BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24539_g1_i1 len=699 path=[1094:0-170 2621:171-173 1268:174-185
1280:186-222 455:223-247 2647:248-251 484:252-253 486:254-282
515:283-288 521:289-507 740:508-555 1648:556-655 1748:656-698]

Length=699
                                                                      Score     E

emb|CDP20628.1|  unnamed protein product                                314   1e-103   
ref|NP_001275303.1|  erg-1 precursor                                    299   8e-98    
ref|XP_004230631.1|  PREDICTED: protein EXORDIUM-like 2                 298   2e-97    
ref|XP_011087905.1|  PREDICTED: protein EXORDIUM-like 2                 296   2e-96    
ref|XP_009760896.1|  PREDICTED: protein EXORDIUM-like 2                 296   2e-96    
dbj|BAG16530.1|  putative phosphate-induced protein                     294   7e-96    Capsicum chinense [bonnet pepper]
ref|XP_011092430.1|  PREDICTED: protein EXORDIUM-like 2                 294   1e-95    
ref|XP_009606160.1|  PREDICTED: protein EXORDIUM-like 2                 291   1e-94    
gb|KDP40915.1|  hypothetical protein JCGZ_24914                         281   1e-90    
ref|XP_002298705.2|  phosphate-responsive family protein                280   4e-90    Populus trichocarpa [western balsam poplar]
ref|XP_011043114.1|  PREDICTED: protein EXORDIUM-like 2                 280   4e-90    
gb|EYU39128.1|  hypothetical protein MIMGU_mgv1a026379mg                279   8e-90    
ref|XP_011003866.1|  PREDICTED: protein EXORDIUM-like 2                 278   1e-89    
ref|XP_002323973.2|  hypothetical protein POPTR_0017s07860g             278   1e-89    Populus trichocarpa [western balsam poplar]
gb|ABK96539.1|  unknown                                                 277   2e-89    Populus trichocarpa x Populus deltoides
ref|XP_008373268.1|  PREDICTED: uncharacterized protein LOC103436601    276   6e-89    
ref|XP_009344591.1|  PREDICTED: uncharacterized protein LOC103936476    276   9e-89    
ref|XP_008382034.1|  PREDICTED: uncharacterized protein LOC103444863    276   1e-88    
ref|XP_006433956.1|  hypothetical protein CICLE_v10001970mg             275   3e-88    
ref|XP_006472580.1|  PREDICTED: uncharacterized protein LOC102624853    274   6e-88    
ref|XP_002307366.1|  hypothetical protein POPTR_0005s17250g             273   1e-87    Populus trichocarpa [western balsam poplar]
gb|EYU18459.1|  hypothetical protein MIMGU_mgv1a010684mg                273   2e-87    
ref|XP_007042914.1|  EXORDIUM like 2                                    271   6e-87    
ref|XP_006472581.1|  PREDICTED: uncharacterized protein LOC102625136    271   6e-87    
ref|XP_003541423.1|  PREDICTED: uncharacterized protein LOC100810770    271   1e-86    
ref|XP_011003039.1|  PREDICTED: protein EXORDIUM-like 2                 271   1e-86    
ref|XP_004485593.1|  PREDICTED: uncharacterized protein LOC101490191    269   5e-86    
ref|XP_007200523.1|  hypothetical protein PRUPE_ppa009421mg             268   1e-85    
gb|KDP41405.1|  hypothetical protein JCGZ_15812                         268   1e-85    
ref|XP_006433957.1|  hypothetical protein CICLE_v10001968mg             268   1e-85    
ref|XP_003593220.1|  hypothetical protein MTR_2g009070                  268   2e-85    
ref|XP_002273316.1|  PREDICTED: protein EXORDIUM-like 2                 267   4e-85    Vitis vinifera
dbj|BAJ33879.1|  unnamed protein product                                266   6e-85    
ref|XP_004504811.1|  PREDICTED: uncharacterized protein LOC101501714    265   3e-84    
ref|XP_010267345.1|  PREDICTED: protein EXORDIUM-like 2                 265   4e-84    
emb|CDY63721.1|  BnaC02g48820D                                          263   9e-84    
ref|XP_010484201.1|  PREDICTED: protein EXORDIUM-like 2                 263   1e-83    
ref|XP_006394173.1|  hypothetical protein EUTSA_v10005461mg             263   2e-83    
ref|XP_009130446.1|  PREDICTED: uncharacterized protein LOC103855233    263   2e-83    
ref|XP_006423793.1|  hypothetical protein CICLE_v10028909mg             261   5e-83    
ref|XP_010094136.1|  hypothetical protein L484_017174                   261   6e-83    
ref|XP_007018740.1|  EXORDIUM like 2                                    260   1e-82    
ref|XP_004137161.1|  PREDICTED: uncharacterized protein LOC101213735    259   4e-82    
emb|CAN83333.1|  hypothetical protein VITISV_024712                     258   4e-82    Vitis vinifera
ref|NP_201231.1|  protein EXORDIUM like 2                               259   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065641.1|  PREDICTED: protein EXORDIUM-like 2                 258   6e-82    
ref|XP_002864892.1|  hypothetical protein ARALYDRAFT_919741             258   1e-81    
ref|XP_007159119.1|  hypothetical protein PHAVU_002G210200g             258   1e-81    
gb|AGV54462.1|  phi-1-like phosphate-induced protein                    258   1e-81    
ref|XP_003531029.1|  PREDICTED: uncharacterized protein LOC100776258    258   2e-81    
ref|XP_004168612.1|  PREDICTED: uncharacterized protein LOC101227929    258   2e-81    
ref|XP_010690524.1|  PREDICTED: protein EXORDIUM-like 2                 257   3e-81    
gb|EPS68014.1|  hypothetical protein M569_06759                         256   3e-81    
ref|XP_006399422.1|  hypothetical protein EUTSA_v10014244mg             257   3e-81    
ref|XP_003608450.1|  hypothetical protein MTR_4g094240                  256   3e-81    
ref|XP_010273025.1|  PREDICTED: protein EXORDIUM-like 2                 256   1e-80    
ref|XP_008462872.1|  PREDICTED: uncharacterized protein LOC103501152    256   1e-80    
gb|KFK28118.1|  hypothetical protein AALP_AA8G474900                    255   1e-80    
ref|XP_004237934.1|  PREDICTED: protein EXORDIUM-like 2                 255   2e-80    
ref|XP_010065642.1|  PREDICTED: protein EXORDIUM-like 2                 253   5e-80    
ref|XP_009621840.1|  PREDICTED: protein EXORDIUM-like 2                 253   8e-80    
ref|XP_010461594.1|  PREDICTED: protein EXORDIUM-like 2                 253   9e-80    
ref|XP_006363278.1|  PREDICTED: uncharacterized protein LOC102581378    253   2e-79    
ref|XP_003545684.1|  PREDICTED: uncharacterized protein LOC100788174    252   2e-79    
ref|XP_003518235.1|  PREDICTED: uncharacterized protein LOC100800380    252   4e-79    
ref|XP_010060036.1|  PREDICTED: protein EXORDIUM-like 2                 251   5e-79    
ref|XP_009122517.1|  PREDICTED: uncharacterized protein LOC103847210    251   5e-79    
ref|XP_010065640.1|  PREDICTED: protein EXORDIUM-like 2                 251   5e-79    
emb|CDX84508.1|  BnaC03g49920D                                          251   7e-79    
ref|XP_010520896.1|  PREDICTED: protein EXORDIUM-like 2                 251   8e-79    
ref|XP_009150498.1|  PREDICTED: uncharacterized protein LOC103873843    251   9e-79    
gb|KCW63229.1|  hypothetical protein EUGRSUZ_G00849                     250   1e-78    
emb|CDY21583.1|  BnaC09g47090D                                          250   1e-78    
emb|CDX69904.1|  BnaA10g22530D                                          250   1e-78    
ref|XP_002513948.1|  conserved hypothetical protein                     250   2e-78    Ricinus communis
ref|XP_002285759.1|  PREDICTED: protein EXORDIUM-like 2                 249   2e-78    Vitis vinifera
ref|XP_004299657.1|  PREDICTED: uncharacterized protein LOC101298424    249   4e-78    
ref|XP_008349972.1|  PREDICTED: uncharacterized protein LOC103413276    249   6e-78    
ref|XP_003531542.1|  PREDICTED: uncharacterized protein LOC100785002    248   7e-78    
ref|XP_009341761.1|  PREDICTED: uncharacterized protein LOC103933804    248   2e-77    
ref|XP_006280854.1|  hypothetical protein CARUB_v10026839mg             246   5e-77    
gb|EYU29610.1|  hypothetical protein MIMGU_mgv1a027015mg                245   8e-77    
emb|CBI19177.3|  unnamed protein product                                245   9e-77    
ref|XP_008807998.1|  PREDICTED: uncharacterized protein LOC103720179    245   2e-76    
ref|XP_002285775.1|  PREDICTED: protein EXORDIUM-like 2                 244   2e-76    Vitis vinifera
ref|XP_008808001.1|  PREDICTED: uncharacterized protein LOC103720182    244   3e-76    
ref|XP_007223146.1|  hypothetical protein PRUPE_ppa009026mg             244   4e-76    
ref|XP_003544805.1|  PREDICTED: uncharacterized protein LOC100792751    244   5e-76    
ref|XP_009631998.1|  PREDICTED: protein EXORDIUM-like 2                 244   6e-76    
ref|XP_006853274.1|  hypothetical protein AMTR_s00038p00236640          243   8e-76    
ref|XP_009792435.1|  PREDICTED: protein EXORDIUM-like 2                 243   9e-76    
ref|XP_010444357.1|  PREDICTED: protein EXORDIUM-like 2                 243   2e-75    
ref|XP_010098621.1|  hypothetical protein L484_012733                   241   3e-75    
ref|XP_006383500.1|  hypothetical protein POPTR_0005s17230g             242   3e-75    
ref|XP_003522787.2|  PREDICTED: uncharacterized protein LOC100810910    242   7e-75    
emb|CDP21253.1|  unnamed protein product                                240   1e-74    
ref|XP_006387583.1|  hypothetical protein POPTR_0815s00210g             242   1e-74    
ref|XP_010937404.1|  PREDICTED: protein EXORDIUM-like 2                 240   1e-74    
ref|XP_010937409.1|  PREDICTED: protein EXORDIUM-like                   240   2e-74    
ref|XP_002307374.1|  hypothetical protein POPTR_0005s17200g             239   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_002301062.2|  phosphate-responsive family protein                239   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_009631899.1|  PREDICTED: protein EXORDIUM-like                   239   4e-74    
ref|XP_010937408.1|  PREDICTED: protein EXORDIUM-like                   239   4e-74    
ref|XP_010320183.1|  PREDICTED: protein EXORDIUM-like                   239   5e-74    
ref|XP_006433958.1|  hypothetical protein CICLE_v10001854mg             239   6e-74    
gb|KHN08948.1|  hypothetical protein glysoja_021770                     238   8e-74    
ref|XP_003526574.1|  PREDICTED: uncharacterized protein LOC100793598    238   8e-74    
ref|XP_002307368.2|  hypothetical protein POPTR_0005s17210g             238   1e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006472582.1|  PREDICTED: uncharacterized protein LOC102625424    238   1e-73    
ref|XP_006853272.1|  hypothetical protein AMTR_s00038p00236240          238   1e-73    
ref|XP_010939670.1|  PREDICTED: protein EXORDIUM-like 1                 238   1e-73    
gb|ABK93831.1|  unknown                                                 238   1e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006288248.1|  hypothetical protein CARUB_v10001493mg             238   2e-73    
ref|XP_006363276.1|  PREDICTED: uncharacterized protein LOC102580699    237   2e-73    
ref|XP_002285762.1|  PREDICTED: protein EXORDIUM                        238   2e-73    Vitis vinifera
ref|XP_010422983.1|  PREDICTED: protein EXORDIUM-like 4                 236   2e-73    
emb|CDP01089.1|  unnamed protein product                                237   2e-73    
ref|XP_008808009.1|  PREDICTED: uncharacterized protein LOC103720188    237   3e-73    
ref|XP_010676078.1|  PREDICTED: protein EXORDIUM-like 2                 237   3e-73    
ref|XP_011016644.1|  PREDICTED: protein EXORDIUM-like                   237   3e-73    
ref|XP_010452934.1|  PREDICTED: protein EXORDIUM-like 4                 236   3e-73    
ref|XP_009792820.1|  PREDICTED: protein EXORDIUM-like                   236   4e-73    
ref|XP_007148400.1|  hypothetical protein PHAVU_006G205300g             236   4e-73    
ref|XP_002871372.1|  hypothetical protein ARALYDRAFT_487757             235   4e-73    
ref|XP_009618458.1|  PREDICTED: protein EXORDIUM-like                   236   5e-73    
dbj|BAA33810.1|  phi-1                                                  236   5e-73    Nicotiana tabacum [American tobacco]
ref|XP_002513946.1|  conserved hypothetical protein                     236   6e-73    Ricinus communis
ref|XP_003544803.1|  PREDICTED: uncharacterized protein LOC100791695    236   6e-73    
ref|XP_009779725.1|  PREDICTED: protein EXORDIUM-like                   236   7e-73    
ref|XP_007222573.1|  hypothetical protein PRUPE_ppa008424mg             236   1e-72    
ref|XP_007018742.1|  Phosphate-responsive 1 family protein              235   2e-72    
gb|KEH34959.1|  phosphate-responsive 1 family protein                   234   2e-72    
ref|XP_002874502.1|  hypothetical protein ARALYDRAFT_489716             234   3e-72    
ref|XP_010491572.1|  PREDICTED: protein EXORDIUM-like 4                 233   3e-72    
ref|XP_011003041.1|  PREDICTED: protein EXORDIUM-like                   234   3e-72    
ref|XP_007018741.1|  Phosphate-responsive 1 family protein              234   3e-72    
ref|NP_192634.1|  protein EXORDIUM                                      234   3e-72    Arabidopsis thaliana [mouse-ear cress]
gb|AAM64992.1|  putative phi-1-like phosphate-induced protein           234   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009779726.1|  PREDICTED: protein EXORDIUM-like                   234   3e-72    
ref|XP_010320182.1|  PREDICTED: protein EXORDIUM-like                   234   3e-72    
ref|XP_009605184.1|  PREDICTED: protein EXORDIUM-like                   234   4e-72    
ref|XP_008790895.1|  PREDICTED: uncharacterized protein LOC103707944    234   4e-72    
gb|KEH34958.1|  phosphate-responsive 1 family protein                   234   4e-72    
gb|AFK43172.1|  unknown                                                 233   4e-72    
gb|KDP41402.1|  hypothetical protein JCGZ_15809                         234   4e-72    
ref|XP_002513943.1|  conserved hypothetical protein                     234   4e-72    Ricinus communis
ref|XP_010025813.1|  PREDICTED: protein EXORDIUM-like 2                 234   4e-72    
ref|XP_011003040.1|  PREDICTED: protein EXORDIUM-like                   234   4e-72    
ref|XP_011016663.1|  PREDICTED: protein EXORDIUM-like                   234   6e-72    
gb|EPS71944.1|  hypothetical protein M569_02811                         233   7e-72    
ref|XP_009409276.1|  PREDICTED: uncharacterized protein LOC103991514    233   9e-72    
ref|XP_009380864.1|  PREDICTED: uncharacterized protein LOC103969134    233   9e-72    
ref|XP_008219324.1|  PREDICTED: uncharacterized protein LOC103319550    233   1e-71    
ref|XP_006363271.1|  PREDICTED: uncharacterized protein LOC102579064    233   1e-71    
ref|XP_006853277.1|  hypothetical protein AMTR_s00038p00237970          232   1e-71    
ref|XP_006363272.1|  PREDICTED: uncharacterized protein LOC102579389    232   1e-71    
gb|KDP41401.1|  hypothetical protein JCGZ_15808                         233   2e-71    
ref|XP_002513945.1|  conserved hypothetical protein                     232   2e-71    Ricinus communis
gb|KHN30293.1|  hypothetical protein glysoja_042453                     232   3e-71    
ref|XP_003523812.1|  PREDICTED: uncharacterized protein LOC100779037    232   3e-71    
gb|KDP41404.1|  hypothetical protein JCGZ_15811                         231   4e-71    
ref|XP_004253500.2|  PREDICTED: protein EXORDIUM-like                   231   5e-71    
ref|XP_003518234.2|  PREDICTED: uncharacterized protein LOC100799846    233   5e-71    
ref|XP_009341762.1|  PREDICTED: uncharacterized protein LOC103933805    231   5e-71    
ref|XP_006363275.1|  PREDICTED: uncharacterized protein LOC102580361    231   8e-71    
ref|XP_010436130.1|  PREDICTED: protein EXORDIUM-like                   230   9e-71    
ref|XP_006363274.1|  PREDICTED: uncharacterized protein LOC102580035    230   1e-70    
ref|XP_009372905.1|  PREDICTED: uncharacterized protein LOC103961973    231   1e-70    
ref|XP_010538939.1|  PREDICTED: protein EXORDIUM-like                   230   1e-70    
gb|KDP41403.1|  hypothetical protein JCGZ_15810                         230   1e-70    
gb|KEH28079.1|  phosphate-responsive 1 family protein                   230   1e-70    
ref|XP_006288093.1|  hypothetical protein CARUB_v10001324mg             231   1e-70    
ref|XP_008237196.1|  PREDICTED: uncharacterized protein LOC103335938    229   1e-70    
ref|XP_010273027.1|  PREDICTED: protein EXORDIUM-like                   230   2e-70    
ref|XP_010060031.1|  PREDICTED: protein EXORDIUM-like                   230   2e-70    
ref|XP_009409277.1|  PREDICTED: uncharacterized protein LOC103991515    229   2e-70    
ref|XP_010060034.1|  PREDICTED: protein EXORDIUM-like                   229   2e-70    
ref|XP_010060027.1|  PREDICTED: protein EXORDIUM-like                   229   2e-70    
ref|XP_010455304.1|  PREDICTED: protein EXORDIUM-like                   229   3e-70    
ref|XP_006363273.1|  PREDICTED: uncharacterized protein LOC102579714    229   3e-70    
gb|EYU29446.1|  hypothetical protein MIMGU_mgv1a010094mg                229   3e-70    
ref|XP_004237932.1|  PREDICTED: protein EXORDIUM-like                   229   4e-70    
gb|KCW66563.1|  hypothetical protein EUGRSUZ_F00362                     229   5e-70    
ref|XP_010421809.1|  PREDICTED: protein EXORDIUM isoform X1             229   5e-70    
ref|NP_196506.1|  protein exordium like 4                               227   5e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152631.1|  PREDICTED: uncharacterized protein LOC101221106    228   6e-70    
gb|KCW66560.1|  hypothetical protein EUGRSUZ_F00359                     228   7e-70    
ref|XP_007141205.1|  hypothetical protein PHAVU_008G176000g             228   8e-70    
ref|XP_010060033.1|  PREDICTED: protein EXORDIUM-like                   228   8e-70    
gb|KCW66562.1|  hypothetical protein EUGRSUZ_F00361                     229   9e-70    
ref|XP_008444846.1|  PREDICTED: uncharacterized protein LOC103488070    228   1e-69    
ref|XP_010098619.1|  hypothetical protein L484_012731                   227   1e-69    
gb|KCW66558.1|  hypothetical protein EUGRSUZ_F00357                     231   2e-69    
ref|XP_004516719.1|  PREDICTED: uncharacterized protein LOC101502011    227   2e-69    
ref|XP_010060030.1|  PREDICTED: protein EXORDIUM-like                   227   2e-69    
ref|XP_010060035.1|  PREDICTED: protein EXORDIUM-like                   227   2e-69    
ref|XP_009380865.1|  PREDICTED: uncharacterized protein LOC103969135    227   2e-69    
ref|XP_010060026.1|  PREDICTED: protein EXORDIUM-like                   227   2e-69    
ref|XP_009341759.1|  PREDICTED: uncharacterized protein LOC103933801    226   4e-69    
ref|XP_004500640.1|  PREDICTED: uncharacterized protein LOC101494486    226   4e-69    
ref|XP_004516718.1|  PREDICTED: uncharacterized protein LOC101501686    226   4e-69    
ref|XP_010066691.1|  PREDICTED: protein EXORDIUM-like                   226   4e-69    
ref|XP_004301324.1|  PREDICTED: uncharacterized protein LOC101294668    226   4e-69    
gb|EYU36488.1|  hypothetical protein MIMGU_mgv1a010163mg                226   5e-69    
emb|CDX90701.1|  BnaA03g23810D                                          226   5e-69    
ref|XP_003615144.1|  hypothetical protein MTR_5g064360                  226   6e-69    
ref|XP_007141203.1|  hypothetical protein PHAVU_008G175800g             227   6e-69    
ref|XP_008790896.1|  PREDICTED: uncharacterized protein LOC103707945    225   8e-69    
gb|KCW66561.1|  hypothetical protein EUGRSUZ_F00360                     226   1e-68    
emb|CDP21255.1|  unnamed protein product                                225   1e-68    
ref|XP_008219325.1|  PREDICTED: uncharacterized protein LOC103319552    226   1e-68    
ref|XP_010060028.1|  PREDICTED: protein EXORDIUM-like isoform X1        225   1e-68    
ref|XP_007136266.1|  hypothetical protein PHAVU_009G032100g             225   1e-68    
ref|XP_010060029.1|  PREDICTED: protein EXORDIUM-like isoform X2        225   1e-68    
gb|KHN42563.1|  hypothetical protein glysoja_042421                     224   2e-68    
ref|XP_003544804.1|  PREDICTED: uncharacterized protein LOC100792222    224   2e-68    
ref|XP_006853270.1|  hypothetical protein AMTR_s00038p00235960          224   2e-68    
ref|XP_007141206.1|  hypothetical protein PHAVU_008G176100g             226   2e-68    
gb|KFK32101.1|  hypothetical protein AALP_AA6G199000                    224   2e-68    
ref|XP_004299652.1|  PREDICTED: uncharacterized protein LOC101296960    224   2e-68    
ref|XP_011074198.1|  PREDICTED: protein EXORDIUM-like                   224   3e-68    
ref|XP_008386106.1|  PREDICTED: uncharacterized protein LOC103448623    224   3e-68    
gb|ABK21569.1|  unknown                                                 224   3e-68    Picea sitchensis
ref|XP_003526573.1|  PREDICTED: uncharacterized protein LOC100793070    224   4e-68    
ref|XP_010267357.1|  PREDICTED: protein EXORDIUM-like                   224   4e-68    
ref|XP_010676117.1|  PREDICTED: protein EXORDIUM-like                   224   4e-68    
gb|ACJ84728.1|  unknown                                                 223   5e-68    Medicago truncatula
ref|XP_002513944.1|  conserved hypothetical protein                     223   5e-68    Ricinus communis
emb|CDP01092.1|  unnamed protein product                                223   6e-68    
ref|XP_003522788.2|  PREDICTED: uncharacterized protein LOC100811449    225   6e-68    
ref|XP_007222578.1|  hypothetical protein PRUPE_ppa008439mg             224   6e-68    
ref|XP_009372924.1|  PREDICTED: uncharacterized protein LOC103961987    223   7e-68    
ref|XP_010676127.1|  PREDICTED: protein EXORDIUM-like                   223   7e-68    
ref|XP_010676103.1|  PREDICTED: protein EXORDIUM-like                   222   2e-67    
gb|ACU19080.1|  unknown                                                 221   3e-67    Glycine max [soybeans]
emb|CBI19186.3|  unnamed protein product                                222   3e-67    
emb|CDY05033.1|  BnaC03g28310D                                          221   3e-67    
ref|XP_010543912.1|  PREDICTED: protein EXORDIUM-like                   221   4e-67    
emb|CDP21256.1|  unnamed protein product                                221   5e-67    
ref|XP_010676090.1|  PREDICTED: protein EXORDIUM-like                   221   6e-67    
ref|XP_009125761.1|  PREDICTED: uncharacterized protein LOC103850725    220   6e-67    
ref|XP_010538937.1|  PREDICTED: protein EXORDIUM-like 1                 220   6e-67    
ref|XP_002525844.1|  conserved hypothetical protein                     219   8e-67    Ricinus communis
ref|XP_004299654.1|  PREDICTED: uncharacterized protein LOC101297541    220   1e-66    
ref|XP_003570605.1|  PREDICTED: protein EXORDIUM-like                   220   1e-66    
ref|XP_011083391.1|  PREDICTED: protein EXORDIUM-like                   221   1e-66    
ref|XP_009125760.1|  PREDICTED: uncharacterized protein LOC103850724    219   1e-66    
ref|XP_010273029.1|  PREDICTED: protein EXORDIUM-like                   219   2e-66    
ref|XP_003526575.1|  PREDICTED: uncharacterized protein LOC100794117    220   2e-66    
ref|XP_003615142.1|  hypothetical protein MTR_5g064340                  230   3e-66    
ref|XP_009387394.1|  PREDICTED: uncharacterized protein LOC103974319    218   3e-66    
ref|XP_009598592.1|  PREDICTED: protein EXORDIUM-like                   219   3e-66    
ref|XP_009406617.1|  PREDICTED: uncharacterized protein LOC103989488    219   3e-66    
gb|ABK21150.1|  unknown                                                 218   4e-66    Picea sitchensis
ref|XP_010939671.1|  PREDICTED: protein EXORDIUM-like 2                 218   4e-66    
ref|XP_010273026.1|  PREDICTED: protein EXORDIUM-like                   219   4e-66    
ref|XP_009380868.1|  PREDICTED: uncharacterized protein LOC103969137    218   4e-66    
ref|XP_002454241.1|  hypothetical protein SORBIDRAFT_04g027360          218   4e-66    Sorghum bicolor [broomcorn]
emb|CDY40722.1|  BnaAnng05850D                                          217   5e-66    
ref|XP_002285761.1|  PREDICTED: protein EXORDIUM-like                   218   5e-66    Vitis vinifera
ref|XP_006647929.1|  PREDICTED: uncharacterized protein LOC102712887    218   6e-66    
ref|XP_002285764.1|  PREDICTED: protein EXORDIUM                        218   7e-66    Vitis vinifera
ref|XP_010098620.1|  hypothetical protein L484_012732                   218   7e-66    
ref|XP_011003048.1|  PREDICTED: LOW QUALITY PROTEIN: protein EXOR...    216   1e-65    
emb|CDP05646.1|  unnamed protein product                                218   1e-65    
ref|XP_003630473.1|  Phi-1 protein                                      217   1e-65    
ref|XP_009134114.1|  PREDICTED: uncharacterized protein LOC103858498    217   2e-65    
emb|CDP01088.1|  unnamed protein product                                217   2e-65    
gb|KEH34956.1|  phosphate-responsive 1 family protein                   218   2e-65    
ref|XP_006397243.1|  hypothetical protein EUTSA_v10029426mg             216   6e-65    
ref|XP_007141202.1|  hypothetical protein PHAVU_008G175700g             215   7e-65    
gb|EPS72394.1|  hypothetical protein M569_02362                         215   8e-65    
ref|XP_002285777.1|  PREDICTED: protein EXORDIUM                        215   9e-65    Vitis vinifera
emb|CAN84160.1|  hypothetical protein VITISV_017171                     215   9e-65    Vitis vinifera
ref|XP_009779727.1|  PREDICTED: protein EXORDIUM-like                   215   9e-65    
ref|XP_006397426.1|  hypothetical protein EUTSA_v10001826mg             214   1e-64    
ref|NP_001149436.1|  phi-1-like phosphate-induced protein precursor     214   1e-64    Zea mays [maize]
ref|XP_006853273.1|  hypothetical protein AMTR_s00038p00236470          214   1e-64    
ref|XP_004500639.1|  PREDICTED: uncharacterized protein LOC101494177    214   1e-64    
gb|ABR17283.1|  unknown                                                 214   2e-64    
ref|XP_009409278.1|  PREDICTED: uncharacterized protein LOC103991516    214   2e-64    
gb|AAG40350.1|AF324998_1  At1g35140                                     211   3e-64    
gb|ACG26284.1|  phi-1-like phosphate-induced protein                    214   4e-64    
ref|XP_004299649.1|  PREDICTED: uncharacterized protein LOC101295714    213   4e-64    
ref|XP_002452520.1|  hypothetical protein SORBIDRAFT_04g027370          214   5e-64    
ref|XP_010267366.1|  PREDICTED: protein EXORDIUM-like 2                 213   5e-64    
ref|XP_008679291.1|  PREDICTED: uncharacterized protein LOC103654240    213   5e-64    
gb|ACF85606.1|  unknown                                                 213   8e-64    
ref|XP_004953973.1|  PREDICTED: uncharacterized protein LOC101756947    213   8e-64    
ref|NP_001182841.1|  uncharacterized protein LOC100501091 precursor     212   9e-64    
ref|XP_004953972.1|  PREDICTED: uncharacterized protein LOC101756271    212   2e-63    
ref|XP_010937410.1|  PREDICTED: protein EXORDIUM-like                   211   4e-63    
ref|NP_174746.1|  protein EXORDIUM LIKE 1                               210   6e-63    
ref|XP_007018743.1|  Phosphate-responsive 1 family protein, putative    210   6e-63    
ref|XP_009341758.1|  PREDICTED: uncharacterized protein LOC103933800    210   9e-63    
ref|XP_010937406.1|  PREDICTED: protein EXORDIUM-like                   209   9e-63    
gb|ACN31305.1|  unknown                                                 210   1e-62    
ref|XP_008808002.1|  PREDICTED: uncharacterized protein LOC103720183    209   1e-62    
ref|XP_009341760.1|  PREDICTED: uncharacterized protein LOC103933802    209   2e-62    
ref|XP_002891160.1|  phosphate-induced 1                                209   2e-62    
ref|XP_009618457.1|  PREDICTED: protein EXORDIUM-like                   208   3e-62    
gb|ABR17786.1|  unknown                                                 210   3e-62    
gb|ABK26415.1|  unknown                                                 209   5e-62    
dbj|BAK06443.1|  predicted protein                                      208   7e-62    
gb|EEC74034.1|  hypothetical protein OsI_08995                          208   7e-62    
gb|AFW73507.1|  phi-1-like phosphate-induced protein                    207   9e-62    
ref|XP_010098618.1|  hypothetical protein L484_012729                   207   1e-61    
ref|XP_009413573.1|  PREDICTED: uncharacterized protein LOC103994855    207   1e-61    
ref|NP_001048171.1|  Os02g0757100                                       207   1e-61    
ref|XP_004237930.1|  PREDICTED: protein EXORDIUM-like                   206   2e-61    
ref|XP_008466221.1|  PREDICTED: uncharacterized protein LOC103503698    206   2e-61    
ref|XP_008219326.1|  PREDICTED: uncharacterized protein LOC103319553    206   2e-61    
ref|XP_010917317.1|  PREDICTED: protein EXORDIUM-like 2                 206   2e-61    
ref|XP_006363277.1|  PREDICTED: uncharacterized protein LOC102581036    206   2e-61    
gb|KGN62699.1|  hypothetical protein Csa_2G369000                       206   3e-61    
ref|XP_008790894.1|  PREDICTED: uncharacterized protein LOC103707943    206   3e-61    
ref|XP_004299653.1|  PREDICTED: uncharacterized protein LOC101297249    206   4e-61    
emb|CDY44799.1|  BnaC02g00880D                                          204   4e-61    
dbj|BAD17079.1|  putative phi-1                                         205   6e-61    
ref|XP_009403075.1|  PREDICTED: uncharacterized protein LOC103986711    205   6e-61    
ref|XP_009380866.1|  PREDICTED: uncharacterized protein LOC103969136    205   7e-61    
ref|NP_001048170.1|  Os02g0756800                                       205   7e-61    
emb|CDY44798.1|  BnaC02g00890D                                          204   7e-61    
ref|XP_004301325.1|  PREDICTED: uncharacterized protein LOC101294953    202   1e-60    
ref|XP_008807999.1|  PREDICTED: uncharacterized protein LOC103720180    204   1e-60    
ref|XP_002438071.1|  hypothetical protein SORBIDRAFT_10g007660          204   1e-60    
ref|XP_002864891.1|  predicted protein                                  203   1e-60    
ref|XP_008808000.1|  PREDICTED: uncharacterized protein LOC103720181    204   2e-60    
ref|XP_006647927.1|  PREDICTED: uncharacterized protein LOC102712054    204   2e-60    
gb|ABK24226.1|  unknown                                                 205   3e-60    
ref|XP_006363313.1|  PREDICTED: uncharacterized protein LOC102592419    203   4e-60    
dbj|BAJ95266.1|  predicted protein                                      202   6e-60    
ref|XP_008444845.1|  PREDICTED: uncharacterized protein LOC103488069    202   8e-60    
gb|KFK23379.1|  hypothetical protein AALP_AAs59400U000100               202   9e-60    
gb|KDP41400.1|  hypothetical protein JCGZ_15807                         202   9e-60    
ref|XP_004964970.1|  PREDICTED: uncharacterized protein LOC101769198    202   1e-59    
ref|XP_010273047.1|  PREDICTED: protein EXORDIUM-like                   201   2e-59    
ref|XP_010937405.1|  PREDICTED: protein EXORDIUM-like 2                 201   2e-59    
ref|XP_010939669.1|  PREDICTED: protein EXORDIUM-like 1                 201   2e-59    
ref|NP_001147643.1|  phi-1-like phosphate-induced protein               201   3e-59    
ref|XP_006305423.1|  hypothetical protein CARUB_v10009822mg             201   3e-59    
ref|XP_004171128.1|  PREDICTED: uncharacterized protein LOC101224428    201   3e-59    
gb|EAZ00182.1|  hypothetical protein OsI_22187                          200   6e-59    
ref|XP_010060025.1|  PREDICTED: protein EXORDIUM-like 2                 199   1e-58    
ref|XP_007222765.1|  hypothetical protein PRUPE_ppa008769mg             199   2e-58    
gb|EAZ36297.1|  hypothetical protein OsJ_20618                          198   2e-58    
ref|XP_010478921.1|  PREDICTED: protein EXORDIUM-like 1                 198   3e-58    
ref|NP_001057166.1|  Os06g0219900                                       198   3e-58    
ref|XP_010480904.1|  PREDICTED: protein EXORDIUM-like 1                 197   3e-58    
gb|ACG47040.1|  PHI-1                                                   198   4e-58    
ref|XP_010500012.1|  PREDICTED: protein EXORDIUM-like 1                 197   5e-58    
gb|EPS72395.1|  hypothetical protein M569_02363                         196   5e-58    
ref|XP_003570606.1|  PREDICTED: protein EXORDIUM-like                   197   7e-58    
ref|XP_008649246.1|  PREDICTED: uncharacterized protein LOC103629921    197   1e-57    
ref|XP_004152632.1|  PREDICTED: uncharacterized protein LOC101221347    195   1e-57    
ref|NP_001150825.1|  PHI-1 precursor                                    196   2e-57    
ref|XP_004136283.1|  PREDICTED: uncharacterized protein LOC101211963    196   2e-57    
ref|XP_004953970.1|  PREDICTED: uncharacterized protein LOC101755456    196   2e-57    
dbj|BAJ95912.1|  predicted protein                                      196   3e-57    
dbj|BAD17075.1|  putative phi-1                                         195   3e-57    
gb|ABK26758.1|  unknown                                                 196   3e-57    
ref|NP_001048167.1|  Os02g0756200                                       195   4e-57    
ref|NP_001169340.1|  uncharacterized protein LOC100383207 precursor     195   5e-57    
gb|EEE65344.1|  hypothetical protein OsJ_20619                          194   5e-57    
ref|XP_004973743.1|  PREDICTED: uncharacterized protein LOC101762492    195   5e-57    
ref|XP_010676149.1|  PREDICTED: protein EXORDIUM-like                   194   9e-57    
gb|EAY87583.1|  hypothetical protein OsI_08993                          194   1e-56    
gb|EMT27499.1|  hypothetical protein F775_06310                         194   1e-56    
ref|XP_009393640.1|  PREDICTED: uncharacterized protein LOC103979284    193   1e-56    
ref|XP_010461288.1|  PREDICTED: protein EXORDIUM-like 1                 194   1e-56    
gb|EAZ07406.1|  hypothetical protein OsI_29657                          194   3e-56    
emb|CBI19185.3|  unnamed protein product                                193   5e-56    
ref|XP_002513940.1|  conserved hypothetical protein                     192   5e-56    
ref|XP_008386295.1|  PREDICTED: uncharacterized protein LOC103448808    192   6e-56    
gb|EAZ00184.1|  hypothetical protein OsI_22188                          192   6e-56    
ref|XP_003572314.1|  PREDICTED: protein EXORDIUM-like 2                 192   8e-56    
ref|XP_004953971.1|  PREDICTED: uncharacterized protein LOC101755869    192   1e-55    
ref|XP_003573070.1|  PREDICTED: protein EXORDIUM-like                   191   2e-55    
dbj|BAD37247.1|  putative phi-1                                         190   5e-55    
dbj|BAD37242.1|  putative phi-1                                         188   4e-54    
ref|XP_004964973.1|  PREDICTED: uncharacterized protein LOC101770417    186   1e-53    
gb|EEE57838.1|  hypothetical protein OsJ_08447                          185   2e-53    
ref|XP_004964972.1|  PREDICTED: uncharacterized protein LOC101770010    186   3e-53    
ref|XP_009413186.1|  PREDICTED: uncharacterized protein LOC103994551    185   3e-53    
ref|XP_008804763.1|  PREDICTED: uncharacterized protein LOC103717957    185   4e-53    
ref|XP_006386410.1|  hypothetical protein POPTR_0002s09900g             183   7e-53    
ref|XP_010236099.1|  PREDICTED: protein EXORDIUM-like                   184   7e-53    
gb|AFW76755.1|  hypothetical protein ZEAMMB73_322122                    184   1e-52    
ref|NP_001048169.1|  Os02g0756600                                       183   2e-52    
dbj|BAJ96606.1|  predicted protein                                      182   5e-52    
gb|EMT27500.1|  hypothetical protein F775_13137                         182   7e-52    
ref|XP_008466213.1|  PREDICTED: uncharacterized protein LOC103503693    182   1e-51    
ref|XP_008219323.1|  PREDICTED: uncharacterized protein LOC103319549    180   3e-51    
ref|XP_002444839.1|  hypothetical protein SORBIDRAFT_07g029050          178   2e-50    
ref|NP_001057167.1|  Os06g0220000                                       177   2e-50    
ref|XP_004136282.1|  PREDICTED: uncharacterized protein LOC101211728    177   4e-50    
ref|XP_004169035.1|  PREDICTED: uncharacterized LOC101211728            177   5e-50    
ref|XP_006647928.1|  PREDICTED: uncharacterized protein LOC102712333    175   2e-49    
ref|XP_004964971.1|  PREDICTED: uncharacterized protein LOC101769607    176   3e-49    
ref|XP_006854039.1|  hypothetical protein AMTR_s00048p00063790          175   3e-49    
ref|XP_002452522.1|  hypothetical protein SORBIDRAFT_04g027390          174   3e-49    
ref|XP_002452521.1|  hypothetical protein SORBIDRAFT_04g027380          174   9e-49    
ref|XP_008646290.1|  PREDICTED: uncharacterized protein LOC103627762    172   2e-48    
ref|XP_004983214.1|  PREDICTED: uncharacterized protein LOC101764457    172   5e-48    
ref|XP_008659107.1|  PREDICTED: uncharacterized protein LOC103637861    172   7e-48    
ref|XP_003564073.1|  PREDICTED: protein EXORDIUM-like                   172   9e-48    
ref|XP_008644882.1|  PREDICTED: uncharacterized protein LOC103626267    172   2e-47    
ref|XP_006433959.1|  hypothetical protein CICLE_v10003257mg             167   2e-47    
gb|ACJ84530.1|  unknown                                                 165   3e-47    
ref|XP_002436727.1|  hypothetical protein SORBIDRAFT_10g007690          169   9e-47    
gb|KHN08947.1|  hypothetical protein glysoja_021769                     167   2e-46    
gb|EEC80242.1|  hypothetical protein OsI_22189                          167   3e-46    
ref|XP_004966802.1|  PREDICTED: uncharacterized protein LOC101782830    167   3e-46    
ref|XP_002489237.1|  hypothetical protein SORBIDRAFT_0012s005000        167   4e-46    
ref|XP_002301064.2|  hypothetical protein POPTR_0002s09910g             162   2e-45    
ref|XP_003560907.1|  PREDICTED: protein EXORDIUM-like 1                 160   2e-43    
ref|XP_002967348.1|  hypothetical protein SELMODRAFT_87913              159   3e-43    
ref|XP_006656788.1|  PREDICTED: uncharacterized protein LOC102700349    160   3e-43    
ref|XP_002960368.1|  hypothetical protein SELMODRAFT_229905             158   5e-43    
ref|XP_002960292.1|  hypothetical protein SELMODRAFT_402451             157   2e-42    
ref|XP_007226790.1|  hypothetical protein PRUPE_ppa017967mg             155   3e-42    
gb|AAU84435.1|  putative phi-1-like phosphate-induced protein           155   5e-42    
ref|XP_002967421.1|  hypothetical protein SELMODRAFT_87388              155   1e-41    
gb|AAM08535.1|AC079935_7  Putative protein with similarity to phi-1     155   1e-41    
ref|XP_001752677.1|  predicted protein                                  154   2e-41    
ref|XP_002983950.1|  hypothetical protein SELMODRAFT_156322             154   2e-41    
ref|XP_002960721.1|  hypothetical protein SELMODRAFT_75490              154   3e-41    
ref|XP_002967422.1|  hypothetical protein SELMODRAFT_408423             154   4e-41    
ref|XP_001762725.1|  predicted protein                                  152   2e-40    
gb|EYU36489.1|  hypothetical protein MIMGU_mgv11b020575mg               148   2e-40    
ref|NP_001057169.1|  Os06g0220300                                       150   4e-40    
dbj|BAD37666.1|  putative phi-1                                         150   7e-40    
emb|CAJ13706.1|  Phi-1 protein                                          146   1e-39    
ref|XP_006841666.1|  hypothetical protein AMTR_s00003p00242450          149   2e-39    
ref|XP_001754405.1|  predicted protein                                  149   3e-39    
gb|ABR17880.1|  unknown                                                 147   3e-38    
gb|ABK22366.1|  unknown                                                 143   3e-38    
ref|XP_001767660.1|  predicted protein                                  145   5e-38    
gb|KHN19778.1|  hypothetical protein glysoja_024879                     142   3e-37    
gb|EEE65345.1|  hypothetical protein OsJ_20620                          143   4e-37    
ref|XP_001759019.1|  predicted protein                                  141   1e-36    
emb|CBI19184.3|  unnamed protein product                                137   1e-36    
ref|XP_001785374.1|  predicted protein                                  140   2e-36    
ref|XP_001774902.1|  predicted protein                                  141   3e-36    
ref|XP_001763033.1|  predicted protein                                  139   6e-36    
ref|XP_009780900.1|  PREDICTED: protein EXORDIUM-like                   136   2e-35    
ref|XP_002273753.1|  PREDICTED: protein EXORDIUM-like 1                 137   4e-35    
ref|XP_010276870.1|  PREDICTED: protein EXORDIUM-like 2                 136   1e-34    
ref|XP_006656785.1|  PREDICTED: uncharacterized protein LOC102699515    135   3e-34    
gb|EEE65346.1|  hypothetical protein OsJ_20621                          135   3e-34    
ref|XP_002319256.1|  phosphate-responsive 1 family protein              135   3e-34    
ref|XP_002438072.1|  hypothetical protein SORBIDRAFT_10g007670          136   4e-34    
emb|CBI19183.3|  unnamed protein product                                132   5e-34    
ref|XP_001774357.1|  predicted protein                                  134   6e-34    
ref|XP_002272941.1|  PREDICTED: protein EXORDIUM-like 2                 134   1e-33    
ref|XP_002960293.1|  hypothetical protein SELMODRAFT_229886             132   2e-33    
gb|AHL69787.1|  hypothetical protein                                    128   2e-33    
ref|XP_001772443.1|  predicted protein                                  132   2e-33    
ref|XP_010276873.1|  PREDICTED: protein EXORDIUM-like 3                 133   3e-33    
gb|KDO81007.1|  hypothetical protein CISIN_1g045506mg                   128   5e-33    
ref|XP_009414140.1|  PREDICTED: uncharacterized protein LOC103995304    131   7e-33    
ref|XP_002301063.2|  hypothetical protein POPTR_0002s09890g             129   1e-32    
ref|XP_006841667.1|  hypothetical protein AMTR_s00003p00242490          131   2e-32    
ref|XP_010250255.1|  PREDICTED: protein EXORDIUM-like 2                 130   2e-32    
gb|AFG46260.1|  hypothetical protein 2_4863_01                          125   2e-32    
ref|XP_010247385.1|  PREDICTED: protein EXORDIUM-like 2                 130   2e-32    
ref|XP_010558624.1|  PREDICTED: protein EXORDIUM-like 6                 130   5e-32    
emb|CDP01091.1|  unnamed protein product                                125   6e-32    
ref|XP_010245464.1|  PREDICTED: protein EXORDIUM-like 2                 129   6e-32    
gb|AFG63569.1|  hypothetical protein 0_562_01                           124   8e-32    
gb|KHN42562.1|  hypothetical protein glysoja_042420                     128   1e-31    
emb|CDP01090.1|  unnamed protein product                                125   1e-31    
gb|ABK93521.1|  unknown                                                 128   1e-31    
ref|XP_010034938.1|  PREDICTED: protein EXORDIUM-like 2                 128   1e-31    
ref|XP_001778759.1|  predicted protein                                  127   1e-31    
ref|XP_002523132.1|  conserved hypothetical protein                     128   2e-31    
ref|XP_001770346.1|  predicted protein                                  128   2e-31    
ref|XP_002318280.2|  hypothetical protein POPTR_0012s14490g             128   2e-31    
ref|XP_009391859.1|  PREDICTED: uncharacterized protein LOC103977925    129   2e-31    
gb|AFG63570.1|  hypothetical protein 0_562_01                           123   2e-31    
ref|XP_002972612.1|  hypothetical protein SELMODRAFT_172930             127   2e-31    
ref|XP_011029968.1|  PREDICTED: protein EXORDIUM-like 3                 128   3e-31    
ref|XP_003534418.1|  PREDICTED: uncharacterized protein LOC100778428    127   5e-31    
gb|KDP28203.1|  hypothetical protein JCGZ_13974                         127   5e-31    
ref|XP_008465856.1|  PREDICTED: uncharacterized protein LOC103503448    126   6e-31    
ref|XP_010103414.1|  hypothetical protein L484_007483                   126   8e-31    
gb|KHG05849.1|  hypothetical protein F383_32344                         127   8e-31    
ref|XP_001767188.1|  predicted protein                                  126   8e-31    
ref|XP_007051014.1|  EXORDIUM like 2                                    126   9e-31    
ref|XP_007131327.1|  hypothetical protein PHAVU_011G004400g             127   9e-31    
gb|KGN60488.1|  hypothetical protein Csa_3G915170                       125   1e-30    
ref|XP_008376450.1|  PREDICTED: uncharacterized protein LOC103439652    126   1e-30    
ref|XP_004148375.1|  PREDICTED: uncharacterized protein LOC101213615    125   1e-30    
ref|XP_009399577.1|  PREDICTED: uncharacterized protein LOC103983940    126   2e-30    
gb|AFG63573.1|  hypothetical protein 0_562_01                           120   2e-30    
ref|XP_009759532.1|  PREDICTED: protein EXORDIUM-like                   122   3e-30    
gb|AFK43637.1|  unknown                                                 125   3e-30    
ref|XP_004148130.1|  PREDICTED: uncharacterized protein LOC101209305    125   4e-30    
ref|XP_007038432.1|  EXORDIUM like 3                                    124   5e-30    
gb|AAK15505.1|AF325723_1  phosphate-induced protein 1-like protein      124   5e-30    



