCKAYFGVEPRPNWITAEFGGHDIKRVLKRFGSNIIFFNGLRDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVLENIS SIVAI+AK+GAHHVDLRF+T EDPKWL+DVR++EV II KW+S+YY
Sbjct  442  GGGVLENISSSIVAIIAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSEYY  497



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++   KLY A +++YNY+G   CF+ +   +     G  W WQ CTE+I+P   ++KDS
Sbjct  324  GNNTFAKLYGAASVYYNYSGTATCFNLDDDSDPHGLGG--WSWQACTEMILPTSGNNKDS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IF ASEWNY + A FCK  F +EPRPNWITTEFG H+IKRVLKRFGSNIIFFNGLRDPWS
Sbjct  382  IFTASEWNYDDRATFCKAYFGVEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVLENIS SIVAIVAK+GAHHVDLRF+T EDPKWL+DVR++EV II KW+S+YY
Sbjct  442  GGGVLENISSSIVAIVAKQGAHHVDLRFATSEDPKWLQDVRKREVSIIAKWLSKYY  497



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A N++YNY+G V CF+ +   +     G  W WQ CTE+I+P G +++DS
Sbjct  324  GNDTFAKLYGAANVYYNYSGTVTCFELDDNSDPHDLGG--WYWQACTEMIMPTGGNNEDS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPAS+W+Y + A  CK+ F IEPRP WITTEFG H I+RVLKR+GSNIIFFNGLRDPWS
Sbjct  382  IFPASDWDYKDQASVCKSRFGIEPRPLWITTEFGGHAIERVLKRYGSNIIFFNGLRDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NISKSIVAIVAKEGAHHVDL F + EDP+WL+DVR++E+KII KWISQYYH
Sbjct  442  GGGVLKNISKSIVAIVAKEGAHHVDLMFKSSEDPEWLQDVRKQEIKIIAKWISQYYH  498



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 142/177 (80%), Gaps = 7/177 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++   KLYAA NIFYNY+G V CFD       +S     W WQ+CTE+I+P+G ++++S
Sbjct  327  GNETFTKLYAAANIFYNYSGSVICFD-------ISNDSGGWDWQSCTEMIMPLGGNNEES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPA +W   E   +CK  ++I+PRP+WITTEFG H+I RVLKR+GSNIIFFNGLRDPWS
Sbjct  380  IFPAHKWELEETLSYCKQTYHIDPRPHWITTEFGGHDIGRVLKRYGSNIIFFNGLRDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NISK+++AIVAKEGAHHVDLRFSTKEDP+WLKDVR++EVKII  WISQYY 
Sbjct  440  GGGVLKNISKTLIAIVAKEGAHHVDLRFSTKEDPEWLKDVRKQEVKIITSWISQYYQ  496



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY AV ++YNY+G   CFDP+   +     G  W WQ CTE+I+    + K+S
Sbjct  332  GNDTFAKLYGAVTVYYNYSGTTTCFDPDDNSDPHDLGG--WDWQACTEMIMQTNGNDKES  389

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP SE  Y +   +CK A+ +EPRPNWITTEFG H+IKRVL+R+GSNIIFFNGLRDPWS
Sbjct  390  IFPPSESQYKDQVSYCKEAYGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWS  449

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL NISK IVAIVAKEGAHHVDLRF T EDP+WLKDVR++EVKII KWIS+YYH
Sbjct  450  GGGVLSNISKRIVAIVAKEGAHHVDLRFKTNEDPEWLKDVRKQEVKIIAKWISEYYH  506



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   +LY AVNI+YN TG   CFD E   +       +W WQ CTE+I+P   +  DS
Sbjct  327  GNDTFARLYGAVNIYYNNTGNATCFDIEDDSDPHGL--SEWTWQACTEMILPTDGNKNDS  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEW+Y+  A  C+ AF I PRP+WITTE+G ++I+RVLKRFGSNIIFFNGLRDPWS
Sbjct  385  IFPASEWDYANRATNCQFAFGINPRPHWITTEYGGYDIRRVLKRFGSNIIFFNGLRDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVLE+ISKSI+AIVAKEGAHHVDLRFSTKEDP+WL+DVR++EV II KW+SQYY+
Sbjct  445  GGGVLESISKSIIAIVAKEGAHHVDLRFSTKEDPEWLRDVRKREVGIIRKWLSQYYN  501



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D  EK+Y A NI+YNYTG   CFD     +     G  W WQ+CTE+++P   ++K+S
Sbjct  314  GKDTFEKIYEAANIYYNYTGNATCFDLNDHSDPHGLAG--WTWQSCTEMVMPTDGNNKES  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP S+W+Y+E A+FCK+ F +EPRPNW+TTEFG +NI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  372  IFPPSKWDYNERAQFCKSIFGVEPRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
              GVL++ISKSIVAIVAKEGAHHVDLR+S+KEDPKWL+ VR +EV II  W+SQYY 
Sbjct  432  GAGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLQQVREREVNIISNWLSQYYQ  488



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D  EK+Y A NI+YNYTG   CF+     +     G  W WQ CTE+++P   ++K+S
Sbjct  313  GKDTFEKIYGAANIYYNYTGNATCFNLNDHSDPHGLAG--WTWQACTEMVMPTDGNNKES  370

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP S+W+Y+E A+FCK+ F +EPRPNW+TTEFG +NI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  371  IFPPSKWDYNERAQFCKSNFGVEPRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWS  430

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
              GVL++ISKSIVAIVAKEGAHHVDLR+S+KEDPKWLK VR +EV II  W+SQYY 
Sbjct  431  GAGVLKDISKSIVAIVAKEGAHHVDLRWSSKEDPKWLKQVREREVNIISNWLSQYYQ  487



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D  EKLY A NI+YNYTG+  C +     +     G  W WQ CTE+++P   ++K+S
Sbjct  327  GNDTFEKLYGAANIYYNYTGKATCLNLNDNSDPHGLGG--WTWQACTEMVMPTNGNNKES  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP SEW+Y+E  +FCK   +++PRP+WITTEFG H+I+RVLKRFGSNIIFFNGLRDPWS
Sbjct  385  IFPPSEWDYNERVRFCKLILDVKPRPDWITTEFGGHDIERVLKRFGSNIIFFNGLRDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*L  180
             GGVL++ISKSIVAI+AKEGAHHVDLR+S+KEDP+WL++VR +E+ II KWISQYY    
Sbjct  445  GGGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRAREINIISKWISQYYQTKT  504

Query  179  GFS  171
             FS
Sbjct  505  DFS  507



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   K +AA +++YNY+G   CFD +   +     G  W WQ CTE+I+P G S+ +S
Sbjct  327  GNDTFAKFHAAASVYYNYSGTATCFDLDDDSDPHGLGG--WDWQACTEMILPTGGSTAES  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEW+Y++   +CK  F+I+PRPNWITTEFG HNIK  LKRF SNIIFFNGLRDPWS
Sbjct  385  IFPASEWDYNDRVTYCKLRFDIDPRPNWITTEFGGHNIKMALKRFASNIIFFNGLRDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVLE+ISKS+VA+V ++GAHHVDLRF+T EDPKWL++VR+KEVKII KW+S YY 
Sbjct  445  GGGVLEDISKSLVALVEEKGAHHVDLRFATSEDPKWLQEVRQKEVKIIAKWLSDYYQ  501



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++  EKLY A N++YNYTG+  CFD     +     G  W WQ CTE+I+    +++DS
Sbjct  325  GNNTFEKLYGAANVYYNYTGDATCFDLADDSDPHGLGG--WTWQACTEMILLTDGNTEDS  382

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP + ++Y++   FCK+ +NIEPRP WI T+FGAHNI RVLKRFGSNIIFFNGLRDPWS
Sbjct  383  IFPPNNYSYNDRFVFCKDNYNIEPRPTWIPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWS  442

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL++ISKS+VAIVAKEGAHHVDLRFST EDPKWL+DVR +EV+II KW+SQYY
Sbjct  443  GGGVLKDISKSLVAIVAKEGAHHVDLRFSTSEDPKWLEDVRNREVRIISKWLSQYY  498



>ref|XP_004306148.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=795

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KL+ A  ++YNYTG   CFDP    +     G  W+WQ CTE+I+P   ++++S
Sbjct  613  GNDTFAKLFGAATVYYNYTGTATCFDPNDNSDPHDLGG--WQWQACTEMIMPTSGNNEES  670

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP SEW Y     +C+ A+ +EPRPNWITTEFG H+IKRVL+R+GSNIIFFNGLRDPWS
Sbjct  671  MFPPSEWRYQGRVSYCEGAYGVEPRPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWS  730

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL NIS+SIVAIVAKEGAHHVDLRF T EDP+WLKDVR++E+ II KWIS+YYH
Sbjct  731  GGGVLSNISESIVAIVAKEGAHHVDLRFKTSEDPEWLKDVRKQEIGIIAKWISEYYH  787



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A +++YN++G   CFD +   +     G  W WQ CTE+I+P G ++K+S
Sbjct  318  GNDTFAKLYGAASVYYNHSGTATCFDLDNNSDPHGLGG--WSWQACTEMILPTGGNNKES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPAS W+ ++ A +C+ AF+I+PRPNW+  EFG HNIKRVLKRFGSNIIFFNGLRDPWS
Sbjct  376  MFPASSWSLNDRATYCQYAFHIQPRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVLE+ISKSI+AIVAK+GAHHVDLR+++ EDPKWL+ VR++E+KII KW+S+YY
Sbjct  436  GGGVLEDISKSIIAIVAKKGAHHVDLRYASSEDPKWLQHVRKREIKIIAKWLSEYY  491



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L KLYAA NI+YNYTG   CFD     +     G  W+WQ CTE+I+P+ +++K+SIFP 
Sbjct  335  LGKLYAAANIYYNYTGTAKCFDLYDNSDPHDLGG--WQWQACTEMIMPLDSNNKESIFPE  392

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            SEW+Y + + +CK  +N+ PRPNWIT+EFG H+I+ VLKR  SNIIFFNGLRDPWS GGV
Sbjct  393  SEWSYKDRSSYCKFEYNVVPRPNWITSEFGGHDIEIVLKRSASNIIFFNGLRDPWSGGGV  452

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            L+NISKSIVA+V KEGAHHVDLRFSTKEDPKWLKDVRR+EVKII  WISQY+ 
Sbjct  453  LKNISKSIVALVEKEGAHHVDLRFSTKEDPKWLKDVRRQEVKIIESWISQYHQ  505



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D  +KLY A +++YNY+G+  CFD +   +     G  W WQ CTE+I+P+G +++ S
Sbjct  334  GNDTFKKLYGAASVYYNYSGKATCFDLDDDSDPHDLGG--WSWQACTEMIMPMGGNTEVS  391

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEW Y   A  C   F IEPRP WITTEFG H+IKRVLKR+GSNIIFFNGLRDPWS
Sbjct  392  IFPASEWKYKYRAASCMRNFGIEPRPLWITTEFGGHDIKRVLKRYGSNIIFFNGLRDPWS  451

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NISKSIVAIVAKEGAHHVDLRF   EDP+WLK+VR++E+ II  WISQYYH
Sbjct  452  GGGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPEWLKEVRKQEINIIGNWISQYYH  508



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D  +KLY A +++YNY+G   CFD +   +     G  W WQ CTE+I+P   ++++S
Sbjct  334  GNDTFKKLYGAASVYYNYSGTATCFDLDDDSDPHDLGG--WSWQACTEMIMPTSGNTEES  391

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPASEW Y   A  CK +F IEPRP WITTEFG H+I+RVLKR+GSNIIFFNGLRDPWS
Sbjct  392  IFPASEWKYXYRAASCKRSFGIEPRPLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWS  451

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NISKSIVAIVAKEGAHHVDLRF   EDP WLK+VR++E+ II  WISQYYH
Sbjct  452  GGGVLKNISKSIVAIVAKEGAHHVDLRFKNSEDPDWLKEVRKQEINIIGNWISQYYH  508



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ L KLYAA N++YNYTG+  CFD +   +     G  W+WQ CTE+I+PVG S+K+S
Sbjct  326  GNNRLAKLYAAANVYYNYTGKATCFDLDDNSDPHDLGG--WQWQACTEMIMPVGGSNKES  383

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP  EW+Y   A +C   +N++PRP+WITTEFG H I+RVLKR  SNIIFFNGLRDPWS
Sbjct  384  IFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWS  443

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            +GGVL+ ISK+IVAIVAK+GAHHVDLR+S+KEDP+WLKDVR++EV II  WISQY+ 
Sbjct  444  AGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQ  500



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ L KLYAA N++YNYTG+  CFD +   +     G  W+WQ CTE+I+PVG S+K+S
Sbjct  328  GNNRLAKLYAAANVYYNYTGKATCFDLDDNSDPHDLGG--WQWQACTEMIMPVGGSNKES  385

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP  EW+Y   A +C   +N++PRP+WITTEFG H I+RVLKR  SNIIFFNGLRDPWS
Sbjct  386  IFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWS  445

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            +GGVL+ ISK+IVAIVAK+GAHHVDLR+S+KEDP+WLKDVR++EV II  WISQY+ 
Sbjct  446  AGGVLKTISKTIVAIVAKKGAHHVDLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQ  502



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 138/183 (75%), Gaps = 14/183 (8%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF------DPEKPLEVLSRIGVQWRWQTCTEIIIPVG  558
            G+D   KLY A N++YN+TG   CF      DP   L++       W WQ CTE+I+P  
Sbjct  328  GNDSFAKLYGAANVYYNHTGTTTCFNLAYSPDPHG-LDM-------WSWQACTEMIMPTD  379

Query  557  ASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNG  378
             +++DSIFP S+W+YS+ A  CK  + ++PRPNWITTEFG H+I R LKRFGSNIIF+NG
Sbjct  380  GNNQDSIFPESQWSYSQRAAVCKGYYGVDPRPNWITTEFGGHDISRALKRFGSNIIFYNG  439

Query  377  LRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQ  198
            LRDPWS GGVL+NISK+IVAIVA++GAHHVDLRF+T +DPKWL+ VR +EVKII  WISQ
Sbjct  440  LRDPWSGGGVLKNISKTIVAIVAEQGAHHVDLRFATSQDPKWLQQVREREVKIISNWISQ  499

Query  197  YYH  189
            YYH
Sbjct  500  YYH  502



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A N++YNYTG   CFD +        +G  W WQ CTE+I+P G ++K+S
Sbjct  323  GNDTFAKLYGAANVYYNYTGTATCFDLDD-DSDPHDLG-DWTWQACTEMILPTGGNTKES  380

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPAS W++++   FCK  F++EPR  WI T FG HNI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  381  IFPASTWHFADRLHFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWS  440

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS +I+AIVAKEGAHHVDLRFS+ EDPKWLKDVR++E+ II  W+SQYY
Sbjct  441  GGGVLKNISSTIIAIVAKEGAHHVDLRFSSAEDPKWLKDVRQQELSIIEDWLSQYY  496



>ref|XP_004167790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=501

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A NI+YN+TG V CFD +        +G  W WQ CTE+I+P G ++K+S
Sbjct  322  GNDSFTKLYGAANIYYNFTGTVTCFDLDD-DSDPHDLG-DWSWQACTEMILPTGGNTKES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPAS W++++  +FCK  F++EPR  WI T FG HNI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  380  IFPASTWHFADRFQFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS +I+AIVAKEGAHHVDLRFS  +DPKWLKDVR++EV II  W+SQYY
Sbjct  440  GGGVLKNISSTIIAIVAKEGAHHVDLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYY  495



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A NI+YN+TG V CFD +        +G  W WQ CTE+I+P G ++K+S
Sbjct  323  GNDSFTKLYGAANIYYNFTGTVTCFDLDD-DSDPHDLG-DWSWQACTEMILPTGGNTKES  380

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPAS W++++  +FCK  F++EPR  WI T FG HNI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  381  IFPASTWHFADRFQFCKTFFDVEPRRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWS  440

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS +I+AIVAKEGAHHVDLRFS  +DPKWLKDVR++EV II  W+SQYY
Sbjct  441  GGGVLKNISSTIIAIVAKEGAHHVDLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYY  496



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 7/186 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF---DPEKPLEVLSRIGVQWRWQTCTEIIIPVGASS  549
            G++  EKLYAA +I+YNYTG   CF   D   P  +  R G  W WQ CTE+I+    ++
Sbjct  313  GNNTFEKLYAAASIYYNYTGNAKCFNLIDRSDPHGI--RPG--WNWQACTEMILLTDGNT  368

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
            +DSIFPAS ++Y++  ++CK+ ++I+PRP WI TEFGA +I RVLKRFGSNIIFFNGLRD
Sbjct  369  EDSIFPASNYSYNDRLQYCKSNYDIDPRPTWIPTEFGARHIHRVLKRFGSNIIFFNGLRD  428

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            PWS GGVL++ISKS+VAIVAKEGAHHVDLRFST+EDP+WL++VR++EV II  W+SQYYH
Sbjct  429  PWSGGGVLKDISKSVVAIVAKEGAHHVDLRFSTREDPEWLREVRKREVHIISNWLSQYYH  488

Query  188  K*LGFS  171
                FS
Sbjct  489  TLADFS  494



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G + LEKLY A +I+YNY+G   CFD     +     G  W+WQ C+E+I+P GASSK+S
Sbjct  322  GKNTLEKLYDAASIYYNYSGTSKCFDLNDHSDPHDLGG--WQWQACSEMIMPEGASSKES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP S+W+  +   +CK A+N+ PRPNWIT+EFG HNI+ VLKR   NIIFFNGLRDPWS
Sbjct  380  IFPESKWSVKDRNAYCKFAYNVVPRPNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NISK+I+AIVAKEGAHHVDLR+STKEDPKWLKDVR++EVKII  WISQY+ 
Sbjct  440  GGGVLKNISKTIIAIVAKEGAHHVDLRYSTKEDPKWLKDVRKQEVKIIESWISQYHQ  496



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D  EKLY A N++YNY+G+  CFD     +     G  W WQ CTE+++P   ++K+S
Sbjct  327  GNDTFEKLYGAANMYYNYSGKATCFDLNDNSDPHGLGG--WTWQACTEMVMPTDGNNKES  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP SEW+Y+E  +FC+   +++PR +WITTEFG +NI+RVLKRFGSNIIFFNGLRDPWS
Sbjct  385  IFPPSEWDYNERVRFCQLILDVKPRSDWITTEFGGYNIERVLKRFGSNIIFFNGLRDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL++ISKSIVAI+AKEGAHHVDLR+S+KEDP+WL++VR +EV II  WISQYY 
Sbjct  445  GGGVLKDISKSIVAIIAKEGAHHVDLRWSSKEDPEWLREVRGREVNIISNWISQYYQ  501



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFD--PEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            G+D+  KLY A +++YNY+G   CFD   +     LS    +W WQ CTE+I+  G  +K
Sbjct  327  GNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLS----EWGWQACTEMIMLTGGDNK  382

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
            DSIF  SE +Y   A++CK A+ ++PRPNWITTEFG H I  VLKRF SNIIFFNGLRDP
Sbjct  383  DSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDP  442

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            WS GGVL+NISK+++A+V KEGAHHVDLRFSTKEDP+WLKDVRR+EV+II KWISQY+ 
Sbjct  443  WSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIIGKWISQYFQ  501



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFD--PEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            G+D+  KLY A +++YNY+G   CFD   +     LS    +W WQ CTE+I+  G  +K
Sbjct  327  GNDVFAKLYGAASVYYNYSGTAKCFDLNGDSDPHGLS----EWGWQACTEMIMLTGGDNK  382

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
            DSIF  SE +Y   A++CK A+ ++PRPNWITTEFG H I  VLKRF SNIIFFNGLRDP
Sbjct  383  DSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDP  442

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            WS GGVL+NISK+++A+V KEGAHHVDLRFSTKEDP+WLKDVRR+EV+I+ KWISQY+ 
Sbjct  443  WSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRREVEIVGKWISQYFQ  501



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            ++   KLYAA NIFYNYTG   CF  +     L      W WQ CTE+I+P+GA+++ S+
Sbjct  328  NETFTKLYAAANIFYNYTGTATCFFLDNTTAPLG----GWDWQACTELIMPLGANNEGSM  383

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP  +W   +   +CK  ++I+PRP+WITTEFG H+IKRVLKR GSNIIFFNGLRDPWS 
Sbjct  384  FPPYKWKLRDVEFYCKRVYHIQPRPHWITTEFGGHDIKRVLKRSGSNIIFFNGLRDPWSG  443

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            GGVL+NIS++IVAIVAKEGAHHVDLRFST EDP+WLKD+R++E+KII  WISQYY 
Sbjct  444  GGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKREIKIIANWISQYYQ  499



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ L KL+AA +++YNYTG+  CFD +   +     G  W+WQ CTE+I+PVG S+K+S
Sbjct  329  GNNRLAKLHAAASVYYNYTGKARCFDLDDNSDPHDLGG--WQWQACTEMIMPVGGSNKES  386

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP  EW+Y   A +C   +N++PRP+WITTEFG H I+RVLKR  SNIIFFNGLRDPWS
Sbjct  387  IFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWS  446

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+ ISK++VAIVAK+GAHHVDLRFS+KEDP+WLKDVR+ EV II  WISQY+ 
Sbjct  447  GGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQ  503



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ L KL+AA +++YNYTG+  CFD +   +     G  W+WQ CTE+I+PVG S+K+S
Sbjct  329  GNNRLAKLHAAASVYYNYTGKARCFDLDDNSDPHDLGG--WQWQACTEMIMPVGGSNKES  386

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP  EW+Y   A +C   +N++PRP+WITTEFG H ++RVLKR  SNIIFFNGLRDPWS
Sbjct  387  IFPEYEWSYEARASWCDFFYNVQPRPHWITTEFGGHAVERVLKRSASNIIFFNGLRDPWS  446

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+ ISK++VAIVAK+GAHHVDLRFS+KEDP+WLKDVR+ EV II  WISQY+ 
Sbjct  447  GGGVLKTISKTLVAIVAKKGAHHVDLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQ  503



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGV-QWRWQTCTEIIIPVGASSKD  543
            G D   KLY A NI+YNY+G V+CFD    L+     G+ +W WQ CTE+I+P G + + 
Sbjct  335  GDDDFAKLYGAANIYYNYSGGVSCFDL---LDDSDPHGLGEWAWQACTEMILPTGGNRET  391

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFPA E+NY++    C + F + PRP WI  EFG H+I+R L+RFGSNIIFFNGLRDPW
Sbjct  392  SIFPAHEYNYNDRVATCTSLFGVVPRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPW  451

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL++ISKSIVAIVA++GAHHVDLR+ST EDP+WL+DVR+KE+KII  WISQYY
Sbjct  452  SGGGVLKSISKSIVAIVAEKGAHHVDLRYSTNEDPEWLQDVRKKEIKIISGWISQYY  508



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +D L KLYAA +++YNYTG   CFD +   +     G  W+WQ CTE+I+PVG S+K SI
Sbjct  327  NDGLGKLYAAASVYYNYTGTATCFDLDDDSDPHDLGG--WQWQACTEMIMPVGGSNKHSI  384

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   W+Y + A  C+  +N+ PRP+WITTEFG H I+ VLKR  SNIIFFNGLRDPWS 
Sbjct  385  FPEYVWSYQDRASACQFFYNVTPRPHWITTEFGGHAIQTVLKRSASNIIFFNGLRDPWSG  444

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            GGVL+NISK+IVAIV K GAHHVDLR+S KEDPKWLKDVRR+EV II  WISQYY 
Sbjct  445  GGVLKNISKTIVAIVEKRGAHHVDLRYSAKEDPKWLKDVRRQEVNIIASWISQYYQ  500



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKD  543
            G+D   +LY A+NI+YNYTG+  CFD      +   +G   W WQ+CTE+I+P G  S++
Sbjct  316  GNDTFARLYGAMNIYYNYTGKATCFDVNTD-SLDDTVGTDGWNWQSCTEMILPTGGRSEE  374

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FPA++++Y +NA FC++ + + PRP+WITTEFG H+I RVLKRFGSNIIFFNGLRDPW
Sbjct  375  SMFPANKYSYDDNAGFCESYYGVAPRPHWITTEFGGHDITRVLKRFGSNIIFFNGLRDPW  434

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL++++ S+ A+V  +GAHHVDLR+STKEDP WL++VRRKE+ II  W +Q+Y
Sbjct  435  SGGGVLKSLNPSLKAMVVPQGAHHVDLRYSTKEDPMWLQNVRRKEINIIAGWTNQFY  491



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   +LY A+NI+YNY+G   CF      E     G  W WQ+C E+I+P GAS+ +S
Sbjct  322  GNDTFTRLYGAMNIYYNYSGTETCFVTVGSDEHGMDDG--WEWQSCMEMILPTGASNNES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP S +NY++ A  C+  + + PRP+WITTEFG H+I+RVLKR GSNIIFFNGLRDPWS
Sbjct  380  IFPPSTYNYTDQAVGCQEYYYVAPRPHWITTEFGGHDIRRVLKRSGSNIIFFNGLRDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+++SKS++AIV  EGAHHVDLRFSTKEDPKWLK VR KEVKII +W+ QYY
Sbjct  440  GGGVLKSLSKSLIAIVEPEGAHHVDLRFSTKEDPKWLKAVRMKEVKIISRWLEQYY  495



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   KLY A N++YNYTG   CFD     +    +G +W WQ CTE+I+PV A++++S
Sbjct  315  GNDTFAKLYGAANVYYNYTGTAACFDLADDSDP-HGLG-EWTWQACTEMIMPVNANNEES  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFP S WNYS  A FCK AF+IEPRPNWITTEFG H+IKRVLKRFGSNIIFFNGLRDPWS
Sbjct  373  IFPVSTWNYSNRAAFCKFAFDIEPRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDV  240
             GGVLE+ISKSIVAIVAK+GAHHVDLRF+T EDP+WL++ 
Sbjct  433  GGGVLESISKSIVAIVAKDGAHHVDLRFATSEDPEWLQBA  472



>ref|XP_007203815.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
 gb|EMJ05014.1| hypothetical protein PRUPE_ppa005504m1g, partial [Prunus persica]
Length=139

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  587  TCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKR  408
             CTE+I+P   S+KDSIFPAS+W+Y + A  CK+ F IEPRP W+TTEFG H+I+RVLKR
Sbjct  1    ACTEMIMPTSGSNKDSIFPASDWDYKDQASVCKSRFGIEPRPLWVTTEFGGHDIERVLKR  60

Query  407  FGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKE  228
            +GSNIIFFNGLRDPWS GGVL+NIS SIVAIVAKEGAHHVDL F + EDP+WLKDVR++E
Sbjct  61   YGSNIIFFNGLRDPWSGGGVLKNISNSIVAIVAKEGAHHVDLMFKSSEDPEWLKDVRKQE  120

Query  227  VKIIHKWISQYYH  189
            +KII KWISQYYH
Sbjct  121  IKIIAKWISQYYH  133



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   +LY A+NI+YNY+G   C       +    +   W WQ+CTE+ I  G S+ +S
Sbjct  321  GNDTFARLYGAMNIYYNYSGTETCLAAGGDSDE-HGMARGWSWQSCTEMTIVEGGSNNES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            I P + +NY+E A  C+N + + PRP+WITTEFG H+I+RVLKRFGSNIIFFNGLRDPWS
Sbjct  380  ILPPATYNYTEQAVACQNYYGVAPRPHWITTEFGGHDIRRVLKRFGSNIIFFNGLRDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+++S S++AIVA EGAHHVDLRFSTKEDPKWLK VR KE KII  W+ QYY
Sbjct  440  GGGVLKSLSNSLIAIVAPEGAHHVDLRFSTKEDPKWLKTVRTKENKIIAGWLEQYY  495



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+    K+Y A N++YNY+G   CFD     +     G  W WQ CTE+I+    + ++S
Sbjct  314  GNSTFAKMYGAANVYYNYSGNATCFDLADDSDPHGVNG--WYWQACTEMILITDGNREES  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IF AS ++Y++  ++CK+ + +EPRPNW  TEFGAHNIKR LK FGS+IIFFNGLRDPWS
Sbjct  372  IFTASNYSYNDRREYCKDKYGVEPRPNWAPTEFGAHNIKRALKNFGSSIIFFNGLRDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+N+S+S+VAIVAKEGAHHVDLRFSTKEDPKWL DVR++E +II  W+S Y+
Sbjct  432  GGGVLKNLSESLVAIVAKEGAHHVDLRFSTKEDPKWLVDVRKRETEIISTWLSHYH  487



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGV-QWRWQTCTEIIIPVGASSKD  543
            G+D   KLY A NI+YNYTG V+CFD     +   + G+ +W WQ CTE+I+P   ++K+
Sbjct  328  GNDTFAKLYGAANIYYNYTGNVDCFDITNDSD---KHGLDEWTWQACTEMILPTDGNNKE  384

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFP S  +Y++   +C + + ++PRP+WITTEFG  +I RVL+R+ SNI+FFNG RDPW
Sbjct  385  SIFPTSNDDYNDRDLYCTSIYGVQPRPHWITTEFGGFDIHRVLRRYASNILFFNGRRDPW  444

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            S GGVL+NIS S+VAIVAKEGAHHVDLR+ST+EDP WLK++R+ E+  I KW+S+YYH
Sbjct  445  SGGGVLKNISSSLVAIVAKEGAHHVDLRYSTEEDPNWLKEIRKTEIHHIKKWLSRYYH  502



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D   KLY A NI+YNY+G ++CFD     +     G  W WQ CTE+++P+  + + S
Sbjct  287  GDDDFAKLYGAANIYYNYSGGISCFDLMDDSDPHGLSG--WGWQACTEMVMPIDGNRETS  344

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPA ++NY++    C    ++  RP WI  EFG H+I+R L+RFGSNIIFFNGLRDPWS
Sbjct  345  IFPAYKYNYTDTISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWS  404

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL++ISKSIVAIVA++GAHHVDLR+ST EDP+WL+DVR+KE+KII  WISQYY
Sbjct  405  GGGVLKSISKSIVAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQYY  460



>gb|ABR17682.1| unknown [Picea sitchensis]
Length=501

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +D+L +LY   N++YNYTG  +CFD  +P +     G  W++Q CTE+++P+    K S+
Sbjct  321  TDLLSQLYGVANVYYNYTGRSSCFDI-RPSDPHGEDG--WQFQACTEMVMPMADDPKKSM  377

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP S ++Y E    C++A+ ++PR +WITT++G H+IKRVLK F SNIIFFNGLRDPWS 
Sbjct  378  FPNSTFDYQERVDSCESAYGVQPRRHWITTQYGGHHIKRVLKNFASNIIFFNGLRDPWSG  437

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            GGVLE+I++S+VAIVAKEGAHHVD RF+TK+DP+WLKD R KE+ II  W+ QYY
Sbjct  438  GGVLEDINESVVAIVAKEGAHHVDFRFATKDDPQWLKDARTKEISIIKSWLQQYY  492



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D   KLY A NI+YNY+G ++CFD     +     G  W WQ CTE+++P+  + + S
Sbjct  337  GDDDFAKLYGAANIYYNYSGGISCFDLMDDSDPHGLSG--WGWQACTEMVMPIDGNRETS  394

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            IFPA ++NY++    C    ++  RP WI  EFG H+I+R L+RFGSNIIFFNGLRDPWS
Sbjct  395  IFPAYKYNYTDTISSCAADSSVVSRPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWS  454

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL++ISKSIVAIVA++GAHHVDLR+ST EDP+WL+DVR+KE+KII  WISQYY
Sbjct  455  GGGVLKSISKSIVAIVAEKGAHHVDLRYSTSEDPEWLQDVRKKEIKIISGWISQYY  510



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKD  543
            G +  + +Y A NIFYNYTG+  CF+     +   R G+  W +Q CTE+++  G  +++
Sbjct  340  GDEQFKGIYEAANIFYNYTGDSMCFNLSDNSD---RHGLNGWGFQACTEMLLATGGRTQE  396

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFP   +NY++  ++C+ ++ I PRP+WITT FG H+IKRVLKRFGSNIIFFNGLRDPW
Sbjct  397  SIFPPYTYNYTQTQEYCQQSYGINPRPHWITTHFGGHDIKRVLKRFGSNIIFFNGLRDPW  456

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVLEN+S SIVA+VAKEGAHH+DLRFST+ DP WL +VR++E+ I+  W+ QYY
Sbjct  457  SGGGVLENLSDSIVALVAKEGAHHIDLRFSTEGDPMWLSEVRKREIHILSMWLEQYY  513



>ref|NP_001044360.1| Os01g0767100 [Oryza sativa Japonica Group]
 dbj|BAD53352.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD53324.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06274.1| Os01g0767100 [Oryza sativa Japonica Group]
Length=517

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+ + S+DS
Sbjct  325  GTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD----GWDWQACTEMVMPM-SYSEDS  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NY+   K C N+F +EPRP WITTEFG HNI  VL+RFGSNIIFFNGL DPWS
Sbjct  380  MFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAI+A  GAHH+DLR ++K+DP WL  +R  E+ II  W+S YY
Sbjct  440  GGGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  495



>gb|KDO70538.1| hypothetical protein CISIN_1g0106562mg, partial [Citrus sinensis]
Length=137

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  587  TCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKR  408
             CTE+I+  G  +KDSIF  SE +Y   A++CK A+ ++PRPNWITTEFG H I  VLKR
Sbjct  1    ACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDPRPNWITTEFGGHKIGLVLKR  60

Query  407  FGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKE  228
            F SNIIFFNGLRDPWS GGVL+NISK+++A+V KEGAHHVDLRFSTKEDP+WLKDVRR+E
Sbjct  61   FASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHVDLRFSTKEDPQWLKDVRRRE  120

Query  227  VKIIHKWISQYYH  189
            V+II KWISQY+ 
Sbjct  121  VEIIGKWISQYFQ  133



>gb|EAY75958.1| hypothetical protein OsI_03875 [Oryza sativa Indica Group]
Length=549

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+ + S+DS
Sbjct  357  GTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD----GWDWQACTEMVMPM-SYSEDS  411

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NY+   K C N+F +EPRP WITTEFG HNI  VL+RFGSNIIFFNGL DPWS
Sbjct  412  MFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWS  471

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAI+A  GAHH+DLR ++K+DP WL  +R  E+ II  W+S YY
Sbjct  472  GGGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>ref|XP_002438751.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
 gb|EER90118.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
Length=192

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +DILEK++AA ++FYNYTG+  C   E      S     WRWQ CTE+I+P+ +SS +S+
Sbjct  12   ADILEKVFAAASLFYNYTGDQTCNHIEDKDSPRSLDLSYWRWQACTEMIMPM-SSSNESM  70

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP S ++Y +   +C   F + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDPWS 
Sbjct  71   FPPSTFSYEDRFNYCFRFFGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSG  130

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            GGVL+NIS SIVA+V ++GAHH+DLR +TK+DP W+ + RR+EV+II  WI QYY 
Sbjct  131  GGVLKNISSSIVALVTEKGAHHLDLRGATKDDPDWVIEQRRQEVEIIQGWIDQYYQ  186



>gb|EAZ13666.1| hypothetical protein OsJ_03583 [Oryza sativa Japonica Group]
Length=549

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 131/176 (74%), Gaps = 5/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+ + S+DS
Sbjct  357  GTSILERIYAGVNVYYNYTGTVDCFDLNDDPHGMD----GWDWQACTEMVMPM-SYSEDS  411

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NY+   K C N+F +EPRP WITTEFG HNI  VL+RFGSNIIFFNGL DPWS
Sbjct  412  MFPADKFNYTSYEKDCINSFGVEPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWS  471

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAI+A  GAHH+DLR ++K+DP WL  +R  E+ II  W+S YY
Sbjct  472  GGGVLKNISESVVAIIAPLGAHHIDLRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>gb|AFK45793.1| unknown [Lotus japonicus]
Length=212

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++Y  VN++YNYTGE  CF+ +     LS     W WQ CTE+++P+ +S + S
Sbjct  32   GTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLS----GWNWQACTEMVMPMSSSQESS  87

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY+   + C  +F +EPRP WITTEFG HNI   LK+FGSNIIF N L DPWS
Sbjct  88   MFPPYEYNYTSYLEDCIKSFGVEPRPKWITTEFGGHNILAPLKKFGSNIIFSNSLLDPWS  147

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NI +SIV +V KEGAHH++LR ST  DP WL + R  E+K+I  WIS YY K
Sbjct  148  GGSVLQNIFESIVFLVTKEGAHHINLRASTGNDPDWLVEQRATEIKLIQGWISDYYRK  205



>emb|CDM83096.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 126/176 (72%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS ILE++YA VNI+YNYTG V+CFD +     +      W WQ CTE+++P+ +S   S
Sbjct  325  GSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG----GWDWQACTEMVMPMSSSEGLS  380

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E++Y   A  C   F + PRP WI+TEFG HNI  VL++FGSNIIFFNGL DPWS
Sbjct  381  MFPPDEFDYELYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWS  440

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAIVA  GAHH+DLR +TKEDP WL  +R  E++II  W+S +Y
Sbjct  441  GGGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELEIISGWLSDHY  496



>ref|XP_003569899.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=512

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VNI+YNYTG V+CFD +     +      W+WQ CTE+++P+ +S   S
Sbjct  321  GTSTLERIYAGVNIYYNYTGTVDCFDLDDDPHGMG----GWQWQACTEMVMPMSSSESLS  376

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E++Y+  A  C  +F + P P WITTEFG HNI  VL++FGSNIIFFNGL DPWS
Sbjct  377  MFPPYEFDYASYADDCVKSFGVRPSPRWITTEFGGHNISAVLEKFGSNIIFFNGLLDPWS  436

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS S+VAIVA  GAHH+DLR +TKEDP WL  +R  E+ II  W+S +Y
Sbjct  437  GGGVLKNISGSVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELGIISGWLSDHY  492



>ref|XP_006646360.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=500

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++YA VNI+YNYTG  +CFD       +      W WQ CTE+++P+  S   S
Sbjct  310  GTSILERIYAGVNIYYNYTGTFDCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEDGS  365

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA +++Y+     C ++F + PRP WITTEFG HNI  VL+RFGSNIIFFNGL DPWS
Sbjct  366  MFPAYKFDYASYENDCISSFGVRPRPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWS  425

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAIVA  GAHH+DLR +TK DP WL  +R+ E+ II  W+  YY
Sbjct  426  GGGVLKNISESVVAIVAPLGAHHIDLRPATKADPDWLVSIRKSELDIISGWLLDYY  481



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++Y  VN++YNYTGE  CF+ +     +S     W WQ CTE+++P+ +S + S
Sbjct  333  GTSILERIYEGVNVYYNYTGEAKCFELDDDPHGMS----GWEWQACTEMVMPMSSSQESS  388

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY+     C   F ++PRP WITTEFG H+I   LK+FGSNIIF NGL DPWS
Sbjct  389  MFPPYEYNYTSIQAECLKKFGVKPRPRWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWS  448

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             GGVL+NIS+S+V++V +EGAHH+DLR STK DP WL + R  E+K+I  WIS Y+ K
Sbjct  449  GGGVLQNISESVVSLVTEEGAHHIDLRSSTKNDPDWLVEQRETEIKLIEGWISDYHQK  506



>gb|AIA26578.1| serine protease [Cicer arietinum]
Length=379

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++Y  VN++YNYTGE  CF+ +     L      W WQ CTE+++P+ +S + S
Sbjct  199  GTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLD----GWNWQACTEMVMPMSSSQESS  254

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY    + C   F ++PRP WITTEFG HNI   LK+FGSNIIF NGL DPWS
Sbjct  255  MFPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWS  314

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+SIV++V +EGAHH+DLR ST+ DP WL + R  E+K+I  WI++YY K
Sbjct  315  GGSVLQNISESIVSLVTQEGAHHLDLRASTENDPDWLIEQRATEIKLIEGWINEYYQK  372



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  644  DPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPR  465
            D   P   LS +      + C+E+I+P GASSK+SIFP S+W+  +   +CK A+N+ PR
Sbjct  311  DYPTPTNFLSPLPAYPVRKACSEMIMPEGASSKESIFPESKWSVKDRNAYCKFAYNVVPR  370

Query  464  PNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVD  285
            PNWIT+EFG HNI+ VLKR   NIIFFNGLRDPWS GGVL+NISK+I+AIVAKEGAHHVD
Sbjct  371  PNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVD  430

Query  284  LRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            LR+STKEDPKWLKDVR++EVKII  WISQY+ 
Sbjct  431  LRYSTKEDPKWLKDVRKQEVKIIESWISQYHQ  462



>gb|KHN33176.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=420

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  590  QTCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLK  411
            + CTE+I+P+GA+++ S+FP  +W   +   +CK  ++I+PRP+WITTEFG H+IKRVLK
Sbjct  282  KACTELIMPLGANNEGSMFPPYKWKLRDVEFYCKRVYHIQPRPHWITTEFGGHDIKRVLK  341

Query  410  RFGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRK  231
            R GSNIIFFNGLRDPWS GGVL+NIS++IVAIVAKEGAHHVDLRFST EDP+WLKD+R++
Sbjct  342  RSGSNIIFFNGLRDPWSGGGVLKNISETIVAIVAKEGAHHVDLRFSTTEDPEWLKDIRKR  401

Query  230  EVKIIHKWISQYYH  189
            E+KII  WISQYY 
Sbjct  402  EIKIIANWISQYYQ  415



>ref|NP_001136852.1| uncharacterized protein LOC100217003 [Zea mays]
 gb|ACF82763.1| unknown [Zea mays]
Length=319

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+  S + S
Sbjct  130  GTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEQRS  185

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y+  A+ C  ++ + PRP WITTEFG HNI +VL+ FGSNIIFFNGL DPWS
Sbjct  186  MYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWS  245

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAIVA  GAHH+DLR +T +DP WL  +R  E++II  W+  YY
Sbjct  246  GGGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  301



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            S ILE++YA VNI+YNYTG V+CFD +     +      W WQ CTE+++P+ +S   S+
Sbjct  325  SSILERIYAGVNIYYNYTGTVHCFDLDDDPHGMG----GWDWQACTEMVMPMSSSEGLSM  380

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP  E++Y+  A  C   F + PRP WI+TEFG HNI  VL++F SNIIFFNGL DPWS 
Sbjct  381  FPPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFSSNIIFFNGLLDPWSG  440

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            GGVL+NIS S+VAIVA  GAHH+DLR +TKEDP WL  +R  E++II  W+S +Y
Sbjct  441  GGVLKNISDSVVAIVAPLGAHHIDLRPATKEDPDWLVSLRESELEIISGWLSDHY  495



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +DILEK++AA +++YNYTG+  C   E            W WQ CTE+++P+ +S+ DS+
Sbjct  352  ADILEKVFAAASLYYNYTGDQTCNQIEDEGNPRCLNLNYWGWQACTELMMPM-SSANDSM  410

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   ++Y + A +C   F + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS 
Sbjct  411  FPPHTFSYEDKANYCLQTFGVRPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSR  470

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            GGVL+NIS SIVA+V ++GAHH+DLR +TK+DP W+ + RR+EV+IIH WI QYY
Sbjct  471  GGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYY  525



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
             + ILE+++  V+++YNYTG+V+CF  +     L      W WQ CTE+++P+ +S   S
Sbjct  337  ATSILERIFEGVSVYYNYTGDVDCFQLDDDPHGLD----GWNWQACTEMVMPMSSSRDKS  392

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NYS   + C N FN+ PRP WITTEFG H+IK VLK FGSNIIF NGL DPWS
Sbjct  393  MFPAYDYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWS  452

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             G VL+N+S++IVA+V +EGAHH+DLR ST EDP WLK  R  E+K+I  WI  YY
Sbjct  453  GGSVLQNLSETIVALVTEEGAHHLDLRPSTNEDPDWLKKQRETEIKLIEDWIDNYY  508



>emb|CDP02648.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  L+++Y  VN++YNYTG V+CF+    L+      + W WQ CTE+++P  +S    
Sbjct  323  GTSTLQRVYEGVNVYYNYTGTVDCFN----LDDDPHGMIGWDWQACTEMVMPFASSKNTG  378

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY+++ + C   +N++PRP WI+TEFG H++K VLK+FGSNIIF NGL DPWS
Sbjct  379  MFPEFEYNYADDEERCLKDYNVKPRPTWISTEFGGHDLKNVLKKFGSNIIFSNGLLDPWS  438

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             G VLE++S++IVA+V ++GAHH+DLR +T EDP WL D R  EVK+I KW+ +YY
Sbjct  439  GGSVLEDVSETIVALVTEKGAHHLDLRAATDEDPDWLVDQRESEVKLIKKWLQEYY  494