>emb|CDP20628.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -1

Query  597  IPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP  418
            I EP+   LV++ P+VL+YH G LLKG ITVNLIWYGKFTPTQRSIIVDFL+SL +  A 
Sbjct  24   ISEPASAALVQQQPLVLQYHNGILLKGKITVNLIWYGKFTPTQRSIIVDFLQSLNSPRAA  83

Query  417  TPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
            +PS  SWW TTEKYKGGG ST+V+GKQIL+EN SLGK LK+  +V LA++GG+  G +NV
Sbjct  84   SPSAASWWMTTEKYKGGGASTLVVGKQILDENYSLGKMLKNSNLVYLAARGGHMAGSINV  143

Query  237  VLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            VLT  DV VDGFC RCG+HGST G  + AYAWVGNSETQCPGQCAWPFH+P+ GPQTPPL
Sbjct  144  VLTSADVYVDGFCSRCGTHGSTRGPARFAYAWVGNSETQCPGQCAWPFHQPLYGPQTPPL  203

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPNGDVG+DGM+INLATV
Sbjct  204  VAPNGDVGVDGMVINLATV  222



>ref|NP_001275303.1| erg-1 precursor [Solanum tuberosum]
 gb|AAP42136.1| erg-1 [Solanum tuberosum]
Length=301

 Score =   299 bits (766),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRSIIVDFL+SL +  AP PS 
Sbjct  27   SMAALVQEQPLVLKYHNGALLKGTVTVNLIWYGKFTPIQRSIIVDFLQSLNSPKAPNPSA  86

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWWKTTEKYK G  ST+ +GKQIL+ENCSLGK+LK+  IV LASKGG     VN+VLT 
Sbjct  87   ASWWKTTEKYKTGA-STVTLGKQILDENCSLGKSLKNSHIVYLASKGGYMGRSVNLVLTA  145

Query  225  KDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPN  46
            KDV V+GFC RCGSHGST G+ +  YAWVGNSETQC GQCAWPFH+PI GPQTPPL+APN
Sbjct  146  KDVFVEGFCSRCGSHGSTRGKVRFTYAWVGNSETQCAGQCAWPFHQPIYGPQTPPLLAPN  205

Query  45   GDVGIDGMIINLATV  1
            GDVG+DGMIIN+ATV
Sbjct  206  GDVGVDGMIINVATV  220



>ref|XP_004230631.1| PREDICTED: protein EXORDIUM-like 2 [Solanum lycopersicum]
Length=301

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LLKG++TVNL+WYGKFTP QRSIIVDFL+SL +  AP PS 
Sbjct  27   SMAALVQEQPLVLKYHNGALLKGTVTVNLVWYGKFTPAQRSIIVDFLQSLNSPKAPNPSA  86

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWWKTTEKYK G  ST+ +GKQIL+ENCSLGK+LK+  IV LASKGG     VN+VLT 
Sbjct  87   ASWWKTTEKYKTGA-STVTLGKQILDENCSLGKSLKNSHIVYLASKGGYMGRSVNLVLTA  145

Query  225  KDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPN  46
            KDV V+GFC RCGSHGST G+ +  YAWVGNSE QC GQCAWPFH+PI GPQTPPLVAPN
Sbjct  146  KDVFVEGFCSRCGSHGSTRGKVRFTYAWVGNSEIQCAGQCAWPFHQPIYGPQTPPLVAPN  205

Query  45   GDVGIDGMIINLATV  1
            GDVG+DGMIIN+ATV
Sbjct  206  GDVGVDGMIINVATV  220



>ref|XP_011087905.1| PREDICTED: protein EXORDIUM-like 2 [Sesamum indicum]
Length=304

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 163/197 (83%), Gaps = 2/197 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LLKG+ITVNLIWYGKFTP QRSIIVDFL+SL +     PSV
Sbjct  27   SMAALVQEQPLVLKYHNGALLKGTITVNLIWYGKFTPIQRSIIVDFLQSLNSPLPHQPSV  86

Query  405  ESWWKTTEKYKGGG-PSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             SWWKTTEKYKGG   ST+V+GKQ L+EN SLGK+LK+  IV LA+KGG++ G VNVVLT
Sbjct  87   SSWWKTTEKYKGGARSSTLVVGKQFLDENYSLGKSLKNSHIVYLAAKGGHSSGAVNVVLT  146

Query  228  DKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
             KDV+VDGFC  RCGSHGST G  + AYAWVGNSET+CPG CAWPFH+P+ GPQTPPLVA
Sbjct  147  AKDVAVDGFCMNRCGSHGSTRGVNRFAYAWVGNSETECPGYCAWPFHQPLYGPQTPPLVA  206

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVG+DGM+IN+A V
Sbjct  207  PNGDVGVDGMVINIAAV  223



>ref|XP_009760896.1| PREDICTED: protein EXORDIUM-like 2 [Nicotiana sylvestris]
Length=302

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 2/196 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LVKE P+VL+YH G LLKG+ITVNLIWYGKFTP QRSIIVDFL+SL +  AP PS 
Sbjct  27   SMAALVKEQPLVLKYHNGALLKGTITVNLIWYGKFTPIQRSIIVDFLQSLNSPKAPLPSA  86

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWWKTTEKYK G  ST+++GKQIL+EN SLGK+LK+  IV LASKGG+    VN+VLT 
Sbjct  87   ASWWKTTEKYKTGA-STLIVGKQILDENYSLGKSLKNSHIVYLASKGGHMGRSVNLVLTA  145

Query  225  KDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            KDV V+GFC  RCG+HGST G+ + AYAWVGNSETQC GQCAWPFH+PI GPQ+PPLVAP
Sbjct  146  KDVFVEGFCMSRCGTHGSTRGKIRFAYAWVGNSETQCAGQCAWPFHQPIYGPQSPPLVAP  205

Query  48   NGDVGIDGMIINLATV  1
            NGDVG+DGMIIN+ATV
Sbjct  206  NGDVGVDGMIINVATV  221



>dbj|BAG16530.1| putative phosphate-induced protein [Capsicum chinense]
Length=298

 Score =   294 bits (753),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRSIIVDFL+SL +  AP+PS 
Sbjct  23   SMAALVQEQPLVLKYHNGALLKGTVTVNLIWYGKFTPIQRSIIVDFLQSLSSPKAPSPSA  82

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWWKTTEKY+ G  ST+++GKQIL+EN SLGK+LK+  IV LA+KGG T   VN+VLT 
Sbjct  83   ASWWKTTEKYETGA-STLILGKQILDENYSLGKSLKNSHIVYLAAKGGYTGRSVNLVLTA  141

Query  225  KDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            KDV V+GFC  RCG+HGS+ G+ + AYAWVGNSETQCPGQCAWPFH+PI GPQ+PPLVAP
Sbjct  142  KDVFVEGFCMSRCGTHGSSRGKIRFAYAWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAP  201

Query  48   NGDVGIDGMIINLATV  1
            NGDVG+DGMIIN+ATV
Sbjct  202  NGDVGVDGMIINVATV  217



>ref|XP_011092430.1| PREDICTED: protein EXORDIUM-like 2 [Sesamum indicum]
Length=304

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV++ P+VL+YH G LLKG++TVNLIWYGKFTP QRS+IVDFL+SL +     PSV
Sbjct  27   SMAALVQQQPLVLKYHNGLLLKGTVTVNLIWYGKFTPVQRSVIVDFLQSLNSPATARPSV  86

Query  405  ESWWKTTEKYKGG-GPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             SWWKTTE YKGG G S IV+GKQ L+EN SLGK+LK+  IV LA+KGG++ G VNVVLT
Sbjct  87   SSWWKTTENYKGGSGSSAIVVGKQFLDENYSLGKSLKNSHIVYLAAKGGHSGGAVNVVLT  146

Query  228  DKDVSVDGFCKR-CGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
             KDV+VDGFC+  CGSHGST G  + AYAWVGNSETQCPG CAWPFH+P+ GPQTPPLV 
Sbjct  147  AKDVAVDGFCRSSCGSHGSTRGPARFAYAWVGNSETQCPGYCAWPFHQPLYGPQTPPLVP  206

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVG+DGM+INLATV
Sbjct  207  PNGDVGVDGMVINLATV  223



>ref|XP_009606160.1| PREDICTED: protein EXORDIUM-like 2 [Nicotiana tomentosiformis]
Length=302

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LVKE P+VL+YH G LLKG+ITVNLIWYGKFTP QRSIIVDFL+SL +  +P PS 
Sbjct  27   SMAALVKEQPLVLKYHNGALLKGTITVNLIWYGKFTPIQRSIIVDFLQSLNSPKSPLPSA  86

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWWKTTEKYK G  ST+++GKQIL+E  SLGK+LK+  IV LASKGG+    VN+VLT 
Sbjct  87   ASWWKTTEKYKTGA-STLIVGKQILDEKYSLGKSLKNSHIVYLASKGGHMGRSVNLVLTA  145

Query  225  KDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            KDV V+GFC  RCG+HGST G+ + AYAWVGNSETQC GQCAWPF++PI GPQTPPLVAP
Sbjct  146  KDVFVEGFCMSRCGTHGSTRGKIRFAYAWVGNSETQCAGQCAWPFYQPIYGPQTPPLVAP  205

Query  48   NGDVGIDGMIINLATV  1
            NGDVG+DGMIIN+ATV
Sbjct  206  NGDVGVDGMIINVATV  221



>gb|KDP40915.1| hypothetical protein JCGZ_24914 [Jatropha curcas]
Length=296

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 161/211 (76%), Gaps = 6/211 (3%)
 Frame = -1

Query  630  AVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVD  451
            A+ LLFCF+     P F  +V+E P+VL+YH G LLKG++TVNLIWYG+F+P QRSIIVD
Sbjct  10   AILLLFCFIT----PLFSAVVEEQPLVLKYHNGVLLKGNVTVNLIWYGQFSPAQRSIIVD  65

Query  450  FLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS  271
            F+ SL +  AP PS  +WW+TTEKY+GG  ST+ +G QIL E  +LGK LK   ++ LAS
Sbjct  66   FINSLSSKRAPVPSAATWWQTTEKYRGGS-STLKVGHQILHEQYTLGKILKTSHLLALAS  124

Query  270  KGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPF  94
            K       +NVVLT KDV+VD FC  RCG+HGS+ G  +  Y WVGNSETQCPGQCAWPF
Sbjct  125  KTNFAMDSINVVLTSKDVAVDRFCMSRCGTHGSSRGSAKGTYIWVGNSETQCPGQCAWPF  184

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  185  HQPIYGPQTPPLVAPNGDVGVDGMIINLATL  215



>ref|XP_002298705.2| phosphate-responsive family protein [Populus trichocarpa]
 gb|EEE83510.2| phosphate-responsive family protein [Populus trichocarpa]
Length=296

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            + +A LFCF++    PS   LV+E P+VL+YH G LLKG+ITVNLIWYG+FTP QRSIIV
Sbjct  8    ATLAFLFCFIS----PSLSALVQEQPLVLKYHNGILLKGNITVNLIWYGEFTPIQRSIIV  63

Query  453  DFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
            DF+ SL +  AP PS  SWWKTTE Y+GG  S++ +G QIL E  +LGK LK   ++ LA
Sbjct  64   DFINSLNSKGAPLPSTSSWWKTTEMYRGGS-SSLTVGHQILHEELTLGKILKSQHLIALA  122

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAW  100
            SK   T   +NVVLT KDV+VDGFC  RCG+HGST +G  +  Y WVGNS+ QCPGQCAW
Sbjct  123  SKTHFTVNSINVVLTAKDVAVDGFCMNRCGTHGSTKSGSGRGTYIWVGNSDVQCPGQCAW  182

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PFH+P+ GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  183  PFHQPLYGPQTPPLVAPNGDVGVDGMIINLATL  215



>ref|XP_011043114.1| PREDICTED: protein EXORDIUM-like 2 [Populus euphratica]
Length=296

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 164/223 (74%), Gaps = 10/223 (4%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGK  484
            MA   N AT   +A L CFLA    PSF  LV+E P+VL+YH G LLKG+ITVNLIWYG+
Sbjct  1    MAFNYNLAT---LAFLLCFLA----PSFAALVQEQPLVLKYHNGILLKGNITVNLIWYGQ  53

Query  483  FTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKT  304
            FTP QRSIIVDF+ SL +  AP PS  SWWKTTEKY+GG  S++ +G QIL E  +LGK 
Sbjct  54   FTPIQRSIIVDFINSLNSKGAPLPSTSSWWKTTEKYRGGS-SSLSVGHQILHEEYTLGKI  112

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK-QVAYAWVGNS  130
            LK   ++ LASK       +NVVLT KDV VDGFC  RCG+HGST     +  Y WVGNS
Sbjct  113  LKSQHLIALASKTHFAVSSINVVLTAKDVVVDGFCMSRCGTHGSTKSRSGRGTYIWVGNS  172

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            + QCPGQCAWPFH+PI GPQTPPL+APNGDVG+DGM+INLAT+
Sbjct  173  DLQCPGQCAWPFHQPIYGPQTPPLIAPNGDVGVDGMVINLATL  215



>gb|EYU39128.1| hypothetical protein MIMGU_mgv1a026379mg [Erythranthe guttata]
Length=304

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 158/195 (81%), Gaps = 5/195 (3%)
 Frame = -1

Query  570  VKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWK  391
            V++PP+VL+YH G LLKG++ VNLIWYGKFT  QRS+IVDFL+SL +   P PSV SWWK
Sbjct  29   VQQPPLVLKYHNGALLKGTVAVNLIWYGKFTAVQRSVIVDFLQSLTSTKPPQPSVASWWK  88

Query  390  TTEKYKGG-GPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            TT KYKGG G S +V+GKQ L+E+ SLGK+LK+  IV LA+KGG + G VNV+LT +DV+
Sbjct  89   TTAKYKGGAGASAVVVGKQFLDESYSLGKSLKNPHIVYLAAKGGRSGGAVNVILTAEDVA  148

Query  213  VDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPN  46
            V+GFC  RCGSHGS+ G     + AYAWVGNS  QCPG CAWPFH+P+ GPQTPPLVAPN
Sbjct  149  VEGFCMSRCGSHGSSRGAAPGGRFAYAWVGNSGRQCPGYCAWPFHQPLYGPQTPPLVAPN  208

Query  45   GDVGIDGMIINLATV  1
            GDVG+DGM+INLATV
Sbjct  209  GDVGVDGMVINLATV  223



>ref|XP_011003866.1| PREDICTED: protein EXORDIUM-like 2 [Populus euphratica]
Length=296

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 162/211 (77%), Gaps = 7/211 (3%)
 Frame = -1

Query  627  VALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDF  448
            +A LFCF++    PS   LV+E P+VL+YH G LLKG+ITVNLIWYG+FTP QRSIIVDF
Sbjct  10   LAFLFCFIS----PSLSALVQEQPLVLKYHNGILLKGNITVNLIWYGEFTPIQRSIIVDF  65

Query  447  LESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK  268
            + SL +  AP P+  SWWKTTE Y+GG  S++ +G QIL E  +LGK LK   ++ LASK
Sbjct  66   INSLNSKGAPLPATSSWWKTTEMYRGGS-SSLTVGHQILHEELTLGKILKSQHLIALASK  124

Query  267  GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAWPF  94
               T   +NVVLT KDV+VDGFC  RCG+HGST +G  +  Y WVGNS+ QCPGQCAWPF
Sbjct  125  THFTVNAINVVLTAKDVAVDGFCMNRCGTHGSTKSGSGRGTYIWVGNSDLQCPGQCAWPF  184

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+P+ GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  185  HQPLYGPQTPPLVAPNGDVGVDGMIINLATL  215



>ref|XP_002323973.2| hypothetical protein POPTR_0017s07860g [Populus trichocarpa]
 gb|EEF04106.2| hypothetical protein POPTR_0017s07860g [Populus trichocarpa]
Length=296

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            + +A L CFLA    PSF  LV+E P+VL+YH G LLKG+ITVNLIWYG+FTP QRSIIV
Sbjct  8    TTLAFLLCFLA----PSFAALVQEQPLVLKYHNGILLKGNITVNLIWYGQFTPIQRSIIV  63

Query  453  DFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
            DF+ SL +  AP PS  SWWKTTEKY+GG  S++ +G QIL E  +LGK LK   ++ LA
Sbjct  64   DFINSLNSKGAPLPSTSSWWKTTEKYRGGS-SSLSVGHQILHEEYTLGKILKSQHLIALA  122

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAW  100
            SK       +NVVLT KDV VDGFC  +CG+HGST +G  +  Y WVGNS+ QCPGQCAW
Sbjct  123  SKTHFAVSSINVVLTAKDVVVDGFCMSKCGTHGSTKSGSGRGTYIWVGNSDLQCPGQCAW  182

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PFH+PI GPQTPPL+APNGDVG+DGM+INLAT+
Sbjct  183  PFHQPIYGPQTPPLIAPNGDVGVDGMVINLATL  215



>gb|ABK96539.1| unknown [Populus trichocarpa x Populus deltoides]
Length=296

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            + +A L CFLA    PSF  LV+E P+VL+YH G LLKG+ITVNLIWYG+FTP QRSIIV
Sbjct  8    TTLAFLLCFLA----PSFAALVQEQPLVLKYHNGILLKGNITVNLIWYGQFTPIQRSIIV  63

Query  453  DFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
            DF+ SL +  AP PS  SWWKTTEKY+GG  S++ +G QIL E  +LGK LK   ++ LA
Sbjct  64   DFINSLNSKGAPLPSTSSWWKTTEKYRGGS-SSLSVGHQILHEEYTLGKILKSQHLIALA  122

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAW  100
            SK       +NVVLT KDV VDGFC  +CG+HGST +G  +  Y WVGNS+ QCPGQCAW
Sbjct  123  SKTHFAVSSINVVLTAKDVVVDGFCMSKCGTHGSTNSGSGRGTYIWVGNSDLQCPGQCAW  182

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PFH+PI GPQTPPL+APNGDVG+DGM+INLAT+
Sbjct  183  PFHQPIYGPQTPPLIAPNGDVGVDGMVINLATL  215



>ref|XP_008373268.1| PREDICTED: uncharacterized protein LOC103436601 [Malus domestica]
Length=293

 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = -1

Query  597  IPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP  418
            + +PSFG LV+E P+VL+YH G LLKG+I VNLIWYG FTP QRSIIVDF+ SL    +P
Sbjct  17   VAKPSFGALVEEQPLVLKYHNGALLKGNIPVNLIWYGSFTPIQRSIIVDFIHSLAPRRSP  76

Query  417  TPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
             PS  SWWKTTEKY+GG  + +++G+QIL E  SLGK+L++  +V LA K  N    +NV
Sbjct  77   LPSASSWWKTTEKYRGGA-TNLLVGRQILHEAYSLGKSLRNRHLVALAGK-VNALNAINV  134

Query  237  VLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            VLT  DV+VDGFC RCG+HGS   +K+ AY WVGNS  QCPGQCAWPFH+PI GPQTPPL
Sbjct  135  VLTASDVAVDGFCSRCGTHGSNR-DKKTAYVWVGNSVVQCPGQCAWPFHQPIYGPQTPPL  193

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPNGDVG+DGMIINLAT+
Sbjct  194  VAPNGDVGVDGMIINLATL  212



>ref|XP_009344591.1| PREDICTED: uncharacterized protein LOC103936476 [Pyrus x bretschneideri]
Length=293

 Score =   276 bits (705),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = -1

Query  597  IPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP  418
            + +P FG LV+E P+VL+YH G LLKG+ITVNLIWYG FTP QRSIIVDF+ SL    +P
Sbjct  17   VAKPGFGALVEEQPLVLKYHNGALLKGNITVNLIWYGSFTPIQRSIIVDFIHSLAPRRSP  76

Query  417  TPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
             PS  SWWKTTEKY+GG  + +V+G+QIL E  SLGK+L++  +V LA K  N    +NV
Sbjct  77   LPSASSWWKTTEKYRGGA-TNLVVGRQILHEAYSLGKSLRNRHLVALAGK-VNALNAINV  134

Query  237  VLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            VLT  DV VDGFC RCG+HGS   +K+ AY WVGNS  QCPGQCAWPFH+PI GPQTPPL
Sbjct  135  VLTASDVVVDGFCSRCGTHGSNR-DKKTAYVWVGNSVVQCPGQCAWPFHQPIYGPQTPPL  193

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPNGDVG+DGMIIN+AT+
Sbjct  194  VAPNGDVGVDGMIINIATL  212



>ref|XP_008382034.1| PREDICTED: uncharacterized protein LOC103444863 [Malus domestica]
Length=293

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 153/197 (78%), Gaps = 3/197 (2%)
 Frame = -1

Query  591  EPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTP  412
            EP  G LV+E P+VL+YH G LLKG+ITVNLIWYG FTP QRSIIVDF+ SL     P P
Sbjct  19   EPGLGALVEEQPLVLKYHNGALLKGNITVNLIWYGHFTPIQRSIIVDFIHSLAPRRGPLP  78

Query  411  SVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            S  SWWKTTEKYKGG  S +V+G+QIL E  SLGK+L +  +V LA K  N    +NVVL
Sbjct  79   SASSWWKTTEKYKGGA-SNLVVGRQILHEAYSLGKSLGNRHLVALAGK-VNALKAINVVL  136

Query  231  TDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            T  DV+VDGFC RCG+HGS A +K+ AY WVGNS  QCPGQCAWPFH+PI GPQTPPLVA
Sbjct  137  TASDVAVDGFCSRCGTHGS-ARDKKSAYVWVGNSVVQCPGQCAWPFHQPIYGPQTPPLVA  195

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVG+DGMIINLAT+
Sbjct  196  PNGDVGVDGMIINLATL  212



>ref|XP_006433956.1| hypothetical protein CICLE_v10001970mg [Citrus clementina]
 gb|ESR47196.1| hypothetical protein CICLE_v10001970mg [Citrus clementina]
Length=303

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            L ++ P+VL+YH G LL G++TVNL+WYGKF+P QRSI+VDFL+SL +   P PSV SWW
Sbjct  31   LAEQHPLVLKYHNGQLLNGNVTVNLVWYGKFSPIQRSIVVDFLKSLSSAKTPPPSVSSWW  90

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTE YKGG P ++V G Q+L+EN SLGK+LK  Q++ LASK G     VNVVLT  DV 
Sbjct  91   QTTEAYKGG-PRSVVAGNQVLDENYSLGKSLKTPQVISLASKAGIKNNAVNVVLTSSDVV  149

Query  213  VDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            VDGFC  RCG+HG+  + E + AYAWVGNSE+QCPGQCAWPFH+PI GPQTPPLVAPNGD
Sbjct  150  VDGFCMSRCGTHGAGRSKESKFAYAWVGNSESQCPGQCAWPFHQPIYGPQTPPLVAPNGD  209

Query  39   VGIDGMIINLATV  1
            VG+DGMIINLATV
Sbjct  210  VGVDGMIINLATV  222



>ref|XP_006472580.1| PREDICTED: uncharacterized protein LOC102624853 [Citrus sinensis]
Length=303

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            L ++ P+VL+YH G LL G++TVNL+WYGKF+P QRSI+VDFL+SL +   P PSV SWW
Sbjct  31   LAEQHPLVLKYHNGQLLNGNVTVNLVWYGKFSPIQRSIVVDFLKSLSSARTPPPSVSSWW  90

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTE YKGG P ++V G Q+L+EN SLGK+LK  Q++ LASK G     VNVVLT  DV 
Sbjct  91   QTTEAYKGG-PRSVVAGNQVLDENYSLGKSLKTPQVISLASKAGIKNNAVNVVLTSSDVV  149

Query  213  VDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            VDGFC  RCG+HG+  + E + AYAWVGNSE+QCPGQCAWPFH+PI GPQTPPLVAPNGD
Sbjct  150  VDGFCMSRCGTHGAGRSKESKFAYAWVGNSESQCPGQCAWPFHQPIYGPQTPPLVAPNGD  209

Query  39   VGIDGMIINLATV  1
            VG+DGM+INLATV
Sbjct  210  VGVDGMVINLATV  222



>ref|XP_002307366.1| hypothetical protein POPTR_0005s17250g [Populus trichocarpa]
 gb|EEE94362.1| hypothetical protein POPTR_0005s17250g [Populus trichocarpa]
Length=304

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 164/215 (76%), Gaps = 7/215 (3%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            S +AL    +  +       LV+E P+VL+YH G LLKG+ITVN++WYGKF+P QRSIIV
Sbjct  12   SLLALFSSLVPAVATARLLALVQEQPLVLKYHNGPLLKGNITVNIVWYGKFSPAQRSIIV  71

Query  453  DFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
            DFL SL ++  P PSV +WW+TT +++ GGP T+V+GKQ+LEE  SLGK LK  Q V LA
Sbjct  72   DFLHSLNSMKPPAPSVSTWWRTTGRFR-GGPRTVVVGKQVLEEKYSLGKLLKTPQTVTLA  130

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV---AYAWVGNSETQCPGQC  106
            SK G+ +  +N++LT  DV++DGFC  +CG+HGS  G+ +V   AYAWVGNS TQCPGQC
Sbjct  131  SKAGHGKNSINLILTSADVAIDGFCMSKCGTHGS--GQDKVGKFAYAWVGNSATQCPGQC  188

Query  105  AWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            AWPFH+PI GPQ PPLVAPNGDVGIDGMI+NLATV
Sbjct  189  AWPFHQPIYGPQGPPLVAPNGDVGIDGMIVNLATV  223



>gb|EYU18459.1| hypothetical protein MIMGU_mgv1a010684mg [Erythranthe guttata]
Length=305

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 3/198 (2%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LL+G++TVNLIWYGKFTPTQRSIIVDFL+SL       PS 
Sbjct  27   STAALVQEQPLVLKYHNGALLRGTVTVNLIWYGKFTPTQRSIIVDFLQSLNPGKTAQPSA  86

Query  405  ESWWKTTEKYKG-GGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             SWWKTTEKYKG  GPST+ +GKQ ++E  S+GK+LK+ Q+V LA++GG+  G +NVVLT
Sbjct  87   ASWWKTTEKYKGVAGPSTLAVGKQFIDEKYSMGKSLKNSQLVYLAARGGHAAGAINVVLT  146

Query  228  DKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
             KDV+V GFC  RCG+HGS+  G  + AYAWVGNSETQCPG CAWPFH+P+ GPQTPPLV
Sbjct  147  AKDVAVAGFCMNRCGTHGSSRGGATRFAYAWVGNSETQCPGYCAWPFHQPLYGPQTPPLV  206

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGM+INLATV
Sbjct  207  APNGDVGVDGMVINLATV  224



>ref|XP_007042914.1| EXORDIUM like 2 [Theobroma cacao]
 gb|EOX98745.1| EXORDIUM like 2 [Theobroma cacao]
Length=295

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 158/213 (74%), Gaps = 9/213 (4%)
 Frame = -1

Query  630  AVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVD  451
            A  LLFCF+      S  ELV+E P+VL+YH G LLKG ITVN IWYGKFTP QRSIIVD
Sbjct  8    ATLLLFCFI----HLSSSELVQEQPLVLKYHNGPLLKGKITVNFIWYGKFTPIQRSIIVD  63

Query  450  FLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS  271
            F+ SL T     PS  SWWKTTEKYKGG  S + +GKQIL EN  LGK LK+  +  LAS
Sbjct  64   FVNSLSTDKTTLPSSSSWWKTTEKYKGGA-SNLGVGKQILLENYPLGKILKNPHLPALAS  122

Query  270  KGGNTEGCVNVVLTDKDVSVDGFCKRCGSHGST---AGEKQVAYAWVGNSETQCPGQCAW  100
            K  N    +N++LT KDVSV+GFC RCG+HGST    G  +  Y WVGNSETQCPGQCAW
Sbjct  123  K-FNGVNTINIILTAKDVSVEGFCMRCGTHGSTRVGRGPIRGTYIWVGNSETQCPGQCAW  181

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PFH+PI GPQTPPLVAPNGDVG+DGM+INLAT+
Sbjct  182  PFHQPIYGPQTPPLVAPNGDVGVDGMVINLATL  214



>ref|XP_006472581.1| PREDICTED: uncharacterized protein LOC102625136 [Citrus sinensis]
Length=303

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            L ++ P+VL+YH G LL G++TVNL+WYGKF+P QRSI+VDFL+SL +   P PSV SWW
Sbjct  31   LAEQQPLVLKYHNGQLLSGNVTVNLVWYGKFSPIQRSIVVDFLKSLSSAKTPPPSVSSWW  90

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTE Y+GG P ++ +G ++L+EN SLGK+L+  Q++ LASK G     VNVVLT  DV 
Sbjct  91   RTTEAYEGG-PRSVAVGNEVLDENYSLGKSLQTPQVISLASKAGIKNNAVNVVLTSSDVV  149

Query  213  VDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            VDGFC  RCG+HG+  + E + AYAWVGNSE+QCPGQCAWPFH+PI GPQTPPLVAPNGD
Sbjct  150  VDGFCMSRCGTHGAGRSKESKFAYAWVGNSESQCPGQCAWPFHQPIYGPQTPPLVAPNGD  209

Query  39   VGIDGMIINLATV  1
            VG+DGM+INLATV
Sbjct  210  VGVDGMVINLATV  222



>ref|XP_003541423.1| PREDICTED: uncharacterized protein LOC100810770 [Glycine max]
Length=303

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 154/198 (78%), Gaps = 6/198 (3%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV-DAPTPSVE  403
            GELV+E P+VL+YH G LLKG ITVNLIWYG FTP QRSIIVDF+ SL +  +AP PS  
Sbjct  26   GELVQEQPLVLKYHNGQLLKGRITVNLIWYGTFTPIQRSIIVDFINSLSSAPNAPLPSTA  85

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            +WWKTTEKYKGGG S +V+GKQ L    SLGK LK   ++ LASK  N    + VVLT K
Sbjct  86   TWWKTTEKYKGGGSSALVVGKQFLHSAYSLGKNLKGKDVLALASKF-NELKSITVVLTAK  144

Query  222  DVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V+GFC  RCG+HGST   K   + AY WVGNSETQCPGQCAWPFH+PI GPQTPPLV
Sbjct  145  DVAVEGFCMSRCGTHGSTRNVKNAARTAYIWVGNSETQCPGQCAWPFHQPIYGPQTPPLV  204

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGM+INLAT+
Sbjct  205  APNGDVGVDGMVINLATL  222



>ref|XP_011003039.1| PREDICTED: protein EXORDIUM-like 2 [Populus euphratica]
Length=305

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 169/227 (74%), Gaps = 9/227 (4%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFL--AGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWY  490
            MA I++    +++  LF  L  A         LVKE P+VL+YH G LLKG+ITVN++WY
Sbjct  1    MASISHLIVFTSLLALFSSLVPAIATARKLAALVKEQPLVLKYHNGPLLKGNITVNIVWY  60

Query  489  GKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLG  310
            GKF+P QRSIIVDFL SL ++    PSV +WW+TT +Y+ GGP T+V+G Q+LEE  +LG
Sbjct  61   GKFSPAQRSIIVDFLHSLNSMKPRAPSVSTWWQTTGRYR-GGPRTVVVGTQVLEEKYALG  119

Query  309  KTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV---AYAW  142
            K LK  QI+ LASK G+ +  +N++LT  DV++DGFC  RCG+HGS  G+ +V   AYAW
Sbjct  120  KLLKTPQIITLASKAGHGKNSINLILTSADVAIDGFCMSRCGTHGS--GQDKVGKFAYAW  177

Query  141  VGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            VGN+ TQCPGQCAWPFH+PI GPQ PPLVAPNGDVGIDGMI+NLATV
Sbjct  178  VGNAATQCPGQCAWPFHQPIYGPQGPPLVAPNGDVGIDGMILNLATV  224



>ref|XP_004485593.1| PREDICTED: uncharacterized protein LOC101490191 [Cicer arietinum]
Length=305

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 161/218 (74%), Gaps = 9/218 (4%)
 Frame = -1

Query  627  VALLFC----FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSI  460
            VA+++C     L  +  PS G LV++ P++L+YH G LLKG ITVNL+WYG FTP QRSI
Sbjct  7    VAMIWCALLVVLVEMFNPSMGALVEQQPLILKYHNGQLLKGRITVNLLWYGSFTPIQRSI  66

Query  459  IVDFLESLKT-VDAPTPSVESWWKTTEKYKGG-GPSTIVIGKQILEENCSLGKTLKDDQI  286
            IVDF+ SL +    P PSV SWWKTTE YKGG G S +V+GKQIL  + SLGK LK  Q+
Sbjct  67   IVDFINSLSSSTTVPLPSVASWWKTTENYKGGSGSSVLVVGKQILHPSYSLGKYLKGTQL  126

Query  285  VQLASKGGNTEGCVNVVLTDKDVSVDGFCKRCGSHGSTA---GEKQVAYAWVGNSETQCP  115
            + LAS   N    +NV+LT K+V+V+ FC RCG+HGS     G+ + AY WVG+SE QCP
Sbjct  127  LSLASTFNNPSNAINVILTAKEVAVEDFCSRCGTHGSIRPVNGKNRTAYVWVGDSEAQCP  186

Query  114  GQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            GQCAWPFH+PI GPQTPPLV+PN DVGIDGMIINLAT+
Sbjct  187  GQCAWPFHQPIYGPQTPPLVSPNNDVGIDGMIINLATL  224



>ref|XP_007200523.1| hypothetical protein PRUPE_ppa009421mg [Prunus persica]
 gb|EMJ01722.1| hypothetical protein PRUPE_ppa009421mg [Prunus persica]
Length=293

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 164/221 (74%), Gaps = 9/221 (4%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGK  484
            MA I + AT+      F  L  +  P+ G LV++ P+VL+YH G LLKG ITVNLIWYG+
Sbjct  1    MASIYHYATS------FIILLSLIGPNLGALVEQQPLVLKYHNGALLKGDITVNLIWYGR  54

Query  483  FTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKT  304
            FTP QRSI+VDF++SL +  AP  S  SWWKTTEKYK G  S +V+G+Q+L E  +LGK+
Sbjct  55   FTPIQRSIVVDFVQSLSSRRAPPGSAASWWKTTEKYKSGA-SNLVVGRQVLHEAYTLGKS  113

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSET  124
            L +  ++ LA K  N    ++VVLT  DV+V GFC RCG+HGST  +K+ AY WVGNSE 
Sbjct  114  LGNRHLLALAGK-VNALKAISVVLTASDVAVAGFCSRCGTHGSTP-DKKTAYIWVGNSEA  171

Query  123  QCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            QCPGQCAWPFH+PI GPQTPPLVAPNGDVGIDG+IINLAT+
Sbjct  172  QCPGQCAWPFHQPIYGPQTPPLVAPNGDVGIDGVIINLATL  212



>gb|KDP41405.1| hypothetical protein JCGZ_15812 [Jatropha curcas]
Length=306

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 156/205 (76%), Gaps = 9/205 (4%)
 Frame = -1

Query  591  EPSFG------ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            EP+F        LV+E P++L+YH G LLKG++TVNL+WYGKF+P QRSIIVDF  SL +
Sbjct  22   EPAFATTRKLAALVQEQPLLLKYHNGPLLKGNVTVNLVWYGKFSPIQRSIIVDFFNSLNS  81

Query  429  VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEG  250
               P+PSV SWW+TT KY+GG P  + +G Q+ +EN SLGK++K   +  LASK G  + 
Sbjct  82   DGTPSPSVSSWWETTAKYRGG-PCNVNLGNQVFDENYSLGKSVKTSYLAALASKAGRGKN  140

Query  249  CVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK-QVAYAWVGNSETQCPGQCAWPFHKPIQG  76
             + VV T  DV+VDGFC  RCG+HGS  GEK + AYAWVGNS TQCPGQCAWPFH+PI G
Sbjct  141  PITVVFTSADVAVDGFCMSRCGTHGSGQGEKAKFAYAWVGNSVTQCPGQCAWPFHQPIYG  200

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQTPPLV+PNGDVGIDGMIINLATV
Sbjct  201  PQTPPLVSPNGDVGIDGMIINLATV  225



>ref|XP_006433957.1| hypothetical protein CICLE_v10001968mg [Citrus clementina]
 gb|ESR47197.1| hypothetical protein CICLE_v10001968mg [Citrus clementina]
Length=303

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            L ++ P+VL+YH G LL G++TVNL+WYGKF+P QRSI+VDFL+SL +   P PSV SWW
Sbjct  31   LSEQQPLVLKYHNGQLLSGNVTVNLVWYGKFSPIQRSIVVDFLKSLSSAKTPPPSVSSWW  90

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTE Y+GG P ++ +G ++L+E  SLGK+L+  Q++ LASK G     VNVVLT  DV 
Sbjct  91   RTTEAYEGG-PRSVAVGNEVLDEKYSLGKSLQTPQVISLASKAGIKNNAVNVVLTSSDVV  149

Query  213  VDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            VDGFC  RCG+HG+  + E + AYAWVGNSE+QCPGQCAWPFH+PI GPQTPPLVAPNGD
Sbjct  150  VDGFCMSRCGTHGAGRSKESKFAYAWVGNSESQCPGQCAWPFHQPIYGPQTPPLVAPNGD  209

Query  39   VGIDGMIINLATV  1
            VG+DGM+INLATV
Sbjct  210  VGVDGMVINLATV  222



>ref|XP_003593220.1| hypothetical protein MTR_2g009070 [Medicago truncatula]
 gb|AES63471.1| phosphate-responsive 1 family protein [Medicago truncatula]
Length=304

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 153/210 (73%), Gaps = 4/210 (2%)
 Frame = -1

Query  618  LFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLES  439
            LF  L  +  PS GE V+  P++L+YH G LLKG ITVNL+WYG F P QRSIIVDF+ S
Sbjct  14   LFVMLVAMLHPSLGEQVEPQPLILKYHNGPLLKGRITVNLLWYGSFNPIQRSIIVDFINS  73

Query  438  LKTV-DAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGG  262
            L T   AP PSV SWWKT E YK GG STIV+GKQI+ +  +LGK LK   +V LAS   
Sbjct  74   LTTSPKAPLPSVASWWKTIENYKRGGSSTIVVGKQIMHQRYALGKNLKGTHLVSLASVFK  133

Query  261  NTEGCVNVVLTDKDVSVDGFCKRCGSHGSTAG---EKQVAYAWVGNSETQCPGQCAWPFH  91
                 VN++ T ++V+V+GFC RCG+HGS        ++ Y WVGNSETQCPGQCAWPFH
Sbjct  134  YAPNAVNIIFTAEEVTVEGFCGRCGTHGSIRSVRRRNRIPYIWVGNSETQCPGQCAWPFH  193

Query  90   KPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            +PI GPQTPPLVAPNGD+G+DG+IINLAT+
Sbjct  194  QPIYGPQTPPLVAPNGDIGVDGIIINLATL  223



>ref|XP_002273316.1| PREDICTED: protein EXORDIUM-like 2 [Vitis vinifera]
 emb|CBI34066.3| unnamed protein product [Vitis vinifera]
Length=307

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 10/214 (5%)
 Frame = -1

Query  618  LFCFLAGIPEPSFGE------LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            L C LA   EP+ G       LV+E P  ++YH G LLKG +TVNL+WYG F+  QRSII
Sbjct  15   LSCLLASFVEPAMGSTRKLSALVEEQPFPMKYHNGALLKGKVTVNLVWYGSFSAIQRSII  74

Query  456  VDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQL  277
            +DFLES  +   P+PSV SWWKTTEKY GG  S +V+GKQ+L++  SLGK LK   +  L
Sbjct  75   IDFLESFNSRTPPSPSVASWWKTTEKYHGGS-SAVVVGKQVLDQRYSLGKVLKTSHLTAL  133

Query  276  ASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCA  103
            ASK  N  G V ++LT KDV+VDGFC  RCG+HG T +G+ + AY WVGNSETQCPGQCA
Sbjct  134  ASKP-NFIGSVTILLTAKDVAVDGFCMSRCGTHGWTHSGKARSAYVWVGNSETQCPGQCA  192

Query  102  WPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            WPFH+P+ GPQTPPLVAPNGDVG+DGM+INLAT+
Sbjct  193  WPFHQPMYGPQTPPLVAPNGDVGVDGMVINLATL  226



>dbj|BAJ33879.1| unnamed protein product [Thellungiella halophila]
Length=304

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 160/217 (74%), Gaps = 10/217 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+    L     PS   LVKE P++L+YH G LLKG+ITVNL+WYGKFTP QRS+IVDF+
Sbjct  8    AIFLTLLFATAGPSTAALVKEQPLILKYHNGVLLKGNITVNLVWYGKFTPIQRSVIVDFI  67

Query  444  ESLKTVDAPT---PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + DA T   PSV SWWKTTEKYKGG  ST+V+GKQ+L E   LGK+LK+  +  L+
Sbjct  68   RSLNSKDAATSAVPSVASWWKTTEKYKGGS-STLVVGKQLLLEKYPLGKSLKNPYLRALS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPG  112
            +K       + VVLT KDV+V+GFC  RCG+HGS+  + +      AY WVGNSETQCPG
Sbjct  127  TKLNGGLRSITVVLTAKDVTVEGFCMNRCGTHGSSGSKSRRAANGAAYIWVGNSETQCPG  186

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  187  YCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  223



>ref|XP_004504811.1| PREDICTED: uncharacterized protein LOC101501714 [Cicer arietinum]
Length=302

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 151/200 (76%), Gaps = 6/200 (3%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S GELV+E P+VL+YH G LLKG ITVNLIWYG FTP QRSIIVDF+ SL +  AP PS 
Sbjct  23   SIGELVQEQPLVLKYHNGQLLKGRITVNLIWYGTFTPIQRSIIVDFINSLSSTGAPLPSA  82

Query  405  ESWWKTTEKYKGG-GPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             +WWKTTEKYKGG G S +V+GKQ L    SLGK LK   ++ LA+K  N    + VVLT
Sbjct  83   ATWWKTTEKYKGGSGSSALVVGKQFLHPAYSLGKNLKGKDLLALATK-FNELSSITVVLT  141

Query  228  DKDVSVDGFC-KRCGSHGSTA---GEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
             KDV+V+GFC  RCG+HGS     G  +  Y WVGNSET CPGQCAWPFH+PI GPQTPP
Sbjct  142  SKDVAVEGFCMSRCGTHGSIRRGNGGARTPYIWVGNSETLCPGQCAWPFHQPIYGPQTPP  201

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPNGDVG+DGMIINLAT+
Sbjct  202  LVAPNGDVGVDGMIINLATL  221



>ref|XP_010267345.1| PREDICTED: protein EXORDIUM-like 2 [Nelumbo nucifera]
Length=307

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 154/196 (79%), Gaps = 7/196 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV++ P+VL+YH G LLKG+ TVN+IWYG F+P QRSI+VDF +SL     P PSV SWW
Sbjct  33   LVQQQPLVLKYHNGALLKGNYTVNIIWYGNFSPVQRSILVDFFQSLNAPIPPAPSVSSWW  92

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            K TE+YK G  S +++GKQIL+EN SLGK+LK  Q V LA+K G+    +NVV T KDV 
Sbjct  93   KITERYKVGS-SNLILGKQILDENYSLGKSLKISQXVSLAAKAGHVN-AINVVFTAKDVV  150

Query  213  VDGFC-KRCGSHGS---TAGEK-QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            ++GFC  RCG+HGS   TAG+K + AY WVGNSETQCPGQCAWPFH+PI GPQTPPLVAP
Sbjct  151  IEGFCMSRCGTHGSSRGTAGDKSKFAYLWVGNSETQCPGQCAWPFHQPIYGPQTPPLVAP  210

Query  48   NGDVGIDGMIINLATV  1
            NGD G+DGMIINLATV
Sbjct  211  NGDAGVDGMIINLATV  226



>emb|CDY63721.1| BnaC02g48820D [Brassica napus]
Length=304

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 157/217 (72%), Gaps = 10/217 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A     L  I   S   LVKE P+VL+YH G LLKG+I VNL+WYGKFTPTQRS+IVDF+
Sbjct  8    AFFLTVLTAIAGISSAALVKEQPLVLKYHNGALLKGNINVNLVWYGKFTPTQRSVIVDFI  67

Query  444  ESLKTVDAPT---PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + +A T   PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L+
Sbjct  68   RSLNSKEAATSAAPSVASWWKTTEKYKGGA-STLVVGKQLLLENYPLGKSLKNPNLRALS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVA-----YAWVGNSETQCPG  112
            +K       + VVLT KDVSV+GFC  RCGSHGST    + A     Y WVGN+ET CPG
Sbjct  127  TKLNGGLRSITVVLTAKDVSVEGFCMNRCGSHGSTVSTSRRAANGPAYVWVGNAETMCPG  186

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQ PPLV+PNGDVG+DGMIINLAT+
Sbjct  187  YCAWPFHQPIYGPQGPPLVSPNGDVGVDGMIINLATL  223



>ref|XP_010484201.1| PREDICTED: protein EXORDIUM-like 2 [Camelina sativa]
Length=308

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 165/227 (73%), Gaps = 14/227 (6%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A+  + A+L   L      S   LV+E P+VL+YH G LLKG+ITVNL+WYGKFTP QRS
Sbjct  2    ASNYSFAILLTLLFATAGFSAAVLVEEQPLVLKYHNGALLKGNITVNLVWYGKFTPIQRS  61

Query  462  IIVDFLESLKTVDAPT------PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTL  301
            +IVDF+ SL + DA +      PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+L
Sbjct  62   VIVDFIRSLNSKDASSSFSAAVPSVSSWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSL  120

Query  300  KDDQIVQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAW  142
            K+  +  L++K  G     + VVLT KDV+V+GFC  RCG+HGS+  + +      AY W
Sbjct  121  KNPYLRALSTKLNGGGLRAITVVLTAKDVTVEGFCMNRCGTHGSSGSKPRRAANGAAYVW  180

Query  141  VGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            VGNSETQCPG CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  181  VGNSETQCPGYCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  227



>ref|XP_006394173.1| hypothetical protein EUTSA_v10005461mg [Eutrema salsugineum]
 gb|ESQ31459.1| hypothetical protein EUTSA_v10005461mg [Eutrema salsugineum]
Length=304

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 159/217 (73%), Gaps = 10/217 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+    L      S   LVKE P++L+YH G LLKG+ITVNL+WYGKFTP QRS+IVDF+
Sbjct  8    AIFLTLLFATAGLSTAALVKEQPLILKYHNGVLLKGNITVNLVWYGKFTPIQRSVIVDFI  67

Query  444  ESLKTVDAPT---PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + DA T   PSV SWWKTTEKYKGG  ST+V+GKQ+L E   LGK+LK+  +  L+
Sbjct  68   RSLNSKDAATSAVPSVASWWKTTEKYKGGS-STLVVGKQLLLEKYPLGKSLKNPYLRALS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPG  112
            +K       + VVLT KDV+V+GFC  RCG+HGS+  + +      AY WVGNSETQCPG
Sbjct  127  TKLNGGLRSITVVLTAKDVTVEGFCMNRCGTHGSSGSKSRRAANGAAYIWVGNSETQCPG  186

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  187  YCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  223



>ref|XP_009130446.1| PREDICTED: uncharacterized protein LOC103855233 [Brassica rapa]
 emb|CDY31329.1| BnaA02g34120D [Brassica napus]
Length=304

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 157/217 (72%), Gaps = 10/217 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A     L  +   S   LVKE P+VL+YH G LLKG+I VNL+WYGKFTPTQRS+IVDF+
Sbjct  8    AFFLTVLTALAGISSAALVKEQPLVLKYHNGALLKGNINVNLVWYGKFTPTQRSVIVDFI  67

Query  444  ESLKTVDAPT---PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + +A T   PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L+
Sbjct  68   RSLNSKEATTSAAPSVASWWKTTEKYKGGA-STLVVGKQLLLENYPLGKSLKNPNLRALS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVA-----YAWVGNSETQCPG  112
            +K       + VVLT KDVSV+GFC  RCGSHGS+    + A     Y WVGN+ET CPG
Sbjct  127  TKLNGGLRSITVVLTAKDVSVEGFCMNRCGSHGSSVSTSRRAANGEAYVWVGNAETMCPG  186

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQ PPLVAPNGDVG+DGMIINLAT+
Sbjct  187  YCAWPFHQPIYGPQGPPLVAPNGDVGVDGMIINLATL  223



>ref|XP_006423793.1| hypothetical protein CICLE_v10028909mg [Citrus clementina]
 ref|XP_006492632.1| PREDICTED: uncharacterized protein LOC102625790 [Citrus sinensis]
 gb|ESR37033.1| hypothetical protein CICLE_v10028909mg [Citrus clementina]
 gb|KDO37947.1| hypothetical protein CISIN_1g021826mg [Citrus sinensis]
Length=307

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 158/219 (72%), Gaps = 13/219 (6%)
 Frame = -1

Query  621  LLFCFLAGIPEPSF------GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSI  460
            +LF F + +  P+         LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRSI
Sbjct  9    ILFLFCSTLISPTLSTTRKLNALVQEQPLVLKYHNGALLKGNVTVNLIWYGKFTPIQRSI  68

Query  459  IVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQ  280
            IVDF+ SL    AP PS  SWWKTTE YKGG  S +V+  Q+L EN SLGK LK   ++ 
Sbjct  69   IVDFIHSLNFNRAPQPSTSSWWKTTENYKGGS-SNLVVRHQVLLENYSLGKALKKVHLLA  127

Query  279  LASKGGNT-EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVA----YAWVGNSETQC  118
            L+ K  NT    +NVVLT KDV+VDGFC  RCG+HGS    + +A    Y WVGNSETQC
Sbjct  128  LSKKVTNTLPTSINVVLTAKDVAVDGFCMNRCGTHGSALPGRGLASRGTYIWVGNSETQC  187

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PG CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  188  PGYCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  226



>ref|XP_010094136.1| hypothetical protein L484_017174 [Morus notabilis]
 gb|EXB55269.1| hypothetical protein L484_017174 [Morus notabilis]
Length=308

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 153/196 (78%), Gaps = 7/196 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV-DAPTPSVESW  397
            LV+E P++L+YH G LLKG+I+VNLIWYG FTP QRSIIVDF++SL +      PS  SW
Sbjct  34   LVQEQPLILKYHNGALLKGNISVNLIWYGSFTPIQRSIIVDFIQSLSSGGKTMAPSAASW  93

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            WKTTEKYKGG  S +V+ KQIL E  +LGK+LK   +V LA K  N  G +N+VLT KDV
Sbjct  94   WKTTEKYKGGS-SKLVVRKQILHEAYTLGKSLKSSHLVALAGKV-NDLGAINMVLTAKDV  151

Query  216  SVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            +VDGFC  RCG+HG+T G K   + AY WVGNSE QCPGQCAWPFHKPI GPQTPPLVAP
Sbjct  152  AVDGFCMSRCGTHGATRGFKGKARQAYVWVGNSEVQCPGQCAWPFHKPIYGPQTPPLVAP  211

Query  48   NGDVGIDGMIINLATV  1
            NGDVG+DGMIINLAT+
Sbjct  212  NGDVGVDGMIINLATL  227



>ref|XP_007018740.1| EXORDIUM like 2 [Theobroma cacao]
 gb|EOY15965.1| EXORDIUM like 2 [Theobroma cacao]
Length=305

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV+E P+VL+YH G LLKG+ITVNLIWYGKF+ TQRSIIVDFL SL +    +PSV SWW
Sbjct  32   LVQEQPLVLKYHHGPLLKGNITVNLIWYGKFSSTQRSIIVDFLNSLSSTKTTSPSVSSWW  91

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK-GGNTEGCVNVVLTDKDV  217
            +TT KY+ G  S +V+GKQIL+E  SLGK LK  Q+V LASK G      VNVVLT  DV
Sbjct  92   QTTGKYRRGS-SRVVVGKQILDEKYSLGKALKTIQLVALASKPGYGGSNVVNVVLTSADV  150

Query  216  SVDGFC-KRCGSHGSTAGEK-QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNG  43
            +VDGFC  RCG+HGS   +K + AYAWVGNS +QCPG CAWPFH+P+ GPQTPPL+APNG
Sbjct  151  AVDGFCMSRCGTHGSGRVKKSRFAYAWVGNSVSQCPGYCAWPFHQPVYGPQTPPLIAPNG  210

Query  42   DVGIDGMIINLATV  1
            DVG+DGM+INLATV
Sbjct  211  DVGVDGMVINLATV  224



>ref|XP_004137161.1| PREDICTED: uncharacterized protein LOC101213735 [Cucumis sativus]
 gb|KGN53718.1| hypothetical protein Csa_4G110050 [Cucumis sativus]
Length=305

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 152/198 (77%), Gaps = 6/198 (3%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVE  403
               LV++ P+VLEYHKG LLKG+IT+NLIWYG+FT +QRS+IVDF++SL    AP PS  
Sbjct  29   LAALVEQQPLVLEYHKGALLKGNITLNLIWYGQFTSSQRSVIVDFIQSLTYSRAPAPSAS  88

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
             WWKTTE YKGG  S +V+GKQIL E+ +LGK LK   +  LA K  N    VN+VLT K
Sbjct  89   LWWKTTENYKGGS-SNLVVGKQILHESYTLGKNLKSLHLRALAMK-VNQLNSVNLVLTAK  146

Query  222  DVSVDGFCK-RCGSHGST---AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V+GFC+ RCG+HGS      + + AY WVGNSE+QCPG CAWPFH+PI GPQTPPL+
Sbjct  147  DVAVEGFCRSRCGTHGSVPVGRSKARTAYVWVGNSESQCPGYCAWPFHQPIYGPQTPPLI  206

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGMIINLATV
Sbjct  207  APNGDVGVDGMIINLATV  224



>emb|CAN83333.1| hypothetical protein VITISV_024712 [Vitis vinifera]
Length=281

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LVKE P  ++YH G LLKG +TVNL+WYG F+  QRSII+DFLES  +   P+PSV SWW
Sbjct  10   LVKEQPFPMKYHNGALLKGKVTVNLVWYGSFSAIQRSIIIDFLESFNSRTPPSPSVASWW  69

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            KTTEKY GG  S +V+GKQ+L++  SLGK LK   +  LASK  N  G V ++LT KDV+
Sbjct  70   KTTEKYHGGS-SAVVVGKQVLDQRYSLGKVLKTSHLTALASKP-NFIGSVTILLTAKDVA  127

Query  213  VDGFC-KRCGSHGST-AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            VDGFC  RCG+HG T +G+ + AY WVGNSETQCPGQCAWPFH+P+ GPQT PLVAPNGD
Sbjct  128  VDGFCMSRCGTHGWTHSGKARSAYVWVGNSETQCPGQCAWPFHQPMYGPQTQPLVAPNGD  187

Query  39   VGIDGMIINLATV  1
            VG+DGM+INLAT+
Sbjct  188  VGVDGMVINLATL  200



>ref|NP_201231.1| protein EXORDIUM like 2 [Arabidopsis thaliana]
 sp|Q9FE06.1|EXOL2_ARATH RecName: Full=Protein EXORDIUM-like 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG41473.1|AF326891_1 putative phi-1 protein [Arabidopsis thaliana]
 gb|AAK00390.1|AF339708_1 putative phi-1 protein [Arabidopsis thaliana]
 gb|AAK55719.1|AF380638_1 AT5g64260/MSJ1_10 [Arabidopsis thaliana]
 dbj|BAB09857.1| phi-1-like protein [Arabidopsis thaliana]
 gb|AAL15369.1| AT5g64260/MSJ1_10 [Arabidopsis thaliana]
 gb|AAM65190.1| phi-1-like protein [Arabidopsis thaliana]
 gb|AED97863.1| protein EXORDIUM like 2 [Arabidopsis thaliana]
Length=305

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 158/216 (73%), Gaps = 14/216 (6%)
 Frame = -1

Query  618  LFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLES  439
            LF   AG    S   LV+E P+V++YH G LLKG+ITVNL+WYGKFTP QRS+IVDF+ S
Sbjct  13   LFFATAGF---SAAALVEEQPLVMKYHNGVLLKGNITVNLVWYGKFTPIQRSVIVDFIHS  69

Query  438  LKTVD----APTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS  271
            L + D    A  PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L++
Sbjct  70   LNSKDVASSAAVPSVASWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNPYLRALST  128

Query  270  KGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPGQ  109
            K       + VVLT KDV+V+ FC  RCG+HGS+    +      AY WVGNSETQCPG 
Sbjct  129  KLNGGLRSITVVLTAKDVTVERFCMSRCGTHGSSGSNPRRAANGAAYVWVGNSETQCPGY  188

Query  108  CAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  189  CAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  224



>ref|XP_010065641.1| PREDICTED: protein EXORDIUM-like 2 [Eucalyptus grandis]
 gb|KCW63231.1| hypothetical protein EUGRSUZ_G00850 [Eucalyptus grandis]
Length=297

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 149/191 (78%), Gaps = 3/191 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV++ P+VL+YH G LLKG+ITV+L+WYG+F+PTQRS+IVDF+ SL    +P PS  SWW
Sbjct  29   LVQQQPLVLKYHNGALLKGNITVDLVWYGRFSPTQRSVIVDFIRSLGYARSPPPSAASWW  88

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTEKYKGGG S +V+G+Q+L E  +LGK+LK+  +  LA K     G + VVLT  DV+
Sbjct  89   RTTEKYKGGG-SNLVVGRQVLHEAYTLGKSLKNRHLRALAGKFNAAPGTITVVLTAADVA  147

Query  213  VDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVG  34
            V+GFC RCG+HGS       A+ WVGNSETQCPGQCAWPFH+P+ G QTPPLVAP+GDVG
Sbjct  148  VEGFCMRCGTHGSA--RPGSAFVWVGNSETQCPGQCAWPFHQPMYGSQTPPLVAPSGDVG  205

Query  33   IDGMIINLATV  1
             DGM+INLAT+
Sbjct  206  ADGMVINLATL  216



>ref|XP_002864892.1| hypothetical protein ARALYDRAFT_919741 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41151.1| hypothetical protein ARALYDRAFT_919741 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 158/217 (73%), Gaps = 11/217 (5%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE  442
            +    L  I   S   LV+E P+VL+YH G LLKG+ITVNLIWYGKFTP QRS+IVDF+ 
Sbjct  9    IFLTLLFAIVGFSAAALVEEQPLVLKYHNGVLLKGNITVNLIWYGKFTPIQRSVIVDFIR  68

Query  441  SLKTVD----APTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
            SL + D    A  PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L+
Sbjct  69   SLNSKDVASSAAVPSVASWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNPHLRALS  127

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPG  112
            +K       + VVLT KDV+V+ FC  RCG+HGS++ + +      AY WVGNSET CPG
Sbjct  128  TKLNGGLRSITVVLTAKDVTVERFCMSRCGTHGSSSSKPRRAANGAAYVWVGNSETLCPG  187

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  188  YCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  224



>ref|XP_007159119.1| hypothetical protein PHAVU_002G210200g [Phaseolus vulgaris]
 gb|ESW31113.1| hypothetical protein PHAVU_002G210200g [Phaseolus vulgaris]
Length=302

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL-KTVDAPTPSVE  403
            GELV+E P+VL+YH G LLKG ITVNLIWYG FTP QRS+IVDF+ SL K  +A  PS  
Sbjct  26   GELVQEQPLVLKYHNGQLLKGRITVNLIWYGSFTPIQRSVIVDFINSLSKAPNAALPSTA  85

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            +WWKTTE YKGG  S +V+G QIL    +LGK+L+   ++ LASK  N    + VVLT K
Sbjct  86   TWWKTTENYKGGS-SALVVGSQILHPAYTLGKSLEGKHLLALASKF-NQLNSITVVLTGK  143

Query  222  DVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V GFC  RCG+HGST G +   + AY WVGNSETQCPGQCAWPFH+PI GPQTPPLV
Sbjct  144  DVAVKGFCMSRCGTHGSTRGVQNATRTAYIWVGNSETQCPGQCAWPFHQPIYGPQTPPLV  203

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGMIINLAT+
Sbjct  204  APNGDVGVDGMIINLATL  221



>gb|AGV54462.1| phi-1-like phosphate-induced protein [Phaseolus vulgaris]
Length=302

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 7/198 (4%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL-KTVDAPTPSVE  403
            GELV+E P+VL+YH G LLKG ITVNLIWYG FTP QRS+IVDF+ SL K  +A  PS  
Sbjct  26   GELVQEQPLVLKYHNGQLLKGRITVNLIWYGSFTPIQRSVIVDFINSLSKAPNAALPSTA  85

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            +WWKTTE YKGG  S +V+G QIL    +LGK+L+   ++ LASK  N    + VVLT K
Sbjct  86   TWWKTTENYKGGS-SALVVGSQILHPAYTLGKSLEGKHLLALASKF-NQLNSITVVLTGK  143

Query  222  DVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V GFC  RCG+HGST G +   + AY WVGNSETQCPGQCAWPFH+PI GPQTPPLV
Sbjct  144  DVAVKGFCMSRCGTHGSTRGVQNATRTAYIWVGNSETQCPGQCAWPFHQPIYGPQTPPLV  203

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGMIINLAT+
Sbjct  204  APNGDVGVDGMIINLATL  221



>ref|XP_003531029.1| PREDICTED: uncharacterized protein LOC100776258 [Glycine max]
Length=304

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 151/199 (76%), Gaps = 7/199 (4%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV-DAPTPSVE  403
            GELV+E P+VL+YH G LLKG ITVNLIWYG FTP QRSIIVDF+ SL +  +AP PS  
Sbjct  26   GELVEEQPLVLKYHNGQLLKGRITVNLIWYGTFTPIQRSIIVDFINSLSSAPNAPLPSTA  85

Query  402  SWWKTTEKYK-GGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
            +WWKTTEKYK GGG   +V+G Q L    +LGK LK   ++ LASK  N    + VVLT 
Sbjct  86   TWWKTTEKYKVGGGSPALVVGMQFLHPAYTLGKNLKGRDLLALASKF-NEINSITVVLTA  144

Query  225  KDVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            KDV+V+GFC  RCG+HGST   K   + AY WVGNSETQCPGQCAWPFH+PI GPQTPPL
Sbjct  145  KDVAVEGFCMSRCGTHGSTRNVKSNARTAYIWVGNSETQCPGQCAWPFHQPIYGPQTPPL  204

Query  57   VAPNGDVGIDGMIINLATV  1
            V+PNGD G+DGM+INLAT+
Sbjct  205  VSPNGDAGVDGMVINLATL  223



>ref|XP_004168612.1| PREDICTED: uncharacterized protein LOC101227929, partial [Cucumis 
sativus]
Length=321

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 152/198 (77%), Gaps = 6/198 (3%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVE  403
               LV++ P+VLEYHKG LLKG+IT+NLIWYG+FT +QRS+IVDF++SL    AP PS  
Sbjct  45   LAALVEQQPLVLEYHKGALLKGNITLNLIWYGQFTSSQRSVIVDFIQSLTYSRAPAPSAS  104

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
             WWKTTE YKGG  S +V+GKQIL E+ +LGK LK   +  LA K  N    VN+VLT K
Sbjct  105  LWWKTTENYKGGS-SNLVVGKQILHESYTLGKNLKSLHLRALAMK-VNQLNSVNLVLTAK  162

Query  222  DVSVDGFCK-RCGSHGST---AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V+GFC+ RCG+HGS      + + AY WVGNSE+QCPG CAWPFH+PI GPQTPPL+
Sbjct  163  DVAVEGFCRSRCGTHGSVPVGRSKARTAYVWVGNSESQCPGYCAWPFHQPIYGPQTPPLI  222

Query  54   APNGDVGIDGMIINLATV  1
            APNGDVG+DGMIINLATV
Sbjct  223  APNGDVGVDGMIINLATV  240



>ref|XP_010690524.1| PREDICTED: protein EXORDIUM-like 2 [Beta vulgaris subsp. vulgaris]
Length=302

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 145/201 (72%), Gaps = 10/201 (5%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVES  400
            G LVK+ P+VL+YH G LLKG   VNLIWYGKFTP QRSIIVDF++SL +  AP PSV S
Sbjct  23   GALVKQQPLVLKYHNGALLKGKFNVNLIWYGKFTPVQRSIIVDFIQSLSSTRAPRPSVSS  82

Query  399  WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEG--------CV  244
            WW+T E YKGG  ST+++G QIL EN   GK LK+  IV LAS                +
Sbjct  83   WWRTIENYKGGA-STLMVGNQILHENYPFGKNLKNSHIVGLASSKPKPNNKPNNNVIHSI  141

Query  243  NVVLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            +VVLT +DV VDGFC RCGSHG   G  + AY WVGNS TQC GQCAWPF+KP+ GPQTP
Sbjct  142  DVVLTAEDVVVDGFCMRCGSHG-VLGRSKRAYIWVGNSVTQCAGQCAWPFYKPMYGPQTP  200

Query  63   PLVAPNGDVGIDGMIINLATV  1
             LVAPNGDVG+DGMIINLAT+
Sbjct  201  ALVAPNGDVGVDGMIINLATL  221



>gb|EPS68014.1| hypothetical protein M569_06759, partial [Genlisea aurea]
Length=287

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 153/206 (74%), Gaps = 4/206 (2%)
 Frame = -1

Query  606  LAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV  427
            L   P P    LV++P +VL+YH G LLKG++TVNLIWYG+F P QRS++VDF +SL   
Sbjct  1    LCACPSPLMAFLVQQPLLVLKYHNGVLLKGNVTVNLIWYGEFKPAQRSVVVDFFQSLGAA  60

Query  426  D--APTPSVESWWKTTEKYKGGGPSTIVIG-KQILEENCSLGKTLKDDQIVQLASKGGNT  256
            D  AP PSV SWW+TT+KY GGG    +   +Q L+   S GK+LK   +V L+++GG  
Sbjct  61   DDAAPQPSVASWWRTTKKYDGGGGGPAIAIGQQFLDGGYSRGKSLKTSDLVYLSARGGRR  120

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQ  79
             G VNVVLT KDV+VDGFC  RCG+HGST G  + AYAWVG+SE QCPG CAWPFH+P+ 
Sbjct  121  NGAVNVVLTAKDVAVDGFCTSRCGTHGSTRGATRFAYAWVGDSEAQCPGYCAWPFHQPMY  180

Query  78   GPQTPPLVAPNGDVGIDGMIINLATV  1
            GPQTPPLVAPNGDVG+DGM+INLA V
Sbjct  181  GPQTPPLVAPNGDVGVDGMVINLAAV  206



>ref|XP_006399422.1| hypothetical protein EUTSA_v10014244mg [Eutrema salsugineum]
 gb|ESQ40875.1| hypothetical protein EUTSA_v10014244mg [Eutrema salsugineum]
Length=296