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++Y  VN++YNYTGE  CF+ +     L      W WQ CTE+++P+ +S + S
Sbjct  328  GTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLD----GWNWQACTEMVMPMSSSQESS  383

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY    + C   F ++PRP WITTEFG HNI   LK+FGSNIIF NGL DPWS
Sbjct  384  MFPPYEFNYLSFEEECFKNFGVKPRPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWS  443

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+SIV++V +EGAHH+DLR ST+ DP WL + R  E+K+I  WI++YY K
Sbjct  444  GGSVLQNISESIVSLVTQEGAHHLDLRASTENDPDWLIEQRATEIKLIEGWINEYYQK  501



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +LE+++A V+I+YNYTG V+CFD E     LS     W WQ CTE+++P+ +S ++S
Sbjct  318  GTTVLERIFAGVSIYYNYTGNVDCFDLEDDPHGLS----GWNWQACTEMVMPMSSSQENS  373

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA +++Y+     C   + + PRP WITTEFG H+IK  LK+FGSNIIF NGL DPWS
Sbjct  374  MFPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWS  433

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+N+S+SI+A+V + GAHH+DLR STKEDP WL + R  E+ +I  W+  YY +
Sbjct  434  GGSVLQNVSESIIALVTELGAHHIDLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQE  491



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +LE+++A V+I+YNYTG V+CFD E     LS     W WQ CTE+++P+ +S ++S
Sbjct  320  GTTVLERIFAGVSIYYNYTGNVDCFDLEDDPHGLS----GWNWQACTEMVMPMSSSQENS  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA +++Y+     C   + + PRP WITTEFG H+IK  LK+FGSNIIF NGL DPWS
Sbjct  376  MFPAYDFDYAAYQDQCLQDYGVRPRPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+N+S+SI+A+V + GAHH+DLR STKEDP WL + R  E+ +I  W+  YY +
Sbjct  436  GGSVLQNVSESIIALVTELGAHHIDLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQE  493



>ref|XP_004970093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=565

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++YA VN++YNYTG V CFD       +      W WQ CTE+++P+  S   S
Sbjct  376  GTSILERIYAGVNVYYNYTGTVGCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEDRS  431

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y+  A+ C  ++ + PRP WITT FG HNI  VL++FGSNIIFFNGL DPWS
Sbjct  432  MYPPYKFDYASYAENCIKSYGVRPRPRWITTNFGGHNITTVLEKFGSNIIFFNGLLDPWS  491

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S++AIVA  GAHH+DLR +T +DP WL  +R  E+KII  W+S YY
Sbjct  492  GGGVLKNISESVIAIVAPLGAHHIDLRPATSDDPDWLVSLRESELKIISGWLSDYY  547



>gb|AGT17295.1| hypothetical protein SHCRBa_168_J15_F_160 [Saccharum hybrid cultivar 
R570]
Length=523

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VN++YNYTG V CFD       +      W WQ CTE+++P+  S   S
Sbjct  334  GTSTLERIYAGVNVYYNYTGTVGCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEVRS  389

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y   A+ C  ++ + PRP WITTEFG HNI +VL++FGSNIIFFNGL DPWS
Sbjct  390  MYPPYKFDYPSYAEDCIKSYGVRPRPRWITTEFGGHNITKVLEKFGSNIIFFNGLLDPWS  449

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S++AIVA  GAHH+DLR +T +DP WL  +R  E+KII  W+S YY
Sbjct  450  GGGVLKNISESVIAIVAPLGAHHIDLRPATPDDPDWLVALRESELKIISGWLSDYY  505



>gb|EMT22762.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=269

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D++EK +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P   S+ +S
Sbjct  32   GADVVEKAFAAASLYYNYTGDQKCFQVEGGDDPHGLSG--WDWQACTEMVMPTTVSN-ES  88

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++Y E ++ C  ++ + PR +WITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  89   MFPPFNFSYEERSERCLASYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  148

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EV+IIH WI QY
Sbjct  149  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  203



>ref|XP_010910623.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=370

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+L++++A V+++YNYTG V+CFD E     +S     W WQ CTE+++P+ +S ++S
Sbjct  190  GTDLLDRIFAGVSVYYNYTGTVDCFDLEDDPHGMS----GWDWQACTEMVMPMSSSQENS  245

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA  ++Y+     C   + ++PRP W+TTEFG H+IK  L +FGSNIIF NGL DPWS
Sbjct  246  MFPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWS  305

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+SI+A+V + GAHH+DLR ST EDP WL + R+ E+ +I  WI  +Y +
Sbjct  306  GGSVLQNISESIIALVTELGAHHIDLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQE  363



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 124/176 (70%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
             + ILE+++  V+++YNYTG V+CF  +     L      W WQ CTE+++P+ +S   S
Sbjct  340  ATSILERIFEGVSVYYNYTGNVDCFQLDDDPHGLD----GWNWQACTEMVMPMSSSRDKS  395

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NYS   + C N FN+ PRP WITTEFG H+IK VLK FGSNIIF NGL DPWS
Sbjct  396  MFPAYDYNYSSFKEECWNDFNVIPRPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWS  455

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             G VL+N+S++IVA+V +EGAHH+DLR ST EDP WLK  R  E+K+I  WI  YY
Sbjct  456  GGSVLQNLSETIVALVTEEGAHHLDLRPSTNEDPDWLKKQRETEIKLIEGWIDNYY  511



>ref|XP_002458558.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
 gb|EES03678.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
Length=518

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VN++YNYTG V CFD       +      W WQ CTE+++P+  S   S
Sbjct  329  GTSTLERIYAGVNVYYNYTGTVGCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEGRS  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y   A  C  ++ + PRP WITTEFG HNI  VL++FGSNIIFFNGL DPWS
Sbjct  385  MYPPYKFDYPSYADGCIKSYGVRPRPRWITTEFGGHNITTVLEKFGSNIIFFNGLLDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S++AIVA  GAHH+DLR +T +DP WL  +R  E+KII  W+S YY
Sbjct  445  GGGVLKNISESVIAIVAPLGAHHIDLRPATPDDPDWLVALRESELKIISGWLSDYY  500



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 131/179 (73%), Gaps = 8/179 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKD  543
            G+  LE+++  V+IFYNYTG+  CF+    LE  S +G   W WQ CTE+++P+  SS+D
Sbjct  341  GTSTLERVFEGVSIFYNYTGQAECFE----LEDTSAVGTDGWNWQACTEMVMPM--SSRD  394

Query  542  -SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
             S+FP  ++N S   + C   +N++PRP WITTE+G H+IK  LK FGSNIIF NGL DP
Sbjct  395  ASMFPTYDFNLSSFEEECLKNYNVKPRPTWITTEYGGHDIKATLKAFGSNIIFSNGLLDP  454

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            WS G VL+N+S++IVA+VA+EGAHH+DLRFSTK+DPKWL + R  E+K+I  WI ++Y 
Sbjct  455  WSGGSVLQNVSETIVALVAEEGAHHLDLRFSTKDDPKWLIEQRETEIKLIEGWIEKFYQ  513



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score =   211 bits (537),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +DILEK++AA +++YNYTG+  C   E            W WQ CTE+++P+ +S+ DS+
Sbjct  379  ADILEKVFAAASLYYNYTGDQTCNQIEDEGNPRCLNLNYWGWQACTELMMPM-SSANDSM  437

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   ++Y + A +C   F + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS 
Sbjct  438  FPPHTFSYEDKANYCLQTFGVRPRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSR  497

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            GGVL+NIS SIVA+V ++GAHH+DLR +TK+DP W+ + RR+EV+IIH WI QYY
Sbjct  498  GGVLKNISSSIVALVTEKGAHHLDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYY  552



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ILE++Y  VN++YNYTG+  CF+ +     +S     W WQ CTE+++P+ ++   S
Sbjct  326  GTNILERIYEGVNVYYNYTGKEKCFELDDDPHGMSG----WDWQACTEMVMPMSSNQDSS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NY+   + C N + ++PRP WITTEFG H+I   LK+FGSNIIF NGL DPWS
Sbjct  382  MFPPYEYNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+S+V++V +EGAHH+DLR ST+ DP WL + R  E+K+I  WIS Y+ K
Sbjct  442  GGSVLQNISESVVSLVTEEGAHHIDLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQK  499



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            LE+ +AA +++YNY+G V CFD E   +     G  W WQ CTE+++P+  S++    P 
Sbjct  325  LERAFAAASLYYNYSGSVTCFDMENHTDSHGLNG--WGWQACTEMVMPMSCSNQTMFRPF  382

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
               +   N ++C   + ++PRPNWITTEFG   I+ VLKRFGSNIIF NGL+DPWS GGV
Sbjct  383  ESDDEKANQEYCLREYGVKPRPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGV  442

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            L+NIS SI+A+V ++GAHH DLR +TK+DP+WLK  RR+EV II KWIS+YY+
Sbjct  443  LKNISSSIIALVTRKGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYN  495



>gb|AFW84965.1| putative serine peptidase S28 family protein [Zea mays]
Length=515

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+  S + S
Sbjct  326  GTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEQRS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y+  A+ C  ++ + PRP WITTEFG HNI +VL+ FGSNIIFFNGL DPWS
Sbjct  382  MYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAIVA  GAHH+DLR +T +DP WL  +R  E++II  W+  YY
Sbjct  442  GGGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  497



>ref|XP_008654499.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654500.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654501.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654502.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654503.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654504.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654505.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 gb|AFW84964.1| putative serine peptidase S28 family protein [Zea mays]
Length=517

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE++YA VN++YNYTG V+CFD       +      W WQ CTE+++P+  S + S
Sbjct  328  GTGTLERIYAGVNVYYNYTGTVDCFDLNDDPHGMG----GWDWQACTEMVMPMSYSEQRS  383

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  +++Y+  A+ C  ++ + PRP WITTEFG HNI +VL+ FGSNIIFFNGL DPWS
Sbjct  384  MYPPYKFDYASYAEDCIKSYGVRPRPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWS  443

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS+S+VAIVA  GAHH+DLR +T +DP WL  +R  E++II  W+  YY
Sbjct  444  GGGVLKNISESVVAIVAPLGAHHIDLRPATPDDPDWLVALRESELEIISGWLWDYY  499



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 128/177 (72%), Gaps = 3/177 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+  L K+++A +++YNY+G+ +CFD E   +     G  W WQ CTE+++P+   S +
Sbjct  222  QGASKLTKVFSAASLYYNYSGDQSCFDIENGTDPHGLHG--WDWQACTEMVMPM-ICSNE  278

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP+S ++Y E    C   + + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPW
Sbjct  279  SMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPW  338

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL NIS SI+A+V ++GAHH+DLR++TK+DPKWL + R++E+ II  WI QY+
Sbjct  339  SRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYH  395



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 5/178 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE+++  +++FYNYTG+V CF  +     +      W WQ CTE+++P  +SS  S
Sbjct  335  GTSTLEQIFEGISVFYNYTGDVECFQLDDDPHGMD----GWNWQACTEMVMPT-SSSWGS  389

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++N S   + C N F ++PRP WITTEFG H+IK  L+RFGSNIIFFNGL DPWS
Sbjct  390  MFPRYDFNLSAYEEQCWNDFGVKPRPRWITTEFGGHDIKADLERFGSNIIFFNGLLDPWS  449

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             GGVL+NIS+SIVA+V  EGAHH+DLR STKEDP WL ++R  E+K+I  WI  YY +
Sbjct  450  GGGVLQNISESIVALVTIEGAHHIDLRASTKEDPDWLVELRETEIKLIKGWIDNYYQR  507



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = -3

Query  710  ILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFP  531
            +L+++YA V+++YNYTG ++CF+ +     L      W WQ CTE+++P+ +S  +S+FP
Sbjct  336  VLDRIYAGVSVYYNYTGNIDCFELDDDPHGLD----GWNWQACTEMVMPMSSSQGNSMFP  391

Query  530  ASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGG  351
            A ++NYS   + C N F + PRP W+TTEFG H+I+  LK FGSNIIF NGL DPWS G 
Sbjct  392  ADDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGLLDPWSGGS  451

Query  350  VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            VL+N+S SI+A+V KEGAHH+DLR ST EDPKWL D R  E+++I  WI  Y
Sbjct  452  VLKNLSNSIIALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  503



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS ILE+++  V+++YNYTGEV+CF  +     +      W WQ CTE+++P+ +    S
Sbjct  330  GSSILERIFNGVSVYYNYTGEVDCFQLDDDPHGMD----GWNWQACTEMVMPMSSDRNTS  385

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA +++YS   + C+  F + PRP WITTEFG H+I+ VLK FGSNIIF NGL DPWS
Sbjct  386  MFPAYDYDYSAFQEECRRDFQVTPRPRWITTEFGGHDIEHVLKFFGSNIIFSNGLLDPWS  445

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             GGVL+NIS++IVA+V +EGAHH+DLR ST EDP WL + R  E+++I  W+  Y  K
Sbjct  446  GGGVLKNISQTIVALVTEEGAHHIDLRASTTEDPDWLVEQRETEIELIEGWLDNYGEK  503



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            +G+D+L++++A V+++YNYTGE  CFD     +     G  W WQ CTE+++P+ ++ + 
Sbjct  327  NGTDVLDRIFAGVSVYYNYTGEEKCFDVND--DPHGENG--WNWQACTEMVMPMSSNPES  382

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            SIFP   ++     K C N F +EPRP+WITTEFG  +IKRVLK +GSNIIF NGL DPW
Sbjct  383  SIFPQFTFDIESYTKNCLNMFGVEPRPHWITTEFGGQDIKRVLKNYGSNIIFSNGLLDPW  442

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            S GGVL+NIS SIVA+V + GAHH+DLR +T+ DP WL + R  E+KII+KW+++YY 
Sbjct  443  SGGGVLQNISNSIVALVTELGAHHLDLRAATENDPLWLVEQRNAEMKIINKWMNEYYQ  500



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+L++++A V+I+YNYTG V+CFD E     +S     W WQ CTE+++P+ +S ++S
Sbjct  327  GTDLLDRIFAGVSIYYNYTGTVDCFDLEDDPHGMS----GWGWQACTEMVMPMSSSQENS  382

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++Y+     C + + + PRP W+TTEFG H+IK  LK FGSNIIF NGL DPWS
Sbjct  383  MFPTYNFSYAAYQDECVHNYGVRPRPRWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWS  442

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+SI+A+V + GAHH+DLR ST EDP WL + R+ E+ +I  WI  YY +
Sbjct  443  GGSVLQNISESIIALVTELGAHHIDLRPSTNEDPDWLIEQRKSEISLIRGWIYDYYQE  500



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D++EK + A +++YNYTG+  CF+ E   +     G  W WQ CTE+++P+  S+ +S
Sbjct  361  GADVVEKAFTAASLYYNYTGDQKCFEMEGGDDPHGLSG--WGWQACTEMVMPMTVSN-ES  417

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E ++ C  ++ + PR NWITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  418  MFPPSGFSYEEKSEGCFASYEVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  477

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EV+IIH WI QY
Sbjct  478  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  532



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+   S +S
Sbjct  346  GADIIDKAFAAASLYYNYTGDQKCFQVEGDDDPHGLDG--WDWQACTEMVMPM-IVSNES  402

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y  N+  C   + + PR NWITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  403  MFPPSSFSYENNSDACLADYGVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  462

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R  TK+DP W+ + RR+EV+IIH WI QY
Sbjct  463  RGGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGWIDQY  517



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  L + +AA +++YNY+   NCF+ E  ++     G  W WQTCTE+++P+   SK+S
Sbjct  320  GATKLSRSFAAASLYYNYSRAENCFEIEHEVDTHGLHG--WDWQTCTEMVMPM-TCSKES  376

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ C+  + + PRP+WITTEFG   I++VLK+FGSNIIF NG++DPWS
Sbjct  377  MFPPSGFDYEEFAEQCQMKYEVLPRPHWITTEFGGERIQKVLKKFGSNIIFSNGMQDPWS  436

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHHVD R +TK+DP WL + RR+EV+II KW+++YY
Sbjct  437  RGGVLKNISASIIALVTKKGAHHVDFRSATKDDPDWLVEQRRQEVEIIQKWLNEYY  492



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+   S +S
Sbjct  357  GADIIDKAFAAASLYYNYTGDQKCFQVEGDDDPHGLDG--WDWQACTEMVMPM-IVSNES  413

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y  N+  C   + + PR NWITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  414  MFPPSSFSYENNSDACLADYGVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  473

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R  TK+DP W+ + RR+EV+IIH WI QY
Sbjct  474  RGGVLKNISSSIIALVTEKGAHHLDFRSETKDDPDWVVEQRRQEVEIIHGWIDQY  528



>gb|ABK95653.1| unknown [Populus trichocarpa]
Length=213

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   S++S
Sbjct  32   GASKITRVFAAASLYYNYSRAEKCFKLEHGPDAHGLHG--WNWQACTEMVMPM-TCSEES  88

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ C   F ++PRP+WITTEFG   I  VLKR G NIIF NG++DPWS
Sbjct  89   MFPTSSFSYKEFAEDCMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWS  148

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V ++GAHHVD R +TK+DP+WLK++RR+EV+II  WI QYY
Sbjct  149  RGGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  204



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL+++YA ++++YNYTG+V+CF  +     L      W WQ CTE+++P+ +S ++S+
Sbjct  329  ASILDRIYAGISVYYNYTGDVDCFKLDDDPHGLD----GWDWQACTEMVMPMSSSQENSM  384

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FPA ++NYS   + C N F + PRP W+TTE G H+I+  LK FGSNIIF NGL DPWS 
Sbjct  385  FPADDFNYSSYKEECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSG  444

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST EDPKWL + R  E+++I  WI  Y
Sbjct  445  GSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVEQREAEIRLIQGWIETY  498



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+L++++A V+++YNYTG V+CFD E     +S     W WQ CTE+++P+ +S ++S
Sbjct  329  GTDLLDRIFAGVSVYYNYTGTVDCFDLEDDPHGMS----GWDWQACTEMVMPMSSSQENS  384

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA  ++Y+     C   + ++PRP W+TTEFG H+IK  L +FGSNIIF NGL DPWS
Sbjct  385  MFPAYNFSYAAYQDGCVQNYGVKPRPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWS  444

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+SI+A+V + GAHH+DLR ST EDP WL + R+ E+ +I  WI  +Y +
Sbjct  445  GGSVLQNISESIIALVTELGAHHIDLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQE  502



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G DIL K+++A +++YNY+   +CFD E   +     G  W WQ CTE+++P+  SS +S
Sbjct  329  GEDILIKVFSAASLYYNYSSTNSCFDIENGSDPHGLHG--WDWQACTEMVMPM-TSSNES  385

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E    C   + + PRP+WITTE+G + I+ VLKRFGSNIIF NG+RDPWS
Sbjct  386  MFPPSTYDYKEFGDQCMTKYEVRPRPHWITTEYGGNKIELVLKRFGSNIIFSNGMRDPWS  445

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V   GAHH+D R +TK+DPKWLK+ R  EVKII  WI QYY
Sbjct  446  RGGVLKNISSSIIALVTPLGAHHLDFRAATKDDPKWLKEQRETEVKIIQAWIDQYY  501



>gb|KEH31545.1| serine carboxypeptidase S28 family protein [Medicago truncatula]
Length=527

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 123/177 (69%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++Y  VN++YNYTGE  CF+ +     LS     W +Q CTE+++P+ +S K S
Sbjct  347  GTSILERIYEGVNVYYNYTGEAKCFELDDDPHGLS----GWNFQACTEMVMPMSSSRKSS  402

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E+NYS   + C   F ++PRP  ITT FG HNI   L++FGSNIIF NGL DPWS
Sbjct  403  MFPPYEYNYSSFQEDCLKNFGVKPRPKQITTVFGGHNIHLALRKFGSNIIFSNGLLDPWS  462

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             G VL+NIS+SIV++V +EGAHH+DLR ST+ DP WL + R  EVK+I  WIS YY 
Sbjct  463  GGSVLQNISESIVSLVTEEGAHHIDLRASTENDPDWLVEQRATEVKLIQGWISDYYQ  519



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K ++A +++YNYTG+  CFD E   +     G  W WQ CTE+++P+  S+K S
Sbjct  356  GADIVDKAFSAASLYYNYTGDQKCFDVEGGDDPHGLSG--WGWQACTEMVMPMTVSNK-S  412

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E ++ C  ++ + PR +WITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  413  MFPPSSFSYEEKSEGCLASYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  472

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EV+II  WI QY
Sbjct  473  RGGVLKNISSSIIALVTEKGAHHLDFRTATKDDPDWVIEQRRQEVEIIQGWIDQY  527



>gb|EMT33353.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=347

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             GS ILE++YA VNI+YNYTG V+CFD +     +      W WQ CTE+++P+ +S   
Sbjct  174  EGSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG----GWDWQACTEMVMPMSSSEGL  229

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP  E++Y+  A  C   F + PRP WI+TEFG HNI  VL++FGSNIIFFNGL DPW
Sbjct  230  SMFPPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPW  289

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWL  249
            S GGVL+NIS+S+VAIVA  GAHH+DLR +TKEDP WL
Sbjct  290  SGGGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWL  327



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D++EK +AA +++YNYTG+  CF+ E   +     G  W WQ CTE+++P+  S+ +S
Sbjct  348  GADVVEKAFAAASLYYNYTGDQKCFEVEGGDDPHGLSG--WGWQACTEMVMPMTVSN-ES  404

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E ++ C  A+++ PR +WITTE+G H I +VLKRFGSNIIF N +RDPWS
Sbjct  405  MFPPSGFSYEEKSEGCIAAYDVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNEMRDPWS  464

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EV+IIH WI QY
Sbjct  465  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQY  519



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE+++A V+++YNYTG V+CFD  +  + L   G  W WQ CTE+++P+ +S   S
Sbjct  336  GTSTLERIFAGVSVYYNYTGVVDCFDLGESNQDLGADG--WDWQACTEMVMPMSSSQSTS  393

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F A ++NYS     C   F I+PR  WITTEFG HN+   LK FGSNIIF NGL DPWS
Sbjct  394  MFTAYDFNYSSYQDECFKHFGIKPRSRWITTEFGGHNLLTDLKTFGSNIIFSNGLLDPWS  453

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             GGVL+N+S++I A+V KEGAHH+DLR S  EDP WL + R  EVK+I  WI++YY +
Sbjct  454  GGGVLQNVSETITALVTKEGAHHIDLRPSIDEDPDWLVEQRASEVKLITGWINKYYQE  511