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 158/214 (74%), Gaps = 8/214 (4%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+L   L+     S   LV++ P+VL+YH G LLKG++T+NLIWYGKFTP QRSIIVDF+
Sbjct  8    AILLVLLSATVGFSSAALVEQEPLVLKYHNGILLKGNVTLNLIWYGKFTPIQRSIIVDFI  67

Query  444  ESLK--TVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS  271
             SL   T  A  P+V SWWKTTEKYKGG  STIV+GKQ+L EN  LGK+LK   +  L+S
Sbjct  68   RSLNSATAAAKGPTVASWWKTTEKYKGGA-STIVVGKQLLLENYPLGKSLKSPYLRALSS  126

Query  270  K--GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGE-KQVAYAWVGNSETQCPGQCA  103
            K  GG     + VVLT KDV+V+GFC  RCG+HGS +      AY WVGNSE QCPG CA
Sbjct  127  KLNGGGVR-SITVVLTAKDVAVEGFCMNRCGTHGSKSSSVNGGAYVWVGNSERQCPGYCA  185

Query  102  WPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            WPFH+PI GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  186  WPFHQPIYGPQSPPLVAPNGDVGVDGMIINLATL  219



>ref|XP_003608450.1| hypothetical protein MTR_4g094240 [Medicago truncatula]
 gb|AES90647.1| phosphate-responsive 1 family protein [Medicago truncatula]
 gb|AFK38707.1| unknown [Medicago truncatula]
Length=300

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = -1

Query  594  PEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT  415
            P  SFGELV+E P+VL+YH G LLKG +TVNLIWYG FTP QRSIIVDF+ SL T  A  
Sbjct  20   PTLSFGELVQEQPLVLKYHNGQLLKGKLTVNLIWYGTFTPIQRSIIVDFINSLSTTGAAL  79

Query  414  PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            PS  +WWKTTEKYK G  S + +GKQ L    +LGK LK   ++ LA+K  N    + VV
Sbjct  80   PSASAWWKTTEKYKVGS-SALTVGKQFLHPAYTLGKNLKGKDLLALATK-FNELSSITVV  137

Query  234  LTDKDVSVDGFC-KRCGSHGST---AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            LT KDV+V+GFC  RCG+HGS    +G  +  Y WVGN+ET CPGQCAWPFH+PI GPQT
Sbjct  138  LTAKDVNVEGFCMSRCGTHGSVRRGSGGARTPYIWVGNAETLCPGQCAWPFHQPIYGPQT  197

Query  66   PPLVAPNGDVGIDGMIINLATV  1
            PPLVAPNGDVG+DGM+INLAT+
Sbjct  198  PPLVAPNGDVGVDGMVINLATL  219



>ref|XP_010273025.1| PREDICTED: protein EXORDIUM-like 2 [Nelumbo nucifera]
Length=308

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 156/201 (78%), Gaps = 15/201 (7%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP----TPSV  406
            LV++ P+VL+YH G LLKG+ TVN+IWYGKF+P QRSI+VDF +SL   +AP     PSV
Sbjct  32   LVQQQPLVLKYHNGVLLKGNFTVNIIWYGKFSPVQRSILVDFFQSL---NAPRLRAAPSV  88

Query  405  ESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             SWW  T+KYK G  S +++G+QIL+E CSLGK+LK   IV LA+KG + +  +NVV T 
Sbjct  89   SSWWGITDKYKVGS-SKLILGRQILDEECSLGKSLKTSHIVALAAKG-DHKNAINVVFTA  146

Query  225  KDVSVDGFC-KRCGSHGS---TAGEKQ--VAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            KD+ VDGFC  RCG+HGS   TAG K+   AY WVGNSETQCPGQC+WPFH+PI GPQTP
Sbjct  147  KDIVVDGFCMSRCGTHGSALGTAGTKKSKFAYVWVGNSETQCPGQCSWPFHQPIYGPQTP  206

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLV PNGDVG+DGMIINLATV
Sbjct  207  PLVPPNGDVGVDGMIINLATV  227



>ref|XP_008462872.1| PREDICTED: uncharacterized protein LOC103501152 [Cucumis melo]
Length=306

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 155/206 (75%), Gaps = 10/206 (5%)
 Frame = -1

Query  594  PEPSFGE----LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV  427
            P+ + G     L+++ P+ LEYHKG+LLKG+IT+N IWYG+FT +QRS+I+DF++SL   
Sbjct  22   PDSALGRKLAALLQQQPLTLEYHKGSLLKGNITINFIWYGQFTSSQRSLILDFIQSLTYS  81

Query  426  DAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGC  247
             AP PS   WWKTTE YKGG  S +V+GKQIL E+ +LGK L +  +  LA K  N    
Sbjct  82   RAPPPSASLWWKTTENYKGG-TSNLVVGKQILHESYTLGKNLNNLHLRALAMKV-NQLNS  139

Query  246  VNVVLTDKDVSVDGFCK-RCGSHGSTA---GEKQVAYAWVGNSETQCPGQCAWPFHKPIQ  79
            VN+VLT KDV+VDGFC+ RCG+HGS +      + AY WVGNSE+QCPG CAWPFH+PI 
Sbjct  140  VNLVLTAKDVAVDGFCRSRCGTHGSVSVGRSRARTAYVWVGNSESQCPGYCAWPFHQPIY  199

Query  78   GPQTPPLVAPNGDVGIDGMIINLATV  1
            GPQTPPL+APNGDVG+DGMIINLATV
Sbjct  200  GPQTPPLIAPNGDVGVDGMIINLATV  225



>gb|KFK28118.1| hypothetical protein AALP_AA8G474900 [Arabis alpina]
Length=308

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 159/221 (72%), Gaps = 14/221 (6%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+   FL      S   LV+E P+VL+YH G LLKG+ITVNL+WYGKFTP QRS+IVDF+
Sbjct  8    AIFLTFLLTTAGFSAAALVEEQPLVLKYHNGVLLKGNITVNLVWYGKFTPIQRSVIVDFI  67

Query  444  ESLKTVDA---PTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + DA     PSV SWWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L+
Sbjct  68   HSLNSKDAVSSAAPSVASWWKTTEKYKGGS-STLVVGKQLLLENYHLGKSLKNPYLRALS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVA---------YAWVGNSET  124
            +K       + VVLT KDV+V+GFC  RCG+HGS+  + + A         Y WVGNSE+
Sbjct  127  TKLNGGLRSITVVLTAKDVTVEGFCMNRCGTHGSSGSKSRRAANGAANGAAYVWVGNSES  186

Query  123  QCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CPG CAWPFH+PI GPQTPPLV+PNGDVG+DGMIINLAT+
Sbjct  187  FCPGYCAWPFHQPIYGPQTPPLVSPNGDVGVDGMIINLATL  227



>ref|XP_004237934.1| PREDICTED: protein EXORDIUM-like 2 [Solanum lycopersicum]
Length=309

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 154/219 (70%), Gaps = 15/219 (7%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGE-----LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            LLF      P PS        LVKE P+VL+YHKG LLKG++T+NLIWYGKFT  QRSII
Sbjct  13   LLFSLFVLFPNPSLANSRILALVKEKPLVLKYHKGALLKGNVTINLIWYGKFTSVQRSII  72

Query  456  VDFLESL----KTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            VDF++SL    K + +P PSV SWW TTE YKGG  S I +GKQI +E  SLGK LKD Q
Sbjct  73   VDFIQSLSPKTKKIKSP-PSVASWWSTTEAYKGGA-SVISLGKQIFDEKYSLGKYLKDPQ  130

Query  288  IVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQC  118
            +  LASK       + V+LT  DV VD FC  RCG HGST  +K  + AYAWVGNS +QC
Sbjct  131  LESLASKATRVN-SIAVILTATDVGVDDFCMNRCGMHGSTRLKKAGKFAYAWVGNSASQC  189

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PGQCAWPF KPI GPQ  PLVAPNGDVG+DGMIINLATV
Sbjct  190  PGQCAWPFQKPIVGPQITPLVAPNGDVGVDGMIINLATV  228



>ref|XP_010065642.1| PREDICTED: protein EXORDIUM-like 2 [Eucalyptus grandis]
 gb|KCW63232.1| hypothetical protein EUGRSUZ_G00851 [Eucalyptus grandis]
Length=297

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  570  VKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWK  391
            V++ P+VL+YH G LLKG+ITV+L+WYG+FTPTQRS+IVDF+ SL     P PS  SWW+
Sbjct  30   VQQQPLVLKYHHGALLKGNITVDLVWYGRFTPTQRSVIVDFIRSLGYPRCPPPSAASWWR  89

Query  390  TTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSV  211
            TTEKYKGG  S +V+ +Q + E  +LGK+LK+  +  LASK     G + VVLT  DV+V
Sbjct  90   TTEKYKGGS-SNLVVRRQAVHEAYTLGKSLKNRHLRALASKFNAAPGTITVVLTAADVAV  148

Query  210  DGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGI  31
            +GFC RCG+HG  A     A+ WVGNSETQCPGQCAWPFH+P+ GPQTPPLVAP+GDVG+
Sbjct  149  EGFCSRCGTHG--AARPGSAFVWVGNSETQCPGQCAWPFHQPMYGPQTPPLVAPSGDVGV  206

Query  30   DGMIINLATV  1
            DGM+INLAT+
Sbjct  207  DGMVINLATL  216



>ref|XP_009621840.1| PREDICTED: protein EXORDIUM-like 2 [Nicotiana tomentosiformis]
Length=311

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 156/219 (71%), Gaps = 14/219 (6%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGE-----LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            +LF     +P P         LVKE P+VL+YHK  LLKG++TVNLIWYGKFTP QRSII
Sbjct  14   ILFSLFVLVPNPCLANSRILALVKEKPLVLKYHKSALLKGNVTVNLIWYGKFTPAQRSII  73

Query  456  VDFLESLKTVDA---PTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            VDF++SL   +    PTPS  SWW+TTE YKGG PS I +GKQI +E  S+GK LKD Q+
Sbjct  74   VDFIQSLSPKNKKIQPTPSAASWWRTTEAYKGG-PSVITVGKQIFDEKYSIGKLLKDPQL  132

Query  285  VQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ---VAYAWVGNSETQC  118
              LASK       + VVLT  DV+V+ FC  RCG HGST G+K+    AYAWVGNS +QC
Sbjct  133  EILASKVTRANS-IAVVLTAADVAVEDFCMNRCGMHGSTRGKKKGSKFAYAWVGNSASQC  191

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PGQCAWPF KPI GPQT PL +PNGD+G+DGM+I+LATV
Sbjct  192  PGQCAWPFQKPIVGPQTTPLGSPNGDIGVDGMVISLATV  230



>ref|XP_010461594.1| PREDICTED: protein EXORDIUM-like 2 [Camelina sativa]
Length=308

 Score =   253 bits (647),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 163/227 (72%), Gaps = 14/227 (6%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A+  + A+L   L      S   LVKE P+VL+YH G LLKG+ITVNL+WYGKFTP QRS
Sbjct  2    ASNYSFAILLTLLFATTGFSAAALVKEQPLVLKYHNGALLKGNITVNLVWYGKFTPIQRS  61

Query  462  IIVDFLESLKTVDAPTPSVES------WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTL  301
            +IVDF+ SL + DA + S  +      WWKTTEKYKGG  ST+V+GKQ+L EN  LGK+L
Sbjct  62   VIVDFIRSLNSKDASSSSSAAVPSVSSWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSL  120

Query  300  KDDQIVQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAW  142
            K+  +  L++K  G     + VVLT KDV+V+GFC  RCG+HGS+  + +      AY W
Sbjct  121  KNPYLRALSTKLNGGGLRAITVVLTAKDVTVEGFCMNRCGTHGSSGSKPRRAANGAAYVW  180

Query  141  VGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            VGNSETQCPG CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  181  VGNSETQCPGYCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  227



>ref|XP_006363278.1| PREDICTED: uncharacterized protein LOC102581378 [Solanum tuberosum]
Length=309

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 155/219 (71%), Gaps = 15/219 (7%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGE-----LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            LLF     +P PS        LVKE P+VL+YHKG LLKG++T+NLIWYGKFTP QR II
Sbjct  13   LLFSLFVLVPIPSLANSRILALVKEKPLVLKYHKGALLKGNVTLNLIWYGKFTPAQRLII  72

Query  456  VDFLESL----KTVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            VDF++SL    K + +P PSV SWW TTE YKGG  S I +GKQI +E  SLGK LKD Q
Sbjct  73   VDFIQSLNPKSKKITSP-PSVASWWSTTEAYKGGA-SVISLGKQIFDEKYSLGKYLKDPQ  130

Query  288  IVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQC  118
            +  LASK       + V+LT  DV VD FC  RCG HGST  +K  + AYAWVGNS +QC
Sbjct  131  LESLASKATRVN-SIAVILTATDVGVDDFCMNRCGMHGSTRLKKAGKFAYAWVGNSASQC  189

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PGQCAWPF KPI GPQ  PLVAPNGDVG+DG+IINLATV
Sbjct  190  PGQCAWPFQKPIVGPQITPLVAPNGDVGVDGLIINLATV  228



>ref|XP_003545684.1| PREDICTED: uncharacterized protein LOC100788174 [Glycine max]
Length=297

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = -1

Query  591  EPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV-DAPT  415
             P+ GE   E  +VL+YHKG LLKG ITVNL+WYG FTP QRS IVDF++SL +   AP 
Sbjct  21   NPTVGEQ-DEQNLVLQYHKGALLKGRITVNLLWYGSFTPIQRSTIVDFIKSLSSSPGAPL  79

Query  414  PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            PSV  WWKTTEKY GG  +T+V+GKQIL++  SLGK L   Q++ L+S+  N    +NVV
Sbjct  80   PSVAWWWKTTEKYNGGS-TTLVVGKQILQQTYSLGKYLNGTQLLYLSSRF-NDLNAINVV  137

Query  234  LTDKDVSVDGFCK-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            LT  DV VDGFC+ RCG+HGS  G+ ++ Y WVGNSE QCPGQCAWPFH+P  GPQTPPL
Sbjct  138  LTSNDVGVDGFCRSRCGTHGSINGKARIPYMWVGNSEAQCPGQCAWPFHQPAYGPQTPPL  197

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPN DVG+DGM+IN+AT+
Sbjct  198  VAPNADVGVDGMVINIATL  216



>ref|XP_003518235.1| PREDICTED: uncharacterized protein LOC100800380 [Glycine max]
Length=316

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 155/199 (78%), Gaps = 9/199 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP-TPSVESW  397
            LV+  P+VL+YHKG LLKG+IT++L+WYG FTPTQRSI++DFLESL +  AP  PSV +W
Sbjct  38   LVQNQPLVLKYHKGPLLKGNITLHLLWYGTFTPTQRSIVIDFLESLTSTSAPGAPSVSTW  97

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS----KGGNTEGCVNVVLT  229
            W+TTE Y+ GGP T+V+G QIL+E  SLGK+LK+D +V LAS         +  ++V+LT
Sbjct  98   WQTTESYR-GGPCTLVVGNQILDETYSLGKSLKNDHLVALASNPKLNSAPGDRVIHVILT  156

Query  228  DKDVSVDGFC-KRCGSHGS--TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
              DV+V+ FC  +CG+HG       +++AYAWVGNS TQCPGQCAWPFH+P+ GPQT PL
Sbjct  157  AADVAVEDFCMNQCGTHGRGKNGNSEKIAYAWVGNSVTQCPGQCAWPFHQPLYGPQTAPL  216

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPNGDVG+DGM+INLATV
Sbjct  217  VAPNGDVGVDGMVINLATV  235



>ref|XP_010060036.1| PREDICTED: protein EXORDIUM-like 2 [Eucalyptus grandis]
 gb|KCW66565.1| hypothetical protein EUGRSUZ_F00365 [Eucalyptus grandis]
Length=311

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 154/207 (74%), Gaps = 10/207 (5%)
 Frame = -1

Query  594  PEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT  415
            P P+   LV++ P+VL+YH G LLKG++T+NL+WYG F+P QR++++DFL SL    A +
Sbjct  25   PRPAAPALVQQQPLVLKYHNGPLLKGNVTLNLLWYGAFSPAQRAVVLDFLHSLSAAPAAS  84

Query  414  --PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE----  253
              P+V SWW TT +YKGG PS + +G QIL+E  SLGK+LK  Q+  LASK G       
Sbjct  85   RPPTVSSWWSTTARYKGG-PSNLAVGTQILDERYSLGKSLKTGQLAALASKAGYKSIKAR  143

Query  252  -GCVNVVLTDKDVSVDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPI  82
               +N+VLT  DV+VDGFC  RCG+HGS  AG+ +  YAWVGN+ +QCPGQCAWPFH+P 
Sbjct  144  ALAINLVLTSADVAVDGFCMSRCGTHGSGAAGKSRYTYAWVGNAVSQCPGQCAWPFHQPQ  203

Query  81   QGPQTPPLVAPNGDVGIDGMIINLATV  1
             GPQTPPLVAP+GDVG+DGM+INLATV
Sbjct  204  YGPQTPPLVAPSGDVGVDGMVINLATV  230



>ref|XP_009122517.1| PREDICTED: uncharacterized protein LOC103847210 [Brassica rapa]
Length=297

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 157/220 (71%), Gaps = 8/220 (4%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A     A L   L+     S   LV+E P+VL+YH G LLKG++T+NL+WYGKFT  QRS
Sbjct  2    AYTHRFAALLILLSATIGFSTAALVEEQPLVLKYHNGILLKGNVTLNLVWYGKFTSIQRS  61

Query  462  IIVDFLESLKTVDAPT--PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            IIVDF+ SL +   P+  PSV SWWKTTEKYKGG  STI++GKQ+L EN  LGK+LK   
Sbjct  62   IIVDFIRSLSSSAVPSKGPSVASWWKTTEKYKGG-SSTIIVGKQLLLENYPLGKSLKSPY  120

Query  288  IVQLASK--GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGE-KQVAYAWVGNSETQ  121
            +  L+ K  GG     + VVLT KDV+V+GFC  RCG+HG+ A      AY WVGNSETQ
Sbjct  121  LRALSGKLNGGGVR-SITVVLTAKDVAVEGFCMNRCGTHGAKARSVNSGAYVWVGNSETQ  179

Query  120  CPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            C G CAWPFH+P+ GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  180  CAGYCAWPFHQPMYGPQSPPLVAPNGDVGVDGMIINLATL  219



>ref|XP_010065640.1| PREDICTED: protein EXORDIUM-like 2 [Eucalyptus grandis]
 gb|KCW63230.1| hypothetical protein EUGRSUZ_G00849 [Eucalyptus grandis]
Length=297

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV++ P+VL+YH G LLKG+ITV+L+WYG+F+PTQRS+IVDF+ SL    +P PS  SWW
Sbjct  29   LVQQQPLVLKYHNGALLKGNITVDLVWYGRFSPTQRSVIVDFIRSLGYARSPPPSAASWW  88

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTEKY+GG  S +V+G+Q L E  +LGK+L++  +  LA       G + VVLT  DV+
Sbjct  89   RTTEKYRGGS-SNLVVGRQALHEAYTLGKSLENRHLRALAGNFNAAPGSITVVLTAADVA  147

Query  213  VDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVG  34
            V+ FC RCG+HGS        + WVGNSETQCPGQCAWPFH+P+ GPQTPPLVAP+GDVG
Sbjct  148  VEAFCMRCGTHGSA--RPGSTFVWVGNSETQCPGQCAWPFHQPVYGPQTPPLVAPSGDVG  205

Query  33   IDGMIINLATV  1
             DGM+INLAT+
Sbjct  206  ADGMVINLATL  216



>emb|CDX84508.1| BnaC03g49920D [Brassica napus]
Length=304

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 161/223 (72%), Gaps = 10/223 (4%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A  +  A+   FL  I   S   LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRS
Sbjct  2    AHNNRFAIFLTFLYAIAGLSAAALVEEQPLVLKYHNGVLLKGNVTVNLIWYGKFTPIQRS  61

Query  462  IIVDFLESLKTVDAPTPSVES---WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDD  292
            +IVDF+ SL + DA + +  S   WWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+ 
Sbjct  62   VIVDFIRSLNSKDAASSASPSVASWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNP  120

Query  291  QIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNS  130
             +  L++K       + V+LT KDV+V+GFC  RCGSHG++  + +      AY WVGNS
Sbjct  121  YLRSLSTKLNGGLRSITVILTAKDVTVEGFCMNRCGSHGTSVSKPRRAANGAAYVWVGNS  180

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            ET CPG CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  181  ETMCPGYCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  223



>ref|XP_010520896.1| PREDICTED: protein EXORDIUM-like 2 [Tarenaya hassleriana]
Length=305

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 161/224 (72%), Gaps = 11/224 (5%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A+ +  A+L    A   + S   LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRS
Sbjct  2    ASINRFAILLALFAVTVDLSAAALVEEQPLVLKYHNGVLLKGNVTVNLIWYGKFTPIQRS  61

Query  462  IIVDFLESLK-TVDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            IIVDF+ SL      P PSV +WWKTTEKYKGG  ST+++GKQ+L EN  LGK+LK   +
Sbjct  62   IIVDFIRSLNHPAAVPAPSVAAWWKTTEKYKGGA-STLLVGKQLLLENYPLGKSLKSPHL  120

Query  285  VQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV--------AYAWVGN  133
              L++K       + VVLT KDV+V+GFC  RCG+HGST    +         A+AWVGN
Sbjct  121  RALSTKLNGAVRSITVVLTAKDVAVEGFCMSRCGTHGSTGTSARRAAGSAHGGAFAWVGN  180

Query  132  SETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            SETQCPG CAWPFH+P+ GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  181  SETQCPGYCAWPFHQPMYGPQTPPLVAPNGDVGVDGMIINLATL  224



>ref|XP_009150498.1| PREDICTED: uncharacterized protein LOC103873843 [Brassica rapa]
 emb|CDY43802.1| BnaA06g23380D [Brassica napus]
Length=304

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 160/217 (74%), Gaps = 10/217 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+    L+ I   S G LV+E P+VL+YH G LLKG++TVNLIWYGKFTP QRS+IVDF+
Sbjct  8    AIFLTLLSAIAGLSAGALVEEQPLVLKYHNGVLLKGNVTVNLIWYGKFTPIQRSVIVDFI  67

Query  444  ESLKTVDAPTPSVES---WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
             SL + DA + +  S   WWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L+
Sbjct  68   RSLNSKDASSSAAPSVASWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNPYLRSLS  126

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPG  112
            +K       + V+LT KDV+V+GFC  RCGSHG++  + +      AY WVGNSET CPG
Sbjct  127  TKLNGGLRSITVILTAKDVTVEGFCMNRCGSHGTSVSKPRRAANGAAYIWVGNSETMCPG  186

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  187  YCAWPFHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  223



>gb|KCW63229.1| hypothetical protein EUGRSUZ_G00849 [Eucalyptus grandis]
Length=310

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV++ P+VL+YH G LLKG+ITV+L+WYG+F+PTQRS+IVDF+ SL    +P PS  SWW
Sbjct  29   LVQQQPLVLKYHNGALLKGNITVDLVWYGRFSPTQRSVIVDFIRSLGYARSPPPSAASWW  88

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            +TTEKY+GG  S +V+G+Q L E  +LGK+L++  +  LA       G + VVLT  DV+
Sbjct  89   RTTEKYRGGS-SNLVVGRQALHEAYTLGKSLENRHLRALAGNFNAAPGSITVVLTAADVA  147

Query  213  VDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVG  34
            V+ FC RCG+HGS        + WVGNSETQCPGQCAWPFH+P+ GPQTPPLVAP+GDVG
Sbjct  148  VEAFCMRCGTHGSA--RPGSTFVWVGNSETQCPGQCAWPFHQPVYGPQTPPLVAPSGDVG  205

Query  33   IDGMIINLATV  1
             DGM+INLAT+
Sbjct  206  ADGMVINLATL  216



>emb|CDY21583.1| BnaC09g47090D [Brassica napus]
Length=297

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 158/220 (72%), Gaps = 8/220 (4%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A    +A+L   L+     S   LV+E P+VL+YH G LLKG++T+NL+WYGKFT  QRS
Sbjct  2    AHTHRLAVLLILLSATIGFSSAALVEEQPLVLKYHNGILLKGNVTLNLVWYGKFTSIQRS  61

Query  462  IIVDFLESLKTVDAPT--PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            IIVDF+ SL +   P+  PSV SWWKTTEKYKGG  S IV+GKQ+L EN  LGK+LK   
Sbjct  62   IIVDFIRSLSSSAVPSKGPSVASWWKTTEKYKGG-SSKIVVGKQLLLENYPLGKSLKSPY  120

Query  288  IVQLASK--GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGE-KQVAYAWVGNSETQ  121
            +  L+ K  GG     + VVLT KDV+V+GFC  RCG+HG+ A      AY WVGNSETQ
Sbjct  121  LRALSGKLNGGGVR-SITVVLTAKDVAVEGFCMNRCGTHGAKARSVNSGAYVWVGNSETQ  179

Query  120  CPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            C G CAWPFH+P+ GPQ+PPL+APNGDVG+DGMIINLAT+
Sbjct  180  CAGYCAWPFHQPMYGPQSPPLIAPNGDVGVDGMIINLATL  219



>emb|CDX69904.1| BnaA10g22530D [Brassica napus]
Length=297

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 156/220 (71%), Gaps = 8/220 (4%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A     A L   L+     S   LV+E P+VL+YH G LLKG++T+NL+WYGKFT  QRS
Sbjct  2    AYTHRFAALLILLSATVGFSSAALVEEQPLVLKYHNGILLKGNVTLNLVWYGKFTSIQRS  61

Query  462  IIVDFLESLKTVDAPT--PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            IIVDF+ SL +   P+  PSV SWWKTTEKYKGG  S IV+GKQ+L EN  LGK+LK   
Sbjct  62   IIVDFIRSLSSSAVPSKGPSVASWWKTTEKYKGG-SSNIVVGKQLLLENYPLGKSLKSPY  120

Query  288  IVQLASK--GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGE-KQVAYAWVGNSETQ  121
            +  L+ K  GG     + VVLT KDV+V+GFC  RCG+HG+ A      AY WVGNSETQ
Sbjct  121  LRALSGKLNGGGVR-SITVVLTAKDVAVEGFCMNRCGTHGAKARSVNSGAYVWVGNSETQ  179

Query  120  CPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            C G CAWPFH+P+ GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  180  CAGYCAWPFHQPMYGPQSPPLVAPNGDVGVDGMIINLATL  219



>ref|XP_002513948.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48531.1| conserved hypothetical protein [Ricinus communis]
Length=308

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 149/194 (77%), Gaps = 4/194 (2%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV+E P+VL+YH G LLKG++ +NL+WYG F+  QRSIIVDFL SL +V  P+PSV SWW
Sbjct  35   LVQEQPLVLKYHNGPLLKGNVALNLLWYGNFSHIQRSIIVDFLNSLNSVKTPSPSVSSWW  94

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK-GGNTEGCVNVVLTDKDV  217
            +TT KY+ GGP T+ IG Q+L+EN SLGK+LK  Q+  LASK G   +  +N + T  DV
Sbjct  95   ETTGKYR-GGPCTVAIGNQVLDENYSLGKSLKLAQLPVLASKAGARGKNPINFIFTSDDV  153

Query  216  SVDGFC-KRCGSHGSTAGEK-QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNG  43
            +++GFC  RCG+HGS    K + AYAWVGNS  QCPGQCAWPFH+PI GPQ P LVAPNG
Sbjct  154  AIEGFCMSRCGTHGSGQDNKGKFAYAWVGNSVRQCPGQCAWPFHQPIYGPQNPALVAPNG  213

Query  42   DVGIDGMIINLATV  1
            DVGIDGM+IN+ATV
Sbjct  214  DVGIDGMVINVATV  227



>ref|XP_002285759.1| PREDICTED: protein EXORDIUM-like 2 [Vitis vinifera]
Length=301

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESW  397
             LV+E P++L+YH G LLKG+IT+NL+WYG F+P QRSI+VDFL+SL +      SV SW
Sbjct  32   SLVQEQPLILKYHNGPLLKGNITLNLVWYGNFSPIQRSILVDFLQSLNSHTTTPHSVSSW  91

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W+T +KYKG    T+ +G QIL+E+ SLGK+L+   I+ LAS+  N    + VV T  DV
Sbjct  92   WQTIQKYKGVS-CTLAVGNQILDEDYSLGKSLRSSDIISLASRS-NQRSEITVVFTSADV  149

Query  216  SVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            +V+GFC  RCG+HGST  + + AYAWVGNSETQCPGQCAWPFH+P+ GPQTPPLV+PNGD
Sbjct  150  AVEGFCMSRCGTHGST--QSKWAYAWVGNSETQCPGQCAWPFHQPMYGPQTPPLVSPNGD  207

Query  39   VGIDGMIINLATV  1
            VGIDGM+INLATV
Sbjct  208  VGIDGMLINLATV  220



>ref|XP_004299657.1| PREDICTED: uncharacterized protein LOC101298424 [Fragaria vesca 
subsp. vesca]
Length=307

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 151/196 (77%), Gaps = 8/196 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVES  400
            LVK+ P+VL+YHKG LL G++TVNL+WYG+F+P QRSI+VDFL+SL +V   +P P+V S
Sbjct  34   LVKQQPLVLKYHKGPLLAGNVTVNLVWYGRFSPKQRSILVDFLQSLSSVHRRSPQPTVAS  93

Query  399  WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKG--GNTEGCVNVVLTD  226
            WW T   Y G  P T+ +G QIL+E+ SLGKTL  +++  LA+KG  G     VNVVLTD
Sbjct  94   WWHTIAGYTGK-PCTVAVGNQILQESYSLGKTLTKEKLAVLAAKGWKGGKTTAVNVVLTD  152

Query  225  KDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
             DV+V+GFC  RCG+H S+ G    AYAWVGN   QCPGQCAWPFH+PI GPQTPPLV+P
Sbjct  153  GDVAVEGFCMSRCGNHASSRGGS--AYAWVGNPGKQCPGQCAWPFHQPIYGPQTPPLVSP  210

Query  48   NGDVGIDGMIINLATV  1
            NGDVGIDGM+INLATV
Sbjct  211  NGDVGIDGMVINLATV  226



>ref|XP_008349972.1| PREDICTED: uncharacterized protein LOC103413276 [Malus domestica]
Length=310

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 7/197 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESW  397
            LV++ P+VL YH G LLKG++TVN++WYGKF+P+QRSI+VDF++SL +    P PSV SW
Sbjct  34   LVQQQPLVLNYHNGPLLKGNLTVNIVWYGKFSPSQRSILVDFVQSLSSGQRTPQPSVSSW  93

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE-GCVNVVLTDKD  220
            W+TT  YK GGPST ++G QIL+E  SLGK L D ++V LA+K    +   +NVVLT  D
Sbjct  94   WQTTGGYK-GGPSTPIVGNQILDETYSLGKALTDQKLVALAAKASKGQNAAINVVLTGAD  152

Query  219  VSVDGFC-KRCGSHGS-TAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            V+VDGFC  RCGSHGS   G K  ++AYAWVGN  +Q PGQCAWPFH+PI GPQTPPLV 
Sbjct  153  VTVDGFCSSRCGSHGSGIEGRKTGKLAYAWVGNPASQAPGQCAWPFHQPIYGPQTPPLVP  212

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVGIDGM+I+LATV
Sbjct  213  PNGDVGIDGMVISLATV  229



>ref|XP_003531542.1| PREDICTED: uncharacterized protein LOC100785002 [Glycine max]
Length=295

 Score =   248 bits (633),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = -1

Query  555  VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK-TVDAPTPSVESWWKTTEK  379
            ++L YH G LLKG+ITVNL+WYG FTP QRSII+DF+ SL  T  AP PSV SWWKTT+K
Sbjct  27   LMLPYHNGALLKGTITVNLLWYGSFTPIQRSIILDFINSLSSTAGAPLPSVASWWKTTDK  86

Query  378  YKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC  199
            Y+GG  +TIV+GKQILE+  SLG  L   Q+V L+S+  +    +NVVLT  DV VDGFC
Sbjct  87   YRGGS-TTIVLGKQILEQTYSLGNYLNGTQLVSLSSRFDHLN-AINVVLTSSDVGVDGFC  144

Query  198  K-RCGSHGS-TAGEK-QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGID  28
            + RCG+HGS T G+K ++ Y WVGNSE QCPGQCAWPFH+P  GPQ PPL+APNGDVG+D
Sbjct  145  RSRCGTHGSITNGQKARIPYVWVGNSEAQCPGQCAWPFHQPAYGPQAPPLIAPNGDVGLD  204

Query  27   GMIINLATV  1
            GM+IN+AT+
Sbjct  205  GMVINVATL  213



>ref|XP_009341761.1| PREDICTED: uncharacterized protein LOC103933804 [Pyrus x bretschneideri]
Length=310

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 7/197 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVESW  397
            LV++ P+VL YHKG LLKG++ VN++WYGKF+P+QRSI+VDF++SL +    + PSV SW
Sbjct  34   LVQQQPLVLNYHKGPLLKGNLAVNIVWYGKFSPSQRSILVDFVQSLSSGQRTSQPSVSSW  93

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE-GCVNVVLTDKD  220
            W+TT  YK GGPST  +G QIL+E  SLGK L D ++V LA+K    +   +NVVLT  D
Sbjct  94   WQTTGGYK-GGPSTPTVGNQILDETYSLGKVLTDQKLVALAAKASKGQNAAINVVLTGAD  152

Query  219  VSVDGFC-KRCGSHGS-TAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            V+VDGFC  RCGSHGS   G K  ++AYAWVGN  +QCPGQCAWPFH+PI GPQTPPLV 
Sbjct  153  VTVDGFCSSRCGSHGSGIEGRKTGKLAYAWVGNPASQCPGQCAWPFHQPIYGPQTPPLVP  212

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVGIDGM+I+LATV
Sbjct  213  PNGDVGIDGMVISLATV  229



>ref|XP_006280854.1| hypothetical protein CARUB_v10026839mg [Capsella rubella]
 gb|EOA13752.1| hypothetical protein CARUB_v10026839mg [Capsella rubella]
Length=305

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 153/205 (75%), Gaps = 11/205 (5%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            S   LV+E P+VL+YH G LLKG+ITVNL+WYGKFTP QRS+IVDF+ SL + DA + + 
Sbjct  21   SAAALVEEQPLVLKYHNGVLLKGNITVNLVWYGKFTPIQRSVIVDFIRSLNSKDAVSSAA  80

Query  405  ES----WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
                  WWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+  +  L++K       + V
Sbjct  81   APSVASWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNPYLRALSTKLNGGLRSITV  139

Query  237  VLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGNSETQCPGQCAWPFHKPIQG  76
            VLT KDV+V+GFC  RCG+HGS+  + +      AY WVGNSET CPG CAWPFH+PI G
Sbjct  140  VLTAKDVTVEGFCMNRCGTHGSSGSKPRRAANGAAYVWVGNSETLCPGYCAWPFHQPIYG  199

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQTPPLV+PNGDVG+DGMIINLAT+
Sbjct  200  PQTPPLVSPNGDVGVDGMIINLATL  224



>gb|EYU29610.1| hypothetical protein MIMGU_mgv1a027015mg, partial [Erythranthe 
guttata]
Length=280

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 150/196 (77%), Gaps = 6/196 (3%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE-SLKTVDAPTPSVESW  397
            L+K  P+VL+YH G LLKG++TVNLIWYGKFT  Q+SI+VDFL+    +     PSV SW
Sbjct  4    LIKPNPIVLKYHNGKLLKGNVTVNLIWYGKFTSPQKSILVDFLQSLSPSRPPAPPSVASW  63

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W TT  YK GGPS I++GKQ+++E  SLGK+LKD QI  LA+K G     VNVVLT  DV
Sbjct  64   WSTTATYK-GGPSNILLGKQVVDEKYSLGKSLKDAQITALATKAGLGPSAVNVVLTSADV  122

Query  216  SVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            +V+ FC   CG+HG T+G+K   + AYAWVGNS  QCPGQCAWPF+KP+ GPQTPPLVAP
Sbjct  123  AVEDFCMNTCGTHGYTSGKKPDDKYAYAWVGNSGKQCPGQCAWPFYKPVVGPQTPPLVAP  182

Query  48   NGDVGIDGMIINLATV  1
            NGDVGIDGM+INLATV
Sbjct  183  NGDVGIDGMVINLATV  198



>emb|CBI19177.3| unnamed protein product [Vitis vinifera]
Length=301

 Score =   245 bits (626),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 148/193 (77%), Gaps = 5/193 (3%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESW  397
             LV+E P++L+YH G LLKG+IT+NL+WYG F+P QRSI+VDFL+SL +      SV SW
Sbjct  77   SLVQEQPLILKYHNGPLLKGNITLNLVWYGNFSPIQRSILVDFLQSLNSHTTTPHSVSSW  136

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W+T +KYKG    T+ +G QIL+E+ SLGK+L+   I+ LAS+  N    + VV T  DV
Sbjct  137  WQTIQKYKGVS-CTLAVGNQILDEDYSLGKSLRSSDIISLASRS-NQRSEITVVFTSADV  194

Query  216  SVDGF-CKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            +V+GF   RCG+HGST  + + AYAWVGNSETQCPGQCAWP H+P+ GPQTPPLV+PNGD
Sbjct  195  AVEGFFMSRCGTHGST--QSKWAYAWVGNSETQCPGQCAWPLHQPMYGPQTPPLVSPNGD  252

Query  39   VGIDGMIINLATV  1
            VGIDGM+INLATV
Sbjct  253  VGIDGMVINLATV  265



>ref|XP_008807998.1| PREDICTED: uncharacterized protein LOC103720179 [Phoenix dactylifera]
Length=309

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F + + +P    LV++ P+VL+YH G LL G++TV+L+WYG+F+ +QRSII DF+ SL  
Sbjct  22   FHSSMADPRKLSLVQQQPLVLQYHNGPLLTGNLTVHLLWYGRFSASQRSIIADFVRSLSG  81

Query  429  VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEG  250
                 PS  SWW TT  Y+G   S + +G+Q+L+E  SLGK+L    +  LAS+ G+   
Sbjct  82   ASPAVPSAASWWSTTALYRGAA-SRLSLGRQLLDEKYSLGKSLTSADLATLASRAGHHRN  140

Query  249  CVNVVLTDKDVSVDGFC-KRCGSHGST----AGEKQVAYAWVGNSETQCPGQCAWPFHKP  85
             V  VLT  DV+V+GFC  RCG+HGS      G  + AY W+GNSE QCPGQCAWPFH+P
Sbjct  141  AVTAVLTSSDVAVEGFCMSRCGTHGSAPAGRRGRVRFAYIWIGNSEVQCPGQCAWPFHQP  200

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            I GPQTPPLVAPNGDVGIDGM+INLAT+
Sbjct  201  IYGPQTPPLVAPNGDVGIDGMVINLATL  228



>ref|XP_002285775.1| PREDICTED: protein EXORDIUM-like 2 [Vitis vinifera]
Length=301

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 148/193 (77%), Gaps = 5/193 (3%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESW  397
             LV+E P++L+YH G LLKG+IT+NL+WYG F+P QRSI+VDFL+SL +      SV SW
Sbjct  32   SLVQEQPLILKYHNGPLLKGNITLNLVWYGNFSPIQRSILVDFLQSLNSHTTTPHSVSSW  91

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W+T +KYKG    T+ +G QIL+E+ SLGK+L+   I+ LAS+  N    + VV T  DV
Sbjct  92   WQTIQKYKGVS-CTLAVGNQILDEDYSLGKSLRSSDIISLASRS-NQRSEITVVFTSADV  149

Query  216  SVDGF-CKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGD  40
            +V+GF   RCG+HGST  + + AYAWVGNSETQCPGQCAWP H+P+ GPQTPPLV+PNGD
Sbjct  150  AVEGFFMSRCGTHGST--QSKWAYAWVGNSETQCPGQCAWPLHQPMYGPQTPPLVSPNGD  207

Query  39   VGIDGMIINLATV  1
            VGIDGM+INLATV
Sbjct  208  VGIDGMVINLATV  220



>ref|XP_008808001.1| PREDICTED: uncharacterized protein LOC103720182 [Phoenix dactylifera]
Length=314

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 150/201 (75%), Gaps = 11/201 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA----PTPSV  406
            LV+E   VL YHKGTLL G ++VNLIWYGKFT +QR+II DFL SL T       P PSV
Sbjct  34   LVEEQSPVLTYHKGTLLTGPVSVNLIWYGKFTASQRAIISDFLTSLSTKGGDQKQPEPSV  93

Query  405  ESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             +WWKTTEKY     +   T+++G+QIL+++CSLGK+L D  I +LA +G      VNVV
Sbjct  94   SAWWKTTEKYYAQSKTKFPTLMVGEQILDDSCSLGKSLTDADIAKLAGRGAPKHA-VNVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            LT  DV+V+GFC  RCG+HGS+   K  + AY WVGNS TQCPGQCAWPFH+P+ GPQTP
Sbjct  153  LTTDDVAVEGFCMSRCGTHGSSPRSKSGRFAYIWVGNSATQCPGQCAWPFHQPVYGPQTP  212

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLVAPNGDVGIDGM++NLA++
Sbjct  213  PLVAPNGDVGIDGMVMNLASM  233



>ref|XP_007223146.1| hypothetical protein PRUPE_ppa009026mg [Prunus persica]
 gb|EMJ24345.1| hypothetical protein PRUPE_ppa009026mg [Prunus persica]
Length=309

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 152/198 (77%), Gaps = 10/198 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV++ P+ L+YHKG LLKG+ITVN++WYGKF+P QRSI+VDF++SL +     PSV SWW
Sbjct  34   LVQQQPLTLKYHKGPLLKGNITVNVVWYGKFSPIQRSILVDFVQSLSSHHTTQPSVSSWW  93

Query  393  KTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDD---QIVQLASKGGNTEGCVNVVLTDK  223
            +TTE+Y+ GGP T+ +G QIL++  SLG+TL D     +   AS G N    VNVVLTD 
Sbjct  94   QTTERYR-GGPCTVAVGNQILDQTYSLGRTLTDQKLAALAAKASTGRN--AAVNVVLTDA  150

Query  222  DVSVDGFC-KRCGSHGSTA-GEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+VDGFC  RCGSHGS   G K  ++AYAWVGN  +QCPGQCAWPFH+P+ GPQT PLV
Sbjct  151  DVAVDGFCMSRCGSHGSGGVGRKTGRLAYAWVGNPGSQCPGQCAWPFHQPMYGPQTAPLV  210

Query  54   APNGDVGIDGMIINLATV  1
             PNGDVG+DGM+I+LATV
Sbjct  211  PPNGDVGVDGMVISLATV  228



>ref|XP_003544805.1| PREDICTED: uncharacterized protein LOC100792751 [Glycine max]
Length=316

 Score =   244 bits (623),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 9/199 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL-KTVDAPTPSVESW  397
            LV++ P+VL+YHKG LLKG+IT++L+WYG FTPTQRSI++DFLESL  T    +PSV +W
Sbjct  38   LVQKQPLVLKYHKGPLLKGNITLHLLWYGTFTPTQRSIVIDFLESLTSTSSPESPSVSTW  97

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS----KGGNTEGCVNVVLT  229
            WKTTE Y+ GGP T+V+G QIL+EN SLGK+LK+D +V LAS         +  V+V+LT
Sbjct  98   WKTTESYR-GGPCTLVVGNQILDENYSLGKSLKNDNLVALASNPKLNSAPGDRVVHVILT  156

Query  228  DKDVSVDGFC-KRCGSHGS--TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
              DV+V+ FC  +CG+HG       +++AYAWVGNS TQCPGQCAWPFH+P+ GPQTPPL
Sbjct  157  AADVAVEDFCMNQCGTHGRGKNGNSEKIAYAWVGNSVTQCPGQCAWPFHQPLYGPQTPPL  216

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPNGDVG+DGM+INLATV
Sbjct  217  VAPNGDVGVDGMVINLATV  235



>ref|XP_009631998.1| PREDICTED: protein EXORDIUM-like 2 [Nicotiana tomentosiformis]
Length=314

 Score =   244 bits (622),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 149/197 (76%), Gaps = 8/197 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL---KTVDAPTPSVE  403
            LV++PP+VL+YH G LLKG +T+NLIWYGKF+  QR+II+DF++SL    T   P  S  
Sbjct  39   LVEQPPLVLKYHNGALLKGHVTINLIWYGKFSSNQRAIIIDFIQSLSPNHTRRQPHHSAG  98

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            SWW+TTE+YKGG PS I +GKQI ++  S GK LKD Q+  LASK   +   + VVLT  
Sbjct  99   SWWRTTEEYKGG-PSVISLGKQIFDQKYSQGKLLKDPQLESLASKATQSN-SIAVVLTAA  156

Query  222  DVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            DV+V+ FC  RCG H  T G+K  + AYAWVGNS +QCPGQCAWPF+KPI GPQTPPLVA
Sbjct  157  DVAVEDFCLNRCGMHEWTRGKKGSKYAYAWVGNSASQCPGQCAWPFYKPIVGPQTPPLVA  216

Query  51   PNGDVGIDGMIINLATV  1
            PNGDVG+DGM+INLATV
Sbjct  217  PNGDVGVDGMVINLATV  233



>ref|XP_006853274.1| hypothetical protein AMTR_s00038p00236640 [Amborella trichopoda]
 gb|ERN14741.1| hypothetical protein AMTR_s00038p00236640 [Amborella trichopoda]
Length=306

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 160/239 (67%), Gaps = 24/239 (10%)
 Frame = -1

Query  699  SSFHLKALALSIMAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLK  520
            S+FHL  LALS+    +   T  A                 ELV++ P+ L+YH G +L 
Sbjct  5    STFHLFFLALSLFHFASAARTTPA-----------------ELVQDQPLSLKYHNGHVLS  47

Query  519  GSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPST---IV  349
            G I VNLIWYG FTP+QR+II D   SL +    +PSV SWW+TT++Y+    S    + 
Sbjct  48   GRIAVNLIWYGSFTPSQRAIISDLFLSLSSPKPTSPSVSSWWQTTQRYRPASSSRSLRLT  107

Query  348  IGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGS-  175
            + KQIL+ + SLGKTL + Q+V LASKG + +  +NVVLT KDV+V+GFC  RCG+HGS 
Sbjct  108  LNKQILDTSYSLGKTLTNAQLVALASKG-DEKNAINVVLTAKDVAVEGFCSSRCGTHGSA  166

Query  174  -TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             +A   + AY WVGNSETQCPGQCAWPFH+PI GPQTP LVAPNGDVG+DGM IN+ ++
Sbjct  167  RSAHRTKFAYIWVGNSETQCPGQCAWPFHQPIYGPQTPALVAPNGDVGMDGMAINVGSL  225



>ref|XP_009792435.1| PREDICTED: protein EXORDIUM-like 2 [Nicotiana sylvestris]
Length=310

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 9/198 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA---PTPSVE  403
            LVKE P+VL+YHKGTLLKG++TVNLIWYGKFTP QRSIIVDF++SL   +    P PS  
Sbjct  34   LVKEKPLVLKYHKGTLLKGNVTVNLIWYGKFTPAQRSIIVDFIQSLSPKNKKIQPPPSAA  93

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            SWW+TTE YKGG PS I +GKQI +E  S+GK LKD ++  LASK       + VVLT  
Sbjct  94   SWWRTTEAYKGG-PSVITLGKQIFDEKYSVGKLLKDHELEILASKITQANS-IAVVLTAA  151

Query  222  DVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV+V+ FC  RCG HGST  +K   + AYAWVGNS +QCPGQCAWPF KPI GPQT PL 
Sbjct  152  DVAVEDFCMNRCGMHGSTHVKKIGSKFAYAWVGNSASQCPGQCAWPFQKPIVGPQTMPLG  211

Query  54   APNGDVGIDGMIINLATV  1
            +PNGD+G+DGM+I LATV
Sbjct  212  SPNGDIGVDGMVICLATV  229



>ref|XP_010444357.1| PREDICTED: protein EXORDIUM-like 2 [Camelina sativa]
Length=322

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 161/224 (72%), Gaps = 11/224 (5%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A+  + A+L   L      S   LVKE P+VL+YH G LLKG+ITVNL+ YGKFTP QRS
Sbjct  19   ASYYSFAILLTLLFATTGFSAAALVKEQPLVLKYHNGALLKGNITVNLVCYGKFTPIQRS  78

Query  462  IIVDFLESLKTVDAPTPSVES---WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDD  292
            +IVDF+ SL + DA + +V S   WWKTTEKYKGG  ST+V+GKQ+L EN  LGK+LK+ 
Sbjct  79   VIVDFIRSLNSKDASSAAVPSVSSWWKTTEKYKGGS-STLVVGKQLLLENYPLGKSLKNP  137

Query  291  QIVQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQ-----VAYAWVGN  133
             +  L++K  G     + VVLT KDV+V+GFC  RCG+HGS+  + +      AY WVGN
Sbjct  138  YLRALSTKLNGGGLRAITVVLTAKDVTVEGFCMNRCGTHGSSGSKPRRAANGAAYVWVGN  197

Query  132  SETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            SETQCPG CAWPFH+PI GPQT  LVAPNGDVG+DGMIINLAT+
Sbjct  198  SETQCPGYCAWPFHQPIYGPQTVTLVAPNGDVGVDGMIINLATL  241



>ref|XP_010098621.1| hypothetical protein L484_012733 [Morus notabilis]
 gb|EXB75360.1| hypothetical protein L484_012733 [Morus notabilis]
Length=294

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 156/227 (69%), Gaps = 20/227 (9%)
 Frame = -1

Query  663  MAVINNCAT-ASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYG  487
            MA  N+ A  AS   LLF             LV+    +L+YH G LL G+ITVNLIWYG
Sbjct  1    MAFFNHLALPASLFVLLFA------------LVESQSPLLKYHNGPLLNGNITVNLIWYG  48

Query  486  KFTPTQRSIIVDFLESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLG  310
            KF+PTQRSI VDFL SL +     T SV SWWKT   Y+GG PS +V+G QIL+E CSLG
Sbjct  49   KFSPTQRSISVDFLYSLGSHTRTHTTSVSSWWKTIGSYRGG-PSAVVVGNQILDERCSLG  107

Query  309  KTLKDDQIVQLASKGGNTE---GCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEKQVAYAW  142
            K L    ++ LA KGG        VNVVLT  DV+V+GFC  RCG+HG+  G K V YAW
Sbjct  108  KLLTTQNLIALALKGGGRGRGRNAVNVVLTADDVAVEGFCSSRCGTHGTARGRKAV-YAW  166

Query  141  VGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            VGNS +QCPGQCAWPFH+PI GPQTPPLV+P+GDVG+DGM+INLATV
Sbjct  167  VGNSVSQCPGQCAWPFHQPIYGPQTPPLVSPSGDVGVDGMVINLATV  213



>ref|XP_006383500.1| hypothetical protein POPTR_0005s17230g [Populus trichocarpa]
 gb|ERP61297.1| hypothetical protein POPTR_0005s17230g [Populus trichocarpa]
Length=319

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 148/204 (73%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  36   QDPLLFQYHNGPLLTGEISINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAQPSVATWWK  95

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E+CSLGK+L   QI+QLASKGG  +G +NVVLT
Sbjct  96   ATEKYYNLVKTKKTSPLLLSVGTQILDESCSLGKSLSSKQILQLASKGGQ-KGSINVVLT  154

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   K +       AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  155  SSDVAVEGFCSSKCGTHGSSLSAKTINAKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  214

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  215  QNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_003522787.2| PREDICTED: uncharacterized protein LOC100810910 [Glycine max]
Length=356

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 144/192 (75%), Gaps = 10/192 (5%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWKTTEKY  376
             +YHKG LL G+I+VNLIWYG F P+QR+II DF+ SL +    T  PSV +WWK TEKY
Sbjct  85   FQYHKGPLLSGNISVNLIWYGSFKPSQRAIISDFITSLSSSPKSTAQPSVATWWKGTEKY  144

Query  375  -----KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
                     PS T+ +G QIL+EN SLGK+L  D IV LASKG   +  +NVVLT  DV+
Sbjct  145  YQLIKSAPKPSLTLALGAQILDENYSLGKSLTTDNIVSLASKGAPNDA-INVVLTFSDVT  203

Query  213  VDGFCK-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDV  37
            V+GFC  RCG+HGS+ G  ++AY WVGNSETQCPGQCAWPFH+PI GPQ+PPLVAPN DV
Sbjct  204  VEGFCSSRCGTHGSSVGHGKLAYVWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDV  263

Query  36   GIDGMIINLATV  1
            G+DGM+IN+AT+
Sbjct  264  GLDGMVINVATL  275



>emb|CDP21253.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 154/217 (71%), Gaps = 14/217 (6%)
 Frame = -1

Query  618  LFCFLAGIPE-----PSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            LF  LA +P      P    LVK  P+VL+YHKG LLKG+ TVNL+WYGKFTP+QR+I+V
Sbjct  14   LFALLAILPGSFSAIPRKLALVKPEPIVLKYHKGELLKGNTTVNLLWYGKFTPSQRAIVV  73

Query  453  DFLESLKTVDA---PTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIV  283
            DFL+SL        P  +V SWW TT+KY G  PSTI +GKQ+   N  LGK LKD QI 
Sbjct  74   DFLKSLSPTSRRGPPPQTVASWWSTTQKYLGS-PSTIAVGKQV-SLNYPLGKELKDSQIQ  131

Query  282  QLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPG  112
             L SK  +    VN+VLT  DV+V+ FC   CG+HG T G K  + AYAWVGN+ +QCPG
Sbjct  132  ALTSKFSHVN-TVNLVLTASDVAVEDFCMNSCGTHGWTRGSKGQKYAYAWVGNAVSQCPG  190

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            +CAWPFH+PI GPQTPPLVAPNGDVGIDG++INLATV
Sbjct  191  ECAWPFHRPIVGPQTPPLVAPNGDVGIDGLVINLATV  227



>ref|XP_006387583.1| hypothetical protein POPTR_0815s00210g [Populus trichocarpa]
 gb|ERP46497.1| hypothetical protein POPTR_0815s00210g [Populus trichocarpa]
Length=361

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 147/204 (72%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  78   QDPLLFQYHNGPLLTGEISINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAQPSVATWWK  137

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E  SLGK+L   QIVQLASKGG  +G +NVVLT
Sbjct  138  ATEKYYNLVKTKKTSPLLLSVGAQILDERYSLGKSLSSKQIVQLASKGGQ-KGAINVVLT  196

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   K++       AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  197  SSDVAVEGFCSSKCGTHGSSLSAKKINGKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  256

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  257  QNPPLVAPNNDVGLDGMVINLASL  280



>ref|XP_010937404.1| PREDICTED: protein EXORDIUM-like 2 [Elaeis guineensis]
Length=308

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 146/208 (70%), Gaps = 6/208 (3%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   + +P    LV++ P+VL+YH G LL G++TV+L+WYG+F+ +QRSII DF+ SL  
Sbjct  21   FPYSMADPRKLSLVQQQPLVLQYHNGPLLTGNLTVHLLWYGRFSASQRSIIADFVRSLSA  80

Query  429  VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEG  250
            V    PS  SWW TT +Y+G   + I +G Q+L+E  SLGK+L    +V LA++ G+   
Sbjct  81   VSPAAPSTASWWSTTARYRGAA-TRISLGLQLLDEKYSLGKSLTSADLVTLAARAGHHRD  139

Query  249  CVNVVLTDKDVSVDGFC-KRCGSHGST----AGEKQVAYAWVGNSETQCPGQCAWPFHKP  85
             V  VLT  DV+V+GFC  RCG+HGS      G  +  Y WVG+SE QCPGQCAWPFH+P
Sbjct  140  SVTAVLTSSDVAVEGFCMSRCGTHGSAPAGRRGRVRFTYLWVGDSEVQCPGQCAWPFHQP  199

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            + GPQTPPLVAPNGDVG+DGM+INLAT+
Sbjct  200  MYGPQTPPLVAPNGDVGMDGMVINLATL  227



>ref|XP_010937409.1| PREDICTED: protein EXORDIUM-like [Elaeis guineensis]
Length=314

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 148/201 (74%), Gaps = 11/201 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA----PTPSV  406
            LV+EP  VL YHKG LL G+++VNLIWYGKFT +QR+II DF+ SL T       P PSV
Sbjct  34   LVEEPSPVLTYHKGALLTGTVSVNLIWYGKFTASQRAIISDFVTSLSTKGGGQKQPEPSV  93

Query  405  ESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             +WWKTTEKY     +   T+ +G QIL+E+ SLGK+L D  I +LAS+G      VNVV
Sbjct  94   SAWWKTTEKYYSQSKTKFPTLTLGDQILDESYSLGKSLTDADIAKLASRGAPNYA-VNVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            LT  DV+V+GFC  RCG+HGS+   K  + AY WVGNS TQCPGQCAWPFH+P+ GPQ+P
Sbjct  153  LTADDVAVEGFCMSRCGTHGSSPRSKSGRFAYIWVGNSATQCPGQCAWPFHQPVYGPQSP  212

Query  63   PLVAPNGDVGIDGMIINLATV  1
             LVAPNGDVGIDGM+INLA++
Sbjct  213  ALVAPNGDVGIDGMVINLASM  233



>ref|XP_002307374.1| hypothetical protein POPTR_0005s17200g [Populus trichocarpa]
 gb|EEE94370.1| hypothetical protein POPTR_0005s17200g [Populus trichocarpa]
Length=319

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 147/204 (72%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G +++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  36   QDPLLFQYHNGPLLTGEVSINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAQPSVATWWK  95

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E  SLGK+L   QIVQLASKGG  +G +NVVLT
Sbjct  96   ATEKYYNLVKTKKTSPLLLSVGAQILDERYSLGKSLSSKQIVQLASKGGQ-KGAINVVLT  154

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   K++       AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  155  SSDVAVEGFCSSKCGTHGSSLSAKKINGKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  214

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  215  QNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_002301062.2| phosphate-responsive family protein [Populus trichocarpa]
 gb|EEE80335.2| phosphate-responsive family protein [Populus trichocarpa]
Length=319

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 155/239 (65%), Gaps = 19/239 (8%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGK  484
            MA +N      ++ L+  F          ELV++ P +L YH G LL G I+VNLIWYGK
Sbjct  1    MASLNFQFALKSLLLVCLFHVSFAARKLNELVQDQPQLLRYHDGALLYGKISVNLIWYGK  60

Query  483  FTPTQRSIIVDFLESLK----TVDAPTPSVESWWKTTEKY----KGGGPSTIVIGKQILE  328
            F P+QR+II DF+ SL     ++    PSV  WW+TTEKY          ++ +G QIL+
Sbjct  61   FKPSQRAIISDFVTSLSVSPSSLKDSQPSVAKWWETTEKYYHLTSKKNTLSLTLGTQILD  120

Query  327  ENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---  160
               SLGK+L D QIV+LASKG + +  VN+VLT  DV+V+GFC  RCG+HGS  G K   
Sbjct  121  AKYSLGKSLTDKQIVELASKG-DQKDAVNIVLTSSDVTVEGFCLNRCGTHGSALGSKSGN  179

Query  159  ------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
                  + AY WVGNSETQCPG CAWPFH+PI GPQ PPLVAPN DVG+DGM+INLA++
Sbjct  180  IKGKNYRFAYIWVGNSETQCPGYCAWPFHQPIYGPQNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_009631899.1| PREDICTED: protein EXORDIUM-like [Nicotiana tomentosiformis]
Length=319

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 148/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV+EP   +L+YHKGTLL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  35   LVQEPQNQLLQYHKGTLLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKADPSVA  94

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +N+V
Sbjct  95   KWWKTTEKYYHLANSKKSLSLYLGKQVLIENYSLGKSLTQKQIVQLASKGEQKDA-INIV  153

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+H S+ G        + AY WVGNSETQCPG CAWPFH+PI G
Sbjct  154  LTASDVAVDGFCVNRCGTHESSKGAIIRGKTYKFAYIWVGNSETQCPGYCAWPFHQPIYG  213

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPLVAPN DVG+DGM+INLA++
Sbjct  214  PQSPPLVAPNNDVGVDGMVINLASL  238



>ref|XP_010937408.1| PREDICTED: protein EXORDIUM-like [Elaeis guineensis]
Length=314

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 149/201 (74%), Gaps = 11/201 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA----PTPSV  406
            LV+E   VL YHKG LL G ++VNLIWYGKFT  QR+II DF+ SL T+      P PSV
Sbjct  34   LVEEQSPVLSYHKGILLTGPVSVNLIWYGKFTAPQRAIISDFIASLATMGGDQKQPEPSV  93

Query  405  ESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             +WWKTTE+Y     +   T+++G QIL+E+ SLGK+L +  I +LAS+G   +  VNVV
Sbjct  94   STWWKTTERYYAQSKTKFPTLMLGDQILDESYSLGKSLTNADIAKLASRGA-PKNAVNVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            LT  DV+V+GFC  RCG+HGS+ G K  + AY WVGNS TQCPGQCAWPFH+P+ GPQTP
Sbjct  153  LTADDVAVEGFCMSRCGTHGSSPGSKSGRFAYIWVGNSATQCPGQCAWPFHQPVYGPQTP  212

Query  63   PLVAPNGDVGIDGMIINLATV  1
             LVAPNGDVGIDGM+INLA++
Sbjct  213  ALVAPNGDVGIDGMVINLASM  233



>ref|XP_010320183.1| PREDICTED: protein EXORDIUM-like [Solanum lycopersicum]
Length=314

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 148/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV+EP + +LEYHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  30   LVQEPQMQLLEYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTNPSVA  89

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WW+TTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  90   QWWQTTEKYYHLANSKNTLSLNLGKQVLIENYSLGKSLTQKQIVQLASKGEQRDA-INVV  148

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  149  LTASDVAVDGFCVNRCGTHGSSKGAVIKGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYG  208

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPLVAPN DVG+DGM+INLA++
Sbjct  209  PQSPPLVAPNNDVGVDGMVINLASL  233



>ref|XP_006433958.1| hypothetical protein CICLE_v10001854mg [Citrus clementina]
 gb|ESR47198.1| hypothetical protein CICLE_v10001854mg [Citrus clementina]
 gb|KDO81008.1| hypothetical protein CISIN_1g020726mg [Citrus sinensis]
Length=322

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 19/207 (9%)
 Frame = -1

Query  567  KEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPTPSVES  400
            ++P  +L+YH G LL G I +NLIWYGKF P+Q++II DF+ SL +    + A  PSV +
Sbjct  36   QQPDRLLQYHNGALLSGKIAINLIWYGKFNPSQKAIISDFITSLSSYSSQLKASQPSVAT  95

Query  399  WWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            WWKTTEKY          ++ +GKQI +E CSLGK+LK+  IV+LASKG + +  +NVVL
Sbjct  96   WWKTTEKYYHLISKKSTLSLSLGKQISDETCSLGKSLKNGDIVKLASKG-DQKDAINVVL  154

Query  231  TDKDVSVDGFC-KRCGSHGSTAG---------EKQVAYAWVGNSETQCPGQCAWPFHKPI  82
            T  DV+V+GFC  RCG+HGS +G           + AY WVGNSETQCPGQCAWPFH+PI
Sbjct  155  TASDVAVEGFCMSRCGTHGSASGSIKSSGHNKNNKFAYIWVGNSETQCPGQCAWPFHQPI  214

Query  81   QGPQTPPLVAPNGDVGIDGMIINLATV  1
             GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  215  YGPQSPPLVAPNNDVGLDGMVINLASL  241



>gb|KHN08948.1| hypothetical protein glysoja_021770 [Glycine soja]
Length=308

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = -1

Query  543  YHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVESWWKTTEKY---  376
            YHKG LL G I+VNLIWYG F P+QR+II DF+ SL +  +   PSV +WWK T+KY   
Sbjct  42   YHKGPLLSGKISVNLIWYGNFKPSQRAIISDFITSLSSHKSTAQPSVATWWKGTQKYYQL  101

Query  375  -KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC  199
             K     T+ +G QIL+EN SLGK+L +D IV LASKG + +  +NVVLT  DV+V+GFC
Sbjct  102  IKSSPKLTLTLGTQILDENYSLGKSLTNDNIVSLASKGASKD-AINVVLTSSDVTVEGFC  160

Query  198  K-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGM  22
              RCG+HGS+ G  ++AY WVGNSETQCPGQCAWPF +PI GPQ+PPLVAPN DVG+DGM
Sbjct  161  SSRCGTHGSSVGHGKLAYVWVGNSETQCPGQCAWPFQQPIYGPQSPPLVAPNNDVGLDGM  220

Query  21   IINLATV  1
            +IN+AT+
Sbjct  221  VINVATL  227



>ref|XP_003526574.1| PREDICTED: uncharacterized protein LOC100793598 [Glycine max]
Length=308

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = -1

Query  543  YHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVESWWKTTEKY---  376
            YHKG LL G I+VNLIWYG F P+QR+II DF+ SL +  +   PSV +WWK T+KY   
Sbjct  42   YHKGPLLSGKISVNLIWYGNFKPSQRAIISDFITSLSSHKSTAQPSVATWWKGTQKYYQL  101

Query  375  -KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC  199
             K     T+ +G QIL+EN SLGK+L +D IV LASKG + +  +NVVLT  DV+V+GFC
Sbjct  102  IKSSPKLTLTLGTQILDENYSLGKSLTNDNIVSLASKGASKD-AINVVLTSSDVTVEGFC  160

Query  198  K-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGM  22
              RCG+HGS+ G ++ AY WVGNSETQCPGQCAWPF +PI GPQ PPLVAPN DVG+DGM
Sbjct  161  SSRCGTHGSSVGPRKFAYVWVGNSETQCPGQCAWPFQQPIYGPQNPPLVAPNNDVGLDGM  220

Query  21   IINLATV  1
            +IN+AT+
Sbjct  221  VINVATL  227



>ref|XP_002307368.2| hypothetical protein POPTR_0005s17210g [Populus trichocarpa]
 gb|EEE94364.2| hypothetical protein POPTR_0005s17210g [Populus trichocarpa]
Length=295

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 146/204 (72%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  12   QDPLLFQYHNGPLLTGEISINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAQPSVATWWK  71

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E  SLGK+L   QIVQLASKGG  +G +NVVLT
Sbjct  72   ATEKYYNLVKTKKTSPLLLSVGAQILDERYSLGKSLSSKQIVQLASKGGQ-KGAINVVLT  130

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   K +       AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  131  SSDVAVEGFCSSKCGTHGSSLSAKTINGKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  190

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  191  QNPPLVAPNNDVGLDGMVINLASL  214



>ref|XP_006472582.1| PREDICTED: uncharacterized protein LOC102625424 [Citrus sinensis]
Length=322

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 19/207 (9%)
 Frame = -1

Query  567  KEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPTPSVES  400
            ++P  +L+YH G LL G I +NLIWYGKF P+Q++II DF+ SL +    + A  PSV +
Sbjct  36   QQPDRLLQYHNGALLSGKIAINLIWYGKFNPSQKAIISDFITSLSSYSSQLKANQPSVAT  95

Query  399  WWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            WWKTTEKY          ++ +GKQI +E CSLGK+LK+  IV+LASKG + +  +NVVL
Sbjct  96   WWKTTEKYYHLISKKSTLSLSLGKQISDETCSLGKSLKNGDIVKLASKG-DQKDAINVVL  154

Query  231  TDKDVSVDGFC-KRCGSHGSTAG---------EKQVAYAWVGNSETQCPGQCAWPFHKPI  82
            T  DV+V+GFC  RCG+HGS +G           + AY WVGNSETQCPGQCAWPFH+PI
Sbjct  155  TASDVAVEGFCMSRCGTHGSASGSIKSSGHNKNNKFAYIWVGNSETQCPGQCAWPFHQPI  214

Query  81   QGPQTPPLVAPNGDVGIDGMIINLATV  1
             GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  215  YGPQSPPLVAPNNDVGLDGMVINLASL  241



>ref|XP_006853272.1| hypothetical protein AMTR_s00038p00236240 [Amborella trichopoda]
 gb|ERN14739.1| hypothetical protein AMTR_s00038p00236240 [Amborella trichopoda]
Length=306

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 158/239 (66%), Gaps = 24/239 (10%)
 Frame = -1

Query  699  SSFHLKALALSIMAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLK  520
            S+FHL  L LS                LF F A     +  ELV++ P+ L+YH G +L 
Sbjct  5    STFHLFFLTLS----------------LFHF-ASAARITPAELVQDQPLTLKYHNGHVLS  47

Query  519  GSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPST---IV  349
            G I VNLIWYG FTP+QR+II D   SL +    +PSV SWW+TT+ Y+    S    + 
Sbjct  48   GRIAVNLIWYGSFTPSQRAIISDLFLSLSSPKPTSPSVSSWWQTTQTYRPASSSRSLRLT  107

Query  348  IGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGS-  175
            + KQIL+ + SLGKTL + Q+V LASKG + +  +NVVLT KDV+V+GFC  RCG+HGS 
Sbjct  108  LNKQILDTSYSLGKTLTNAQLVALASKG-DEKNAINVVLTAKDVAVEGFCSSRCGTHGSA  166

Query  174  -TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             +A   +  Y WVGNSETQCPGQCAWPFHKPI GPQTP LVAPNGDVG+DGM IN+ ++
Sbjct  167  RSAHGTKFTYIWVGNSETQCPGQCAWPFHKPIYGPQTPALVAPNGDVGVDGMAINVGSL  225



>ref|XP_010939670.1| PREDICTED: protein EXORDIUM-like 1 [Elaeis guineensis]
Length=314

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 11/201 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA----PTPSV  406
            LV+EP  VL YHKG LL G I+VNLIWYGKFT TQR+II DF+ SL +       P PSV
Sbjct  34   LVEEPSPVLTYHKGALLTGPISVNLIWYGKFTATQRAIISDFVTSLSSKGGGQKQPVPSV  93

Query  405  ESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             +WW TTEKY     +   T+ +G QIL+E+ +LGK+L +  I +LAS+G   +  VNVV
Sbjct  94   STWWNTTEKYYARSKTKFPTLTLGDQILDESYTLGKSLTNADIAKLASRGA-PKYAVNVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            LT  DV+V+GFC  RCG+HG++   K  + AY WVGNS TQCPGQCAWPFH+P+ GPQ+P
Sbjct  153  LTADDVAVEGFCMSRCGTHGTSPRSKSGRFAYIWVGNSATQCPGQCAWPFHQPVYGPQSP  212

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLVAPNGDVGIDGM+INLA++
Sbjct  213  PLVAPNGDVGIDGMVINLASM  233



>gb|ABK93831.1| unknown [Populus trichocarpa]
 gb|ABK95587.1| unknown [Populus trichocarpa]
Length=319

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 150/226 (66%), Gaps = 20/226 (9%)
 Frame = -1

Query  621  LLFC-FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            LL C F          ELV++ P +L YH G LL G I+VNLIWYGKF P+QR+II DF+
Sbjct  14   LLVCLFHVSFAARKLNELVQDQPQLLRYHDGALLYGKISVNLIWYGKFKPSQRAIISDFV  73

Query  444  ESLK----TVDAPTPSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
             SL     ++    PSV  WW+TTEKY          ++ +G QIL+   SLGK+L D Q
Sbjct  74   TSLSVSPSSLKDSQPSVAKWWETTEKYYHLTSKKNTLSLTLGTQILDAKYSLGKSLTDKQ  133

Query  288  IVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---------QVAYAWV  139
            IV+LASKG + +  VN+VLT  DV+V+GFC  RCG+HGS  G K         + AY WV
Sbjct  134  IVELASKG-DQKDAVNIVLTSSDVTVEGFCLNRCGTHGSALGSKSGNIKGKNYRFAYIWV  192

Query  138  GNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            GNSETQCPG CAWPFH+PI GPQ PPLVAPN DVG+DGM+INLA++
Sbjct  193  GNSETQCPGYCAWPFHQPIYGPQNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_006288248.1| hypothetical protein CARUB_v10001493mg [Capsella rubella]
 gb|EOA21146.1| hypothetical protein CARUB_v10001493mg [Capsella rubella]
Length=316

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 152/213 (71%), Gaps = 13/213 (6%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+LF  L+     S   LV++ P     H GT LKGSIT+NL+WYGKFTP QRS+IVDF+
Sbjct  43   AILFVLLSTTFSLSTAALVEQKP--RHSHSGTPLKGSITLNLVWYGKFTPIQRSVIVDFI  100

Query  444  ESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK  268
             S+ +   A  PSV SWWKTTEKYK G  ST V+GKQ+L EN  +GK+LK   +  L+SK
Sbjct  101  RSISSPAVAKGPSVASWWKTTEKYKKG-VSTFVVGKQLLLENYPIGKSLKSPYLRALSSK  159

Query  267  ---GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAW  100
               GG     + VVLT KDV+V+GFC  RCG+HGS A     AY WVGNSE+ CPG CAW
Sbjct  160  INAGGARS--ITVVLTAKDVTVEGFCMNRCGTHGSKASG---AYVWVGNSESMCPGYCAW  214

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PFH+PI GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  215  PFHQPIYGPQSPPLVAPNGDVGVDGMIINLATL  247



>ref|XP_006363276.1| PREDICTED: uncharacterized protein LOC102580699 [Solanum tuberosum]
Length=313

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 147/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV++P + +LEYHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  29   LVQDPQMQLLEYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTNPSVA  88

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    T+ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  89   QWWKTTEKYYHLANSKNTLTLSLGKQVLIENYSLGKSLTQKQIVQLASKGEQRD-AINVV  147

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  148  LTASDVAVDGFCVNRCGTHGSSKGAVIKGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYG  207

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPL APN DVG+DGM+INLA++
Sbjct  208  PQSPPLGAPNNDVGVDGMVINLASL  232



>ref|XP_002285762.1| PREDICTED: protein EXORDIUM [Vitis vinifera]
 emb|CAN68978.1| hypothetical protein VITISV_040774 [Vitis vinifera]
Length=319

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 152/211 (72%), Gaps = 18/211 (9%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA--PTPS  409
              ELV++ P++LEYH G LL G I++NLIWYGKF P+QR+I+ DF+ SL +       PS
Sbjct  29   LNELVQQQPLLLEYHNGPLLSGKISINLIWYGKFKPSQRAIVSDFITSLSSSSLSQDQPS  88

Query  408  VESWWKTTEKY---KGGGPSTI--VIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCV  244
            V +WWKTTEKY       PS++   +G+QIL+E  SLGK+L   QIVQLASKG      +
Sbjct  89   VATWWKTTEKYYHLTSKNPSSLKLSLGEQILDETYSLGKSLTGKQIVQLASKGEQMN-AI  147

Query  243  NVVLTDKDVSVDGFCK-RCGSHGSTAGEKQV---------AYAWVGNSETQCPGQCAWPF  94
            NVVLT  DV+V+GFC  RCG+HGS++  K V         AY WVGNSETQCPGQCAWPF
Sbjct  148  NVVLTSSDVAVEGFCSSRCGTHGSSSSSKNVQVKGKNYKFAYVWVGNSETQCPGQCAWPF  207

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+PI GPQ+PPLVAPN DVG+DG++INLA++
Sbjct  208  HQPIYGPQSPPLVAPNNDVGLDGIVINLASL  238



>ref|XP_010422983.1| PREDICTED: protein EXORDIUM-like 4 [Camelina sativa]
Length=279

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 154/217 (71%), Gaps = 11/217 (5%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A +   A+LF  L+     S   +V++ P     H G  +KGS+T+NL+WYGKFTPTQRS
Sbjct  2    AYSYRFAILFVLLSTTVSLSTAAVVEQKP----RHSGIPVKGSVTLNLVWYGKFTPTQRS  57

Query  462  IIVDFLESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            +IVDF+ S+ +   A  PSV +WWKTTEKYK G  S +V+GKQ+L EN  +GK+LK   +
Sbjct  58   VIVDFIRSIGSPAVAKGPSVAAWWKTTEKYKQG-VSNLVVGKQLLLENYPIGKSLKSPYL  116