>ref|XP_004288288.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 125/179 (70%), Gaps = 5/179 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKD  543
            G+  LE+++  ++++YNY+G  +CF+    LE  S +G   W WQ CTE+++P+ +S   
Sbjct  328  GTSTLERVFEGISVYYNYSGNADCFE----LEDTSDVGTDGWNWQACTEMVMPMSSSRDR  383

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+F   ++N+S    +C    N +PRP WITTEFG H+IK  LK FGSNIIF NGL DPW
Sbjct  384  SMFKTYDYNFSSFQDWCWKELNAKPRPTWITTEFGGHDIKATLKNFGSNIIFSNGLLDPW  443

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
            S G VL+NIS+SIVA+V +EGAHH+DLRFSTK DP WL + R  E+K+I  W+ ++Y +
Sbjct  444  SGGSVLQNISQSIVALVTEEGAHHIDLRFSTKGDPDWLVEQRESEIKLIQGWLDEFYQE  502



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+P +     G  W +Q CTE+++P+  S++ S
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDG--WGYQACTEMVMPMSCSNQ-S  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  372  MFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIESVLKRFGSNIIFSNGMQDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR +TK DP+WLK+ RR+EV II KWIS+YY
Sbjct  432  RGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYY  487



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+P +     G  W +Q CTE+++P+  S++ S
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDG--WGYQACTEMVMPMSCSNQ-S  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  372  MFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKKIETVLKRFGSNIIFSNGMQDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR +TK DP+WLK+ RR+EV II KWIS+YY
Sbjct  432  RGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIEKWISEYY  487



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L + +AA +++YNY+   NCF  E  ++     G  W WQTCTE+++P+   SK+S+FP 
Sbjct  321  LSRAFAAASLYYNYSRSENCFKIEHEVDGHGLHG--WDWQTCTEMVMPM-TCSKESMFPP  377

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            S ++Y E A+ C+  + + PRP+WITTEFG   I++VLKRFGSNIIF NG++DPWS GGV
Sbjct  378  SGFDYEEFAEQCRMKYCVSPRPHWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGV  437

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SI+A+V ++GAHHVD R +TK+DPKWL  +R++EV+II KW+++YY
Sbjct  438  LKNISSSIIALVTEKGAHHVDFRSATKKDPKWLIQLRKQEVEIIQKWLNEYY  489



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+P +     G  W +Q CTE+++P+  S++ S
Sbjct  347  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDG--WGYQACTEMVMPMSCSNQ-S  403

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NGL+DPWS
Sbjct  404  MFPPYENDYEAFEEQCMSKYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGLQDPWS  463

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR +TK DP+WLK+ RR+EV I+ KWIS+YY
Sbjct  464  RGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIVEKWISEYY  519



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L+K++AA +++YNY+    CF+ E   ++    G  W WQ CTE+++P+  S++ S+FP 
Sbjct  321  LDKVFAAASLYYNYSHGEKCFNVENGPDLHGLSG--WDWQACTEMVMPMTCSNQ-SMFPP  377

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            SE++Y E A  CK  + + PRP+WITTEFG   I+ VLKRFGSN+IF NG++DPWS GGV
Sbjct  378  SEFDYEEFATDCKKKYGVSPRPHWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGV  437

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L NIS SI+AIV ++GAHHVD R +TK+DP WL + R++EV+IIH+WI++YY
Sbjct  438  LRNISTSIIAIVTEKGAHHVDFRSATKDDPDWLVEQRKQEVEIIHQWINEYY  489



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+P +     G  W WQ CTE+++P+  S++ S
Sbjct  317  GSSNLDRAFAAASLYYNYSGSKKCFEMEQPTDDHGLDG--WGWQACTEMVMPMSISNQ-S  373

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  + +Y      C   + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  374  MFPPYDNDYEAFQDQCMGRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWS  433

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK+DP+WLK+ R +EV II +WI+QYY
Sbjct  434  RGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRMQEVTIIEQWITQYY  489



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL+++YA V+++YNYTG V+CF+ +     L      W WQ CTE+++P+ +S ++S+
Sbjct  321  ASILDRIYAGVSVYYNYTGNVDCFELDDDPHGLD----GWNWQACTEMVMPMSSSQENSM  376

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FPA  +NYS   + C   F + PRP W TTEFG H+I+  LK FGSNIIF NGL DPWS 
Sbjct  377  FPADGFNYSSYKEECWKTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSG  436

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST +DPKWL D R  E+++I  WI  Y
Sbjct  437  GSVLKNLSDTIVALVTKEGAHHLDLRPSTPDDPKWLVDQREAEIRLIQGWIETY  490



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 128/177 (72%), Gaps = 3/177 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+  L K+++A +++YNY+G+ +CFD E   +     G  W WQ CTE+++P+   S +
Sbjct  347  QGASKLTKVFSAASLYYNYSGDQSCFDIENGTDPHGLHG--WDWQACTEMVMPM-ICSNE  403

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP+S ++Y E    C   + + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPW
Sbjct  404  SMFPSSSYDYDEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPW  463

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL NIS SI+A+V ++GAHH+DLR++TK+DPKWL + R++E+ II  WI QY+
Sbjct  464  SRGGVLRNISSSIIALVTEKGAHHLDLRYATKDDPKWLLEQRKQEIDIIQSWIDQYH  520



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL+++YA V+++YNYTG V+CF+ +     L      W WQ CTE+++P+ +S ++S+
Sbjct  325  ASILDRIYAGVSVYYNYTGNVDCFELDDDPHGLD----GWNWQACTEMVMPMSSSQENSM  380

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FPA ++NYS   + C + F + PRP W TTEFG H+I+  LK FGSNIIF NGL DPWS 
Sbjct  381  FPADDFNYSSYKEECWDTFRVNPRPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSG  440

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST  DPKWL D R  E+ +I  WI  Y
Sbjct  441  GSVLKNLSDTIVALVTKEGAHHLDLRPSTPNDPKWLVDQREAEIGLIEGWIETY  494



>gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G++ILE+++  V+I+YNYTG+V+CF+ +     L      W WQ CTE+++P+ +S   S
Sbjct  334  GTNILERIFEGVSIYYNYTGDVDCFELDDDPHGLD----GWNWQACTEMVMPMASSKDAS  389

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F   ++NY+   + C   F +EPRP WITTEFG H+IK  L+ FGSNIIF NGL DPWS
Sbjct  390  MFLTYDFNYTSFKEECLKNFGVEPRPRWITTEFGGHDIKTALESFGSNIIFSNGLLDPWS  449

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+N+S+++VA+V KEGAHH+DLR ST EDP WL + R  E+K+I  WI+ Y  K
Sbjct  450  GGSVLQNLSETVVALVTKEGAHHIDLRSSTPEDPDWLVEQRATEIKLIEGWINGYNQK  507



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 129/177 (73%), Gaps = 3/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+LEK +AA +++YNYTG+  C   E   +     G  W+WQ CTE+I+P+   S +S
Sbjct  362  GADVLEKAFAAASLYYNYTGDQACNKIEDGDDPHGLDG--WQWQACTEMIMPM-TISNES  418

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y + +  C  ++ + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDPWS
Sbjct  419  MFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWS  478

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NIS SI+A+V ++GAHH+DLR STK DP WL + RR+EV+II  WI QY+ 
Sbjct  479  RGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQ  535



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL+++YA ++++YNYTG V+CF  +     L      W WQ CTE+++P+ ++ ++S+
Sbjct  331  ASILDRIYAGISVYYNYTGNVDCFKLDDDPHGLD----GWNWQACTEMVMPMSSNQENSM  386

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   +NYS   + C N F + PRP W+TTEFG H+I   LK FGSNIIF NGL DPWS 
Sbjct  387  FPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSG  446

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST EDPKWL D R  E+++I  WI  Y
Sbjct  447  GSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  500



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 129/177 (73%), Gaps = 3/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+LEK +AA +++YNYTG+  C   E   +     G  W+WQ CTE+I+P+   S +S
Sbjct  362  GADVLEKAFAAASLYYNYTGDQACNKIEDGDDPHGLDG--WQWQACTEMIMPM-TISNES  418

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y + +  C  ++ + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDPWS
Sbjct  419  MFPPSAFSYDDRSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWS  478

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NIS SI+A+V ++GAHH+DLR STK DP WL + RR+EV+II  WI QY+ 
Sbjct  479  RGGVLKNISSSIIALVTEKGAHHLDLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQ  535



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL+++YA ++++YNYTG V+CF  +     L      W WQ CTE+++P+ ++ ++S+
Sbjct  345  ASILDRIYAGISVYYNYTGNVDCFKLDDDPHGLD----GWNWQACTEMVMPMSSNQENSM  400

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   +NYS   + C N F + PRP W+TTEFG H+I   LK FGSNIIF NGL DPWS 
Sbjct  401  FPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSG  460

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST EDPKWL D R  E+++I  WI  Y
Sbjct  461  GSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQGWIETY  514



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNG--WQYQACTEMVMPMSCSNQ-S  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  + +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  372  MLPPYDNDYEAFQEQCMSTYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK+DP+WLK+ RR+EV II KWIS+YY
Sbjct  432  RGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVSIIEKWISEYY  487



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL++++A ++++YNYTG V+CF  +     L      W WQ CTE+++P+ ++ + S+
Sbjct  330  ASILDRIFAGISVYYNYTGNVDCFKLDDDPHGLD----GWNWQACTEMVMPMSSNQEKSM  385

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FPA ++NYS   + C N F + PRP W+TTEFG H+I+  LK FGSNIIF NG+ DPWS 
Sbjct  386  FPAYDFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIETTLKLFGSNIIFSNGMLDPWSG  445

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEGAHH+DLR ST EDPKWL D R  E+++I  WI  Y
Sbjct  446  GSVLKNLSNTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIQLIQGWIETY  499



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+P +     G  W WQ CTE+++P+  S++ S
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFELEQPTDDHGLDG--WGWQACTEMVMPMSCSNQ-S  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  + +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  372  MFPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR ++K DP+WLK+ RR+EV II KWIS+Y+
Sbjct  432  RGGVLKNISSSIIALVTKKGAHHADLRAASKGDPEWLKEQRRQEVAIIEKWISEYH  487



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + ILE++YA V+++YNYTG+V CF+ +     L      W WQ CTE+++P+ +S K+S+
Sbjct  322  ASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD----GWNWQACTEMVMPMSSSQKNSM  377

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            F A ++NYS   + C N F + PRP W+TTE G H+I+  LK FGSNIIF NGL DPWS 
Sbjct  378  FTAYDFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSG  437

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEG HH+DLR ST EDPKWL + R  E+ +I  WI  Y
Sbjct  438  GSVLKNLSSTIVALVTKEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + ILE++YA V+++YNYTG+V CF+ +     L      W WQ CTE+++P+ +S K+S+
Sbjct  322  ASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD----GWNWQACTEMVMPMSSSQKNSM  377

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            F A ++NYS   + C N F + PRP W+TTE G H+I+  LK FGSNIIF NGL DPWS 
Sbjct  378  FTAYDFNYSSYKEDCWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSG  437

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V KEG HH+DLR ST EDPKWL + R  E+ +I  WI  Y
Sbjct  438  GSVLKNLSSTIVALVTKEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 128/177 (72%), Gaps = 3/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DILEK +AA +++YNYTG+  C   E   +     G  W+WQ CTE+I+P+  S+ +S
Sbjct  378  GADILEKAFAAASLYYNYTGDQTCNKIEDGDDPHGLDG--WQWQACTEMIMPMTVSN-ES  434

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E +  C  ++ + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDPWS
Sbjct  435  MFPPSSFSYDERSDECFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWS  494

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL+NIS SI+A+V ++GAHH+D R STK DP W+ + RR+EV II  WI QY+ 
Sbjct  495  RGGVLKNISSSIIALVTEKGAHHLDFRSSTKGDPDWVIEQRRQEVDIIQGWIDQYHQ  551



>ref|XP_002263389.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI29519.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +LE+++  V+++YNYTG+V CF  +     +      W WQ CTE+++P+ +S + S
Sbjct  330  GTSVLERIFEGVSVYYNYTGKVECFQLDDDPHGMD----GWNWQACTEMVMPMASSRESS  385

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++NYS   + C   F+++PRP WITTEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  386  MFPTYDYNYSSFQEECWKDFSVKPRPTWITTEFGGHEFKTTLKVFGSNIIFSNGLLDPWS  445

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+++VA+V +EGAHH+DLR ST EDP WL + R  EVK+I  WI  Y+ K
Sbjct  446  GGSVLQNISETVVALVTEEGAHHIDLRSSTAEDPDWLVEQRAFEVKLIKGWIEDYHQK  503



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   SK+S
Sbjct  319  GASKVSRVFAAASLYYNYSRGEKCFQLENVPDAHGLHG--WNWQACTEMVMPM-TCSKES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ CK  F + PR +WITTEFG   I +VLKRFGSNIIF NG+ DPWS
Sbjct  376  MFPPSGYDYKEFAEECKKKFGVMPRQHWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+AIV K+GAHHVD R +TK+DP WLK++R++E++II +WI +YY
Sbjct  436  RGGVLKNISSSIIAIVTKKGAHHVDFRSATKDDPNWLKEMRKQEIQIIGRWIDEYY  491



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+   S +S
Sbjct  213  GADIVDKAFAAASLYYNYTGDQTCFQLEDGEDPHGLSG--WGWQACTEMVMPM-TISNES  269

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   + Y   +  C  ++ + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS
Sbjct  270  MFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWS  329

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EVKII  WI QY
Sbjct  330  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  384



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNG--WQYQACTEMVMPMSCSNQ-S  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  + +Y    + CK+ + ++PRP+WITTEFG   I+ VLKRFGSNIIF NGL+DPWS
Sbjct  373  MLPPYDNDYEAFEEQCKSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK DP+WLK+ R +EV II KWIS+YY
Sbjct  433  RGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNC--FDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            G+DILEK++AA N++YNYTG+  C   + +      S     W WQ CTE+I+P+ ++S 
Sbjct  350  GADILEKVFAAANLYYNYTGDQACNQIESDSDDSSSSLGLSGWGWQACTEMIMPM-STSN  408

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
             S+FP S ++Y + +  C  +  + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDP
Sbjct  409  ASMFPPSSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDP  468

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            WS GGVL+NIS SIVA+V ++GAHH+DLRF+T EDP W+ + RR+EV+II  WI QY+
Sbjct  469  WSRGGVLKNISSSIVALVTEKGAHHLDLRFATDEDPDWVTEQRRQEVEIIEGWIDQYH  526



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G   L K +AA +++YNY+    CFD E   +     G  W WQ CTE+++P+  SS +S
Sbjct  325  GETKLSKAFAAASLYYNYSQTEKCFDIEHGSDAHGLHG--WDWQACTEMVMPMSCSS-ES  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F    +NYS  A+ C   + + PRP+WI TEFG   I+++LKRFGSNIIF NG++DPWS
Sbjct  382  MFTPYSYNYSAFAEQCMKNYGVTPRPHWIATEFGGKQIEKILKRFGSNIIFSNGMQDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V +EGAHHVD RF+TK+DP WL + R++EV II  WI +YY
Sbjct  442  RGGVLKNISASIVALVTEEGAHHVDFRFATKDDPNWLVEQRKQEVDIIQSWIDEYY  497



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE +Y  VN++ NYTG+  CF+ +     +S     W WQ CTE+++P+ ++   S
Sbjct  326  GTSILEGIYEGVNVYCNYTGKRKCFEVDDDRHGMSG----WDWQACTEMVMPMSSNQDSS  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E NY+   + C N + ++PRP WITTEFG H+I   LK+FGS+IIF NGL DPWS
Sbjct  382  MFPPYECNYTSFQEECLNDYGVKPRPKWITTEFGGHDIHATLKKFGSDIIFSNGLLDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VL+NIS+S+V++V +EGAHH+DLR ST+ DP WL + R  E+K+I  WIS Y+ K
Sbjct  442  GGSVLQNISESVVSLVTEEGAHHIDLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQK  499



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + ILE++YA V+++YNYTG+V CF+ +     L      W WQ CTE+++P+ +S ++S+
Sbjct  322  ASILERIYAGVSVYYNYTGKVGCFELDDDPHGLD----GWNWQACTEMVMPMSSSQENSM  377

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            F A ++NYS   + C N F + PRP W+TTE G H+I+  LK FGSNIIF NGL DPWS 
Sbjct  378  FTAYDFNYSSYKEDCWNTFGVNPRPRWVTTELGGHDIETALKSFGSNIIFSNGLLDPWSG  437

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V +EG HH+DLR ST EDPKWL + R  E+ +I  WI  Y
Sbjct  438  GSVLKNLSSTIVALVTEEGGHHLDLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +D++ K +AA +++YNYTG+  CF+ E   +     G  W WQ CTE+++P+  S+ +S+
Sbjct  282  ADVIGKAFAAASLYYNYTGDQKCFEVEGGDDPHGLHG--WGWQACTEMVMPMTVSN-ESM  338

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP S ++  + ++ C   + + PR +WITTE+G H I +VLKRFGSNIIF NG+RDPWS 
Sbjct  339  FPPSSFSDEKRSEGCHLVYGVRPRMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSR  398

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GGVL+NIS SI+A+V ++GAHH+DLR +TK+DP WL + RR+EV IIH WI QY
Sbjct  399  GGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWLVEQRRQEVGIIHGWIDQY  452



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +DILEK +AA +++YNYTG++ C   E   +     G  W+WQ CTE+I+P+  S+ +S+
Sbjct  365  TDILEKAFAAASLYYNYTGDLTCNPIEDEDDPHGLDG--WQWQACTEMIMPMTVSN-ESM  421

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP S ++Y + +  C  ++ + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDPWS 
Sbjct  422  FPPSSFSYKDRSDGCFQSWGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSR  481

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            GGVL+NIS SI+A+V ++GAHH+D R +TK DP W+ + RR+EV+II  WI QY+ 
Sbjct  482  GGVLKNISSSIIALVTEKGAHHLDFRSATKGDPDWVIEQRRQEVEIIQGWIDQYHQ  537



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G   L K +AA +++YNYT    CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  320  GGSKLSKAFAAASLYYNYTQTEKCFNLEGGTDSHGLHG--WDWQACTEMVMPM-TCSNES  376

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E +K CK  F ++PRP+WITTEFG + I++VLKRFGSN+IF NG++DPWS
Sbjct  377  MFPPSSFSYKEFSKDCKKQFGVKPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWS  436

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V ++GAHHVD R  TK DP WL   R++EV II KW+ +YY
Sbjct  437  RGGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKWLEEYY  492



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  316  GSSNLDRAFAAASLYYNYSGSKKCFEMEQQSDDHGLNG--WQYQACTEMVMPMSCSNQ-S  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  E +Y    + C + + ++PRP+WITTEFG  +I+ VLKRFGSNIIF NGL+DPWS
Sbjct  373  MLPPYENDYEAFKEQCMSRYGVKPRPHWITTEFGGKSIETVLKRFGSNIIFSNGLQDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR +TK DP+WLK+ RR+EV II  WIS+YY
Sbjct  433  RGGVLKNISSSIIALVTKKGAHHADLRAATKGDPEWLKEQRRQEVAIIENWISEYY  488



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKD  543
            G+  LE+++  V+IFYNYTG+  CF+    L   S +G   W WQ CTE+++P+  S   
Sbjct  336  GTSTLERIFEGVSIFYNYTGQAKCFE----LIDDSDVGTDGWNWQACTEMVMPMSCSQDA  391

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+F   ++N S   + C   +N++PRP  ITTEFG H+IK  LK FGSNIIF NGL DPW
Sbjct  392  SMFQTYDYNLSSFQEECWKDYNVKPRPTRITTEFGGHDIKATLKSFGSNIIFSNGLLDPW  451

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
            S G VL+N+S++IVA+V +EGAHH+DLRFS KEDP+WL D R  E+K+I  W+ ++Y +
Sbjct  452  SGGSVLQNVSETIVALVTEEGAHHIDLRFSKKEDPEWLVDQRATEIKLIEGWLEKFYQE  510



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            + IL++++A ++++YNYTG+V+CF+ +     L      W WQ CTE+++P+ +S ++S+
Sbjct  342  ASILDRIFAGISVYYNYTGDVDCFELDDDPHGLD----GWNWQACTEMVMPMSSSEENSM  397

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FPA  +NYS     C N F + PRP W+TTE G H+I+  LK FGSNIIF NGL DPWS 
Sbjct  398  FPAYAFNYSSYKDECWNTFRVNPRPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSG  457

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G VL+N+S +IVA+V +EG HH+DLR ST EDPKWL + R  E+++I  WI  Y
Sbjct  458  GSVLKNLSNTIVALVTQEGGHHLDLRPSTPEDPKWLVEQREAEIRLIQGWIRTY  511



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L K +AA +++YNY+    CF+ E   ++    G  W WQ CTE+++P+  S++ S+FP 
Sbjct  321  LNKAFAAASLYYNYSHGEKCFNVENGPDLHGLSG--WNWQACTEMVMPMTCSNQ-SMFPP  377

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            S+++Y E A  CK  + + PRP+WITTE+G   I+ VLKRFGSNIIF NG++DPWS GGV
Sbjct  378  SKFDYEEFATDCKKKYGVSPRPHWITTEYGGERIEEVLKRFGSNIIFSNGMQDPWSRGGV  437

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L NIS SIVA+V ++GAHHVD R +TK+DP WL + RR+EV+IIH+WI+++Y
Sbjct  438  LRNISTSIVALVTEKGAHHVDFRSATKDDPDWLVEQRRQEVEIIHQWINEHY  489



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ IL++++A V+++YNYTG V CF  +     L      W +Q CTE+++P+ +S ++S
Sbjct  335  GTSILDRIFAGVSVYYNYTGNVGCFKLDDDPHGLD----GWDFQACTEMVMPMSSSKENS  390

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++NYS   + C + F + PRP WITTEFG H I+ +LK FGSNIIF NGL DPWS
Sbjct  391  MFPTYDFNYSSYKEECWDMFRVIPRPRWITTEFGGHGIETILKMFGSNIIFSNGLLDPWS  450

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             G +L+NIS++IVA+V KEGAHH+DLR ST EDP+WL + R  E+++I  WI+ Y
Sbjct  451  GGSILKNISETIVALVTKEGAHHLDLRPSTPEDPQWLVEQREAEIRVIQGWINSY  505