Query  285  VQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPG  112
              L+SK  G     + VVLT KDV+V+GFC  RCG+HGS A     AY WVGNSETQCPG
Sbjct  117  RALSSKLNGGGARSITVVLTAKDVAVEGFCMNRCGTHGSKASG---AYVWVGNSETQCPG  173

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  174  YCAWPFHQPIYGPQSPPLVAPNGDVGVDGMIINLATL  210



>emb|CDP01089.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 142/200 (71%), Gaps = 17/200 (9%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP---TPSVESWWKTTE  382
            +L YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL +  AP    PSV SWWKTTE
Sbjct  41   LLHYHKGALLGGRISVNLIWYGKFKPSQRAIIADFITSLSSSSAPPQTQPSVASWWKTTE  100

Query  381  KY----KGGGPSTI--VIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            KY        PS++   +GKQIL+EN SLGK+L   QIV+LASKG      +NVVLT  D
Sbjct  101  KYYHLANSKKPSSLSLYLGKQILDENYSLGKSLTRKQIVELASKG-EQRNAINVVLTAAD  159

Query  219  VSVDGFCKR-CGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
            V VDGFC+  CGSHGS+ G        + AY WVGNSETQCPG CAWPFH+P  GPQ PP
Sbjct  160  VIVDGFCQNTCGSHGSSKGAAIQGKTYKFAYIWVGNSETQCPGYCAWPFHQPTYGPQNPP  219

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+INL ++
Sbjct  220  LVAPNNDVGMDGMVINLGSL  239



>ref|XP_008808009.1| PREDICTED: uncharacterized protein LOC103720188 [Phoenix dactylifera]
Length=326

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 11/201 (5%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA----PTPSV  406
            LV+E   VL YHKG LL G ++VNLIWYGKF  +QR+II DF+ SL T  +    P PSV
Sbjct  46   LVEEQSPVLTYHKGALLTGPVSVNLIWYGKFAASQRAIISDFVTSLSTKGSDQKQPAPSV  105

Query  405  ESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             +WWKTTEKY     +    + +G+QIL+++ SLGK+L D  I +LAS+G   +  VNVV
Sbjct  106  STWWKTTEKYYAQSKTKFPALTLGEQILDDSYSLGKSLTDADIAKLASRGA-PKNAVNVV  164

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            LT  DV+V+GFC  RCG+HGS+   K  + AY WVGNS TQCPGQCAWPFH+P+ GPQTP
Sbjct  165  LTAADVAVEGFCMSRCGTHGSSPRSKSGRFAYIWVGNSATQCPGQCAWPFHQPVYGPQTP  224

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLVAPNGDVGIDGM+INLA++
Sbjct  225  PLVAPNGDVGIDGMVINLASM  245



>ref|XP_010676078.1| PREDICTED: protein EXORDIUM-like 2 [Beta vulgaris subsp. vulgaris]
Length=310

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 148/197 (75%), Gaps = 8/197 (4%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESW  397
            LV+  P+VL+YH G LLKG++TVNLIWYGKFTP QRSIIVDF++SL +   A  PSV SW
Sbjct  35   LVQPEPLVLKYHNGPLLKGNLTVNLIWYGKFTPVQRSIIVDFIQSLSSRAHASHPSVSSW  94

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W+ T  Y+GG P TI +GKQ L+++ SLGK L   Q++ LASK  +    +NVVLT  DV
Sbjct  95   WQITGGYRGG-PCTITLGKQFLDQSYSLGKALTPSQLLVLASKLPH-RNAINVVLTSADV  152

Query  216  SVDGFC-KRCGSHG-STAGEKQ---VAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            + D FC   CG+HG   AG+ +    AYAWVGN E QCPGQCAWPFH+P+ GPQTPPL+A
Sbjct  153  TPDRFCMSTCGAHGFGLAGKHKKIKFAYAWVGNPEKQCPGQCAWPFHQPMYGPQTPPLIA  212

Query  51   PNGDVGIDGMIINLATV  1
            PNGD+G+DGMI+NLATV
Sbjct  213  PNGDLGVDGMIMNLATV  229



>ref|XP_011016644.1| PREDICTED: protein EXORDIUM-like [Populus euphratica]
Length=319

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 153/239 (64%), Gaps = 19/239 (8%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGK  484
            MA +N      ++ L+  F          ELV++ P +L YH G LL G I+VNLIWYGK
Sbjct  1    MASLNFQLALKSLLLVCLFHVSFAARKLNELVQDQPQLLHYHDGALLYGKISVNLIWYGK  60

Query  483  FTPTQRSIIVDFLESLK----TVDAPTPSVESWWKTTEKY----KGGGPSTIVIGKQILE  328
            F P+QR+II DF+ SL     ++    PSV  WW+TTEKY          ++ +G QIL+
Sbjct  61   FKPSQRAIISDFVTSLSVSPSSLKESQPSVAKWWETTEKYYHLTSKKNTLSLTLGTQILD  120

Query  327  ENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---  160
               SLGK+L D QIV+LASKG + +  VN+VLT  DV+V GFC  RCG+HGS  G K   
Sbjct  121  AKYSLGKSLTDKQIVELASKG-DQKDSVNIVLTSSDVTVQGFCLNRCGTHGSALGSKSGN  179

Query  159  ------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
                  + AY WVGNSETQCPG CAWPFH+P  GPQ PPLVAPN DVG+DGM+INLA++
Sbjct  180  SKGKNYRFAYIWVGNSETQCPGYCAWPFHQPTYGPQNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_010452934.1| PREDICTED: protein EXORDIUM-like 4 [Camelina sativa]
Length=279

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 154/219 (70%), Gaps = 15/219 (7%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A +   A+LF  L+     S   LV++ P       G  LKGS+T+NL+WYGKFTPTQRS
Sbjct  2    AYSYRFAILFVLLSATVSLSTAALVEQKP----RRGGIPLKGSVTLNLVWYGKFTPTQRS  57

Query  462  IIVDFLESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            +IVDF+ S+ +   A  PSV SWWKTTEKYK G  S +V+GKQ+L EN  +GK+LK   +
Sbjct  58   VIVDFIRSIGSPAVAKGPSVASWWKTTEKYKQG-VSNLVVGKQLLLENYPIGKSLKSPYL  116

Query  285  VQLASK---GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQC  118
              L+SK   GG     + VVLT KDV+V+GFC  RCG+HGS A     AY WVGNSETQC
Sbjct  117  RALSSKLNVGGARS--ITVVLTAKDVAVEGFCMNRCGTHGSRASG---AYVWVGNSETQC  171

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PG CAWPFH+PI GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  172  PGYCAWPFHQPIYGPQSPPLVAPNGDVGVDGMIINLATL  210



>ref|XP_009792820.1| PREDICTED: protein EXORDIUM-like [Nicotiana sylvestris]
Length=313

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 148/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV+EP   +L+YHKGTLL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  29   LVQEPQGQLLQYHKGTLLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTDPSVA  88

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   +IVQLASKG   +  +N+V
Sbjct  89   KWWKTTEKYYHLANSKKSLSLSLGKQVLIENYSLGKSLTQKRIVQLASKGEQKDA-INIV  147

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSETQC G CAWPFH+PI G
Sbjct  148  LTASDVAVDGFCVNRCGTHGSSKGAIIRGKTYKFAYIWVGNSETQCAGYCAWPFHQPIYG  207

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPLVAPN DVG+DGM+INLA++
Sbjct  208  PQSPPLVAPNNDVGVDGMVINLASL  232



>ref|XP_007148400.1| hypothetical protein PHAVU_006G205300g [Phaseolus vulgaris]
 gb|ESW20394.1| hypothetical protein PHAVU_006G205300g [Phaseolus vulgaris]
Length=289

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = -1

Query  555  VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK-TVDAPTPSVESWWKTTEK  379
            +VL YH G LLKG  TVN++WYG FTP QRSIIVDF+ SL     A +P+V SWW+TTEK
Sbjct  27   LVLNYHNGALLKGRFTVNILWYGSFTPIQRSIIVDFVNSLSFPSGAQSPTVASWWQTTEK  86

Query  378  YKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC  199
            YKGG  +T+ +GKQI EE  S GK L ++Q+  LAS+  N    +N+VLT KDV+VDGFC
Sbjct  87   YKGGS-TTLAVGKQITEEY-SAGKHLTENQLRSLASRF-NDVAAINLVLTAKDVAVDGFC  143

Query  198  -KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGM  22
              RCG+H S  G  ++ Y WVGNSETQCP QCAWPFHKP  GPQTPPLVAPNGDVG+DGM
Sbjct  144  GSRCGTHNSING--KIPYVWVGNSETQCPAQCAWPFHKPTFGPQTPPLVAPNGDVGVDGM  201

Query  21   IINLATV  1
            IIN+AT+
Sbjct  202  IINIATL  208



>ref|XP_002871372.1| hypothetical protein ARALYDRAFT_487757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47631.1| hypothetical protein ARALYDRAFT_487757 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 151/212 (71%), Gaps = 11/212 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A+L   L+     S   LV++ P VL       LKG+IT+NLIWYGKFTP QRS+IVDF+
Sbjct  8    AILLVLLSATVGFSSAALVQKKPPVLT------LKGNITLNLIWYGKFTPIQRSVIVDFI  61

Query  444  ESLKTVDAPT-PSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK  268
             S+ +V A   P+V SWWKTTEKYK G  ST+V+GKQ+L EN  LGK+LK   +  L+SK
Sbjct  62   RSISSVAAAKGPTVASWWKTTEKYKQG-VSTLVVGKQLLLENYPLGKSLKSPYLRTLSSK  120

Query  267  -GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGE-KQVAYAWVGNSETQCPGQCAWP  97
              G     + VVLT KDV+V+G C  RCG+HGS +      AY WVGNSETQCPG CAWP
Sbjct  121  LNGGGARSITVVLTAKDVAVEGLCMNRCGTHGSKSRSVNSGAYVWVGNSETQCPGYCAWP  180

Query  96   FHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            FH+PI GPQTPPLVAPNGDVG+DGMIINLAT+
Sbjct  181  FHQPIYGPQTPPLVAPNGDVGVDGMIINLATL  212



>ref|XP_009618458.1| PREDICTED: protein EXORDIUM-like [Nicotiana tomentosiformis]
Length=313

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV+EP   +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  29   LVQEPENQLLQYHKGALLFGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTDPSVA  88

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +N+V
Sbjct  89   KWWKTTEKYYHLANSKKSLSLYLGKQVLVENYSLGKSLTQKQIVQLASKGEQKDA-INIV  147

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSETQC G CAWPFH+PI G
Sbjct  148  LTASDVAVDGFCVNRCGTHGSSKGAIIRGKTYKFAYIWVGNSETQCAGYCAWPFHQPIYG  207

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPLVAPN DVG+DGM+INLA++
Sbjct  208  PQSPPLVAPNNDVGVDGMVINLASL  232



>dbj|BAA33810.1| phi-1 [Nicotiana tabacum]
Length=313

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV+EP   +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  29   LVQEPENQLLQYHKGALLFGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTDPSVA  88

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +N+V
Sbjct  89   KWWKTTEKYYHLANSKKSLSLYLGKQVLVENYSLGKSLTQKQIVQLASKGEQKDA-INIV  147

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSETQC G CAWPFH+PI G
Sbjct  148  LTASDVAVDGFCVNRCGTHGSSKGAIIRGKTYKFAYIWVGNSETQCAGYCAWPFHQPIYG  207

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPLVAPN DVG+DGM+INLA++
Sbjct  208  PQSPPLVAPNNDVGVDGMVINLASL  232



>ref|XP_002513946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48529.1| conserved hypothetical protein [Ricinus communis]
Length=316

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 147/208 (71%), Gaps = 18/208 (9%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP---TPSVE  403
            L ++ P++ +YH G LL G I++NLIWYG F P+QR+I+ DF+ SL +   P    PSV 
Sbjct  29   LTEQEPLLFQYHNGPLLTGKISINLIWYGNFKPSQRAILSDFITSLSSTTQPIKAQPSVT  88

Query  402  SWWKTTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVN  241
            +WWK TEKY      K      + +G QI++E+ S+GK+L   QIVQLASKGG  +  +N
Sbjct  89   TWWKATEKYYHLIKSKTSSDLELSLGTQIVDESYSVGKSLSSKQIVQLASKGGQKD-AIN  147

Query  240  VVLTDKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKP  85
            VVLT  DV VDGFC  RCG+HGS+ G +++       AY WVGNSETQCPGQCAWPFH+P
Sbjct  148  VVLTSADVLVDGFCSSRCGTHGSSMGARKINGKSTKFAYIWVGNSETQCPGQCAWPFHQP  207

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            I GPQ+P LVAPN DVG+DGM+INLA++
Sbjct  208  IYGPQSPSLVAPNNDVGLDGMVINLASL  235



>ref|XP_003544803.1| PREDICTED: uncharacterized protein LOC100791695 [Glycine max]
Length=313

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 151/223 (68%), Gaps = 17/223 (8%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE  442
            L+  F          ELV++   +L YH G LL G I++NLIWYG F P+Q++I+ DF+ 
Sbjct  11   LISIFQISFATRRLNELVQDQTQLLRYHNGPLLSGKISINLIWYGHFKPSQKAIVSDFIT  70

Query  441  SLK--TVDAPTPSVESWWKTTEKY-------KGGGPSTIVIGKQILEENCSLGKTLKDDQ  289
            SL   +  +  PSV +WWKTTEKY       K   P +I + KQIL+EN SLGK+L    
Sbjct  71   SLSPSSPHSTQPSVATWWKTTEKYYHHLSNTKKTSPLSIPLNKQILDENYSLGKSLTSKH  130

Query  288  IVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAG------EKQVAYAWVGNS  130
            ++QLASKG + +  +NVVLT  DV+V+GFC  RCG+HGS++         + AY WVGNS
Sbjct  131  LIQLASKG-DHKNAINVVLTSADVAVEGFCTSRCGTHGSSSAGHAKNKNYKFAYIWVGNS  189

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            E QCPGQCAWPFH+PI GPQ+PPLVAPN DVGIDGM+INLA++
Sbjct  190  EAQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGIDGMVINLASL  232



>ref|XP_009779725.1| PREDICTED: protein EXORDIUM-like [Nicotiana sylvestris]
Length=319

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 162/249 (65%), Gaps = 29/249 (12%)
 Frame = -1

Query  699  SSFHLKA--LALSIMAVINNCATASAVALLFCFLAGIPEPSFGELVKEPP-VVLEYHKGT  529
            SSF LK+    L +  +I+ C          CF +         LV+EP   +L+YHKG 
Sbjct  3    SSFRLKSTHFILKLFLLISLCNV--------CFAS----RKLTALVQEPQGQLLQYHKGA  50

Query  528  LLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVESWWKTTEKYKGGGPS-  358
            LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV  WWKTTEKY     S 
Sbjct  51   LLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTDPSVAKWWKTTEKYYHLANSK  110

Query  357  ---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRC  190
               ++ +GKQ+L EN SLGK+L   +IVQLASKG   +  +N+VLT  DV+VDGFC  RC
Sbjct  111  KSLSLSLGKQVLIENYSLGKSLTQKRIVQLASKGEQKDA-INIVLTASDVAVDGFCVNRC  169

Query  189  GSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGID  28
            G+HGS+ G        + AY WVGNSETQC G CAWPFH+PI GPQ+PPLVAPN DVG+D
Sbjct  170  GTHGSSKGAIIRGKTYKFAYIWVGNSETQCAGYCAWPFHQPIYGPQSPPLVAPNNDVGVD  229

Query  27   GMIINLATV  1
            GM+INLA++
Sbjct  230  GMVINLASL  238



>ref|XP_007222573.1| hypothetical protein PRUPE_ppa008424mg [Prunus persica]
 gb|EMJ23772.1| hypothetical protein PRUPE_ppa008424mg [Prunus persica]
Length=332

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 149/223 (67%), Gaps = 21/223 (9%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      ELV+    +L+YH G LL G I +NL+WYG F P+Q++II DF+ SL +
Sbjct  30   FQVSLATRKLSELVQGQTQLLKYHNGPLLSGKIAINLVWYGNFKPSQKAIISDFITSLSS  89

Query  429  VDAPT---PSVESWWKTTEKYKGGGPS-----TIVIGKQILEENCSLGKTLKDDQIVQLA  274
               P    PSV +WWKTTEKY     +     ++ +G+QIL+E  SLGK+L   QIVQLA
Sbjct  90   SSPPKTTPPSVATWWKTTEKYYHLSSNKKTSLSLSLGRQILDEKYSLGKSLTTKQIVQLA  149

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAG-----------EKQVAYAWVGNS  130
            SKG + +  +NVVLT  DV+VDGFC  RCG+HGS  G             + AY WVGNS
Sbjct  150  SKG-DQKNAINVVLTSADVTVDGFCMNRCGTHGSALGSSKTGLIKGSKRSKFAYIWVGNS  208

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            ETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  209  ETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  251



>ref|XP_007018742.1| Phosphate-responsive 1 family protein [Theobroma cacao]
 gb|EOY15967.1| Phosphate-responsive 1 family protein [Theobroma cacao]
Length=319

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 154/225 (68%), Gaps = 19/225 (8%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE  442
            L+  F   +      ELV++ P +L YH G LL G IT+NLIWYGKF P++R+I+ DF+ 
Sbjct  15   LISLFQISLAGRKLSELVQDQPQLLTYHNGPLLSGKITINLIWYGKFKPSERAIVSDFVT  74

Query  441  SLKTV---DAPTPSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIV  283
            SL +        PSV  WWKTTEKY          ++ +GKQIL+EN S+GK+LK  QIV
Sbjct  75   SLSSTTPSQNNQPSVAKWWKTTEKYYHLTSKKSTLSLSLGKQILDENYSIGKSLKSKQIV  134

Query  282  QLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST--------AGEK--QVAYAWVG  136
            +LASKG + +  +NVVLT  DV+V+GFC  RCG+HGS          G+K  + AY WVG
Sbjct  135  ELASKG-DQKNAINVVLTASDVAVEGFCMSRCGTHGSALSSSKGHIKGDKYSKFAYVWVG  193

Query  135  NSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            NS+TQCPGQCAWPFH+P+ GPQ PPL+APN +VG+DGM+INLA++
Sbjct  194  NSQTQCPGQCAWPFHQPVYGPQNPPLIAPNNNVGLDGMVINLASL  238



>gb|KEH34959.1| phosphate-responsive 1 family protein [Medicago truncatula]
Length=304

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESWWKTTEKYK  373
             +YHKG LL G I++NLIWYGKF PTQR+II DF+ S+ +    P PSV  WWK T+KY 
Sbjct  38   FQYHKGPLLTGKISINLIWYGKFNPTQRAIISDFIASISSPTIKPQPSVAMWWKLTDKYY  97

Query  372  GGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGF  202
                S    +  G  +L+EN S GK+L +DQI++LASKG  T   +NVVLT  DV VDGF
Sbjct  98   QLANSQNLVLTTGSHVLDENYSFGKSLTNDQIIKLASKGSQTN-AINVVLTSADVVVDGF  156

Query  201  CK-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDG  25
            C  RCG HGS+   K  AY WVGNSETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DG
Sbjct  157  CSGRCGKHGSSVNHK-FAYVWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDG  215

Query  24   MIINLATV  1
            M+IN+A++
Sbjct  216  MVINVASL  223



>ref|XP_002874502.1| hypothetical protein ARALYDRAFT_489716 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50761.1| hypothetical protein ARALYDRAFT_489716 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 145/202 (72%), Gaps = 20/202 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGKFKPSQRAIISDFITSL-THTSPTSKTLHQPSVATWWK  92

Query  390  TTEKY-------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            TTEKY       K   P ++ +GKQIL+E+CSL K+L D +I QLASKG +    +NVVL
Sbjct  93   TTEKYYKLAAPNKNSSPLSLTLGKQILDESCSLRKSLTDKKIRQLASKG-DQRDAINVVL  151

Query  231  TDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            T  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ+
Sbjct  152  TSADVTVTGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQS  211

Query  66   PPLVAPNGDVGIDGMIINLATV  1
            PPLVAPN DVG+DGM+INLA++
Sbjct  212  PPLVAPNNDVGLDGMVINLASL  233



>ref|XP_010491572.1| PREDICTED: protein EXORDIUM-like 4 [Camelina sativa]
Length=279

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 152/217 (70%), Gaps = 11/217 (5%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            A +   A+LF  L+     S   +V++ P          LKGS+T+NL+WYGKFTPTQRS
Sbjct  2    AYSYRFAILFVLLSATVSLSTAAVVEQKP----RRSSIPLKGSVTLNLVWYGKFTPTQRS  57

Query  462  IIVDFLESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            ++VDF+ S+ +   A +PSV +WWKTTEKYK G  S +V+GKQ+L EN  +GK+LK   +
Sbjct  58   VVVDFIRSIGSPAVAKSPSVAAWWKTTEKYKQG-VSNLVVGKQLLLENYPIGKSLKSPYL  116

Query  285  VQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPG  112
              L+SK  G     + VVLT KDV V+GFC  RCG+HGS A     AY WVGNSETQCPG
Sbjct  117  RALSSKLNGGGARSITVVLTAKDVYVEGFCMNRCGTHGSKASG---AYVWVGNSETQCPG  173

Query  111  QCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             CAWPFH+PI GPQ+PPLVAPNGDVG+DGMIINLAT+
Sbjct  174  YCAWPFHQPIYGPQSPPLVAPNGDVGVDGMIINLATL  210



>ref|XP_011003041.1| PREDICTED: protein EXORDIUM-like [Populus euphratica]
Length=319

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 145/204 (71%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G +++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  36   QDPLLFQYHNGPLLTGEVSINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAQPSVATWWK  95

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E+ SLGK+L   QIVQLASKGG     +NVVLT
Sbjct  96   ATEKYYNLVKTKKTSPLLLSVGTQILDESYSLGKSLSSKQIVQLASKGGQKR-AINVVLT  154

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   K++       AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  155  SSDVAVEGFCSSKCGTHGSSLSAKKISGKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  214

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPL APN DVG+DGM+INLA++
Sbjct  215  QNPPLGAPNNDVGLDGMVINLASL  238



>ref|XP_007018741.1| Phosphate-responsive 1 family protein [Theobroma cacao]
 gb|EOY15966.1| Phosphate-responsive 1 family protein [Theobroma cacao]
Length=319

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 147/205 (72%), Gaps = 19/205 (9%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT---PSVESWW  394
            E P++ +YH G LL G I+VNLIWYGKF P+QR+I+ DF+ S+ T   PT   PSV +WW
Sbjct  36   EQPLLFQYHNGPLLTGKISVNLIWYGKFKPSQRAIVSDFVASV-TSSKPTVAEPSVSTWW  94

Query  393  KTTEKYK--GGGPSTIVI--GKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
            K TEKY      PS++ +  G QIL+EN SLGK+L + QI++LASKG   +  +NVVLT 
Sbjct  95   KATEKYYQLSKKPSSLALSLGTQILDENYSLGKSLTNQQIIELASKGAQ-KNAINVVLTS  153

Query  225  KDVSVDGFCK-RCGSHGSTAG---------EKQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
             DV+V+GFC  RCG+HGS  G           + AY WVGNSETQCPGQCAWPFH+PI G
Sbjct  154  ADVAVEGFCSSRCGTHGSGLGTSNGQIKGKSSKFAYIWVGNSETQCPGQCAWPFHQPIYG  213

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ PPLVAPN DVG+DGM+INLA++
Sbjct  214  PQNPPLVAPNNDVGLDGMVINLASL  238



>ref|NP_192634.1| protein EXORDIUM [Arabidopsis thaliana]
 sp|Q9ZPE7.1|EXO_ARATH RecName: Full=Protein EXORDIUM; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM18526.1|AF496655_1 cell cycle-related protein [Arabidopsis thaliana]
 gb|AAD17365.1| T3H13.3 gene product [Arabidopsis thaliana]
 emb|CAB78019.1| putative phi-1-like phosphate-induced protein [Arabidopsis thaliana]
 gb|AAK96677.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13294.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82700.1| phosphate-responsive 1 family protein [Arabidopsis thaliana]
Length=314

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 145/202 (72%), Gaps = 20/202 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGKFKPSQRAIISDFITSL-THTSPTSKTLHQPSVATWWK  92

Query  390  TTEKY-------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            TTEKY       K   P ++ +GKQI++E+CSLGK+L D +I  LASKG +    +NVVL
Sbjct  93   TTEKYYKLATPSKNSSPLSLTLGKQIIDESCSLGKSLTDKKIQTLASKG-DQRNAINVVL  151

Query  231  TDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            T  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ+
Sbjct  152  TSADVTVTGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQS  211

Query  66   PPLVAPNGDVGIDGMIINLATV  1
            PPLVAPN DVG+DGM+INLA++
Sbjct  212  PPLVAPNNDVGLDGMVINLASL  233



>gb|AAM64992.1| putative phi-1-like phosphate-induced protein [Arabidopsis thaliana]
 gb|ACG24330.1| phi-1-like phosphate-induced protein [Zea mays]
Length=314

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 145/202 (72%), Gaps = 20/202 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGKFKPSQRAIISDFITSL-THTSPTSKTLHQPSVATWWK  92

Query  390  TTEKY-------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            TTEKY       K   P ++ +GKQI++E+CSLGK+L D +I  LASKG +    +NVVL
Sbjct  93   TTEKYYKLATPSKNSSPLSLTLGKQIIDESCSLGKSLTDKKIQTLASKG-DQRNAINVVL  151

Query  231  TDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            T  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ+
Sbjct  152  TSADVTVTGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQS  211

Query  66   PPLVAPNGDVGIDGMIINLATV  1
            PPLVAPN DVG+DGM+INLA++
Sbjct  212  PPLVAPNNDVGLDGMVINLASL  233



>ref|XP_009779726.1| PREDICTED: protein EXORDIUM-like [Nicotiana sylvestris]
Length=319

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 150/218 (69%), Gaps = 19/218 (9%)
 Frame = -1

Query  612  CFLAGIPEPSFGELVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL  436
            CF +G        LV+EP   +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL
Sbjct  26   CFASG----KLTALVQEPQNQLLQYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSL  81

Query  435  K--TVDAPTPSVESWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLA  274
               T     PSV  WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLA
Sbjct  82   SSSTPSKTDPSVAKWWKTTEKYYHLANSKKSLSLYLGKQVLVENYSLGKSLTQKQIVQLA  141

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK------QVAYAWVGNSETQCP  115
            SKG   +  +NVVLT  DV+VDGFC  RCG+HGS+ G        + AY WVGNS+TQC 
Sbjct  142  SKGEQKDA-INVVLTASDVAVDGFCVNRCGTHGSSKGATIRGKTYKFAYIWVGNSDTQCA  200

Query  114  GQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            G CAWPFH+PI GPQ+ PLVAPN DVG+DGM+INLA++
Sbjct  201  GYCAWPFHQPIYGPQSLPLVAPNNDVGVDGMVINLASL  238



>ref|XP_010320182.1| PREDICTED: protein EXORDIUM-like [Solanum lycopersicum]
Length=312

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 147/205 (72%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV++P + +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  28   LVQDPQMQLLKYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFINSLSSSTPSKTNPSVA  87

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  88   QWWKTTEKYYHLANSKNTLSLNLGKQVLIENYSLGKSLTQKQIVQLASKGEQKDA-INVV  146

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  147  LTASDVAVDGFCVNRCGTHGASKGAVIKGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYG  206

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQTPPL APN DVG+DGM+INLA++
Sbjct  207  PQTPPLGAPNNDVGVDGMVINLASL  231



>ref|XP_009605184.1| PREDICTED: protein EXORDIUM-like [Nicotiana tomentosiformis]
Length=319

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 146/205 (71%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPP-VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV++P   +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  35   LVQDPQNQLLQYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTDPSVA  94

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTT KY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  95   KWWKTTGKYYHLANSKKSLSLYLGKQVLVENYSLGKSLTQKQIVQLASKGEQKD-AINVV  153

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HGS+ G        + AY WVGNSETQCPG CAWPFH+PI G
Sbjct  154  LTASDVAVDGFCVNRCGTHGSSKGSIIRGKTYKFAYIWVGNSETQCPGYCAWPFHQPIYG  213

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+PPL APN DVGIDGM+INLA++
Sbjct  214  PQSPPLGAPNNDVGIDGMVINLASL  238



>ref|XP_008790895.1| PREDICTED: uncharacterized protein LOC103707944 [Phoenix dactylifera]
Length=315

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 157/226 (69%), Gaps = 16/226 (7%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGE-----LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQ  469
            S + +L  F + + + S+G      LV+EP  VL YHKG LL G I+VNLIWYGKFT  Q
Sbjct  10   SFLCILVAFASLLFQCSYGARKLNALVEEPSPVLTYHKGALLTGPISVNLIWYGKFTAAQ  69

Query  468  RSIIVDFLESLKT----VDAPTPSVESWWKTTEKYKGGGPST---IVIGKQILEENCSLG  310
            R+II DF+ SL +     + P PSV +WWKT  KY     +    + +G QIL+ + +LG
Sbjct  70   RAIISDFVTSLSSKGGDQNQPEPSVSAWWKTIGKYYARSKTEFPELTLGAQILDGSYALG  129

Query  309  KTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK--QVAYAWV  139
            K+L +D I +LAS+G   +  VNVVLT  DV+V+GFC  RCG+HGS+   K  + AY WV
Sbjct  130  KSLTNDDIAKLASRGA-PKNAVNVVLTADDVAVEGFCMSRCGTHGSSPRSKSGRFAYIWV  188

Query  138  GNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            GNS TQCPGQCAWPFH+P+ GPQ+PPLVAPNGDVGIDGM+INLA++
Sbjct  189  GNSATQCPGQCAWPFHQPVYGPQSPPLVAPNGDVGIDGMVINLASM  234



>gb|KEH34958.1| phosphate-responsive 1 family protein [Medicago truncatula]
Length=304

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 139/188 (74%), Gaps = 7/188 (4%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESWWKTTEKYK  373
             +YHKG LL G I++NL+WYGKF P+QR+II DF+ S+ +    P PSV +WWK T+KY 
Sbjct  38   FQYHKGPLLTGKISINLVWYGKFNPSQRAIISDFITSISSPTIKPQPSVATWWKLTDKYY  97

Query  372  GGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGF  202
                S    +  G  IL+EN S GK+L +DQI++LASKG  T   +NVVLT  DV VDGF
Sbjct  98   HLANSQNLVLTTGSHILDENYSFGKSLTNDQIIKLASKGSQTN-AINVVLTSADVVVDGF  156

Query  201  CK-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDG  25
            C  RCG+HGS+   K  AY WVGNSETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DG
Sbjct  157  CSSRCGTHGSSVDHK-FAYVWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDG  215

Query  24   MIINLATV  1
            M+IN+A++
Sbjct  216  MVINVASL  223



>gb|AFK43172.1| unknown [Medicago truncatula]
Length=304

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 139/188 (74%), Gaps = 7/188 (4%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESWWKTTEKYK  373
             +YHKG LL G I++NL+WYGKF P+QR+II DF+ S+ +    P PSV +WWK T+KY 
Sbjct  38   FQYHKGPLLTGKISINLVWYGKFNPSQRAIISDFITSISSPTVKPQPSVATWWKLTDKYY  97

Query  372  GGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGF  202
                S    +  G  IL+EN S GK+L +DQI++LASKG  T   +NVVLT  DV VDGF
Sbjct  98   HLANSQNLVLTTGSHILDENYSFGKSLTNDQIIKLASKGSQTN-AINVVLTSADVVVDGF  156

Query  201  CK-RCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDG  25
            C  RCG+HGS+   K  AY WVGNSETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DG
Sbjct  157  CSSRCGTHGSSVDHK-FAYVWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDG  215

Query  24   MIINLATV  1
            M+IN+A++
Sbjct  216  MVINVASL  223



>gb|KDP41402.1| hypothetical protein JCGZ_15809 [Jatropha curcas]
Length=317

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 143/199 (72%), Gaps = 15/199 (8%)
 Frame = -1

Query  555  VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKY  376
            ++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ SL   +   PSV +W+K TEKY
Sbjct  39   LLFQYHNGPLLTGKISINLIWYGKFKPSQRAIVSDFIASLSKPEIAQPSVSTWFKATEKY  98

Query  375  ------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
                  K      + +G QIL+E+ SLGK+L + QIV+LAS+G      +NVVLT KDV+
Sbjct  99   YNLIKSKRASSPVVHLGTQILDESYSLGKSLANKQIVELASRGAQNN-AINVVLTSKDVA  157

Query  213  VDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            V+GFC  RCG+HGS+   K++       AY WVGNSE+QCPGQCAWPFH+PI GPQ PPL
Sbjct  158  VEGFCSSRCGTHGSSVAAKKINGKSSKFAYIWVGNSESQCPGQCAWPFHQPIYGPQNPPL  217

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPN DVG+DGM+INLA++
Sbjct  218  VAPNNDVGLDGMVINLASL  236



>ref|XP_002513943.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48526.1| conserved hypothetical protein [Ricinus communis]
Length=317

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 148/221 (67%), Gaps = 17/221 (8%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE  442
            L+  F   +      ELV++ P +L YH G LL G I++NLIWYGKF P+Q++II DF+ 
Sbjct  15   LISIFQISLAARKLNELVQDQPQLLRYHNGPLLSGKISINLIWYGKFQPSQKAIISDFIS  74

Query  441  SLKTVDAPT--PSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQ  280
            SL    +    PSV SWWKTTEKY          ++ +GKQI++E  SLGK+L ++ IV+
Sbjct  75   SLSEHQSQNSQPSVASWWKTTEKYYHLNSKKATLSLTLGKQIVDEAYSLGKSLTNEHIVE  134

Query  279  LASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---------QVAYAWVGNS  130
            LASKG +    +NVVLT  DV+VDGFC  RCG+HGS +G K         + AY WVGNS
Sbjct  135  LASKG-DKMNAINVVLTSADVAVDGFCLNRCGTHGSASGSKTGHIKGKNYKFAYIWVGNS  193

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            E QCPG CAWPFH+PI GPQ  PLVAPN DVG+DGM+INLA
Sbjct  194  EIQCPGYCAWPFHQPIYGPQNQPLVAPNNDVGLDGMVINLA  234



>ref|XP_010025813.1| PREDICTED: protein EXORDIUM-like 2 [Eucalyptus grandis]
 gb|KCW83067.1| hypothetical protein EUGRSUZ_B00031 [Eucalyptus grandis]
Length=316

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 17/209 (8%)
 Frame = -1

Query  588  PSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPS  409
            P    LVK  P+VL YHKG LLKG++TVNL+WYG+F+  Q S+I DF  SL     P PS
Sbjct  31   PRMLSLVKTKPLVLTYHKGQLLKGNVTVNLLWYGRFSRAQLSVIADFFRSLGGPARPPPS  90

Query  408  VESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASK-------GGNTEG  250
            V SWW TT  Y  GGP+ +V G+Q+++   SLGK+LK+  IV LAS+       GGN+  
Sbjct  91   VASWWSTTAAY-AGGPANVVFGRQLVDSKYSLGKSLKNQDIVSLASRLARAKASGGNS--  147

Query  249  CVNVVLTDKDVSVDGFC-KRCGSHG---STAGEK--QVAYAWVGNSETQCPGQCAWPFHK  88
             +N VLT  DV V+GFC  RCGSHG   +  G K  + AYAWVGN   QCPGQCAWPF++
Sbjct  148  -INFVLTSSDVGVEGFCMSRCGSHGWSTTAPGSKGAKFAYAWVGNPGKQCPGQCAWPFYQ  206

Query  87   PIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PI GPQ PPLVAPNGD+G+DGM+I+LATV
Sbjct  207  PIYGPQIPPLVAPNGDIGVDGMVISLATV  235



>ref|XP_011003040.1| PREDICTED: protein EXORDIUM-like [Populus euphratica]
Length=319

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 144/204 (71%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P++ +YH G LL G +++NLIWYGKF P+QR+I+ DF+ S+ +    T  PSV +WWK
Sbjct  36   QDPLLFQYHNGPLLTGDVSINLIWYGKFKPSQRAIVSDFIASVSSRRPTTAEPSVATWWK  95

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G  IL+E+ SLGK+L   QIVQLASKGG     +NVVLT
Sbjct  96   ATEKYYNLVKTKKTSPLLLSVGTPILDESYSLGKSLSSKQIVQLASKGGQKR-AINVVLT  154

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG+HGS+   KQ+       AY WVGNSE QCPGQCAWPFH+PI GP
Sbjct  155  SSDVAVEGFCSSKCGTHGSSLSAKQISGKRSRFAYIWVGNSEIQCPGQCAWPFHQPIYGP  214

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  215  QNPPLVAPNNDVGLDGMVINLASL  238



>ref|XP_011016663.1| PREDICTED: protein EXORDIUM-like [Populus euphratica]
Length=320

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 144/204 (71%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            + P + +YH G LL G I+VNLIWYGKF P+QR+I+ DF++S+ +    T  PSV +WWK
Sbjct  37   QEPFLFQYHNGPLLTGQISVNLIWYGKFRPSQRAIVSDFIDSVSSRKLTTAQPSVATWWK  96

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             TEKY      K   P  + +G QIL+E  SLGK+L   QIVQLASKGG  +  +NVVLT
Sbjct  97   ATEKYFNLVKPKKTSPPLLSLGTQILDEKYSLGKSLSGKQIVQLASKGGQKD-AINVVLT  155

Query  228  DKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGP  73
              DV+V+GFC  +CG HGS+   K++       AY WVGNSETQCPGQCAWP H+PI GP
Sbjct  156  SSDVAVEGFCSSKCGIHGSSLSAKRINRKISKFAYIWVGNSETQCPGQCAWPLHQPIYGP  215

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q PPLVAPN DVG+DGM+INLA++
Sbjct  216  QNPPLVAPNNDVGLDGMVINLASL  239



>gb|EPS71944.1| hypothetical protein M569_02811, partial [Genlisea aurea]
Length=305

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 146/203 (72%), Gaps = 14/203 (7%)
 Frame = -1

Query  570  VKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL-KTVDAPTPSVESWW  394
            V +  ++L+YH G LL+G I VNLIWYG+F PTQR I+ DF++S+  T  A  P+V +WW
Sbjct  23   VAQNSMLLQYHDGALLRGKIAVNLIWYGEFAPTQRVIVSDFVDSIASTATAKQPTVAAWW  82

Query  393  KTTEKYKGGGPS-----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
            K  EKY   GP      ++ +GKQIL E+ SLGK+L + QIV+LASKG +    VNVVLT
Sbjct  83   KNVEKYYYSGPKRQSPPSLYLGKQILVEDYSLGKSLTEKQIVELASKG-DDRNAVNVVLT  141

Query  228  DKDVSVDGFC-KRCGSHGSTAG------EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
              DV+VDGFC  RCG+HGS +        ++ AY WVGNSETQCPG CAWPFH+PI GPQ
Sbjct  142  AADVAVDGFCVNRCGTHGSKSAVIDGKKNRKFAYIWVGNSETQCPGFCAWPFHQPIYGPQ  201

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
             PPLVAPN DVG+DG+++NLA++
Sbjct  202  APPLVAPNNDVGLDGVVMNLASL  224



>ref|XP_009409276.1| PREDICTED: uncharacterized protein LOC103991514 [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 162/228 (71%), Gaps = 18/228 (8%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIP-EPSFG-----ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKF  481
            ATA+  AL+F  LA +    S+G      LV+E P+ + YHKG LL G+++VNLI+YGKF
Sbjct  4    ATAT-TALVFALLASVVFRGSYGGRTLSALVEEQPLAMTYHKGALLAGNVSVNLIFYGKF  62

Query  480  TPTQRSIIVDFLESLKTV----DAPTPSVESWWKTTEKYKGGGPST---IVIGKQILEEN  322
            T +QR+II DF+ SL  +    D+  PSV +WWKT  KY     ++   + +GKQ+++E 
Sbjct  63   TASQRAIISDFVTSLSPLPHQKDSLEPSVATWWKTLAKYYAASRTSFPKLGLGKQVVDEK  122

Query  321  CSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK--QVA  151
             SLG++L+D  + +LA++G   +  VNVVLT +DV+V+GFC  RCG+HG++   +  + A
Sbjct  123  YSLGRSLRDTDLAKLAARGAPRD-AVNVVLTAEDVAVEGFCMSRCGTHGASRRSRAGRSA  181

Query  150  YAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            Y WVGNS TQCPGQCAWPFH+P+ GPQ PPLVAPNGDVG+DGMIINLA
Sbjct  182  YVWVGNSATQCPGQCAWPFHQPMYGPQAPPLVAPNGDVGVDGMIINLA  229



>ref|XP_009380864.1| PREDICTED: uncharacterized protein LOC103969134 [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 155/222 (70%), Gaps = 15/222 (7%)
 Frame = -1

Query  633  SAVALLF-CFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            S  +LLF C   G    +   LV++ P+ + YHKG LL G+I+VNLI+YGKFT +QR+II
Sbjct  13   STASLLFQCSYGGR---TLSALVEQQPLSMTYHKGALLTGNISVNLIFYGKFTASQRAII  69

Query  456  VDFLESLKTV---DAPTPSVESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKD  295
             DF+ SL ++   D+  PSV +WWKT  KY     +    + +GK +L+E CSLG++L+D
Sbjct  70   SDFVASLSSLPHQDSMEPSVATWWKTLAKYYSTSRTPLPKLSLGKLLLDEECSLGRSLRD  129

Query  294  DQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---QVAYAWVGNSE  127
              I  LA+KG      VNVVLT  DV+V+ FC  RCG+HG++   K   + AY WVGNSE
Sbjct  130  ADIETLAAKGA-PRNAVNVVLTADDVAVERFCMSRCGTHGASGRSKAGGRFAYVWVGNSE  188

Query  126  TQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            TQCPGQCAWPFH+PI GPQ PPLVAPNGDVG+DGMIINLA++
Sbjct  189  TQCPGQCAWPFHQPIYGPQAPPLVAPNGDVGVDGMIINLASL  230



>ref|XP_008219324.1| PREDICTED: uncharacterized protein LOC103319550 [Prunus mume]
Length=332

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 148/223 (66%), Gaps = 21/223 (9%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      ELV+    +L+YH G LL G I +NL+WYG F P+Q++II DF+ SL +
Sbjct  30   FQVSLATRKLSELVQGQTQLLKYHNGPLLSGKIAINLVWYGNFKPSQKAIISDFITSLSS  89

Query  429  VDAPT---PSVESWWKTTEKYKGGGPS-----TIVIGKQILEENCSLGKTLKDDQIVQLA  274
               P    PSV +WWKTTEKY     +     ++ +G+QIL+E  SLGK+L   QIVQLA
Sbjct  90   SSPPKTTPPSVATWWKTTEKYYHLSSNKKTSVSLSLGRQILDEKYSLGKSLTTKQIVQLA  149

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAG-----------EKQVAYAWVGNS  130
            SKG + +  +NVVLT  DV+VDGFC  RCG+HGS  G             + AY WVGNS
Sbjct  150  SKG-DQKNAINVVLTSADVTVDGFCMNRCGTHGSALGSTKTGLIKGSKRSKFAYIWVGNS  208

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            E QCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  209  ERQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  251



>ref|XP_006363271.1| PREDICTED: uncharacterized protein LOC102579064 [Solanum tuberosum]
Length=312

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 147/206 (71%), Gaps = 15/206 (7%)
 Frame = -1

Query  576  ELVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSV  406
             LV++P + +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV
Sbjct  27   SLVQDPQMQLLKYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFINSLSSSTPSKTNPSV  86

Query  405  ESWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
              WWKTTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NV
Sbjct  87   AQWWKTTEKYYHLANSKNTLSLNLGKQVLIENYSLGKSLTQKQIVQLASKGEQKDA-INV  145

Query  237  VLTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQ  79
            VLT  DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI 
Sbjct  146  VLTASDVAVDGFCVNRCGTHGASKGAVINGKTYKFAYIWVGNSETFCPGYCAWPFHQPIY  205

Query  78   GPQTPPLVAPNGDVGIDGMIINLATV  1
            GPQ+PPL APN DVG+DGM+INLA++
Sbjct  206  GPQSPPLGAPNNDVGVDGMVINLASL  231



>ref|XP_006853277.1| hypothetical protein AMTR_s00038p00237970 [Amborella trichopoda]
 gb|ERN14744.1| hypothetical protein AMTR_s00038p00237970 [Amborella trichopoda]
Length=309

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWW  394
            LV+E P+VL+YH G LLKG+ ++NLIWYG FTP Q +II DF+ SL +  A   S  SWW
Sbjct  36   LVEEQPLVLKYHNGPLLKGTFSINLIWYGYFTPAQHAIITDFIRSLSSPSASP-SAASWW  94

Query  393  KTTEKYKGGGP--STIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            +T +KYK   P  +T+ +GKQ+L  +  LGKTL   Q+V LASKGG     ++VVLT KD
Sbjct  95   QTVQKYKSVRPGTTTVALGKQLLHSSYPLGKTLTSKQLVALASKGGQ-RNAISVVLTAKD  153

Query  219  VSVDGFCK-RCGSHGSTAGE-KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPN  46
            V+V+GFC  RCG+HGS  G   + AY WVGNSE QCPGQCAWPFH+P+ GPQTPPLVAPN
Sbjct  154  VAVEGFCSSRCGTHGSALGAGSRFAYIWVGNSELQCPGQCAWPFHQPMYGPQTPPLVAPN  213

Query  45   GDVGIDGMIINLATV  1
            GDVG+DGM+INLAT+
Sbjct  214  GDVGVDGMVINLATL  228



>ref|XP_006363272.1| PREDICTED: uncharacterized protein LOC102579389 [Solanum tuberosum]
Length=311

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 142/201 (71%), Gaps = 14/201 (7%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVESWWK  391
            E   +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV  WWK
Sbjct  31   EQTQLLQYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFINSLSSSTPSKTNPSVAQWWK  90

Query  390  TTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            TTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVVLT  
Sbjct  91   TTEKYYYLANSKNTLSLSLGKQVLIENYSLGKSLTQKQIVQLASKGEQKDA-INVVLTAS  149

Query  222  DVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI GPQTP
Sbjct  150  DVAVDGFCVNRCGTHGASKGAVINGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYGPQTP  209

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PL APN DVG+DGM+INLA++
Sbjct  210  PLGAPNNDVGVDGMVINLASL  230



>gb|KDP41401.1| hypothetical protein JCGZ_15808 [Jatropha curcas]
Length=318

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 147/211 (70%), Gaps = 18/211 (9%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PS  409
              ELV++PP +L YH G LL G I++NLIWYG F P+QR+II DF+ SL +  +    PS
Sbjct  28   LNELVQDPPQLLSYHNGPLLSGKISINLIWYGNFKPSQRAIISDFITSLSSPSSHNSQPS  87

Query  408  VESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVN  241
            V +WWKTTEKY          ++ +GKQIL+EN SLGK+L D QIV+LASKG +    +N
Sbjct  88   VSAWWKTTEKYYHLTSKKTTLSLALGKQILDENYSLGKSLTDKQIVELASKG-DQMNAIN  146

Query  240  VVLTDKDVSVDGFC-KRCGSHGSTAGEKQV----------AYAWVGNSETQCPGQCAWPF  94
            VVLT  DV+VD FC  RCG+HGS + + +           AY WVGNS TQCPG CAWPF
Sbjct  147  VVLTSADVAVDRFCFSRCGTHGSASAKSKTGQIKGKNYKFAYVWVGNSVTQCPGYCAWPF  206

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+P+ GPQ PPLVAPN DVG+DGM+INLA++
Sbjct  207  HQPVYGPQNPPLVAPNNDVGLDGMVINLASL  237



>ref|XP_002513945.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48528.1| conserved hypothetical protein [Ricinus communis]
Length=318

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 145/202 (72%), Gaps = 18/202 (9%)
 Frame = -1

Query  555  VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA--PTPSVESWWKTTE  382
            ++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ SL +V +    PSV +WWK TE
Sbjct  37   LLFQYHNGPLLTGKISINLIWYGKFKPSQRAIVSDFITSLSSVKSTVAQPSVVTWWKATE  96

Query  381  KY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            KY      K      + +G QIL+E+ SLGK+L + QIVQLASKGG  +  +NVVLT  D
Sbjct  97   KYYRHINSKKSYNLALSLGAQILDESYSLGKSLSNKQIVQLASKGGQKD-AINVVLTSAD  155

Query  219  VSVDGFCK-RCGSHGSTAGEKQV--------AYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            V+VDGFC  RCG+HGS+   +++        AY WVGNSETQCPGQCAWPFH+PI GPQ+
Sbjct  156  VAVDGFCSSRCGTHGSSISAQKMINGKNSKFAYIWVGNSETQCPGQCAWPFHQPIYGPQS  215

Query  66   PPLVAPNGDVGIDGMIINLATV  1
             PL+APN D G+DGM+INLA++
Sbjct  216  TPLIAPNNDAGLDGMVINLASL  237



>gb|KHN30293.1| hypothetical protein glysoja_042453 [Glycine soja]
Length=313

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 160/228 (70%), Gaps = 14/228 (6%)
 Frame = -1

Query  645  CATASAVALLFCFLAGIPEPSFGELV-KEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQ  469
             ++++ + +LF  +A +   S  +L   +P +  +YH+G LLKG I+VNLIWYGKF P+Q
Sbjct  6    ASSSTVLWILFLTIATLHLSSARKLSGSDPQLQFQYHRGPLLKGKISVNLIWYGKFKPSQ  65

Query  468  RSIIVDFLESLKTVDAPT--PSVESWWKTTEKYKGGGPSTIVIG---KQILEENCSLGKT  304
            ++I+ DF+ SL +    T  PSV +WWK T+KY       + +     QIL+EN SLGK+
Sbjct  66   KAIVADFITSLSSPKPVTAQPSVATWWKATDKYYKNSSPKLALSLGTTQILDENYSLGKS  125

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK------QVAYA  145
            L ++QI++LASKG      +N+VLT  DV+V+GFC  RCG+HGS+ G +      ++AY 
Sbjct  126  LTNNQILKLASKGPQ-RNAINIVLTSADVAVEGFCSSRCGTHGSSVGARVNGKRYKLAYI  184

Query  144  WVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            WVGNSETQCPGQCAWPFH+PI GPQ PPLVAPN DVG+DGM+IN+A++
Sbjct  185  WVGNSETQCPGQCAWPFHQPIYGPQNPPLVAPNNDVGLDGMLINVASL  232



>ref|XP_003523812.1| PREDICTED: uncharacterized protein LOC100779037 [Glycine max]
Length=315

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 146/201 (73%), Gaps = 10/201 (5%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
             LV+  PVVL YH+G LLKG++TV++ WYG FTP  RSIIVDF++SL ++      PS  
Sbjct  35   SLVQPDPVVLNYHRGPLLKGNVTVHINWYGNFTPIHRSIIVDFIQSLGSIPHSRHHPSPF  94

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGG-----NTEGCVNV  238
            SWW+ T +Y+GG P T+ +G Q L+   SLGK+LK   ++ LASK       +    ++V
Sbjct  95   SWWRITARYRGG-PRTLTVGNQTLDNTYSLGKSLKTSHLLALASKNSPPTTRSNANAIHV  153

Query  237  VLTDKDVSVDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            +LT  DV+VDGFC  RCG+HGS    ++++A+AWVGN  TQCPG+CAWPFH+P+ GPQTP
Sbjct  154  LLTSADVAVDGFCMSRCGTHGSGRVAKRRIAFAWVGNPVTQCPGECAWPFHQPVYGPQTP  213

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLV PNGDVG+DGM+I+LATV
Sbjct  214  PLVPPNGDVGVDGMLISLATV  234



>gb|KDP41404.1| hypothetical protein JCGZ_15811 [Jatropha curcas]
Length=311

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 140/197 (71%), Gaps = 17/197 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL---KTVDAPTPSVESWWKTTEK  379
             +YH G LL G I++NLIWYG F P QR+I+ DF+ SL   +T     PSV +WWK TEK
Sbjct  37   FQYHNGPLLAGKISINLIWYGNFKPAQRAIVSDFITSLSSTQTTVTAQPSVATWWKGTEK  96

Query  378  Y----KGGGPSTIVI--GKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            Y    K    S++V+  G Q+L+E+ SLGK+L + QIV+LASKG  +   +NVVLT  DV
Sbjct  97   YYNLIKSKKTSSLVLSLGTQVLDESYSLGKSLSNKQIVELASKGSQSN-AINVVLTSADV  155

Query  216  SVDGFCK-RCGSHGSTAG------EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            +VDGFC  RCG+HGS  G        + AY WVGNSETQCPGQCAWPFH+PI GPQTPPL
Sbjct  156  AVDGFCSSRCGTHGSAVGANINGKRSKFAYIWVGNSETQCPGQCAWPFHQPIYGPQTPPL  215

Query  57   VAPNGDVGIDGMIINLA  7
            VAPN DVG+DGM+INLA
Sbjct  216  VAPNNDVGLDGMVINLA  232



>ref|XP_004253500.2| PREDICTED: protein EXORDIUM-like [Solanum lycopersicum]
Length=312

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 14/201 (7%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVESWWK  391
            E   +L YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL + +     PSV  WWK
Sbjct  32   EQTQLLHYHKGALLSGKISVNLIWYGKFKPSQRAILSDFINSLSSSNPSKTNPSVAQWWK  91

Query  390  TTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            TTEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVVLT  
Sbjct  92   TTEKYYHLANSKNTLSLNLGKQVLVENYSLGKSLTQKQIVQLASKGEQKDA-INVVLTAS  150

Query  222  DVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI GPQTP
Sbjct  151  DVAVDGFCVNRCGTHGASKGAVIKGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYGPQTP  210

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PL APN DVG+DGM+INLA++
Sbjct  211  PLGAPNNDVGVDGMVINLASL  231



>ref|XP_003518234.2| PREDICTED: uncharacterized protein LOC100799846 [Glycine max]
Length=378

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 167/243 (69%), Gaps = 18/243 (7%)
 Frame = -1

Query  678  LALSIMAVI---NNCATASAVA-LLFCFLAGIPEPSFGELV-KEPPVVLEYHKGTLLKGS  514
             +LSI   I   ++ A++S V  +LF  +A +   S  +L   +P +  +YH+G LLKG 
Sbjct  56   FSLSIQKYIEMASSLASSSTVLWILFLTIATLHLSSARKLSGSDPQLQFQYHRGPLLKGK  115

Query  513  ITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWKTTEKYKGGGPSTIVIG-  343
            I+VNLIWYGKF P+Q++I+ DF+ SL +    T  PSV +WWK T+KY       + +  
Sbjct  116  ISVNLIWYGKFKPSQKAIVADFITSLSSPKPVTAQPSVATWWKATDKYYKNSSPKLALSL  175

Query  342  --KQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGST  172
               QIL+EN SLGK+L ++QI++LASKG      +N+VLT  DV+V+GFC  RCG+HGS+
Sbjct  176  GTTQILDENYSLGKSLTNNQILKLASKGPQ-RNAINIVLTSADVAVEGFCSSRCGTHGSS  234

Query  171  AGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINL  10
             G +      ++AY WVGNSETQCPGQCAWPFH+PI GPQ PPLVAPN DVG+DGM+IN+
Sbjct  235  VGARVNGKRYKLAYIWVGNSETQCPGQCAWPFHQPIYGPQNPPLVAPNNDVGLDGMLINV  294

Query  9    ATV  1
            A++
Sbjct  295  ASL  297



>ref|XP_009341762.1| PREDICTED: uncharacterized protein LOC103933805 [Pyrus x bretschneideri]
Length=312

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 141/209 (67%), Gaps = 15/209 (7%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            +  E   +  +  +YH G LL G ++VNLIWYG+FTP+QR+I+ DFL SL    +  PSV
Sbjct  24   NLAETSDQNQMQFQYHNGPLLTGKLSVNLIWYGRFTPSQRAIVSDFLTSLSKPTSDQPSV  83

Query  405  ESWWKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVN  241
             +WWK+ EKY     K      + +G Q+L+EN SLGK+L   QI QLASKG    G +N
Sbjct  84   ATWWKSIEKYYHLSKKPTSSLALSLGTQVLDENYSLGKSLTSRQIQQLASKGAQNYG-IN  142

Query  240  VVLTDKDVSVDGFC-KRCGSHGSTAGEKQ--------VAYAWVGNSETQCPGQCAWPFHK  88
            VVLT  DV VDGFC   CG+HGS+ G  Q         AY WVGNSETQCPGQCAWPFH+
Sbjct  143  VVLTSSDVLVDGFCMNSCGTHGSSNGGSQSRGSKANKFAYIWVGNSETQCPGQCAWPFHQ  202

Query  87   PIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PI GPQ+PPLV PN DVG+DGM+INLA++
Sbjct  203  PIYGPQSPPLVTPNNDVGLDGMVINLASL  231



>ref|XP_006363275.1| PREDICTED: uncharacterized protein LOC102580361 [Solanum tuberosum]
Length=318

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 145/205 (71%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLK--TVDAPTPSVE  403
            LV++P + +L YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL   T     PSV 
Sbjct  34   LVQDPQMQLLNYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSTPSKTNPSVA  93

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY     S    ++ +GKQIL EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  94   QWWKTTEKYYHLANSKNTLSLNLGKQILIENYSLGKSLTQKQIVQLASKG-EQQDAINVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  153  LTASDVAVDGFCVNRCGTHGASKGAVINGKTYKFAYIWVGNSETFCPGYCAWPFHQPIYG  212

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+ PL APN DVG+DGM+INLA++
Sbjct  213  PQSSPLGAPNNDVGVDGMVINLASL  237



>ref|XP_010436130.1| PREDICTED: protein EXORDIUM-like [Camelina sativa]
Length=316

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 140/203 (69%), Gaps = 20/203 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYG F P+QR+II DF+ SL     PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGNFKPSQRAIISDFITSLTHTSPPTSKTLHQPSVATWWK  93

Query  390  TTEKY--------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            TTEKY              T+ +GKQIL+E+CSLGK+L D  I +LASKG +    VNVV
Sbjct  94   TTEKYYKLAASAKSSSPSLTLTLGKQILDESCSLGKSLTDGDIRKLASKG-DQRDAVNVV  152

Query  234  LTDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
            LT  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ
Sbjct  153  LTSADVAVQGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQ  212

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            +PPLVAPN DVG+DGM+INLA++
Sbjct  213  SPPLVAPNNDVGLDGMVINLASL  235



>ref|XP_006363274.1| PREDICTED: uncharacterized protein LOC102580035 [Solanum tuberosum]
Length=318

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 145/205 (71%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
            LV++P + +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL +       PSV 
Sbjct  34   LVQDPQMQLLKYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFINSLSSSIPSKINPSVA  93

Query  402  SWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWKTTEKY          ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  94   QWWKTTEKYYHLTNSKNTLSLNLGKQVLIENYSLGKSLTQKQIVQLASKGEQRDA-INVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  153  LTASDVAVDGFCVNRCGTHGASKGAVIKGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYG  212

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ PPL APN DVG+DGM+INLA++
Sbjct  213  PQNPPLGAPNNDVGVDGMVINLASL  237



>ref|XP_009372905.1| PREDICTED: uncharacterized protein LOC103961973 [Pyrus x bretschneideri]
 ref|XP_009372914.1| PREDICTED: uncharacterized protein LOC103961973 [Pyrus x bretschneideri]
Length=330

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 151/222 (68%), Gaps = 20/222 (9%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      ELV++   +L+YH G LL G IT+NLIWYG F P+Q++I+ DF+ SL +
Sbjct  29   FQVSLATRKLSELVQDQTQLLKYHNGPLLSGKITINLIWYGNFKPSQKAIVSDFISSLSS  88

Query  429  VDAPT-PSVESWWKTTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLAS  271
                T PSV +WWKTTEKY      K     ++ +G+QIL++  SLGK+L   QIV LA+
Sbjct  89   PSKTTQPSVTAWWKTTEKYYHLTSSKKSYSLSLSLGRQILDQKYSLGKSLTTKQIVALAA  148

Query  270  KGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAG-----------EKQVAYAWVGNSE  127
            KG + +  +NVVLT  DV+VDGFC  RCG+HGS +G             + AY WVGNSE
Sbjct  149  KG-DQKNAINVVLTSADVAVDGFCMNRCGTHGSASGATKTGHVKGSKNYKFAYIWVGNSE  207

Query  126  TQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            TQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  208  TQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  249



>ref|XP_010538939.1| PREDICTED: protein EXORDIUM-like [Tarenaya hassleriana]
Length=313

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 19/201 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWKTTEKY  376
            L+YHKG+LL G I+VNLIWYGKF P+Q++I+ DF+ SL    A T  PSV +WWKTTE Y
Sbjct  33   LKYHKGSLLSGKISVNLIWYGKFKPSQKAIVSDFITSLSHSPAKTGQPSVATWWKTTESY  92

Query  375  K--GGG-----PS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
                GG     PS ++ +G+QIL+E+CSLGK+L + QI++LA +G +    VNVVLT  D
Sbjct  93   YRLAGGRKNPFPSLSLSLGRQILDESCSLGKSLSEKQILELAYRG-DQHNAVNVVLTSAD  151

Query  219  VSVDGFC-KRCGSHGSTAGE-------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP  64
            V+V GFC  +CGSHGS  G         + AY WVGNSETQCPGQCAWPFH P+ GPQ P
Sbjct  152  VAVQGFCMSKCGSHGSALGRPVKGRRSSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQNP  211

Query  63   PLVAPNGDVGIDGMIINLATV  1
            PLVAPN DVG+DG++INLA++
Sbjct  212  PLVAPNNDVGLDGVVINLASL  232



>gb|KDP41403.1| hypothetical protein JCGZ_15810 [Jatropha curcas]
Length=317

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 142/199 (71%), Gaps = 15/199 (8%)
 Frame = -1

Query  555  VVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKY  376
            ++ +YH G LL G I++NLIWYGKF P+Q +I+ DF+ SL   +   PSV +W+K TEKY
Sbjct  39   LLFQYHNGPLLTGKISINLIWYGKFKPSQHAIVSDFIASLSKPEIAQPSVSTWFKATEKY  98

Query  375  ------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
                  K      + +G QI +E+ SLGK+L + QIV+LAS+G   +  +NVVLT KDV+
Sbjct  99   YNLIKSKRASSPVVHLGTQIFDESYSLGKSLSNKQIVELASRGAQND-AINVVLTSKDVT  157

Query  213  VDGFCK-RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            V+GFC  RCG+HGS+   K++       AY WVGNSE+QCPGQCAWPFH+PI GPQ PPL
Sbjct  158  VEGFCSSRCGTHGSSVAAKKINGKSSKLAYIWVGNSESQCPGQCAWPFHQPIYGPQNPPL  217

Query  57   VAPNGDVGIDGMIINLATV  1
            V+PN DVG+DGM+INLA++
Sbjct  218  VSPNNDVGLDGMVINLASL  236



>gb|KEH28079.1| phosphate-responsive 1 family protein [Medicago truncatula]
 gb|AES98100.2| phosphate-responsive 1 family protein [Medicago truncatula]
Length=315

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 156/229 (68%), Gaps = 19/229 (8%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSFGELVK-EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSII  457
            SA+ +LF  ++ +   S  +L + +  +  +YHKG LL G I+VNLIWYGKF P+QR+II
Sbjct  7    SAIFILFLTISLLQLSSARKLTESDQQLKFQYHKGPLLTGKISVNLIWYGKFKPSQRAII  66

Query  456  VDFLESLKTVDAPT----PSVESWWKTTEKY------KGGGPSTIVIGKQILEENCSLGK  307
             DF+ SL +   PT    PSV +WWK+TEKY      K      + +G QIL+E  SLGK
Sbjct  67   TDFITSLSSPIKPTTASQPSVATWWKSTEKYYQLTNNKKSVNLALSLGSQILDEKYSLGK  126

Query  306  TLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK------QVAY  148
            +L  +QI+ LASKG   +  +NVVLT  DV VDGFC  RCG+HGS+ G +      + AY
Sbjct  127  SLTTNQILNLASKG-QQQNAINVVLTAADVLVDGFCSSRCGTHGSSYGARVNGKRNKFAY  185

Query  147  AWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             WVGNSETQC GQCAWPFH+PI GPQ+ PLVAPN DVG+DGM+IN+A++
Sbjct  186  IWVGNSETQCAGQCAWPFHQPIYGPQSAPLVAPNNDVGLDGMVINVASL  234



>ref|XP_006288093.1| hypothetical protein CARUB_v10001324mg, partial [Capsella rubella]
 gb|EOA20991.1| hypothetical protein CARUB_v10001324mg, partial [Capsella rubella]
Length=346

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 144/204 (71%), Gaps = 22/204 (11%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYG F P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  64   LLKYHKGALLSGKISVNLIWYGNFKPSQRAIISDFITSL-THTSPTSKTLHQPSVATWWK  122

Query  390  TTEKY--------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
            TTEKY            PS T+ +GKQIL+E+CSLGK+L D  I +LASKG +    VNV
Sbjct  123  TTEKYYKLAGSAKTSASPSLTLSLGKQILDESCSLGKSLTDKDIRKLASKG-DQRDAVNV  181

Query  237  VLTDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGP  73
            VLT  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GP
Sbjct  182  VLTSADVAVQGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPLYGP  241

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q+PPLVAPN DVG+DGM+INLA++
Sbjct  242  QSPPLVAPNNDVGLDGMVINLASL  265



>ref|XP_008237196.1| PREDICTED: uncharacterized protein LOC103335938 [Prunus mume]
Length=276

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 144/200 (72%), Gaps = 9/200 (5%)
 Frame = -1

Query  624  ALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            A  F  L  +  P+   LV++ P+VL+YH G LLKG+ITVN IWYG+FTP QRSI+VDF+
Sbjct  8    ATSFIILLSLIGPNLSALVEQQPLVLKYHNGALLKGNITVNFIWYGRFTPIQRSIVVDFV  67

Query  444  ESLKTVD------APTPSVESWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIV  283
            +SL++        AP  S  SWWKTTEKYK G  S +V+G+Q+L E  +LGK+L +  +V
Sbjct  68   QSLRSRRSLSSRRAPPGSAASWWKTTEKYKSGA-SNLVVGRQVLHEAYTLGKSLGNQHLV  126

Query  282  QLASKGGNTEGCVNVVLTDKDVSVDGFCKRCGSHGSTAGEKQVAYAWVGNSETQCPGQCA  103
             LA K  N    +NVV T +DV+V GFC RCG+HGST  +K+ AY WVGNSE QCPGQCA
Sbjct  127  ALAGKV-NALKAINVVRTARDVAVAGFCSRCGTHGSTR-DKKTAYIWVGNSEAQCPGQCA  184

Query  102  WPFHKPIQGPQTPPLVAPNG  43
            WPFH+PI GPQTPPLVAP+G
Sbjct  185  WPFHQPIYGPQTPPLVAPDG  204



>ref|XP_010273027.1| PREDICTED: protein EXORDIUM-like [Nelumbo nucifera]
Length=317

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 147/211 (70%), Gaps = 21/211 (10%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA------PT  415
            E V+E   +L+YH G LL G I+VNLIWYG F P+QR+II DF+ SL T  A        
Sbjct  28   EQVQEQAQLLQYHNGPLLSGEISVNLIWYGNFKPSQRAIISDFVSSLSTSPALEQTTQSQ  87

Query  414  PSVESWWKTTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE  253
            PSV +WWKTTEKY      K     ++ +GKQIL+ N SLGK+L   QIV+LA+KGG  +
Sbjct  88   PSVATWWKTTEKYYHLASPKKHPSLSLKMGKQILD-NYSLGKSLTGKQIVELAAKGGQ-K  145

Query  252  GCVNVVLTDKDVSVDGFCK-RCGSHGST------AGEKQVAYAWVGNSETQCPGQCAWPF  94
              +N+VLT  DV+V GFC  RCG+HGS+      +   + AY WVGNSETQCPG CAWPF
Sbjct  146  NAINIVLTASDVTVQGFCSSRCGTHGSSWSSQVKSKSYKFAYIWVGNSETQCPGHCAWPF  205

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+PI GPQTPPLVAPN DVG+DGM+INLA++
Sbjct  206  HQPIYGPQTPPLVAPNNDVGMDGMVINLASL  236



>ref|XP_010060031.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=322

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I++NLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISINLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS  + +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRHAPSLRLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  149  RNAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVKGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P+ GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  PFHQPLYGPQSPPLVAPNGDVGVDGMVINLA  239



>ref|XP_009409277.1| PREDICTED: uncharacterized protein LOC103991515 [Musa acuminata 
subsp. malaccensis]
Length=316

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 154/225 (68%), Gaps = 17/225 (8%)
 Frame = -1

Query  627  VALLFCFLAGIPEPSFG-----ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            V L   F A + + SFG      LV+E P+ + YHKG LL G+++VNL++YGKFT  QR+
Sbjct  12   VLLTLLFAASLFQRSFGGRTLSALVEEQPLAMTYHKGALLTGNVSVNLVFYGKFTAYQRA  71

Query  462  IIVDFLESL----KTVDAPTPSVESWWKTTEKYKGGGPS---TIVIGKQILEENCSLGKT  304
            II DF+ SL    +      PSV +WWKT  KY     +    + +GKQ+L+E  SLG++
Sbjct  72   IISDFVASLSPLPRRKQYVEPSVATWWKTLAKYYATSRTPLPRLRLGKQVLDETYSLGRS  131

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---QVAYAWVG  136
            L+D  + +LA++G   +  +NVVLT +DV+V  FC  RCGSHG++   +   + AY WVG
Sbjct  132  LRDSDLAKLAARGAPRD-AINVVLTAEDVAVGRFCMSRCGSHGASPQSRASGRFAYIWVG  190

Query  135  NSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            NS TQCPGQCAWPFH+P+ GPQTPPLVAPNGDVG+DGM+INLA++
Sbjct  191  NSATQCPGQCAWPFHQPLYGPQTPPLVAPNGDVGVDGMVINLASM  235



>ref|XP_010060034.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=321

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 19/210 (9%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT---VDAPTP  412
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +   +   +P
Sbjct  30   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQASP  89

Query  411  SVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE  253
            SV  WWKT +KY      K   PS TI +G+Q+L+E+ SLGK+L +  +++LAS+G    
Sbjct  90   SVSHWWKTVDKYYHLSSSKRRTPSLTISLGRQVLDESYSLGKSLTNKHLIELASRG-EQR  148

Query  252  GCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWP  97
              +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSET+CPGQCAWP
Sbjct  149  NAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETRCPGQCAWP  208

Query  96   FHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            FH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  FHQPQYGPQSPPLVAPNGDVGVDGMVINLA  238



>ref|XP_010060027.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=322

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRRTPSLTLSLGRQVLDESYSLGKSLMSKHLVKLASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  149  RNAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  PFHQPQYGPQSPPLVAPNGDVGVDGMVINLA  239



>ref|XP_010455304.1| PREDICTED: protein EXORDIUM-like [Camelina sativa]
Length=315

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 143/203 (70%), Gaps = 21/203 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGKFKPSQRAIISDFITSL-THTSPTSKTLHQPSVVTWWK  92

Query  390  TTEKY--------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            TTEKY              T+ +GKQIL+E+CSLGK+L D  I +LASKG +    VNVV
Sbjct  93   TTEKYYKLAASAKSSSPSLTLTLGKQILDESCSLGKSLTDGDIRKLASKG-DQRDAVNVV  151

Query  234  LTDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
            LT  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ
Sbjct  152  LTSADVAVQGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHSPVYGPQ  211

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            +PPLVAPN DVG+DGM+INLA++
Sbjct  212  SPPLVAPNNDVGLDGMVINLASL  234



>ref|XP_006363273.1| PREDICTED: uncharacterized protein LOC102579714 [Solanum tuberosum]
Length=318

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 145/205 (71%), Gaps = 15/205 (7%)
 Frame = -1

Query  573  LVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
            LV++P + +L+YHKG LL G I+VNLIWYGKF P+QR+I+ DF+ SL +       PSV 
Sbjct  34   LVQDPQMQLLKYHKGALLSGKISVNLIWYGKFKPSQRAIVSDFITSLSSSIPSKTNPSVA  93

Query  402  SWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
             WWK TEKY     S    ++ +GKQ+L EN SLGK+L   QIVQLASKG   +  +NVV
Sbjct  94   QWWKITEKYYHLANSKNALSLSLGKQVLIENYSLGKSLTQKQIVQLASKGAQKD-AINVV  152

Query  234  LTDKDVSVDGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            LT  DV+VDGFC  RCG+HG++ G        + AY WVGNSET CPG CAWPFH+PI G
Sbjct  153  LTASDVAVDGFCVNRCGTHGASKGAVINGKTYKFAYIWVGNSETLCPGYCAWPFHQPIYG  212

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ+ PL APN DVG+DGM+INLA++
Sbjct  213  PQSAPLGAPNNDVGVDGMVINLASL  237



>gb|EYU29446.1| hypothetical protein MIMGU_mgv1a010094mg [Erythranthe guttata]
Length=322

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 151/220 (69%), Gaps = 29/220 (13%)
 Frame = -1

Query  582  FGELVKEPPV--VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--  415
            F  LV E P   +L+YHKG+LL G I+VNLIWYGKF P+QR+I+ DF+ SL +  + +  
Sbjct  21   FAALVAEEPQTQLLKYHKGSLLHGRISVNLIWYGKFKPSQRAIVSDFISSLSSSPSNSAA  80

Query  414  -------PSVESWWKTTEKY-------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQL  277
                   PSV +WW+TTEKY       K     ++ +GKQ+L+E  SLGK+L   QIVQL
Sbjct  81   AAAAQIEPSVATWWRTTEKYYNLAGGAKKASSLSLSLGKQVLDEGYSLGKSLSQKQIVQL  140

Query  276  ASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEK---------QVAYAWVGNSE  127
            ASKG  +   VNVVLT  DV+VDGFC  RCGSHGS++  K         + AY WVGNSE
Sbjct  141  ASKGEKSN-AVNVVLTASDVNVDGFCVNRCGSHGSSSNSKFARGGNKNYKFAYIWVGNSE  199

Query  126  TQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            TQCPG CAWPFH+PI GPQ+PPLVAPN DVG+DG++INL+
Sbjct  200  TQCPGFCAWPFHQPIYGPQSPPLVAPNNDVGLDGIVINLS  239



>ref|XP_004237932.1| PREDICTED: protein EXORDIUM-like [Solanum lycopersicum]
Length=315

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 140/197 (71%), Gaps = 14/197 (7%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVESWWKTTEK  379
            +L+YHKG LL G ++VNLIWYGKF P+QR+I+ DF+ SL + +     PSV  WWKTTEK
Sbjct  39   LLKYHKGALLSGKVSVNLIWYGKFKPSQRAIVSDFINSLSSSNPSKTNPSVAQWWKTTEK  98

Query  378  YKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSV  211
            Y     S    ++ +GKQ+L EN SLGK L   QIVQLASKG   +  +NVVLT  DV+V
Sbjct  99   YYHLANSNNTLSLNLGKQVLIENYSLGKALTQKQIVQLASKGEQRDA-INVVLTASDVAV  157

Query  210  DGFC-KRCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            DGFC  RCG+HG++ G        +  Y WVGNSET CPG CAWPFH+PI GPQTPPL A
Sbjct  158  DGFCVNRCGTHGASKGAIIEGKTHKFTYIWVGNSETLCPGYCAWPFHQPIYGPQTPPLGA  217

Query  51   PNGDVGIDGMIINLATV  1
            PN DVG+DGM+INLA++
Sbjct  218  PNNDVGVDGMVINLASL  234



>gb|KCW66563.1| hypothetical protein EUGRSUZ_F00362 [Eucalyptus grandis]
Length=343

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 147/211 (70%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  52   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAHAP-  110

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  111  PSVSQWWKTVDKYYHLSSSKRRTPSLTLSLGRQVLDESYSLGKSLASKHLVELASRG-EQ  169

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
            +  +NVVLT  DV+V+GFC  RCGSH S     +V       AY WVGNSETQCPGQCAW
Sbjct  170  QNAINVVLTSSDVAVEGFCMSRCGSHDSAVSSVKVNGRSSRFAYIWVGNSETQCPGQCAW  229