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  315  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLDG--WQYQACTEMVMPMSCSNQ-S  371

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  E +     + C   + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  372  MLPPYENDSEAFQEQCMTRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWS  431

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK+DP+WLK+ RR+EV II KWIS+YY
Sbjct  432  RGGVLKNISSSIVALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYY  487



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            HG+  + + +AA +++YNY+G   CFD E   +     G  W WQ CTE+++P+   S +
Sbjct  324  HGATNVSRAFAAASLYYNYSGTEKCFDLENGKDAHGLHG--WDWQACTEMVMPL-TCSNE  380

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP S + Y E A  C   + + PRP+WITTEFG   I++VLKR  SNIIF NG++DPW
Sbjct  381  SMFPPSSFEYKEFADECTRKYGVMPRPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPW  440

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            S G VL+NIS SIVA+V K+GAHHVD RF+TKEDP WL + RR+EV+I+ KWI  Y
Sbjct  441  SRGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKWIHDY  496



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +D L K++AA +++YNY+    CFD E   +     G  W WQ CTE+++P+ + S+  +
Sbjct  317  TDTLVKVFAAASVYYNYSSTKKCFDMENASDAHGLHG--WNWQACTEMVMPM-SCSQQGM  373

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP S ++Y E    C   + ++ RP+WITTEFG HNI+ VLKRFGSNIIF NG+ DPWS 
Sbjct  374  FPPSTFSYKEIEDDCMKKYGVKARPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSR  433

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GGVL+NIS SIVA+V ++GAHH+D RF+T++DP+WL + RR+E+++I  WI +Y
Sbjct  434  GGVLKNISSSIVALVTEKGAHHLDFRFATRQDPRWLVEQRRQEIELIQGWIHEY  487



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            HG+  + + +AA +++YNY+G   CFD E   +     G  W WQ CTE+++P+   S +
Sbjct  310  HGATNVSRAFAAASLYYNYSGTEKCFDLENGKDAHGLHG--WDWQACTEMVMPL-TCSNE  366

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP S + Y E A  C   + + PRP+WITTEFG   I++VLKR  SNIIF NG++DPW
Sbjct  367  SMFPPSSFEYKEFADECTRKYGVMPRPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPW  426

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            S G VL+NIS SIVA+V K+GAHHVD RF+TKEDP WL + RR+EV+I+ KWI  Y
Sbjct  427  SRGSVLKNISASIVALVTKKGAHHVDFRFATKEDPDWLIEQRRQEVEILQKWIHDY  482



>gb|EMT03389.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=536

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+++K +AA +++YNYTG   CF  E   +     G  W WQ CTE+++P+  S+ +S
Sbjct  299  GADVIDKAFAAASVYYNYTGNQKCFQVEGGDDPHGFKG--WGWQACTEMVMPMTVSN-ES  355

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F  S ++Y + ++ C   + + PR +WIT+E+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  356  MFRPSSFSYEKMSENCLAGYGVRPRMHWITSEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  415

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+DLR +TK+DP W+ + RR+EV+IIH WI QY
Sbjct  416  GGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIHGWIDQY  470



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE+++  ++I+YNYTGE++CF+ +     L      W WQ CTE+++P+ +S   S
Sbjct  335  GTSILERIFEGISIYYNYTGELHCFELDDDPHGLD----GWNWQACTEMVMPMSSSHNAS  390

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++NYS   + C   F + PRP WITTEFG  +IK  L+ FGSNIIF NGL DPWS
Sbjct  391  MFPTYDFNYSSYQEGCWEEFGVIPRPRWITTEFGGQDIKTALETFGSNIIFSNGLLDPWS  450

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             G VL+NIS+++VA+V +EGAHH+DLR ST EDP WL + R  EVK+I  WI  Y
Sbjct  451  GGSVLQNISETVVALVTEEGAHHIDLRPSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G   L + +AA +++YNY+   NCF+ E  ++     G  W WQTCTE+++P+   S +S
Sbjct  323  GETKLSRAFAAASLYYNYSQTENCFEVEYEVDPHGLHG--WHWQTCTEMVMPM-TCSNES  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y   A+ C+  + + PRP+WITTEFG   I++VLKRFGSNIIF NG++DPWS
Sbjct  380  MFPPSGFDYKRFAEQCRMKYGVLPRPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL NIS +I+A+V ++GAHHVD R +TK+DP WL   RR+EV+II +W+ +YY
Sbjct  440  RGGVLRNISATIIALVTEKGAHHVDFRAATKDDPDWLIQQRRQEVEIIQRWLDEYY  495



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L++ +AA +++YNY+G  NCFD E   +     G  W WQ CTE+++P+  S++ S+F  
Sbjct  319  LDRAFAAASLYYNYSGSENCFDIENQTDPHGLNG--WYWQACTEMVMPISCSNQ-SMFQP  375

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
             E++   + + C   + ++PRP+WITTEFG H I+ VLKRFGSNIIF NG++DPWS  GV
Sbjct  376  FEYDEKVDQEDCLKEYGVKPRPHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGV  435

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SI+A V K+GAHH DLR +TK+DP+WLK+ RR+EV  I KWIS+YY
Sbjct  436  LKNISSSIIAFVTKKGAHHTDLRAATKDDPEWLKEQRRQEVAEIEKWISEYY  487



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  L K +AA +++YNYT    CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  320  GASKLSKAFAAASLYYNYTQTEKCFNLEGGTDSHGLHG--WDWQACTEMVMPM-TCSNES  376

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E ++ CK  + ++PRP+WITTEFG + I++VLKRFGSN+IF NG++DPWS
Sbjct  377  MFPPSSFSYKEFSQDCKKQYGVKPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWS  436

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V ++GAHHVD R  TK DP WL   R++EV II KW+ +YY
Sbjct  437  RGGVLKNISSSIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEVAIIEKWLEEYY  492



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  LE+++AA +++YNY+G   CFD     +     G  W WQ CTE+++P+ + S + 
Sbjct  325  GASDLERVFAAASLYYNYSGSEKCFDIGHEEDAHGLSG--WGWQACTEMVMPM-SCSDEC  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F   E +Y    + C   F ++PRP+WITTEFG   I++VLKRFGSNIIF NG++DPWS
Sbjct  382  MFQPFEEDYKGFEENCVFRFGVKPRPHWITTEFGGQRIEKVLKRFGSNIIFSNGMQDPWS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR  T+EDP WLK+ RR+EV II KWI +YY
Sbjct  442  RGGVLKNISSSIIALVTKQGAHHADLRRETEEDPDWLKEQRRQEVAIIQKWIDEYY  497



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ I++++   V+++YNYTG+V+CFD +     ++     W WQ CTE+++P  +S   S
Sbjct  338  GTSIIQRIVEGVSVYYNYTGKVDCFDLDDDPHGMN----GWNWQACTEMVMPTSSSKDAS  393

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA ++NY+ + ++C   + ++PRP WI+TEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  394  MFPAYDYNYTSDEEWCWENYRVKPRPTWISTEFGGHGFKHTLKNFGSNIIFSNGLLDPWS  453

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLE+IS++IVA+V ++GAHH+DLR +T EDP WL + R  EVK+I  W+ +Y+ +
Sbjct  454  GGSVLEDISETIVALVTEKGAHHLDLRPATAEDPDWLVEQRAAEVKLIQGWLDEYFKR  511



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLNG--WQYQACTEMVMPMSCSNQ-S  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  + +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NGL+DPWS
Sbjct  373  MLPPYDNDYEAFKEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK DP+WLK+ R +EV II KWIS+YY
Sbjct  433  RGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+   S +S
Sbjct  359  GADIVDKAFAAASLYYNYTGDQTCFQLEDGEDPHGLSG--WGWQACTEMVMPM-TISNES  415

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   + Y   +  C  ++ + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS
Sbjct  416  MFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWS  475

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EVKII  WI QY
Sbjct  476  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  530



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   S++S
Sbjct  319  GASKITRVFAAASLYYNYSRAEKCFKLEHGPDAHGLHG--WNWQACTEMVMPM-TCSEES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ C   F ++PRP+WITTEFG   I  VLKR G NIIF NG++DPWS
Sbjct  376  MFPTSSFSYKEFAEDCMKTFGVKPRPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V ++GAHHVD R +TK+DP+WLK++RR+EV+II  WI QYY
Sbjct  436  RGGVLKNISSSIIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+   S +S
Sbjct  359  GADIVDKAFAAASLYYNYTGDQTCFQLEDGEDPHGLSG--WGWQACTEMVMPM-TISNES  415

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   + Y   +  C  ++ + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS
Sbjct  416  MFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWS  475

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+D R +TK+DP W+ + RR+EVKII  WI QY
Sbjct  476  RGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVKIIQGWIDQY  530



>emb|CDX68714.1| BnaC01g07390D [Brassica napus]
Length=390

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            LE+ +AA +++Y+Y+G  +CFD E   +     G  W WQ CTE+++P+  S+     P 
Sbjct  210  LERAFAAASLYYSYSGSESCFDMENHTDSHGLNG--WGWQACTEMVMPMSCSNHTMFRPF  267

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
               +   N ++C   + ++PRP+WIT EFG   I+ VLKRFGSNIIF NGL+DPWS GGV
Sbjct  268  ESDDEKANQEYCLREYGVKPRPHWITAEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGV  327

Query  347  LENISKSIVAIVA-KEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            L+NIS SI+A+V  K GAHH DLR +TK+DP+WLK  RR+EV II KWIS+YY+
Sbjct  328  LKNISSSIIALVTRKAGAHHTDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYN  381



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQ-TCTEIIIPVGASS  549
             GSDIL +++A  +++YNY+G+  CF P  P      +GV  W WQ  CTE+I+P+ ++S
Sbjct  310  EGSDILSRIFAGASVYYNYSGQAECFQPSDPGN--DDLGVTGWDWQQACTEMIMPMSSNS  367

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
             +S+F   +W+   N ++C   + + PRPNWITT +G  +IK VLK FGSNI+F NGL D
Sbjct  368  SNSMFQPYDWDLEGNIQYCMKTYGVRPRPNWITTNYGGKDIKAVLKDFGSNIVFSNGLLD  427

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            PWS GGVLENIS SI+A+VA EGAHH+DLR STK DP WL + R  EV  I KWI+ Y
Sbjct  428  PWSGGGVLENISSSIIALVAPEGAHHLDLRASTKIDPDWLVEQRATEVAYITKWIAAY  485



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  ++I+YNYTG+V+CFD       +S     W WQ CTE+I+P+ ++   S
Sbjct  340  GASVLQRIFEGISIYYNYTGKVDCFDLNDDPHGMS----GWDWQACTEMIMPMASNRTTS  395

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++   N + C   F+++PRP WITTEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  396  MFPEFYYDPKSNEEQCLKDFHVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWS  455

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLE++S++IVA+  K+GAHH+DLR +T EDP WL D R  E+K+I  W+ ++Y K
Sbjct  456  GGSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHYDK  513



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
             S  LE+ +AA +++YNY+G   CFD E   +        W WQ CTE+++P+ +SS  S
Sbjct  316  ASSNLERAFAAASLYYNYSGSEICFDMENQTDPHGL--AFWGWQACTEMVMPM-SSSNQS  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  E +     + C  A+ ++ RP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  373  MFPPFENDDEGEQELCMLAYGVKSRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V K+GAHH DLR +TK DP+WLK+ RR+EV II KWI++YY
Sbjct  433  RGGVLKNISNSIIALVTKKGAHHTDLRAATKYDPEWLKEQRRQEVAIIEKWINEYY  488



>ref|XP_011017986.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Populus 
euphratica]
Length=410

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   S++S
Sbjct  229  GASKITRVFAAASLYYNYSRAEKCFKLEHGPDAHGLHG--WNWQACTEMVMPM-TCSEES  285

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ C   F ++PR +WITTEFG   I  VLKR G NIIF NG++DPWS
Sbjct  286  MFPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWS  345

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS S++A+V ++GAHHVD R +TK+DP+WLK++RR+EV+II  WI QYY
Sbjct  346  RGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  401



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DI++K +AA +++YNYTG+  CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  352  GADIVDKAFAAASLYYNYTGDQTCFELEDGGDPHGLSG--WGWQACTEMVMPM-TISNES  408

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   + Y   +  C  ++ + PRP+WITTE+G + I  VLKRFGSNIIF NG+RDPWS
Sbjct  409  MFPPFTFTYEGKSDDCFQSYGVRPRPHWITTEYGGNKIDLVLKRFGSNIIFSNGMRDPWS  468

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI A+V ++GAHH+D R +TK+DP W+ + RR+EV+II  WI QY
Sbjct  469  RGGVLKNISSSIFALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIQGWIDQY  523



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+++K +AA +++YNYTG+  CF  E   +     G  W WQ CTE+++P+  S+ +S
Sbjct  388  GADVVDKAFAAASLYYNYTGDQKCFQVEGDDDPHDLDG--WGWQACTEMVMPMTVSN-ES  444

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   +NY   ++ C   + + PR +WITTE+G H I +VLK+FGSNIIF NG+RDPWS
Sbjct  445  MFPPDSFNYENMSEDCLLYYGVRPRMHWITTEYGGHKIDKVLKKFGSNIIFSNGMRDPWS  504

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             GGVL+NIS SI+A+V ++GAHH+DLR +TK+DP W+ + RR+EV+II  WI QY
Sbjct  505  RGGVLKNISSSIIALVTEKGAHHLDLRSATKDDPDWVVEQRRQEVEIIRGWIDQY  559



>ref|XP_010432914.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=499

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 123/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L++ +AA N++YNY+   NCFD E   +     G  W WQ CTE+++P+  S++ S+F  
Sbjct  321  LDRAFAAANLYYNYSSSENCFDIENETDPHGLNG--WYWQACTEMVMPISCSNQ-SMFQP  377

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
             E N   + + C   + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS  GV
Sbjct  378  FESNDKRDQEACLREYGVKPRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGV  437

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SI+A+V K+GAHH DLR +TK+DP+WLK+ RR+EV  + KWIS+YY
Sbjct  438  LKNISSSIIALVTKKGAHHADLRAATKDDPEWLKEQRRQEVAEMEKWISEYY  489



>ref|XP_006663226.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Oryza 
brachyantha]
Length=420

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 123/182 (68%), Gaps = 8/182 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFD---PEKPLEVLSRIGVQWRWQTCTEIIIPVG-AS  552
            G++ L ++  A+ I+YN+TG + CF     E P  +L+     W WQ CTE+++ +    
Sbjct  239  GNETLARIKEAMAIYYNHTGGLACFGGAGDEDPYGMLA----GWNWQACTEMVLTMSYGV  294

Query  551  SKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLR  372
            S  SIFP   +N+++    C+    + PRP WI   FG  +I  VLKR  SNIIFFNGLR
Sbjct  295  SGSSIFPPEPFNFTDVLAGCRAYTGLPPRPYWIEAHFGGFDIVNVLKRSASNIIFFNGLR  354

Query  371  DPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            DPWS+GGVL++ISKSI+A+V  EG HHVDLRFSTKEDP+WLK VRRKE++II  W+ QYY
Sbjct  355  DPWSAGGVLKSISKSIIALVEPEGGHHVDLRFSTKEDPEWLKKVRRKEMRIIADWLRQYY  414

Query  191  HK  186
             +
Sbjct  415  SE  416



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + + +AA +++YNYT    CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  319  GASKISRAFAAASLYYNYTQTEKCFNLEGGNDAHGLHG--WDWQACTEMVMPM-TCSNES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E  + CK  + +EPRP+WITTEFG + I++VLKRFGSN+IF NG++DPWS
Sbjct  376  MFPPSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V ++GAHHVD R  TK DP WL   R++E+ II KW+ +YY
Sbjct  436  RGGVLKNISASIVALVTQKGAHHVDFRSETKNDPDWLIMQRKQEMAIIQKWLEEYY  491



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  316  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLDG--WQYQACTEMVMPMSCSNQ-S  372

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  E +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NGL+DPWS
Sbjct  373  MLPPYENDYEAFEEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWS  432

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V K+GAHH DLR +TK DP+WLK+ R +EV II KWIS+YY
Sbjct  433  RGGVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYY  488


 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 128/184 (70%), Gaps = 11/184 (6%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GS  L++ +AA +++YNY+G   CF+ E+  +     G  W++Q CTE+++P+  S++ S
Sbjct  623  GSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGLDG--WQYQACTEMVMPMSCSNQ-S  679

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            + P  E +Y    + C + + ++PRP+WITTEFG   I+ VLKRFGSNIIF NGL+DPWS
Sbjct  680  MLPPYENDYEAFEEQCMSRYGVKPRPHWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWS  739

Query  359  SGG--------VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWI  204
             GG        VL+NIS SIVA+V K+GAHH DLR +TK DP+WLK+ R +EV II KWI
Sbjct  740  RGGSVLTSNFRVLKNISSSIVALVTKKGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWI  799

Query  203  SQYY  192
            S+YY
Sbjct  800  SEYY  803



>gb|EMS49104.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=614

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             GS ILE++YA VNI+YNYTG V+CFD +     +      W WQ CTE+++P+ +S   
Sbjct  174  EGSSILERIYAGVNIYYNYTGTVDCFDLDDDPHGMG----GWDWQACTEMVMPMSSSEGL  229

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+F   E++Y+  A  C   F + PRP WI+TEFG HNI  VL++FGSNIIFFNGL DPW
Sbjct  230  SMFLPDEFDYALYADDCVKNFGVRPRPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPW  289

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLK  246
            S GGVL+NIS+S+VAIVA  GAHH+DLR +TKEDP WL+
Sbjct  290  SGGGVLKNISESVVAIVAPLGAHHIDLRPATKEDPDWLE  328



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + + +AA +++YNYT    CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  319  GASKISRAFAAASLYYNYTKREKCFNLEGGDDAHGLHG--WDWQACTEMVMPM-TCSNES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E  + CK  + +EPRP+WITTEFG + I++VLKRFGSN+IF NG++DPWS
Sbjct  376  MFPPSSYSYKEFKEDCKKKYGVEPRPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SIVA+V ++GAHHVD R  TK DP WL   R++E  II KW+ +YY
Sbjct  436  RGGVLKNISASIVALVTQKGAHHVDFRSETKNDPGWLIMQRKQEAAIIQKWLEEYY  491



>gb|KDO59435.1| hypothetical protein CISIN_1g044064mg [Citrus sinensis]
Length=338

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G   L +++A  +++YNY+    CF  E   +     G  WRWQTCTE+++P+   S +S
Sbjct  169  GVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDG--WRWQTCTEMVMPM-TCSNNS  225

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y + A+ C   + + PR +WITTEFG   I+ VLKRFGSNIIF NG++DPWS
Sbjct  226  MFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWS  285

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWI  204
             GGVL+NIS SI+A+V K+GAHHVD R  TK+DP WL ++RR+EV+II KW+
Sbjct  286  RGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWV  337



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            +G+DIL +++  V+++YN+TG V+CF  +     ++     W WQ CTE+++P+ + +K 
Sbjct  294  NGTDILRRIFEGVSVYYNFTGNVDCFKLDDDPHGMN----GWNWQACTEMVMPLSSGTK-  348

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FP  +++   +A +C  +F + PRP WITTEFG H  K  L+ FGSNI+F NGL DPW
Sbjct  349  SMFPGYDFDLDSDAYWCFQSFRVTPRPTWITTEFGGHGFKNALRWFGSNIVFSNGLLDPW  408

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S G VLEN+S +IVA+V ++GAHH+DLR +T EDP WL D R  E+K+I  W+ +YY
Sbjct  409  SGGSVLENVSDTIVALVTEKGAHHLDLRPATVEDPDWLLDQREIEMKLIQGWLDEYY  465



>ref|XP_006285773.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
 gb|EOA18671.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
Length=483

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L++ +AA +++YNY+G   CFD E   +     G  W WQ CTE+++P+  S++ S+F  
Sbjct  304  LDRAFAAASLYYNYSGSEKCFDIENETDPHGVNG--WYWQACTEMVMPISCSNQ-SMFQP  360

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
             E +   + ++C   + ++PRP+WITTEFG   I+ VLKRFGSNIIF NG++DPWS  G+
Sbjct  361  FENDDKGDQEYCLREYGVKPRPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGI  420

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SI+A+V K+GAHH DLR +TKEDP+WLK+ RR+EV  + KWIS+YY
Sbjct  421  LKNISSSIIALVTKKGAHHADLRAATKEDPEWLKEQRRQEVAEMEKWISEYY  472



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   S++S
Sbjct  319  GASKITRVFAAASLYYNYSRAEKCFKLEHGPDAHGLHG--WNWQACTEMVMPM-TCSEES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E A+ C   F ++PR +WITTEFG   I  VLKR G NIIF NG++DPWS
Sbjct  376  MFPTSSFSYKEFAEDCMKTFGVKPRSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS S++A+V ++GAHHVD R +TK+DP+WLK++RR+EV+II  WI QYY
Sbjct  436  RGGVLKNISSSVIALVTEKGAHHVDFRSATKDDPEWLKELRRQEVEIIQGWIDQYY  491



>gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  + +++AA +++YNY+    CF+ E   +     G  W WQ CTE+++P+   SK+S
Sbjct  319  GASKISRVFAAASLYYNYSHGEKCFELENEHDAHGLHG--WNWQACTEMVMPM-TCSKES  375

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP S ++Y E +K CK  + + PRP+WITTE+G   I +VLKR G NIIF NG++DPWS
Sbjct  376  MFPPSGFDYKEFSKGCKKKYGVMPRPHWITTEYGGKRIDQVLKRSGGNIIFSNGMQDPWS  435

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVL+NIS SI+A+V  +GAHHVD R S K+DP WL+++R +EV+II KWI +YY
Sbjct  436  RGGVLKNISSSIIALVTDKGAHHVDFRSSMKDDPYWLRELRSQEVEIISKWIDEYY  491



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 121/178 (68%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  ++I+YNYTG+V+CF+       +S     W WQ CTE+I+P+ ++   S
Sbjct  308  GASVLQRIFEGISIYYNYTGKVDCFNLNDDPHGMS----GWDWQACTEMIMPMASNMTTS  363

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++   N + C   F ++PRP WITTEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  364  MFPEFYYDPKSNEEQCLKDFRVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWS  423

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLE++S++IVA+  K+GAHH+DLR +T EDP WL D R  E+K+I  W+ ++Y +
Sbjct  424  GGSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHYDE  481



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE+++  V+++YNYTG+V+CFD       ++     W WQ+CTE+++P+ ++   S
Sbjct  337  GTSILERVFEGVSVYYNYTGKVDCFDLYDDPHGMA----GWDWQSCTEMVMPMSSNPHTS  392

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  +++ S + ++C+  + + PRP WITTEFG  +I   LK FGSNIIF NGL DPWS
Sbjct  393  MFPRYDFDLSADKEYCRTEYKVNPRPEWITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWS  452

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             G V +N+S SIVA+  +EGAHH+DLR +T  DP WL + R  E+K+I KW+  YY 
Sbjct  453  GGSVTKNVSDSIVALNTQEGAHHLDLRAATAHDPDWLVEQRATEIKLIRKWLRDYYQ  509



>gb|EMT13135.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=515

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 129/185 (70%), Gaps = 13/185 (7%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+++K +AA +++YNY+G+  CF+ E   +     G  W WQ CTE+++P+   S +S
Sbjct  327  GADVIDKAFAAASLYYNYSGDQKCFEMEGGDDPHGLDG--WGWQACTEMVMPM-IVSNES  383

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++Y  N++ C   + + PR +WITTE+G H I +VLKRFGSNIIF NG+RDPWS
Sbjct  384  MFPPFSFSYENNSEGCLAYYGVRPRIHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWS  443

Query  359  SGGVLENISKSIVAIVAK----------EGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHK  210
             GGVL+NIS SI+A+V +          +GAHH+D R +TK+DP+W+ + RR+EV+IIH 
Sbjct  444  RGGVLKNISSSIIALVTENGKHEFKENMQGAHHLDFRSATKDDPEWVVEQRRQEVEIIHG  503

Query  209  WISQY  195
            WI QY
Sbjct  504  WIDQY  508



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE+++  ++I+YNYTGE++CF+ +     L      W WQ CTE+++P+ +S   S
Sbjct  335  GTSILERIFEGISIYYNYTGELHCFELDDDPHGLD----GWNWQACTEMVMPMSSSHDAS  390

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F   ++NYS   + C   F + PRP WIT EFG  +IK  L+ FGSNIIF NGL DPWS
Sbjct  391  MFSTYDFNYSSYQEGCWEEFGVIPRPRWITMEFGGQDIKTALETFGSNIIFSNGLLDPWS  450

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             G VL+NIS+++VA+V +EGAHH+DLR ST EDP WL + R  EVK+I  WI  Y
Sbjct  451  GGSVLQNISETVVALVTEEGAHHIDLRPSTPEDPDWLVEQRETEVKLIKGWIDGY  505



>ref|XP_002438753.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
 gb|EER90120.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
Length=569

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPE-KPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            +DILEK++AA +++YN+TG+  C   E       S     W WQ CTE+I+P+ + S +S
Sbjct  388  ADILEKVFAAASLYYNFTGDQTCNQIEYDDDSSSSLGLSGWGWQACTEMIMPM-SDSNES  446

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++Y + +  C   + + PRP+WITTE+G + I +VLKRFGSNIIF NGLRDPWS
Sbjct  447  MFPPDTFSYEDTSNTCFQLYGVRPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGLRDPWS  506

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             GGVL++IS SIVA+V ++GAHH+DLR +TK+DP W+ + RR+EV+IIH WI QY+ 
Sbjct  507  RGGVLKDISSSIVALVTEKGAHHLDLRSATKDDPDWVIEQRRQEVEIIHGWIDQYHQ  563



>gb|EAZ17490.1| hypothetical protein OsJ_33021 [Oryza sativa Japonica Group]
Length=259

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 120/179 (67%), Gaps = 4/179 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGV--QWRWQTCTEIIIPVGAS-S  549
            G+D + ++  A+ I+YN TG + CF P    E     G+   W WQ CTE+I+ +     
Sbjct  72   GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  130

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
              ++FP   +N +     C     + PRP+WI + FG ++I+ VLKR GSNIIFFNGLRD
Sbjct  131  NATVFPPDPFNLTAYLAGCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  190

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            PWS+GG+L++IS SI+A+V  +G HHVDLRFSTKEDP+WLK VRR+E++II  W+ QYY
Sbjct  191  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  249



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 120/178 (67%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  +N++YNYTG V+CF+ +     +      W WQ CTE+++P+ ++   S
Sbjct  331  GASVLQRIFEGINVYYNYTGTVDCFNLDDDPHGMG----GWDWQACTEMVMPMASNRTTS  386

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++ + N + C   F+++PRP WITTEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  387  MFPEFYYDPTSNEEQCLKDFHVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWS  446

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLEN+SK+IVA+  ++GAHH+DLR  T  DP WL + R  E+K+I  W+ +YY +
Sbjct  447  GGSVLENVSKTIVALTTEKGAHHLDLRAGTASDPDWLLEQRSSEIKLIRGWLDKYYDE  504



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 121/178 (68%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  ++I+YNYTG+V+CF+       +S     W WQ CTE+I+P+ ++   S
Sbjct  324  GASVLQRIFEGISIYYNYTGKVDCFNLNDDPHGMS----GWDWQACTEMIMPMASNMTTS  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++   N + C   F ++PRP WITTEFG H  K  LK FGSNIIF NGL DPWS
Sbjct  380  MFPEFYYDPKSNEEQCLKDFRVKPRPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLE++S++IVA+  K+GAHH+DLR +T EDP WL D R  E+K+I  W+ ++Y +
Sbjct  440  GGSVLEDVSETIVALTTKKGAHHLDLRAATAEDPDWLLDQRSSEIKLIRGWLDEHYDE  497



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE+++  V+++YNYTG+V+CFD       ++     W WQ+CTE+++P+ ++   S
Sbjct  372  GTSILERVFEGVSVYYNYTGKVDCFDLYDDPHGMA----GWDWQSCTEMVMPMSSNPHTS  427

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  +++ S + ++C+  + + PRP WITTEFG  +I   LK FGSNIIF NGL DPWS
Sbjct  428  MFPRYDFDLSADKEYCRTEYKVNPRPEWITTEFGGKDIMTTLKTFGSNIIFSNGLLDPWS  487

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             G V +N+S SIVA+  +EGAHH+DLR +T  DP WL + R  E+K+I KW+  YY 
Sbjct  488  GGSVTKNVSDSIVALNTQEGAHHLDLRAATAHDPDWLVEQRATEIKLIRKWLRDYYQ  544



>ref|XP_002962483.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
 gb|EFJ35946.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
Length=474

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 125/186 (67%), Gaps = 13/186 (7%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
             S IL+++YA VN++YN+TG   CFD +     LS     W WQ+CTE+++P+ ++S  S
Sbjct  288  ASSILQRIYAGVNVYYNFTGAAKCFDLDDDPHGLS----GWNWQSCTEMVMPMSSNSNTS  343

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  EW+    ++FC   +   PRP+W+TTEFG H+IK VL+ FGSNI+F NGL DPWS
Sbjct  344  MYPPFEWDGEAWSRFCWENYGAIPRPSWVTTEFGGHDIKSVLRNFGSNIVFSNGLLDPWS  403

Query  359  SGG---------VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKW  207
             G          VLE+IS +I+A V KEGAHH+D R+S K+DP+WL + R  EV+ I +W
Sbjct  404  GGRQAMNDSFRFVLESISSTILAFVTKEGAHHLDFRWSRKDDPQWLIEQRESEVREIKRW  463

Query  206  ISQYYH  189
            +S+Y+ 
Sbjct  464  LSEYHQ  469



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 122/177 (69%), Gaps = 2/177 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+  L ++ AA++++YN+TG   CF  E+  +        W WQ CTE+++     S DS
Sbjct  338  GNGTLARVRAAMDVYYNHTGAAACFRGEEEDDPYGMYD-GWNWQACTEMVLMTYGLSNDS  396

Query  539  IF-PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            I  P   +N+++    C+NA  + PRP WI TEFG ++I  VLKR  SNIIFFNGLRDPW
Sbjct  397  ILQPPWPFNFTDVIASCRNATGLPPRPFWIETEFGGYDIGNVLKRSASNIIFFNGLRDPW  456

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S+GGVL++IS SI+A+V  +GAHHVDLRFS+++DP WLK VR KE +II +W+ QYY
Sbjct  457  STGGVLKSISDSIIALVEPKGAHHVDLRFSSEDDPDWLKQVRAKETRIIARWLKQYY  513



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 123/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L ++ AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   SKDS+FP 
Sbjct  319  LSRVVAAASLYYNYSRTEKCFKIENATDAHGLHG--WDWQACTEMVMPM-TCSKDSMFPP  375

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            S ++Y   ++ C   + + PRP+WITTEFG + I++VLKRFGSNIIF NG++DPWS G V
Sbjct  376  STFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGSV  435

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SI+A+  ++GAHHVD R +TKEDP WL + RR+EV+II +WI++Y+
Sbjct  436  LKNISASIIALATEKGAHHVDFRSATKEDPDWLVEQRRQEVEIIQRWINEYH  487



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  +N++YNYTG+V+CF+ +     +S     W WQ CTE+++P+ ++   S
Sbjct  331  GASVLQRIFEGINVYYNYTGKVDCFNLDDDPHGMS----GWDWQACTEMVMPMASNKTTS  386

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++   N + C   F+++PRP WITT FG H  K  LK FGSNIIF NGL DPWS
Sbjct  387  MFPEFYYDPKLNEEQCLKDFHVKPRPTWITTAFGGHAFKSALKAFGSNIIFSNGLLDPWS  446

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
             G VLE++S++IVA++ ++GAHH+DLR +T EDP WL + R  E+K+I  W+ +YY +
Sbjct  447  GGSVLEDVSETIVALITEKGAHHLDLRAATAEDPDWLLEQRSSEIKLIRGWLDKYYDE  504



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 118/177 (67%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE++   V ++YN+TGEVNCF+ +     ++     W WQ CTE+++P+ +S   S
Sbjct  341  GTSILERVSEGVGVYYNHTGEVNCFELDDDPHGMN----GWNWQACTEMVMPLSSSPDTS  396

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++N+S   + C   F + PRP WITTEFG  +I   LK FGSNIIF NG  DPWS
Sbjct  397  MFPTYDFNFSAFQEECWTDFKVNPRPRWITTEFGGKDIMTDLKTFGSNIIFSNGFLDPWS  456

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
             G V +N+S SIVA+  +EGAHH+DLR +T EDP WL + R  E+++I KW+S YY 
Sbjct  457  GGSVTQNVSDSIVALNTQEGAHHLDLRAATAEDPNWLVEQRATEIRVIKKWLSDYYQ  513



>gb|EYU30781.1| hypothetical protein MIMGU_mgv1a0254691mg, partial [Erythranthe 
guttata]
Length=175

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 112/157 (71%), Gaps = 4/157 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            +G+ IL++++  V+I+YNYTG+V CFD    L+        W WQ CTE+++P  +S   
Sbjct  14   NGTSILQRIFKGVSIYYNYTGKVECFD----LDDDPHGTNGWNWQACTEMVMPTSSSKNT  69

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FPA +++Y+ + ++C   + ++PRP WITTEFG H  K  LK FGSNIIF NGL DPW
Sbjct  70   SMFPAYDYDYASDEEWCLENYGVKPRPTWITTEFGGHGFKHALKNFGSNIIFSNGLLDPW  129

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKW  252
            S G VLE+IS++IVA+V ++GAHH+DLR +T EDP W
Sbjct  130  SGGSVLEDISETIVALVTEKGAHHLDLRAATAEDPDW  166



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L +++ A +++YNY+    CF+ E   +     G  W WQ CTE+++P+  S+ +S+FP 
Sbjct  327  LSRVFEAASLYYNYSRTEKCFELENENDDHGLHG--WNWQACTEMVMPMSISN-ESMFPP  383

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
             +++Y + +  C   + + PRP+WITTEFG  NI++VLKRFGSNIIF NGL+DPWS G V
Sbjct  384  YQFSYKDFSDDCLKNYGVRPRPHWITTEFGGTNIEQVLKRFGSNIIFSNGLQDPWSRGSV  443

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L+NIS SIVA+VA++GAHH DLR +T++DP WL + R++E++II KWIS YY
Sbjct  444  LKNISTSIVALVAEKGAHHTDLRRATRKDPDWLIEQRKQEIEIIQKWISDYY  495



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 130/194 (67%), Gaps = 19/194 (10%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNC--FDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            G+DILEK++AA N++YNYTG+  C   + +      S     W WQ CTE+I+P+ ++S 
Sbjct  353  GADILEKVFAAANLYYNYTGDQACNQIESDSDDSSSSLGLSGWGWQACTEMIMPM-STSN  411

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
             S+FP S ++Y + +  C  +  + PRP+WITTE+G + I +VLKRFGSNIIF NG+RDP
Sbjct  412  ASMFPPSSFSYEDTSNACFQSTGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDP  471

Query  365  WSSGGVLENISKSIVAIVAKEG----------------AHHVDLRFSTKEDPKWLKDVRR  234
            WS GGVL+NIS SIVA+V ++G                AHH+DLRF+T EDP W+ + RR
Sbjct  472  WSRGGVLKNISSSIVALVTEKGEHGNLRRKKKKKKKKWAHHLDLRFATDEDPDWVTEQRR  531

Query  233  KEVKIIHKWISQYY  192
            +EV+II  WI QY+
Sbjct  532  QEVEIIEGWIDQYH  545



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF---DPEKPLEVLSRIGVQWRWQTCTEIIIPVGASS  549
            G D   ++  A+ ++YNYTG  +CF     + P  + +     W WQ CTE+I+      
Sbjct  330  GKDTFSRIKDALTVYYNYTGNAHCFGDASEDDPYGMFN----GWDWQACTEMILMSYGVR  385

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
              S+ P   +N+++    C+ +  + PRP WI TEFG  +I  VLKR  SNIIFFNGLRD
Sbjct  386  NRSVLPPEPFNFTKLLDGCRASTGLPPRPYWIPTEFGGFDIANVLKRSASNIIFFNGLRD  445

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            PWSSGGVL++IS+SI+A+V  +G+HHVDLRFS+K+DP WLK VR KE +II  W++QYY
Sbjct  446  PWSSGGVLKDISRSILALVEPKGSHHVDLRFSSKDDPHWLKQVREKETRIIAHWLNQYY  504



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D   ++  A++++YN+TG   C       +        W WQ CTE+I+        +
Sbjct  335  GNDTFARIKGALDVYYNHTGAEPCLGDATESDPYGMFD-GWDWQACTEMILMTYGVRNGT  393

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   +N+++    C+ +  + PRP WI TEFG  +IK VL+R  SNIIFFNGLRDPWS
Sbjct  394  VFPPEPFNFTDLLAGCRASTGLPPRPYWIPTEFGGFDIKHVLRRSASNIIFFNGLRDPWS  453

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVL++IS SI+A+V  +G+HHVDLRFSTKEDP+WLK VR KE +II  W+ QYY
Sbjct  454  SGGVLKSISNSIIALVEPKGSHHVDLRFSTKEDPEWLKQVRIKETRIIAHWLRQYY  509



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D++ +++A V    +Y G   C+D        S   V W WQTC+EI+IP+G    D+
Sbjct  322  GTDVIGRIFAGV---VSYRGNRTCYD-TNAYNYPSETSVGWEWQTCSEIVIPIGRGENDT  377

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA+ ++  E AK CK+ + + PRP+WITT +G H+IK VL RFGSNIIF NGLRDP+S
Sbjct  378  MFPAAPFDLHEFAKSCKDFYGVPPRPHWITTYYGGHDIKLVLNRFGSNIIFSNGLRDPYS  437

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVLE++S+SIVA+   +G+H +D+ +S K DP WL   R++E++II  W+  YY
Sbjct  438  SGGVLEDLSESIVAVTTPKGSHCLDILYSAKTDPDWLILQRKREIEIIEGWLKTYY  493



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 117/177 (66%), Gaps = 4/177 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ ILE+++  V+++YNYTGEV+CF+ +     +      W WQ CTE+++P+ +S   S
Sbjct  337  GTSILERVFEGVSVYYNYTGEVDCFELDDDPHGMD----GWNWQACTEMVMPMSSSPDAS  392

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  ++N+S   + C   F + PRP WITT FG  +I   LK FGSNIIF NG  DPWS
Sbjct  393  MFPTYDFNFSAFQEECWTDFKVIPRPTWITTHFGGKDIMTTLKTFGSNIIFSNGFLDPWS  452

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
               V +N+S S+VA+  +EGAHH+DLR +T EDP WL + R  E+K++ KW+S YY 
Sbjct  453  GYSVTQNVSDSLVALNTQEGAHHIDLRAATAEDPDWLVEQRAAEIKLMKKWLSDYYQ  509



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = -3

Query  704  EKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPAS  525
            E++  A+N++YN+TG   CF  E+  +    +   W WQ CTE+++        ++   +
Sbjct  377  EQVRDAMNVYYNHTGGAACFRAEEDDDPYG-LYDGWNWQACTEVMVMAYGVRDGTVLQPA  435

Query  524  EWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGVL  345
             +N++E    C+N   + PRP WI TEFG ++I  VLK+  SNIIFFNGLRDPWS+GGVL
Sbjct  436  PFNFTEVVDDCRNVTGLPPRPFWIETEFGGYDIANVLKKSASNIIFFNGLRDPWSTGGVL  495

Query  344  ENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            ++IS SI+A+V  +GAHHVDLRFS+KEDP+WLK VR KE +II +W+ QYY
Sbjct  496  KSISDSIIALVEPKGAHHVDLRFSSKEDPEWLKKVRVKETRIIARWLKQYY  546



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 121/173 (70%), Gaps = 5/173 (3%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASSKDSIFP  531
            L +  AA +++YNY+    CF  E   +  +  G+Q W WQ CTE+++P+  S+  S+FP
Sbjct  322  LSRAVAAASLYYNYSKTEKCFKLE---DEDNDHGLQGWNWQACTEMVMPMTCSN-GSMFP  377

Query  530  ASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGG  351
             S ++Y E A  C   F + PR +WITTEFG   I  VLKRFGSNIIF NG++DPWS GG
Sbjct  378  PSPYSYKEFADDCNRQFGVWPREHWITTEFGGMRINLVLKRFGSNIIFSNGMQDPWSRGG  437

Query  350  VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            VL+NIS SIVA+V ++GAHHVD R +T +DP+WL D RR+EV+II KW+ +YY
Sbjct  438  VLKNISSSIVALVTEKGAHHVDFRSATNKDPEWLIDQRRQEVEIIQKWLQEYY  490



>ref|NP_001065793.1| Os11g0156200 [Oryza sativa Japonica Group]
 gb|AAX92949.1| At2g24280/F27D4.19 [Oryza sativa Japonica Group]
 gb|ABA91540.1| Serine carboxypeptidase S28 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27638.1| Os11g0156200 [Oryza sativa Japonica Group]
Length=511

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 120/179 (67%), Gaps = 4/179 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGV--QWRWQTCTEIIIPVGAS-S  549
            G+D + ++  A+ I+YN TG + CF P    E     G+   W WQ CTE+I+ +     
Sbjct  324  GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  382

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
              ++FP   +N +     C     + PRP+WI + FG ++I+ VLKR GSNIIFFNGLRD
Sbjct  383  NATVFPPDPFNLTAYLAGCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  442

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            PWS+GG+L++IS SI+A+V  +G HHVDLRFSTKEDP+WLK VRR+E++II  W+ QYY
Sbjct  443  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>ref|XP_007150129.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
 gb|ESW22123.1| hypothetical protein PHAVU_005G1292001g, partial [Phaseolus vulgaris]
Length=243

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 121/178 (68%), Gaps = 6/178 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            +GSD+L K+Y+ +       G+  CF    P   +S     W WQTC+EI+ P+G  S +
Sbjct  48   YGSDVLSKIYSGLVAL---RGDGICF-VNPPSTTVSETSEGWGWQTCSEIVFPIGIGS-N  102

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FPA  +N++  A  C+  + + PRP+W+TT +G H+IK +L +FGSNIIF+NGLRDP+
Sbjct  103  TMFPAQPYNFNSFATSCEKRYAVSPRPHWVTTYYGGHSIKLILNKFGSNIIFYNGLRDPY  162

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDL-RFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVLE++S S+VAI A +G+H +DL   +   DPKWL D+R KEV II  WI+QYY
Sbjct  163  SSGGVLEDLSDSLVAIQAAQGSHCLDLVPQNLTSDPKWLVDLRNKEVSIIKGWIAQYY  220



>gb|EAY80009.1| hypothetical protein OsI_35177 [Oryza sativa Indica Group]
Length=511

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 120/179 (67%), Gaps = 4/179 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGV--QWRWQTCTEIIIPVGAS-S  549
            G+D + ++  A+ I+YN TG + CF P    E     G+   W WQ CTE+I+ +     
Sbjct  324  GNDTVSRIKDAMTIYYNSTGGLACF-PGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIG  382

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
              ++FP   +N +     C     + PRP+WI + FG ++I+ VLKR GSNIIFFNGLRD
Sbjct  383  NATVFPPDPFNLTAYLADCLATTGVPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRD  442

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            PWS+GG+L++IS SI+A+V  +G HHVDLRFSTKEDP+WLK VRR+E++II  W+ QYY
Sbjct  443  PWSAGGILKSISNSIIALVEPKGGHHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYY  501



>ref|XP_008779559.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=147

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = -3

Query  590  QTCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLK  411
            Q CTE+++P+   S +S+FP+S ++Y+E    C   + + PRP+WITTE+G + I  VLK
Sbjct  11   QACTEMVMPM-TCSNESMFPSSSYDYNEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLK  69

Query  410  RFGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRK  231
            RFGSNIIF NG+RDPWS GGVL NIS SI+A+V ++GAHH+DLRF+TK+DPKWL + R++
Sbjct  70   RFGSNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRFATKDDPKWLLEQRKQ  129

Query  230  EVKIIHKWISQYY  192
            E+ II  WI QY+
Sbjct  130  EIDIIQSWIDQYH  142



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+ +L++++  V ++YNY+G V+CF  +     +S     W+WQ CTE+++P+ +  K S
Sbjct  314  GTSVLDRIFNGVTVYYNYSGTVDCFKLDDDPHGMS----GWQWQACTEMVMPMSSDPKTS  369

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   +NY+   + C  ++ ++PR  WITTEFG H+ K   K  GSNIIF +GL DPWS
Sbjct  370  MFPTFTFNYTYEQERCMKSYGVKPRGRWITTEFGGHDFKTTWKESGSNIIFASGLLDPWS  429

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
             G VL+N+S+++VA+V +EGAHH+DLR ST  DP WL   R  E+++I  WI  Y
Sbjct  430  GGSVLQNVSETLVALVTEEGAHHLDLRASTPNDPDWLVQQRASEIRLIQGWIDDY  484



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 116/177 (66%), Gaps = 12/177 (7%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGE-VNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
             G+DIL +L A       Y  E + C +       LS     W WQTC+E++IP+  ++ 
Sbjct  339  RGTDILTRLAAGAE----YANEGLGCLN-------LSTTLSGWDWQTCSEMVIPLAPNAN  387

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
             ++FP++ ++       C   + + PRP WITTEFG HNIKRVLKRFGSNIIF NGLRDP
Sbjct  388  TTMFPSAPFDLKSYFSGCFKTYGVLPRPYWITTEFGGHNIKRVLKRFGSNIIFSNGLRDP  447

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            +SSGGVL+NIS SIVAI AKEG H  D+R ST +DP WLK+ R+KE+ II KWI  Y
Sbjct  448  YSSGGVLKNISDSIVAITAKEGVHCEDIRSSTNDDPNWLKEQRQKEINIIRKWIIDY  504



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L ++  A++++YN+TG   CF  E+  +        W WQ CTE+++         +   
Sbjct  357  LSQVRDAMDVYYNHTGAAACFRAEEDDDPHGMYD-GWNWQACTEVMVMAYGIRDGGVLQP  415

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGGV  348
            S +N+++    C+N   + PRP WI TEFG  +I  VLK+  SNI+FFNGLRDPWS+GGV
Sbjct  416  SPFNFTDVVDSCRNYTGLPPRPFWIETEFGGFDIGNVLKKSASNIVFFNGLRDPWSTGGV  475

Query  347  LENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            L++IS SI+A+V  +G+HHVDLRFS+KEDP+WLK VR KE +II +W+ QYY
Sbjct  476  LKSISDSIIALVEPKGSHHVDLRFSSKEDPEWLKQVRVKETRIIARWLKQYY  527



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAA-VNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL K+YA  V +  N T +VN      P  V S   V WRWQTC+E++IP+G  + D
Sbjct  260  GSDILSKIYAGIVALRGNSTCKVN-----GPTNV-SETTVGWRWQTCSEMVIPIGIGN-D  312

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++F    +N +  A+ CK  + + PRP+W+TT +G HNIK VL+R GSNIIF NGLRDP+
Sbjct  313  TMFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPY  372

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL+NIS SIVA+    G+H +DL  + + DP WL + R+KEVKII +WI+QYY
Sbjct  373  SIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  429



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            HG+D L K++A V     Y G  +C+    P +  S   V WRWQTC+++++P+G S+ D
Sbjct  327  HGNDTLSKIFAGV---VAYRGNESCY--VNPPKNKSETDVGWRWQTCSDMVMPIGISN-D  380

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FPA++++  E  + CK  + + PRP+W TT FG H+IK VL RF SNIIF NGLRDP+
Sbjct  381  SMFPANQFDLKEYVESCKAQYGVPPRPHWATTYFGGHDIKLVLSRFASNIIFSNGLRDPY  440

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVLENIS ++VA+  K G+H +D+  +   DP WL + R+ EVKII  W+S YY
Sbjct  441  SSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLSNYY  497



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAA-VNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL K+YA  V +  N T +VN      P  V S   V WRWQTC+E++IP+G  + D
Sbjct  287  GSDILSKIYAGIVALRGNSTCKVN-----GPTNV-SETTVGWRWQTCSEMVIPIGIGN-D  339

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++F    +N +  A+ CK  + + PRP+W+TT +G HNIK VL+R GSNIIF NGLRDP+
Sbjct  340  TMFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPY  399

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL+NIS SIVA+    G+H +DL  + + DP WL + R+KEVKII +WI+QYY
Sbjct  400  SIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  456



>gb|EYU41363.1| hypothetical protein MIMGU_mgv1a0060841mg, partial [Erythranthe 
guttata]
Length=164

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 100/142 (70%), Gaps = 4/142 (3%)
 Frame = -3

Query  599  WRWQ----TCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAH  432
            W WQ     CTE+++P  +S   S+FPA +++Y+ + ++C   + ++PRP WITTEFG H
Sbjct  16   WNWQGQFFACTEMVMPTSSSKNTSMFPAYDYDYASDEEWCLENYGVKPRPTWITTEFGGH  75

Query  431  NIKRVLKRFGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKW  252
              K  LK FGSNIIF NGL DPWS G VLE+IS++IVA+V ++GAHH+DLR +T EDP W
Sbjct  76   GFKHALKNFGSNIIFSNGLLDPWSGGSVLEDISETIVALVTEKGAHHLDLRAATAEDPDW  135

Query  251  LKDVRRKEVKIIHKWISQYYHK  186
            L + R  EVK+I  W+ QY  K
Sbjct  136  LVEQRAAEVKLIQSWLDQYLDK  157



>ref|XP_002270231.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI23429.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+DIL+++++ +       G  +C+D  +     S     W WQ C+E++IP+G  S D
Sbjct  324  QGTDILDRIFSGI---VASRGNKSCYDMGQS-SFPSETEEGWNWQVCSELVIPIGRGSND  379

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FPA+ +++ E A  CK ++ + PRP+WIT+ +G HNIK +LKRFGSNIIF NGLRDP+
Sbjct  380  TMFPAAPFDFKEYADSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPY  439

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVLE+IS SI+A+    G+H +D+  ST++DP WL   R  E++IIH W+ +YY
Sbjct  440  SSGGVLEDISHSIIAVHTPRGSHCLDILPSTEDDPNWLVLQRNVEIEIIHGWLLKYY  496



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAA-VNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL K+YA  V +  N T +VN      P  V S   V WRWQTC+E++IP+G  + D
Sbjct  319  GSDILSKIYAGIVALRGNSTCKVN-----GPTNV-SETTVGWRWQTCSEMVIPIGIGN-D  371

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++F    +N +  A+ CK  + + PRP+W+TT +G HNIK VL+R GSNIIF NGLRDP+
Sbjct  372  TMFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGGHNIKLVLRRLGSNIIFSNGLRDPY  431

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            S GGVL+NIS SIVA+    G+H +DL  + + DP WL + R+KEVKII +WI+QYY
Sbjct  432  SIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPGWLVEQRKKEVKIIKRWITQYY  488



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL +++A V     Y G  +C+D            + WRWQTC+E+++P+G  + DS
Sbjct  323  GTDILGRIFAGV---VAYVGNKSCYDMNAYNHPSDETYMGWRWQTCSEMVMPIGHGNNDS  379

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP + +N +   + CK+ F ++P+P+W+TT +G H++K +L RF SNIIF NGLRDP+S
Sbjct  380  MFPPAPFNLNRFIRKCKSLFGVQPQPHWVTTYYGGHDLKLILHRFASNIIFSNGLRDPYS  439

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*L  180
            SGGVLENIS S+VA+    G+H +D+    K DP+WL   R+ EV+II  W+++YY   L
Sbjct  440  SGGVLENISDSVVAVHTIHGSHCLDILPEKKSDPQWLVKQRKTEVQIIEAWLAKYYTDLL  499

Query  179  GF  174
             F
Sbjct  500  EF  501



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 119/176 (68%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL +++A V     Y G  +C+D        ++    WRWQTC+E+++P+G  S D+
Sbjct  326  GTDILSRVFAGV---VAYMGNRSCYDTNY-YNYPTQGYFGWRWQTCSELVMPIGRGSNDT  381

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP+S ++     K C++ + + PRP+WITT+FG H+I+ VL++F SNIIF NGL+DP+S
Sbjct  382  MFPSSPFDLKNYTKSCQDLYGVPPRPHWITTQFGGHDIRLVLQKFASNIIFSNGLKDPYS  441

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVL NIS SIVAI   EG+H +DL  ++  DPKWL   R+ E++ I  WI +YY
Sbjct  442  SGGVLANISDSIVAIYTNEGSHCMDLYQASAHDPKWLVMQRQLEIETIKGWIEKYY  497



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D L K++A V  +Y   G  +C+  E     LS   V W WQTC++++IP+G S+ +S
Sbjct  329  GNDTLSKIFAGVVAYY---GNRSCYVNEP--RNLSETDVGWSWQTCSDLVIPMGVSN-ES  382

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP  +++  E    CK  + + PRP+W TT FG H+IK  L RF SNIIF NGLRDP+S
Sbjct  383  MFPPYQFDLQEYIDSCKALYGVPPRPHWATTYFGGHDIKLALYRFASNIIFSNGLRDPYS  442

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVLENIS ++VA++AK G+H +D+  S   DP WL + R+ EVKII  W+++YY
Sbjct  443  SGGVLENISDTVVAVLAKNGSHCLDVLLSDSTDPDWLVEQRKTEVKIIEGWLAEYY  498



>gb|KDO44733.1| hypothetical protein CISIN_1g0127112mg, partial [Citrus sinensis]
Length=264

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D+L K++  V     Y G  +C+D ++ +   +   V WRWQTC+E+++P+G   KD+
Sbjct  81   GIDVLGKIFKGV---VAYKGNRSCYDMDEYIRP-TETNVGWRWQTCSEMVMPIGHGHKDT  136

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP + ++ +   K C+  F ++P+P+W+TT +G  ++K +L RFGSNIIF NGLRDP+S
Sbjct  137  MFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYS  196

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*L  180
            +GGVL NIS S+VAI    G+H +D+   +K DP+WL   R+ E+KII +WI++Y +  L
Sbjct  197  TGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLL  256

Query  179  GF  174
             F
Sbjct  257  EF  258



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 117/176 (66%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D+L K++A +     Y G  +C+D  K  +  +     W WQ C+E+++P+G  S D+
Sbjct  327  GADLLSKVFAGL---VAYKGNQSCYD-TKEFKYSTETKRGWNWQRCSEMVMPIGRGSNDT  382

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F A+ +N +   + CK  + I PR NWITT+FG H+I+ VLKRFG NIIF NGLRDP+S
Sbjct  383  MFQAAPFNLTNFKQRCKRLYGISPRSNWITTQFGGHDIELVLKRFGGNIIFSNGLRDPYS  442

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SG VL+NIS S+VAI   +G+H +D+     +DPKWL   R +E+KII +WI QYY
Sbjct  443  SGSVLKNISDSLVAIYTTQGSHCMDILPELPDDPKWLVMQRNQEIKIIGQWIKQYY  498



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL +++A +     Y GE+ C+  E   E  + +G  W WQTC +++IP G S+ DS
Sbjct  329  GNDILGRIFAGM---VAYQGELPCYVNEPTKETETDVG--WSWQTCADMVIPFGISN-DS  382

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F    ++ +     CK+ + + PRP+W+TT FG H+IK +LKRFGSNIIF NGLRDP+S
Sbjct  383  MFQPYPFDLNAYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYS  442

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVL+NIS S+VAI   +G+H +D+  +TK DP+WL   R++EV+II KWI  Y+
Sbjct  443  SGGVLQNISDSVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYF  498



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFD---PEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            +DI+ K+ A V    +Y G  +C+D      P +        W WQTC+E+++P+G  S 
Sbjct  325  TDIIGKVVAGV---VSYNGNSSCYDLNASNNPSDSDEETDDGWDWQTCSEMVMPMGRGSN  381

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
            D++F A+ ++     + CK+A+++ PRP+WITT+FG H+IK +L+RFGSNIIF NGLRDP
Sbjct  382  DTMFEAAPFDLEAFIQGCKSAYSVSPRPHWITTQFGGHDIKLILERFGSNIIFSNGLRDP  441

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            +SS GVL +IS S++AI   EG H +D+  S+ +DP WL   RR+E++II  WI QYY
Sbjct  442  YSSAGVLTSISDSLLAIYTNEGCHCLDIVQSSPDDPNWLVMQRRREIEIISDWIKQYY  499



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL ++ A ++  Y   G VN F      E+ ++ G  W WQTCTEI++P+G    ++
Sbjct  313  GTDILGRVAAGLHR-YPGQGCVNIFS----FELSNKSG--WDWQTCTEIVMPIGYGDNET  365

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F A  ++     + C N F + PRP+W+TTEFG H+IK VL  F SNIIF NGLRDPWS
Sbjct  366  MFQAEPFDLKNYTRDCVNCFGVVPRPHWVTTEFGGHDIKTVLGNFASNIIFSNGLRDPWS  425

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
            SGGVLE+IS S+VAI  + GAH  DL  S+ +DP WL + R KEVKII  WI++YY K
Sbjct  426  SGGVLEDISDSVVAIHTEYGAHCADLFPSSPDDPVWLVEQREKEVKIIAVWIAEYYAK  483



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            D++ +++A V    +Y G   C+D        S   + W+WQTC+E+++P+G    +++F
Sbjct  338  DVIGRIFAGV---VSYKGNKTCYD-MNTYNYPSETSIGWQWQTCSEMVMPIGRGQNETMF  393

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            PA+ +N  E  K C   + + PRP+WITT +G H+IK  L RFGSNIIF NGLRDP+SSG
Sbjct  394  PAAPFNLDEFIKICSEIYGVPPRPHWITTYYGGHDIKLALNRFGSNIIFSNGLRDPYSSG  453

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            GVLE++S+S+VA+  + G+H +D+  +TK DP+WL   R  E++II  W++ YY
Sbjct  454  GVLEDLSESVVAVTTRNGSHCLDILQATKTDPEWLIMQRNTELQIIQGWLTTYY  507



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GSD+L+++++ +  ++   G+  C++ +      +  G  W WQTC+E++IP+G  S D+
Sbjct  329  GSDVLDRIFSGIVAYF---GKKPCYNLDAFFSSETLEG--WTWQTCSELVIPIGRGSNDT  383

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA  ++  E  + CK+AF + PRP+WITT +G H+ K VL+RFGSNIIF NGLRDP+S
Sbjct  384  MFPAEPFDLKEYIEECKSAFGVPPRPHWITTYYGGHHFKEVLRRFGSNIIFSNGLRDPYS  443

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            SGGVLENIS SI+A+   +GAH +D+  +T  DP W+   R  E++II+ WI +YY 
Sbjct  444  SGGVLENISDSILAVYTTKGAHCMDILPATIGDPDWVVLQRNIEIEIINGWILKYYQ  500



>emb|CDP17394.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 122/178 (69%), Gaps = 8/178 (4%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVL--SRIGVQWRWQTCTEIIIPVGASSK  546
            G+DIL + +A V    +Y  + +C+D    LE    +   V W+WQTC+E+++P+G  S 
Sbjct  327  GTDILGRTFAGV---VSYKKDESCYDM---LEYARSTETNVGWQWQTCSEMVMPIGRGSN  380

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
            D++FP S +N  +  K CK+++ + PRP+WITT +G H++K V +RFGSNIIF NGL+DP
Sbjct  381  DTMFPPSPFNLPDFIKNCKSSYGVSPRPHWITTYYGGHDMKLVFQRFGSNIIFSNGLKDP  440

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            +SSGGV EN+S S++AI   +G+H +D+  + + DP WL   R+ EV+II +WI QYY
Sbjct  441  YSSGGVRENLSSSLLAIYTVKGSHCLDILAAKESDPSWLVAQRKLEVEIIEEWIKQYY  498



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 117/177 (66%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPE-KPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL +++A V     Y G  +C+     P E        W WQTC+E+++P+G    D
Sbjct  228  GSDILSRIFAGV---VAYGGNSSCYTTSHNPTET----SEGWAWQTCSEMVMPIGRGDND  280

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FP + +N +   + C + + + PRP+W+TT +G HNI+ +L+RF SNIIF NGLRDP+
Sbjct  281  TMFPPAPFNLTTFIQECTSIYGVSPRPHWVTTYYGGHNIELILRRFASNIIFSNGLRDPY  340

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVL+NIS S++AI+   G+H +D+  +T  DP+WL   R+ EV++I  WI+QYY
Sbjct  341  SSGGVLKNISDSVLAILTVNGSHCLDILPATSTDPEWLVMQRKAEVEVIESWIAQYY  397



>ref|XP_002962799.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
 gb|EFJ36262.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
Length=470

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 118/177 (67%), Gaps = 5/177 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
             S IL+++YA VN++YN+TG   CFD +     LS     W WQ+CTE+++P+ ++S  S
Sbjct  288  ASSILQRIYAGVNVYYNFTGAAKCFDLDDDPHGLS----GWNWQSCTEMVMPMSSNSSTS  343

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            ++P  EW+    ++FC   +   PRP+W+TTEFG H+IK  L+ FGSNI+F NGL DPWS
Sbjct  344  MYPPFEWDGEAWSRFCWEKYGAIPRPSWVTTEFGGHDIKSALRNFGSNIVFSNGLLDPWS  403

Query  359  SGGVLENISKSI-VAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             G    N S  +  +++  +GAHH+D R+S K+DP+WL + R  EV+ I +W+S+Y+
Sbjct  404  GGRQAMNDSFRLRSSLIDFDGAHHLDFRWSRKDDPQWLIEQRELEVREIKRWLSEYH  460



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            GSDIL K+YA V       G   C     P  V S   V WRWQTC+E++IP+G   KD+
Sbjct  312  GSDILSKIYAGVVAL---KGNTTC-TINGPTNV-SETTVGWRWQTCSEMVIPIGIE-KDT  365

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F  + ++     + CK  F + PRP+W+TT +GAHNIK VL RFGSNIIF NGL+DP+S
Sbjct  366  MFEPNPFSLKRYVEGCKTTFGVSPRPHWVTTYYGAHNIKLVLGRFGSNIIFSNGLKDPYS  425

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GGVLENIS +IVAI    G+H +D+  + + DP+WL   R+KE+KI+ +WI++YY
Sbjct  426  IGGVLENISDNIVAIHTVNGSHCLDILRANESDPEWLVKQRKKEIKIMKRWITKYY  481



>ref|XP_002874098.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50357.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=427

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            DIL++++A V      TG  +C++    ++V +   + WRWQ C+EI++PVG   +D+++
Sbjct  249  DILDRIFAGVVAL---TGSQSCYNTNYSVQVTNN-DMAWRWQCCSEIVVPVGHDKQDTMY  304

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
              S +N +   + C++++ + PRP+WITT FG  N+K +L+RFGSNIIF NGL DP+S G
Sbjct  305  QTSPFNMTSYIEDCESSYGVSPRPHWITTYFGIQNVKLILQRFGSNIIFSNGLSDPYSVG  364

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE+IS ++VAI  K G+H  D+   +K DP+WL   R KE+K+I+ WIS Y
Sbjct  365  GVLEDISDTVVAITTKNGSHCQDINLKSKGDPEWLVMQREKEIKVINSWISTY  417



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+D L K++A V  F   +G  +C+   +P   L+   + W WQTC++++IP+ + S DS
Sbjct  324  GNDTLTKIFAGVVAF---SGNTSCY-VNQPRN-LTETDMGWSWQTCSDMVIPMASVSNDS  378

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FPA +++  +  K CK  + + PRP+W+TT FG H+IK  L+RF SNIIF NGLRDP+S
Sbjct  379  MFPAYQFDLKDYIKSCKAQYGVPPRPHWVTTYFGGHDIKLALERFASNIIFSNGLRDPYS  438

Query  359  SGGVLENISKSIVAIVAKEGAHHVD-LRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVLE+IS +IVA+ AK G+H +D L      DP WL + R+ EVKII +WI++YY
Sbjct  439  SGGVLEDISDTIVAVHAKNGSHCLDILNADNITDPDWLVNQRKIEVKIIKRWIARYY  495



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 122/176 (69%), Gaps = 6/176 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL +++A +     Y GE+ C+  +   E  + +G  W WQTC +++IP G S+ DS
Sbjct  333  GNDILGRIFAGM---VAYRGELPCYVNKPTKETETDVG--WSWQTCADMVIPFGISN-DS  386

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F    ++ +     CK+ + + PRP+W+TT FG H+IK +LKRFGSNIIF NGLRDP+S
Sbjct  387  MFQPYPFDLNVYINDCKDEYGVPPRPHWVTTYFGGHDIKLILKRFGSNIIFSNGLRDPYS  446

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SGGVL+NIS+S+VAI   +G+H +D+  +TK DP+WL   R++EV+II KWI  Y+
Sbjct  447  SGGVLQNISESVVAITTVKGSHCLDVLATTKSDPQWLVAQRKEEVRIIRKWIRNYF  502



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF----DPEKPLEVLSRIGVQWRWQTCTEIIIPVGAS  552
            GSDIL +++A V  F    G ++C+      + P+E +      W WQTC+EI+IP+G  
Sbjct  325  GSDILSRIFAGVVAF---RGNMSCYYTSNTTDYPIETIQ----GWGWQTCSEIVIPIGRG  377

Query  551  SKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLR  372
              D++FP + +N +  ++ C + + + PRP+WITT +G H+I+ +L+RF SNIIF NGLR
Sbjct  378  VNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLR  437

Query  371  DPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            DP+S GGVL+NIS S++AI+   G+H +DL  +   DP+WL   R+ EV+II  WI+QYY
Sbjct  438  DPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYY  497



>ref|XP_010493392.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=353

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            DIL++++A V      TG  +C+D    + +++   + WRWQ C+EI+IPVG   +D++F
Sbjct  174  DILDRIFAGVVAL---TGNQSCYDTNYSV-LVANDDMAWRWQGCSEIVIPVGHDKQDTMF  229

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P S +N +   + C++ + + PRP+WITT +G  +IK +L+RFGSNIIF NGL DP+S G
Sbjct  230  PTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVG  289

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE++S S+VAI    G+H  D+   +K DP+WL   R +E+KII  W+S Y
Sbjct  290  GVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSWLSTY  342



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 117/176 (66%), Gaps = 4/176 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL +++A V     Y G  +C+D  +  +   +  + WRWQTC+E+++P+G   +++
Sbjct  238  GTDILGRIFAGV---VAYMGHKSCYDMNEFNDPTDQTSLAWRWQTCSELVMPIG-HDRNT  293

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP + +N     K CK+ F I P+P+W+TT +G  ++K +L RF SNIIF NGLRDP+S
Sbjct  294  MFPPAPFNLKSYIKECKSLFGILPQPHWVTTYYGGQDLKLILHRFASNIIFSNGLRDPYS  353

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            +GGVLENIS SIVAI    G+H +D++     DP WL   R+ EV+II  WIS+YY
Sbjct  354  TGGVLENISDSIVAISTVNGSHCLDIQKEKPSDPNWLVMQRKTEVEIIQGWISKYY  409



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 123/206 (60%), Gaps = 37/206 (18%)
 Frame = -3

Query  707  LEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFPA  528
            L ++ AA +++YNY+    CF  E   +     G  W WQ CTE+++P+   SKDS+FP 
Sbjct  319  LSRVVAAASLYYNYSRTEKCFKIENATDAHGLHG--WDWQACTEMVMPM-TCSKDSMFPP  375

Query  527  SEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG--  354
            S ++Y   ++ C   + + PRP+WITTEFG + I++VLKRFGSNIIF NG++DPWS G  
Sbjct  376  STFDYKAFSEQCMRKYGVLPRPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGRF  435

Query  353  --------------------------------GVLENISKSIVAIVAKEGAHHVDLRFST  270
                                             VL+NIS SI+A+  ++GAHHVD R +T
Sbjct  436  QGKSFSEMKCEALSLFVFFFLEKNGTVMECPLSVLKNISASIIALATEKGAHHVDFRSAT  495

Query  269  KEDPKWLKDVRRKEVKIIHKWISQYY  192
            KEDP WL + RR+EV+II +WI++Y+
Sbjct  496  KEDPDWLVEQRRQEVEIIQRWINEYH  521



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  710  ILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFP  531
            +L+K++A +       G + C+    P    ++  + W WQTCTE++IP+G + ++++FP
Sbjct  324  LLQKIFAGLVAI---NGNLTCYVNAPPSGTFAQTLLGWSWQTCTEMVIPMGIT-RNTMFP  379

Query  530  ASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGG  351
               +N +  +  CK+ F + PRP+W+TT FG H+IK +L RF SNIIF NGL+DP+SSGG
Sbjct  380  PKPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGG  439

Query  350  VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            VL+NIS ++VAI   +G+H +D+  + K DP WL + R+ EVKI+ KW+++YY
Sbjct  440  VLKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYY  492



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = -3

Query  710  ILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIFP  531
            +L+K++A +       G + C+    P    ++  + W WQTCTE++IP+G + ++++FP
Sbjct  330  LLQKIFAGLVAI---NGNLTCYVNAPPSGTFAQTLLGWSWQTCTEMVIPMGIT-RNTMFP  385

Query  530  ASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSGG  351
               +N +  +  CK+ F + PRP+W+TT FG H+IK +L RF SNIIF NGL+DP+SSGG
Sbjct  386  PKPFNLNSFSNACKSVFGVPPRPHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGG  445

Query  350  VLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            VL+NIS ++VAI   +G+H +D+  + K DP WL + R+ EVKI+ KW+++YY
Sbjct  446  VLKNISSTVVAIYTAKGSHTLDILGADKSDPDWLVEQRKTEVKIMKKWLAKYY  498



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = -3

Query  716  SDILEKLYAAVNIFY-NYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            +DI+ K+ A V+ +  N + + N      P  V       W WQTCTE+++P+G     +
Sbjct  326  TDIVGKIIAGVSAYKGNVSSKSNVPSALAPGNVQLNENTAWNWQTCTEMVMPIGGGINAT  385

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP   ++ +   + CK+ + + PRP+WITT FG H+IKRVLKRFGSNIIF NGLRDP+S
Sbjct  386  LFPVPPFDLNSRIETCKSFYGVSPRPHWITTYFGGHDIKRVLKRFGSNIIFSNGLRDPYS  445

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
              GVL ++S S+VA++ K+G+H +DL  ++ +DP WL   R +EV+II +WI+QY
Sbjct  446  VAGVLRSLSHSLVALITKQGSHCLDLLPASPDDPHWLTAQRSREVRIIARWITQY  500



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D+L K++  V     Y G  +C+D ++ +   +   V WRWQTC+E+++P+G   KD+
Sbjct  275  GIDVLGKIFKGV---VAYKGNRSCYDMDEYIRP-TETNVGWRWQTCSEMVMPIGHGHKDT  330

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP + ++ +   K C+  F ++P+P+W+TT +G  ++K +L RFGSNIIF NGLRDP+S
Sbjct  331  MFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYS  390

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*L  180
            +GGVL NIS S+VAI    G+H +D+   +K DP+WL   R+ E+KII +WI++Y +  L
Sbjct  391  TGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKSEIKIIEEWIAKYENDLL  450

Query  179  GF  174
             F
Sbjct  451  EF  452



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF----DPEKPLEVLSRIGVQWRWQTCTEIIIPVGAS  552
            GSDIL +++A V  F    G ++C+      + P+E +      W WQTC+EI+IP+G  
Sbjct  444  GSDILSRIFAGVVAF---RGNMSCYYTSNTTDYPIETIQ----GWGWQTCSEIVIPIGRG  496

Query  551  SKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLR  372
              D++FP + +N +  ++ C + + + PRP+WITT +G H+I+ +L+RF SNIIF NGLR
Sbjct  497  VNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITTYYGGHDIELILRRFASNIIFSNGLR  556

Query  371  DPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            DP+S GGVL+NIS S++AI+   G+H +DL  +   DP+WL   R+ EV+II  WI+QYY
Sbjct  557  DPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAASTDPEWLVMQRKAEVEIIEGWIAQYY  616


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -3

Query  590  QTCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLK  411
            Q C E ++P+     D++FP   +N +   + C + + + P P+W TT +G HNI+ +L 
Sbjct  2    QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  410  RFGSNIIFFNGLRDPWSSGG  351
            RF SNIIF NGLRDP++  G
Sbjct  62   RFASNIIFSNGLRDPYAVPG  81



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G+DIL ++   +N      G  +C D    LE LS  G  W WQTCTE++ P+G    ++
Sbjct  313  GTDILGRIVEGLN--GRIPGWSSCHDIFT-LE-LSNNG-SWDWQTCTEMVFPIGYGDNET  367

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +F  S ++ +   K C   F I+PRP+W+TTEFG H+IK VL  F SNIIF NGLRDPWS
Sbjct  368  MFQPSPFDINNYKKECLQVFGIKPRPHWVTTEFGGHDIKTVLGNFASNIIFANGLRDPWS  427

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK  186
            +GGVLE+IS SIVA+  + GAH +DL  ST +DP WL + R KE+KII  W+++YY K
Sbjct  428  AGGVLEDISDSIVAVYTEHGAHCLDLYPSTPDDPNWLVEQREKEIKIIAAWLAEYYAK  485



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDS  540
            G D+L K++  V     Y G  +C+D ++ +   +   V WRWQTC+E+++P+G   KD+
Sbjct  319  GIDVLGKIFKGV---VAYKGNRSCYDMDEYIRP-TETNVGWRWQTCSEMVMPIGHGHKDT  374

Query  539  IFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWS  360
            +FP + ++ +   K C+  F ++P+P+W+TT +G  ++K +L RFGSNIIF NGLRDP+S
Sbjct  375  MFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYS  434

Query  359  SGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*L  180
            +GGVL NIS S+VAI    G+H +D+   +K DP+WL   R+ E+KII +WI++Y +  L
Sbjct  435  TGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLL  494

Query  179  GF  174
             F
Sbjct  495  EF  496



>emb|CAN65360.1| hypothetical protein VITISV_036071 [Vitis vinifera]
Length=580

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 118/177 (67%), Gaps = 4/177 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+DIL ++++ +       G  +C+D  +     S     W WQ C+E++IP+G  S D
Sbjct  324  QGTDILGRIFSGI---VASRGNKSCYDMGQS-SFPSETEEGWNWQVCSELVIPIGRGSND  379

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FPA+ +++ E    CK ++ + PRP+WIT+ +G HNIK +LKRFGSNIIF NGLRDP+
Sbjct  380  TMFPAAPFDFKEYDDSCKYSYGVTPRPHWITSYYGGHNIKLILKRFGSNIIFSNGLRDPY  439

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVLE+IS SI+A+    G+H +D+  S ++DP WL   R  E++I+H W+ +YY
Sbjct  440  SSGGVLEDISHSIIAVHTPRGSHCLDILPSREDDPNWLVLQRNVEIEILHGWLLKYY  496



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            HG+D L K++A V     Y G  +C+  E   +  S   V W WQTC++++IP+G S+ D
Sbjct  327  HGNDTLSKIFAGV---VAYRGNKSCYVNEPKNK--SETDVGWGWQTCSDMVIPIGISN-D  380

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            S+FPA+E++ ++  + CK  + + PRP+W TT FG H+IK  L  F SNIIF NGLRDP+
Sbjct  381  SMFPANEFDLNDYIETCKAQYGVPPRPHWATTYFGGHDIKLALSGFASNIIFSNGLRDPY  440

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SSGGVLENIS ++VA+  K G+H +D+  +   DP WL + R+ EVKII  W+ +YY
Sbjct  441  SSGGVLENISDTVVAVHTKNGSHCLDIVGANTTDPDWLVNQRKVEVKIIKGWLDKYY  497



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 120/179 (67%), Gaps = 10/179 (6%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCF--DPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSK  546
            G+D L K++A V  F   +G  +C+   P      L+   + W WQTC++++IP+ + S 
Sbjct  324  GNDTLTKIFAGVVAF---SGNTSCYVNHPRN----LTETDMGWSWQTCSDMVIPMTSVSN  376

Query  545  DSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDP  366
            DS+FPA +++  +  K C+  + + PRP+W TT FG H+IK  L+RF SNIIF NGLRDP
Sbjct  377  DSMFPAYQFDLKDYIKSCQAQYGVPPRPHWATTYFGGHDIKLALERFASNIIFSNGLRDP  436

Query  365  WSSGGVLENISKSIVAIVAKEGAHHVDLRFSTK-EDPKWLKDVRRKEVKIIHKWISQYY  192
            +SSGGVLE+IS ++VA+ AK G+H +DL  +    DP WL + R+ EVKII +WI++YY
Sbjct  437  YSSGGVLEDISDTVVAVHAKNGSHCLDLLNANNITDPDWLVNQRKIEVKIIKRWIAKYY  495



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            DIL++++A V      TG  +C+D    + +++   + WRWQ C+EI+IPVG   +D++F
Sbjct  321  DILDRIFAGVVAL---TGNQSCYDTNYSV-LVANDDMAWRWQGCSEIVIPVGHDKQDTMF  376

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P S +N +   + C++ + + PRP+WITT +G  +IK +L+RFGSNIIF NGL DP+S G
Sbjct  377  PTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVG  436

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE++S S+VAI    G+H  D+   +K DP+WL   R +E+KII  W+S Y
Sbjct  437  GVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREEEIKIIDSWLSTY  489



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            D+L++++A V       G   C+DP    +  + I + WRWQ+C+EI++PVG   +D++F
Sbjct  323  DLLDRIFAGVVAL---VGNRTCYDPNMFAQPTNNI-IAWRWQSCSEIVMPVGFDKQDTMF  378

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P + +N +   + C++ + + PR +WITT FG  ++K +L++FGSNIIF NGL DP+S G
Sbjct  379  PTAPFNMTSYIEGCESNYGVPPRQHWITTYFGIQDVKLILRKFGSNIIFSNGLSDPYSVG  438

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            G+LE+IS ++VAI    G+H  D+   +KEDP+WL   R KE+KII  WIS Y
Sbjct  439  GILEDISDTVVAITTNNGSHCQDISLKSKEDPEWLVMQREKEIKIIDSWISTY  491



>gb|KDP45057.1| hypothetical protein JCGZ_01557 [Jatropha curcas]
Length=391

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = -3

Query  722  HGSDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
             G+DIL+K++     F  + G+ +C+DP   L         W WQ C++++IP+G  S  
Sbjct  212  QGTDILDKIFLG---FVAFAGKKDCYDPNT-LFWSQETTEGWNWQVCSDLVIPMGIDSNR  267

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++F    +      + CK ++ + PRP+W+TT +G  +IK VL+RFGSNIIF NGLRDP+
Sbjct  268  TMFQHDPFVMEIFTESCKESYGVLPRPHWVTTYYGGQHIKEVLRRFGSNIIFSNGLRDPY  327

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYHK*  183
            SSGGVLE+IS SIVA+  +EG+H +D+ ++TK+DP+WL   R   ++II  WI  YY   
Sbjct  328  SSGGVLEDISDSIVALTTREGSHCMDILYATKDDPEWLVLQRNTALEIISGWILTYYQDL  387

Query  182  LG  177
             G
Sbjct  388  FG  389



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 120/186 (65%), Gaps = 16/186 (9%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQ-----WRWQTCTEIIIPVGAS  552
            + IL++++A V     Y G ++C+D       ++    Q     WRWQTC+E+++P+G  
Sbjct  320  TGILDRIFAGV---VAYMGNISCYD-------MNAFNYQDKTEEWRWQTCSELVMPIGHE  369

Query  551  SKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLR  372
            S +S+FP + +N     K CK+ F + P+P WITT +G H++K +L RFGSNIIF NGLR
Sbjct  370  S-NSMFPPAPFNLKNYIKDCKSLFGVLPQPRWITTYYGGHDLKLILHRFGSNIIFSNGLR  428

Query  371  DPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            DP+S GGVL NIS SIVA+ A  G+H +D++ ++  DP WL   R+ EVKII  WIS+YY
Sbjct  429  DPYSGGGVLNNISDSIVAVSAVNGSHCLDIQRASPSDPHWLVTQRKIEVKIIEGWISKYY  488

Query  191  HK*LGF  174
               L F
Sbjct  489  TDLLEF  494



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            DIL++++A V      TG  +C+D    + +++   + WRWQ C+EI+IPVG   +D++F
Sbjct  321  DILDRIFAGVVAL---TGNQSCYDTNYSV-LVANDDMAWRWQGCSEIVIPVGHDKQDAMF  376

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P S +N +   + C++ + + PRP+WITT +G  +IK +L+RFGSNIIF NGL DP+S G
Sbjct  377  PTSPFNMTSFIEGCESNYGVSPRPHWITTYYGIQDIKLILRRFGSNIIFSNGLSDPYSVG  436

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE++S S+VAI    G+H  D+   +K DP+WL   R KE+KII  W+ +Y
Sbjct  437  GVLEDLSDSVVAITTNNGSHCQDINLKSKGDPEWLVMQREKEIKIIDYWLLKY  489



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 116/177 (66%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPE-KPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL +++A V     Y G  +C++    P E        WRWQTC+E+++P+G    D
Sbjct  319  GSDILSRIFAGV---VAYRGNSSCYNTSVNPTET----SEGWRWQTCSEMVMPIGRGDND  371

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FP S +N +   + C + +++ PRP+WITT +G H+IK +L RF SNIIF NGLRDP+
Sbjct  372  TMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPY  431

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SS GVL+NIS +++AI    G+H +D+  +   DP+WL   R+ EV+II  WI+QY+
Sbjct  432  SSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYH  488



>ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=510

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 116/177 (66%), Gaps = 8/177 (5%)
 Frame = -3

Query  719  GSDILEKLYAAVNIFYNYTGEVNCFDPE-KPLEVLSRIGVQWRWQTCTEIIIPVGASSKD  543
            GSDIL +++A V     Y G  +C++    P E        WRWQTC+E+++P+G    D
Sbjct  327  GSDILSRIFAGV---VAYRGNSSCYNTSVNPTET----SEGWRWQTCSEMVMPIGRGDND  379

Query  542  SIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPW  363
            ++FP S +N +   + C + +++ PRP+WITT +G H+IK +L RF SNIIF NGLRDP+
Sbjct  380  TMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDIKLILHRFASNIIFSNGLRDPY  439

Query  362  SSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
            SS GVL+NIS +++AI    G+H +D+  +   DP+WL   R+ EV+II  WI+QY+
Sbjct  440  SSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLIMQRKTEVEIIESWIAQYH  496



>ref|NP_851059.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 dbj|BAB10607.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
 gb|AED93088.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=502

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            ++L++++A V       G   C+D  K     +   + WRWQ+C+EI++PVG   +D++F
Sbjct  323  NLLDRIFAGVVAL---VGNRTCYD-TKMFAQPTNNNIAWRWQSCSEIVMPVGYDKQDTMF  378

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P + +N +     CK+   + PRP+WITT FG   +K +L++FGSNIIF NGL DP+S G
Sbjct  379  PTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVG  438

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE+IS ++VAI  K G+H +D+   +KEDP+WL   R KE+K+I  WIS Y
Sbjct  439  GVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTY  491



>gb|AAM61502.1| prolylcarboxypeptidase-like protein [Arabidopsis thaliana]
Length=502

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            ++L++++A V       G   C+D  K     +   + WRWQ+C+EI++PVG   +D++F
Sbjct  323  NLLDRIFAGVVAL---VGNRTCYD-TKMFAQPTNNNIAWRWQSCSEIVMPVGYDKQDTMF  378

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P + +N +     CK+   + PRP+WITT FG   +K +L++FGSNIIF NGL DP+S G
Sbjct  379  PTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQEVKLILQKFGSNIIFSNGLSDPYSVG  438

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE+IS ++VAI  K G+H +D+   +KEDP+WL   R KE+K+I  WIS Y
Sbjct  439  GVLEDISDTLVAITTKNGSHCLDITLKSKEDPEWLVIQREKEIKVIDSWISTY  491



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 115/181 (64%), Gaps = 10/181 (6%)
 Frame = -3

Query  719  GSDILEKLYAAVN--IFYNYTGEVNCFDPEKPLEVLSRIGVQ-WRWQTCTEIIIPVGASS  549
            G+DIL ++ A VN  +F N     +C         LSR     W WQTCTE++ P+G   
Sbjct  315  GTDILGRVAAGVNASVFGN-----SCHSASG--SGLSRKSASAWEWQTCTEMVFPMGYGE  367

Query  548  KDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRD  369
             +++F +   + +   K C + F I+PRP+WITTEFG H+IK VL  F SNIIF NGLRD
Sbjct  368  NETMFQSDPLDINNYTKECVDVFGIKPRPHWITTEFGGHDIKTVLGNFASNIIFSNGLRD  427

Query  368  PWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYYH  189
            PWS+GGVLE+IS S+VA+  ++G+H +DL   T  DP WL  +R KE KII  W+++YY 
Sbjct  428  PWSAGGVLEDISDSVVALYTEQGSHCLDLYPPTSSDPDWLLALRDKENKIIAYWLAEYYA  487

Query  188  K  186
            K
Sbjct  488  K  488



>gb|KFK27606.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=499

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            D+L++++A V       G  +C+D     +  +   + WRWQ+CTEI++PVG   +D++F
Sbjct  320  DLLDRIFAGVVAL---VGNRSCYDTNMFAQPTNN-NLAWRWQSCTEIVMPVGYDKQDTMF  375

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P + +N +     C++ + + PRP+W+TT FG  ++K +L+RFGSNIIF NGL+DP+S G
Sbjct  376  PTAPFNMTSFIAGCESYYGVPPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLKDPYSVG  435

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE+IS S+VAI  + G+H  D+   +KEDP+WL   R KE+ II  WI+ Y
Sbjct  436  GVLEDISGSVVAIKTENGSHCQDIVLKSKEDPEWLVMQREKEIDIIESWITSY  488



>ref|XP_010683431.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -3

Query  716  SDILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSI  537
            +DI+ ++YA V  ++N T   +C D     ++   I V + WQTC+E+++P+G +SK S+
Sbjct  324  TDIVSRIYAGVLDYFNSTHH-DCVDTNY-FQIGESI-VGYDWQTCSEMVMPIG-TSKWSM  379

Query  536  FPASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSS  357
            FP   +N  +  + CKN +N+ PRP+WIT+ +G H++K +  RFGSNIIF NGL+DP+SS
Sbjct  380  FPPQPFNLRDFIQDCKNKYNVMPRPHWITSYYGGHDMKLIFGRFGSNIIFSNGLQDPYSS  439

Query  356  GGVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQYY  192
             GVL N+S SI+A+ A +G+H VD++ + K+DP+WL ++R  E++II  WI +YY
Sbjct  440  AGVLYNLSDSIIAVYATQGSHCVDIQHAKKDDPEWLINMRNTEIEIISGWIRKYY  494



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = -3

Query  620  LSRIGVQWRWQTCTEIIIPVGASSKDSIFPASEWNYSENAKFCKNAFNIEPRPNWITTEF  441
            LS   V W WQTC+E++IP+G S+ +++FPAS +   +    CK A+++ PRP+W+TT +
Sbjct  313  LSETDVGWNWQTCSEMVIPIGISN-NTMFPASPFELQDFINECKAAYDVPPRPHWVTTYY  371

Query  440  GAHNIKRVLKRFGSNIIFFNGLRDPWSSGGVLENISKSIVAIVAKEGAHHVDLRFSTKED  261
            G  +IK +L+RF SNIIF NGLRDP+SSGGVLENISKS+VA+   +G+H +D+  + + D
Sbjct  372  GGKDIKLILRRFASNIIFSNGLRDPYSSGGVLENISKSVVAVTTTKGSHCLDILQAKETD  431

Query  260  PKWLKDVRRKEVKIIHKWISQYY  192
            P WL   R+ EV II +WI+QYY
Sbjct  432  PDWLVKQRKVEVNIIKRWIAQYY  454



>gb|KFK27605.1| hypothetical protein AALP_AA8G405500 [Arabis alpina]
Length=509

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  713  DILEKLYAAVNIFYNYTGEVNCFDPEKPLEVLSRIGVQWRWQTCTEIIIPVGASSKDSIF  534
            D+L++++A V       G  +C+D     +  +   + WRWQ+CTEI++PVG   +D++F
Sbjct  330  DLLDRIFAGVVAL---VGNRSCYDTNMFAQPTNN-NLAWRWQSCTEIVMPVGYDKQDTMF  385

Query  533  PASEWNYSENAKFCKNAFNIEPRPNWITTEFGAHNIKRVLKRFGSNIIFFNGLRDPWSSG  354
            P + +N +     C++ + + PRP+W+TT FG  ++K +L+RFGSNIIF NGL+DP+S G
Sbjct  386  PTAPFNMTSFIAGCESYYGVPPRPHWVTTYFGIQDVKLILRRFGSNIIFSNGLKDPYSVG  445

Query  353  GVLENISKSIVAIVAKEGAHHVDLRFSTKEDPKWLKDVRRKEVKIIHKWISQY  195
            GVLE+IS S+VAI  + G+H  D+   +KEDP+WL   R KE+ II  WI+ Y
Sbjct  446  GVLEDISGSVVAIKTENGSHCQDIVLKSKEDPEWLVMQREKEIDIIESWITSY  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185754102464