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P+ GPQ+PPLVAP+GDVG+DGM+INLA
Sbjct  230  PFHQPLYGPQSPPLVAPDGDVGVDGMVINLA  260



>ref|XP_010421809.1| PREDICTED: protein EXORDIUM isoform X1 [Camelina sativa]
 ref|XP_010421810.1| PREDICTED: protein EXORDIUM isoform X2 [Camelina sativa]
Length=315

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 143/203 (70%), Gaps = 21/203 (10%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT------PSVESWWK  391
            +L+YHKG LL G I+VNLIWYGKF P+QR+II DF+ SL T  +PT      PSV +WWK
Sbjct  34   LLKYHKGALLSGKISVNLIWYGKFKPSQRAIISDFITSL-THTSPTSKTLHQPSVATWWK  92

Query  390  TTEKY--------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            TTEKY              T+ +GKQIL+++CSLGK+L D  I +LASKG +    VNVV
Sbjct  93   TTEKYYKLAASAKSSSPSLTLTLGKQILDKSCSLGKSLTDGDIRKLASKG-DQRNAVNVV  151

Query  234  LTDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
            LT  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ
Sbjct  152  LTSADVTVQGFGMSRCGTHGHARGLGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQ  211

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            +PPLVAPN DVG+DGM+INLA++
Sbjct  212  SPPLVAPNNDVGLDGMVINLASL  234



>ref|NP_196506.1| protein exordium like 4 [Arabidopsis thaliana]
 sp|Q9FY71.1|EXOL4_ARATH RecName: Full=Protein EXORDIUM-like 4; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC05470.1| putative protein [Arabidopsis thaliana]
 gb|AAL38302.1| putative protein [Arabidopsis thaliana]
 gb|AAM10122.1| putative protein [Arabidopsis thaliana]
 gb|AAM65367.1| phi-1-like protein [Arabidopsis thaliana]
 gb|AED91393.1| protein exordium like 4 [Arabidopsis thaliana]
Length=278

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 138/181 (76%), Gaps = 9/181 (5%)
 Frame = -1

Query  525  LKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVESWWKTTEKYKGGGPSTIV  349
            L G+IT+NLIWYGKFTP QRSIIVDF+ S+ +V A   PSV SWWKTTEKYK G  ST+V
Sbjct  32   LNGNITLNLIWYGKFTPIQRSIIVDFIRSISSVTAAKGPSVASWWKTTEKYKTG-VSTLV  90

Query  348  IGKQILEENCSLGKTLKDDQIVQLASK---GGNTEGCVNVVLTDKDVSVDGFC-KRCGSH  181
            +GKQ+L EN  LGK+LK   +  L+SK   GG     + VVLT KDV+V+G C  RCG+H
Sbjct  91   VGKQLLLENYPLGKSLKSPYLRALSSKLNAGGARS--ITVVLTAKDVTVEGLCMNRCGTH  148

Query  180  GSTAGE-KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLAT  4
            GS +      AY WVGNSETQCPG CAWPFH+PI GPQ+PPLVAPNGDVG+DGMIIN+AT
Sbjct  149  GSKSSSVNSGAYVWVGNSETQCPGYCAWPFHQPIYGPQSPPLVAPNGDVGVDGMIINIAT  208

Query  3    V  1
            +
Sbjct  209  L  209



>ref|XP_004152631.1| PREDICTED: uncharacterized protein LOC101221106 [Cucumis sativus]
 ref|XP_004171414.1| PREDICTED: uncharacterized LOC101221106 [Cucumis sativus]
 gb|KGN62701.1| hypothetical protein Csa_2G369020 [Cucumis sativus]
Length=316

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
            E + +    L+YH G LL G I+VNLIWYGKF P+Q++I+ DF+ SL +       PSV 
Sbjct  30   EFIPDQTQSLKYHNGALLSGKISVNLIWYGKFKPSQKAIVSDFISSLSSSRPQVTEPSVS  89

Query  402  SWWKTTEKY--KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
            +WWK TEKY  K   P  + +GKQIL+EN SLGK+L + QI+QLASKG      +NVVLT
Sbjct  90   TWWKLTEKYYKKKSSPLFLNLGKQILDENYSLGKSLTNKQILQLASKG-EQRNAINVVLT  148

Query  228  DKDVSVDGFC-KRCGSHGSTAGEKQ-----------VAYAWVGNSETQCPGQCAWPFHKP  85
              DV+VDGFC  RCG+HG  +  ++            AY WVGNSETQCPG CAWPFH+P
Sbjct  149  ASDVTVDGFCMSRCGTHGFGSTVRRGRGGVKGKNYKFAYIWVGNSETQCPGHCAWPFHQP  208

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            + GPQ+PPL+APNGDVG+DGMIINLA++
Sbjct  209  MYGPQSPPLIAPNGDVGMDGMIINLASL  236



>gb|KCW66560.1| hypothetical protein EUGRSUZ_F00359 [Eucalyptus grandis]
Length=322

 Score =   228 bits (582),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 145/210 (69%), Gaps = 21/210 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGQISVNLIWYGRFKPFQRTIVSDFVTSLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYRLSSSKRRTPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  149  RNAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINL  10
            PFH+P+ GPQ+PPLVAPNGDVG+DGM+INL
Sbjct  209  PFHQPLYGPQSPPLVAPNGDVGVDGMVINL  238



>ref|XP_007141205.1| hypothetical protein PHAVU_008G176000g [Phaseolus vulgaris]
 gb|ESW13199.1| hypothetical protein PHAVU_008G176000g [Phaseolus vulgaris]
Length=310

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 142/194 (73%), Gaps = 12/194 (6%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVESWWKTTEKY  376
             +YH+G LL G I+VNLIWYG F P+Q++I+ DF+ SL +     P PSV +WWK T+KY
Sbjct  37   FQYHRGPLLTGKISVNLIWYGNFKPSQKAIVTDFITSLSSPKPLTPQPSVATWWKATQKY  96

Query  375  -KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGF  202
             K   P  ++ +G QIL++N S GK+L +DQI++LASKG      +NVVLT  DV+V+GF
Sbjct  97   YKTSSPKLSLSLGSQILDQNYSFGKSLTNDQILKLASKGPQ-RNAINVVLTSADVAVEGF  155

Query  201  CK-RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNG  43
            C  RCG+HGS+ G +      + AY WVGNSETQCPGQCAWPFH+PI GPQ P L+APN 
Sbjct  156  CSSRCGTHGSSMGARVNGKRYKFAYVWVGNSETQCPGQCAWPFHQPIYGPQNPALIAPNN  215

Query  42   DVGIDGMIINLATV  1
            DVG+DGM+IN+A++
Sbjct  216  DVGVDGMVINVASL  229



>ref|XP_010060033.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=322

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 147/211 (70%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAHAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRRTPSLTLSLGRQVLDESYSLGKSLASKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
            +  +NVVLT  DV+V+GFC  RCGSH S     +V       AY WVGNSETQCPGQCAW
Sbjct  149  QNAINVVLTSSDVAVEGFCMSRCGSHDSAVSSVKVNGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P+ GPQ+PPLVAP+GDVG+DGM+INLA
Sbjct  209  PFHQPLYGPQSPPLVAPDGDVGVDGMVINLA  239



>gb|KCW66562.1| hypothetical protein EUGRSUZ_F00361 [Eucalyptus grandis]
Length=369

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  78   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  136

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  137  PSVSQWWKTVDKYYHLSSSKRRTPSLTLSLGRQVLDESYSLGKSLMSKHLVKLASRG-EQ  195

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  196  RNAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAW  255

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  256  PFHQPQYGPQSPPLVAPNGDVGVDGMVINLA  286



>ref|XP_008444846.1| PREDICTED: uncharacterized protein LOC103488070 [Cucumis melo]
Length=318

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 147/208 (71%), Gaps = 17/208 (8%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
            E + +    L+YH G LL G I+VNLIWYGKF P+Q++I+ DF+ SL +       PSV 
Sbjct  31   EFIPDQTQSLKYHNGVLLSGKISVNLIWYGKFKPSQKAIVSDFISSLSSSRPQITEPSVS  90

Query  402  SWWKTTEKY--KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
            +WWK TEKY  K   P  + +GKQIL+EN SLGK+L + +I+QLASKG      +NVVLT
Sbjct  91   TWWKLTEKYYKKKSSPLFLNLGKQILDENYSLGKSLTNKKILQLASKG-EQRNAINVVLT  149

Query  228  DKDVSVDGFC-KRCGSHG-------STAGEK----QVAYAWVGNSETQCPGQCAWPFHKP  85
              DV+VDGFC  RCG+HG        +AG K    + AY WVGNSETQCPG CAWPFH+P
Sbjct  150  ASDVTVDGFCMSRCGTHGFGSAVRRGSAGVKGKNYKFAYIWVGNSETQCPGHCAWPFHQP  209

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            + GPQ+PPL+APNGD+G+DGMIINLA++
Sbjct  210  MYGPQSPPLIAPNGDMGMDGMIINLASL  237



>ref|XP_010098619.1| hypothetical protein L484_012731 [Morus notabilis]
 gb|EXB75358.1| hypothetical protein L484_012731 [Morus notabilis]
Length=316

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 21/207 (10%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT----PSVESW  397
            +P  +L+YH G LL G I++NLIWYGKF P+QR+I+ DF  SL +  +P+    PSV +W
Sbjct  31   KPDQLLKYHNGPLLSGKISINLIWYGKFKPSQRAIVSDFFTSLSS-PSPSQNNQPSVATW  89

Query  396  WKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            WK TEKY     +     ++ + KQIL+++ SLGK+L + QI+ LASKG + +  +NVVL
Sbjct  90   WKLTEKYYHLTSRKSPQLSLTLNKQILDKSYSLGKSLTNKQIINLASKG-DQKNAINVVL  148

Query  231  TDKDVSVDGFC-KRCGSHGSTAGEK---------QVAYAWVGNSETQCPGQCAWPFHKPI  82
            T  DV+VDGFC  RCG+HGS+ G           + AY WVGNSETQCPGQCAWP H+PI
Sbjct  149  TSADVTVDGFCMSRCGTHGSSVGSNAGHVKGKVYKFAYIWVGNSETQCPGQCAWPLHQPI  208

Query  81   QGPQTPPLVAPNGDVGIDGMIINLATV  1
             GPQ+PPLVAPN DVG+DGMIINLA++
Sbjct  209  YGPQSPPLVAPNNDVGLDGMIINLASL  235



>gb|KCW66558.1| hypothetical protein EUGRSUZ_F00357 [Eucalyptus grandis]
Length=428

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I++NLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  137  LAELVQDQSPPMKYHNGPLLSGKISINLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  195

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS  + +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  196  PSVSQWWKTVDKYYHLSSSKRHAPSLRLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  254

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  255  RNAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVKGRSSRFAYIWVGNSETQCPGQCAW  314

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P+ GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  315  PFHQPLYGPQSPPLVAPNGDVGVDGMVINLA  345



>ref|XP_004516719.1| PREDICTED: uncharacterized protein LOC101502011 [Cicer arietinum]
Length=315

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 143/199 (72%), Gaps = 17/199 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT---PSVESWWKTTEK  379
             +YHKG LL G I++N+IWYGKF P+QR+II DF+ SL +    T   PSV +WWK+TEK
Sbjct  37   FQYHKGPLLSGKISINIIWYGKFKPSQRTIITDFINSLSSPKQTTTLQPSVATWWKSTEK  96

Query  378  Y------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            Y      K      + +G QIL+EN SLGK+L  +QI++LASKG   +  +N+VLT  DV
Sbjct  97   YYHLTNNKKSVNLALSLGAQILDENYSLGKSLTTNQILKLASKGPQKD-SINIVLTSADV  155

Query  216  SVDGFC-KRCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
            +VDGFC  RCG+HGS+ G +      + AY WVGNSETQC GQCAWPFH+PI GPQ+ PL
Sbjct  156  AVDGFCSNRCGTHGSSNGARVNGKRYKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSSPL  215

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPN DVG+DGM+IN+A++
Sbjct  216  VAPNNDVGLDGMVINVASL  234



>ref|XP_010060030.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
 gb|KCW66559.1| hypothetical protein EUGRSUZ_F00358 [Eucalyptus grandis]
Length=322

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFQPSQRTIVSDFVTSLSSDPSLAHAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRPTPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
            +  VNVVLT  DV+V+GFC  RCGSH S  G  +V        Y WVGNSETQCPGQCAW
Sbjct  149  QNAVNVVLTSSDVAVEGFCMSRCGSHDSAIGSVKVNGKSSRFPYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  PFHQPQYGPQSPPLVAPNGDVGVDGMVINLA  239



>ref|XP_010060035.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=321

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 145/210 (69%), Gaps = 19/210 (9%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT---VDAPTP  412
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +   +   +P
Sbjct  30   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQASP  89

Query  411  SVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE  253
            SV  WWKT +KY      K   PS T+  G+QIL+E+ SLGK+L +  +V+LAS+G    
Sbjct  90   SVSHWWKTVDKYYHLSSSKRRTPSLTLSPGRQILDESYSLGKSLTNKHLVELASRG-EQR  148

Query  252  GCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWP  97
              +NVVLT  DV+V+GFC  RCGSH S  G  +V       AY WVGNSETQCPGQCAWP
Sbjct  149  NAINVVLTSSDVAVEGFCMSRCGSHDSAVGSVKVKGRSSRFAYIWVGNSETQCPGQCAWP  208

Query  96   FHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            FH+P  GPQ+PPLVAPNGDV +DGM+INLA
Sbjct  209  FHQPQYGPQSPPLVAPNGDVAVDGMVINLA  238



>ref|XP_009380865.1| PREDICTED: uncharacterized protein LOC103969135 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 149/206 (72%), Gaps = 12/206 (6%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL----KTVDAP  418
            +   LV++ P+ + YHKG L+ G+++VNL++YGKFT +QR+II DF+ SL    +   + 
Sbjct  33   TLAALVEQQPLAMTYHKGALITGNVSVNLVFYGKFTASQRAIISDFVTSLSPLPRQKHSL  92

Query  417  TPSVESWWKTTEKYKGGGPSTI---VIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGC  247
             PSV +WW T  KY     + +   ++GKQIL+E+CSLGK+L+D  + +LA++G   +  
Sbjct  93   EPSVATWWTTLAKYYATSKAPLPKPILGKQILDESCSLGKSLRDADLAKLAARGAARDA-  151

Query  246  VNVVLTDKDVSVDGFC-KRCGSHGSTA---GEKQVAYAWVGNSETQCPGQCAWPFHKPIQ  79
            ++VVLT +DV+VD FC  RCGSHGS++      + AY WVGNS  QCPGQCAWPFH+P+ 
Sbjct  152  ISVVLTAEDVAVDRFCMSRCGSHGSSSLSEAGSRFAYIWVGNSAAQCPGQCAWPFHQPMY  211

Query  78   GPQTPPLVAPNGDVGIDGMIINLATV  1
            GPQTPPLVAPNGDVG DGM+INLA++
Sbjct  212  GPQTPPLVAPNGDVGADGMVINLASM  237



>ref|XP_010060026.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
Length=322

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 145/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFKPSQRTIVSDFVASLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLG++L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRRTPSLTLSLGRQVLDESYSLGESLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               VNVVLT  DV+V+GFC  RCGSH S     +V       AY WVGNSETQCPGQCAW
Sbjct  149  RNAVNVVLTSSDVAVEGFCMSRCGSHDSAVSSVKVNGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  PFHQPQYGPQSPPLVAPNGDVGVDGMVINLA  239



>ref|XP_009341759.1| PREDICTED: uncharacterized protein LOC103933801 [Pyrus x bretschneideri]
Length=311

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 149/223 (67%), Gaps = 15/223 (7%)
 Frame = -1

Query  627  VALLFC-FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVD  451
            +AL+F  F       +  E   +  +  +YH G LL G+ +VNLIWYG+FTP+QR+I+ D
Sbjct  9    LALVFSLFHFSSAARNLAETSDQNQMQFQYHNGPLLTGTFSVNLIWYGRFTPSQRAIVSD  68

Query  450  FLESLKTVDAPTPSVESWWKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQI  286
            FL SL    +  PSV +WWK+ EKY     K     ++ +G QIL+EN SLGK+L   QI
Sbjct  69   FLTSLSKPTSDQPSVATWWKSIEKYYHLSKKPSSSLSLSLGTQILDENYSLGKSLTSRQI  128

Query  285  VQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNS  130
             QLASKG    G +NVVLT  DV VDGFC  +CG+H S+ G  Q+        Y WVGNS
Sbjct  129  QQLASKGAQNYG-INVVLTSSDVLVDGFCMNQCGTHSSSNGGSQIRGSKTKFTYIWVGNS  187

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            ETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+I+LA++
Sbjct  188  ETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVISLASL  230



>ref|XP_004500640.1| PREDICTED: uncharacterized protein LOC101494486 [Cicer arietinum]
Length=303

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 142/196 (72%), Gaps = 8/196 (4%)
 Frame = -1

Query  567  KEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKT  388
             + P+  +YH G LL G I++NLIWYGKF  +QR+II +F+ S+ T     PSV +WWK 
Sbjct  28   NDQPLKFQYHNGPLLTGKISINLIWYGKFNVSQRAIISNFINSIFTPIKAQPSVATWWKI  87

Query  387  TEKYKGGGPSTIV---IGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
             E Y     + IV   +G QIL++N SLGK+L +DQI++LASKG   +  +NVVLT  DV
Sbjct  88   IETYYHLTKTPIVTLTMGSQILDQNYSLGKSLTNDQIIKLASKGPQ-QNSINVVLTSADV  146

Query  216  SVDGFC-KRCGSHGSTAGE---KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            +VD FC  +CG+HGS+ G+   K  AY WVGNSETQCPGQCAWPFH+PI GPQ PPLVAP
Sbjct  147  AVDKFCTSKCGTHGSSVGKQKSKNFAYVWVGNSETQCPGQCAWPFHQPIYGPQGPPLVAP  206

Query  48   NGDVGIDGMIINLATV  1
            N DVG+DGM+IN+A++
Sbjct  207  NNDVGLDGMVINVASL  222



>ref|XP_004516718.1| PREDICTED: uncharacterized protein LOC101501686 [Cicer arietinum]
Length=314

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 161/238 (68%), Gaps = 22/238 (9%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVV-LEYHKGTLLKGSITVNLIWYG  487
            MA +N     S +  LF  ++ +   S  +L++   ++  +YHKG LL G I++N+IWYG
Sbjct  1    MASLN----TSVIFTLFLTISLLHLISARQLIESDQLLKFQYHKGPLLSGKISINIIWYG  56

Query  486  KFTPTQRSIIVDFLESLKTVDAPT---PSVESWWKTTEKY------KGGGPSTIVIGKQI  334
            KF P+QR+II DF+ SL +    T   PSV +WWK+T+KY      K      + +G QI
Sbjct  57   KFKPSQRAIITDFINSLSSPKQTTTLQPSVATWWKSTKKYYHLTNNKKSVNLALSLGAQI  116

Query  333  LEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK-  160
            L+EN SLGK+L  +QI++LASKG   +  +N+VLT  DV+VDGFC  RCG+HGS+ G + 
Sbjct  117  LDENYSLGKSLTTNQILKLASKGPQKDS-INIVLTSADVAVDGFCSSRCGTHGSSNGARV  175

Query  159  -----QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
                 + AY WVGNSETQC GQCAWPFH+PI GPQ+ PLVAPN DVG+DGM+IN+A++
Sbjct  176  NGKRYKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSSPLVAPNNDVGLDGMVINVASL  233



>ref|XP_010066691.1| PREDICTED: protein EXORDIUM-like [Eucalyptus grandis]
 gb|KCW64671.1| hypothetical protein EUGRSUZ_G02257 [Eucalyptus grandis]
Length=322

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 146/211 (69%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHNGPLLSGKISVNLIWYGRFQPSQRTIVSDFVTSLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYHLSSSKRPTPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
            +  +NVVLT  DV+V+GFC  RCGSH S  G  +V        Y WVGNSETQCPGQCAW
Sbjct  149  QNAINVVLTSSDVAVEGFCMSRCGSHDSAIGSVKVNGKSSRFPYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVAPNGDVG+DGM+INLA
Sbjct  209  PFHQPQYGPQSPPLVAPNGDVGVDGMVINLA  239



>ref|XP_004301324.1| PREDICTED: uncharacterized protein LOC101294668, partial [Fragaria 
vesca subsp. vesca]
Length=323

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 141/203 (69%), Gaps = 16/203 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVESWWK  391
            + P++ +YHKG LL G I++NLIWYGKF P+QR+I  DF+ SL T    A  PSV +WWK
Sbjct  41   QQPILFQYHKGPLLTGKISINLIWYGKFKPSQRAIASDFITSLSTSSPSANQPSVATWWK  100

Query  390  TTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
            + EKY      K     T+ +G QIL+E+ S+GK+L    I +LA+KG  +   +NVVLT
Sbjct  101  SIEKYYHLANAKKSSLLTLSLGAQILDESYSMGKSLSQTHIKKLAAKGSQSN-AINVVLT  159

Query  228  DKDVSVDGFCK-RCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
              DV +DGFC  +CG+HGS+          + AY WVGNSETQCPGQCAWPFH+PI GPQ
Sbjct  160  SSDVLIDGFCSSKCGTHGSSRSSFVRGKSSRFAYIWVGNSETQCPGQCAWPFHQPIYGPQ  219

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            T PLVAPN DVG+DGMIINLA++
Sbjct  220  TTPLVAPNNDVGVDGMIINLASL  242



>gb|EYU36488.1| hypothetical protein MIMGU_mgv1a010163mg [Erythranthe guttata]
Length=320

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 147/225 (65%), Gaps = 19/225 (8%)
 Frame = -1

Query  627  VALLFCFLAGIPEPSFGELVKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVD  451
            +A +  F           LV+EP   +L YH G LL G I VNLIWYGKF P+QR+I+ D
Sbjct  14   LAFISLFNVCFASRKLSALVEEPQTQLLRYHNGALLNGRIAVNLIWYGKFKPSQRAIVAD  73

Query  450  FLESLKTVDAPT-------PSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKT  304
            F+ SL    +PT       PSV  WWK TEKY        P ++ +G+QI+++  SLGK+
Sbjct  74   FITSLSAPASPTAKSAASQPSVAKWWKATEKYYNIANSKTPLSLYLGRQIIDDKYSLGKS  133

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTA-----GEKQVAYAW  142
            L + +IVQLAS G + +  +NVVLT  DV+VDGFC  RCG+HGS +        + AY W
Sbjct  134  LSEKKIVQLASNG-DQKNAINVVLTASDVAVDGFCFNRCGTHGSKSTPVKGKNNKFAYIW  192

Query  141  VGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            VGNSETQCPG CAWPFH+PI GPQ+P L+APN DVG+DGM+++L+
Sbjct  193  VGNSETQCPGYCAWPFHQPIYGPQSPALIAPNNDVGLDGMVMSLS  237



>emb|CDX90701.1| BnaA03g23810D [Brassica napus]
Length=311

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 136/197 (69%), Gaps = 15/197 (8%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKY--  376
            L+YHKG LL G I++NL WYGKF P QR+II DF+ SL    +  PSV +WWKTTEKY  
Sbjct  35   LKYHKGALLSGKISINLFWYGKFKPAQRAIISDFITSLSHSSSDQPSVATWWKTTEKYYK  94

Query  375  -----KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
                 K   PS ++ +  QIL+E  SLGK+L D  I +LASKG   +  VNVVLT  DV+
Sbjct  95   LAAGDKTPSPSLSLTLKSQILDETYSLGKSLTDRDIRKLASKGDQYD-AVNVVLTSADVA  153

Query  213  VDGF-CKRCGSHGSTAGE-----KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            V GF   RCG+HG   G       + AY WVGNSETQCPGQCAWPFH P+ GPQ+PPLVA
Sbjct  154  VTGFGMSRCGTHGHARGNAGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQSPPLVA  213

Query  51   PNGDVGIDGMIINLATV  1
            PN DVG+DGM+INLA++
Sbjct  214  PNNDVGLDGMVINLASL  230



>ref|XP_003615144.1| hypothetical protein MTR_5g064360 [Medicago truncatula]
 gb|AES98102.1| phosphate-responsive 1 family protein [Medicago truncatula]
Length=316

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 140/200 (70%), Gaps = 18/200 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT----PSVESWWKTTE  382
             +YHKG LL G I++NLIWYGKF P+QR+II DF+ SL +    T    PSV +WWK+TE
Sbjct  37   FQYHKGPLLTGKISINLIWYGKFKPSQRAIITDFITSLSSPKQGTTTSQPSVATWWKSTE  96

Query  381  KY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            KY      K      + +G QIL EN SLGK+L  +QI++LASKG   +  +NVVLT  D
Sbjct  97   KYYQLANNKKSVNLALSLGSQILNENYSLGKSLTTNQILKLASKG-QQQNAINVVLTAAD  155

Query  219  VSVDGFCK-RCGSHGSTAG------EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
            V VDGFC  RCG+HGS+ G        + AY WVGNSETQC GQCAWPFH+PI GPQ+ P
Sbjct  156  VLVDGFCSSRCGTHGSSYGALVNGKRNKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSAP  215

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+IN+A++
Sbjct  216  LVAPNNDVGLDGMVINVASL  235



>ref|XP_007141203.1| hypothetical protein PHAVU_008G175800g [Phaseolus vulgaris]
 gb|ESW13197.1| hypothetical protein PHAVU_008G175800g [Phaseolus vulgaris]
Length=353

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 141/194 (73%), Gaps = 12/194 (6%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD--APTPSVESWWKTTEKY  376
             +YH+G LL G I+VNLIWYG F P+Q++I+ DF+ SL +     P PSV +WWK T+KY
Sbjct  80   FQYHRGPLLTGKISVNLIWYGNFKPSQKAIVTDFITSLSSPKPLTPQPSVATWWKATQKY  139

Query  375  -KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGF  202
             K   P  ++ +G QIL++N S GK+L  DQI++LASKG      +NVVLT  DV+V+GF
Sbjct  140  YKTSSPKLSLSLGSQILDQNYSFGKSLTSDQILKLASKGPQ-RNAINVVLTSADVAVEGF  198

Query  201  CK-RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNG  43
            C  RCG+HGS+ G +      + AY WVGNSE+QCPGQCAWPFH+PI GPQ P L+APN 
Sbjct  199  CSSRCGTHGSSMGARVNGKRYKFAYVWVGNSESQCPGQCAWPFHQPIYGPQNPALIAPNN  258

Query  42   DVGIDGMIINLATV  1
            DVG+DGM+IN+A++
Sbjct  259  DVGVDGMVINVASL  272



>ref|XP_008790896.1| PREDICTED: uncharacterized protein LOC103707945 [Phoenix dactylifera]
Length=306

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 143/207 (69%), Gaps = 9/207 (4%)
 Frame = -1

Query  597  IPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP  418
            + +P    LV++ P+VL+YH G LL G++TV+++WYG+F+ TQRSII DF+ SL    A 
Sbjct  20   VADPRKLSLVQQQPLVLQYHNGPLLNGNLTVHVLWYGRFSATQRSIIADFVRSLSPSSAS  79

Query  417  TPSVES---WWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGC  247
            +P   S   WW TT +Y+G   S + +G Q+L+E  SLGKTL    +  LA++ G   G 
Sbjct  80   SPPPPSAASWWLTTARYRGAAAS-VSLGLQLLDEKYSLGKTLTSADLATLAARAGPHRGA  138

Query  246  VNVVLTDKDVSVDGFC-KRCGSHGSTA----GEKQVAYAWVGNSETQCPGQCAWPFHKPI  82
            V  VLT  DV+VDGFC  RCG+HGS      G  +  Y WVG+S  QCPGQCAWPFH+PI
Sbjct  139  VTAVLTSSDVAVDGFCMSRCGTHGSAPAGRLGRARFPYLWVGDSTVQCPGQCAWPFHQPI  198

Query  81   QGPQTPPLVAPNGDVGIDGMIINLATV  1
             GPQTPPLVAPNGDVG+DGM+INLAT+
Sbjct  199  YGPQTPPLVAPNGDVGMDGMVINLATL  225



>gb|KCW66561.1| hypothetical protein EUGRSUZ_F00360 [Eucalyptus grandis]
Length=332

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 155/250 (62%), Gaps = 21/250 (8%)
 Frame = -1

Query  699  SSFHLKALALSIMAVINNCATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLK  520
            +SF     AL  + + +N A       L             ELV++    ++YH G LL 
Sbjct  2    ASFFASNTALPKLFLASNTALPKLFLALCLLQMASATRRLAELVQDQSPPMKYHSGPLLS  61

Query  519  GSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPTPSVESWWKTTEKY------KG  370
            G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP PSV  WWKT +KY      K 
Sbjct  62   GKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-PSVSQWWKTVDKYYYLSSSKR  120

Query  369  GGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-K  196
              PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G      +NVVLT  DV+V+ FC  
Sbjct  121  HAPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQRNAINVVLTSSDVAVEEFCMS  179

Query  195  RCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDV  37
            RCGSH S  G  +V       AY WVGNSETQCPGQCAWPFH+P  GPQ+PPLVA NGDV
Sbjct  180  RCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAWPFHQPQYGPQSPPLVAANGDV  239

Query  36   GIDGMIINLA  7
            G+DGM+INLA
Sbjct  240  GVDGMVINLA  249



>emb|CDP21255.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 157/231 (68%), Gaps = 26/231 (11%)
 Frame = -1

Query  627  VALLFCFLAG--IPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIV  454
            V+L+   +AG  +P+P+  +   +  +V +YH G LL G I++NLIWYGKF P++R+II 
Sbjct  16   VSLVHFAMAGRQVPKPTQDD---QNTMVFQYHNGPLLSGKISINLIWYGKFNPSERAIIA  72

Query  453  DFLESLKTVDA-PT---PSVESWWKTTEKY------KGGGPSTIVIGKQILEENCSLGKT  304
            DF+ SL T  + PT   PSV +WWK TEKY      K   P  + +G Q+++E+CSLGK+
Sbjct  73   DFVTSLSTSSSNPTTNEPSVATWWKATEKYYHLLRSKKASPLILSLGTQVIDESCSLGKS  132

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCKR-CGSHGSTAGEK---------QV  154
            L  +QI +LA+KG   +  +NVVLT  DV+VDGFC   CG+HGS    K         + 
Sbjct  133  LTRNQIEELAAKG-EQKNAINVVLTASDVAVDGFCSSTCGTHGSLLSSKIASAKGKIYKF  191

Query  153  AYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            AY WVGNS TQCPGQCAWPF++P+ GPQ PPLVAPN +VG+DGM+IN+AT+
Sbjct  192  AYIWVGNSATQCPGQCAWPFYQPMYGPQAPPLVAPNNNVGLDGMVINVATL  242



>ref|XP_008219325.1| PREDICTED: uncharacterized protein LOC103319552 [Prunus mume]
Length=332

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 147/223 (66%), Gaps = 21/223 (9%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      ELV++   +L+YH G LL G I +NLIWYG F P+Q++II DF+ SL +
Sbjct  30   FQVSLATRRLSELVQDQTQLLKYHNGPLLSGKIAINLIWYGNFKPSQKAIISDFITSLSS  89

Query  429  VDAPTPS---VESWWKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
                  +   V +WWKTTEKY           ++ +G+QIL+E  SLGK+L   QIVQLA
Sbjct  90   SSPSKTTPPSVATWWKTTEKYYHLSSNKKASLSLSLGRQILDEKYSLGKSLTTKQIVQLA  149

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAG-----------EKQVAYAWVGNS  130
            SKG + +  +NVVLT  DV+VDGFC  RCG+HGS  G             + AY WVGNS
Sbjct  150  SKG-DQKNAINVVLTSADVAVDGFCMNRCGTHGSALGSTKTGLIKGSKRSKFAYIWVGNS  208

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            ETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  209  ETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  251



>ref|XP_010060028.1| PREDICTED: protein EXORDIUM-like isoform X1 [Eucalyptus grandis]
Length=322

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 144/211 (68%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  31   LAELVQDQSPPMKYHSGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  89

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  90   PSVSQWWKTVDKYYYLSSSKRHAPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  148

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+ FC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  149  RNAINVVLTSSDVAVEEFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAW  208

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVA NGDVG+DGM+INLA
Sbjct  209  PFHQPQYGPQSPPLVAANGDVGVDGMVINLA  239



>ref|XP_007136266.1| hypothetical protein PHAVU_009G032100g [Phaseolus vulgaris]
 gb|ESW08260.1| hypothetical protein PHAVU_009G032100g [Phaseolus vulgaris]
Length=318

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 138/200 (69%), Gaps = 17/200 (9%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWKTTEK  379
            +L YH G LL G I VNLIWYG+F P+Q++II DF+ SL +  A    PSV +WWKTT+ 
Sbjct  39   LLHYHNGPLLYGKIAVNLIWYGRFKPSQKAIIADFITSLSSPLASNNHPSVATWWKTTDS  98

Query  378  YKGGGPS-----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
            Y    P      ++ +G QIL+E  SLGK+L    +++LASKGG     +NVVLT  DV+
Sbjct  99   YYRLSPRKASSLSLSLGDQILDETYSLGKSLTSKNLLELASKGGQ-RNAINVVLTSADVA  157

Query  213  VDGFC-KRCGSHGSTAGEKQV--------AYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
            V GFC  RCG+HGS +    V        AY WVGNSETQCPGQCAWPFH+PI GPQTPP
Sbjct  158  VQGFCLSRCGTHGSASSAAHVKAGKNYKFAYIWVGNSETQCPGQCAWPFHQPIYGPQTPP  217

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+I+LA++
Sbjct  218  LVAPNNDVGVDGMVISLASL  237



>ref|XP_010060029.1| PREDICTED: protein EXORDIUM-like isoform X2 [Eucalyptus grandis]
Length=321

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 144/211 (68%), Gaps = 21/211 (10%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT----VDAPT  415
              ELV++    ++YH G LL G I+VNLIWYG+F P+QR+I+ DF+ SL +      AP 
Sbjct  30   LAELVQDQSPPMKYHSGPLLSGKISVNLIWYGRFKPSQRTIVSDFVTSLSSDPSLAQAP-  88

Query  414  PSVESWWKTTEKY------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNT  256
            PSV  WWKT +KY      K   PS T+ +G+Q+L+E+ SLGK+L    +V+LAS+G   
Sbjct  89   PSVSQWWKTVDKYYYLSSSKRHAPSLTLSLGRQVLDESYSLGKSLTSKHLVELASRG-EQ  147

Query  255  EGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAW  100
               +NVVLT  DV+V+ FC  RCGSH S  G  +V       AY WVGNSETQCPGQCAW
Sbjct  148  RNAINVVLTSSDVAVEEFCMSRCGSHDSAVGSVKVNGRSSRFAYIWVGNSETQCPGQCAW  207

Query  99   PFHKPIQGPQTPPLVAPNGDVGIDGMIINLA  7
            PFH+P  GPQ+PPLVA NGDVG+DGM+INLA
Sbjct  208  PFHQPQYGPQSPPLVAANGDVGVDGMVINLA  238



>gb|KHN42563.1| hypothetical protein glysoja_042421 [Glycine soja]
Length=316

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 153/220 (70%), Gaps = 15/220 (7%)
 Frame = -1

Query  618  LFCFLAGIPEPSFGELVKE--PPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL  445
            LF  L+ I   S    + E  P +  +YH+G LL G I+VNLIWYGKF P+Q++I+ DF+
Sbjct  15   LFVTLSMILHLSSARKLSESDPQLQFQYHRGPLLTGKISVNLIWYGKFKPSQKAIVADFI  74

Query  444  ESLKTVDAPT--PSVESWWKTTEKY-KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQL  277
             SL +    T  PSV +WWK T+KY K   P   + +G QI++EN SLGK+L  +QI++L
Sbjct  75   TSLSSSKPLTAQPSVATWWKATDKYYKNSFPKLALSLGSQIVDENYSLGKSLTTNQILKL  134

Query  276  ASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK------QVAYAWVGNSETQC  118
            ASKG      +N+VLT  +V+V+GFC  RCG+HGS+ G +      + AY WVGNSETQC
Sbjct  135  ASKGPQ-RNAINIVLTSAEVAVEGFCSSRCGTHGSSVGARVNGKRYKFAYMWVGNSETQC  193

Query  117  PGQCAWPFHKPIQGPQTP-PLVAPNGDVGIDGMIINLATV  1
            PGQCAWPFH+PI GPQ P PLVAPN DVG+DGM+IN+A++
Sbjct  194  PGQCAWPFHQPIYGPQNPAPLVAPNNDVGLDGMVINVASL  233



>ref|XP_003544804.1| PREDICTED: uncharacterized protein LOC100792222 [Glycine max]
Length=314

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 146/200 (73%), Gaps = 13/200 (7%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            +P +  +YH+G LL G I+VNLIWYGKF P+Q++I+ DF+ SL +    T  PSV +WWK
Sbjct  35   DPQLQFQYHRGPLLTGKISVNLIWYGKFKPSQKAIVADFITSLSSSKPLTAQPSVATWWK  94

Query  390  TTEKY-KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
             T+KY K   P   + +G QI++EN SLGK+L  +QI++LASKG      +N+VLT  +V
Sbjct  95   ATDKYYKNSFPKLALSLGSQIVDENYSLGKSLTTNQILKLASKGPQ-RNAINIVLTSAEV  153

Query  216  SVDGFCK-RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP-P  61
            +V+GFC  RCG+HGS+ G +      + AY WVGNSETQCPGQCAWPFH+PI GPQ P P
Sbjct  154  AVEGFCSSRCGTHGSSVGARVNGKRYKFAYMWVGNSETQCPGQCAWPFHQPIYGPQNPAP  213

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+IN+A++
Sbjct  214  LVAPNNDVGLDGMVINVASL  233



>ref|XP_006853270.1| hypothetical protein AMTR_s00038p00235960 [Amborella trichopoda]
 gb|ERN14737.1| hypothetical protein AMTR_s00038p00235960 [Amborella trichopoda]
Length=313

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL---KTVDAPTPSVE  403
            LV++PP+VL YH G LLKG +T++L+WYGKF+P+Q +II DFL+SL       A  PSV 
Sbjct  31   LVQQPPLVLNYHNGALLKGDLTISLVWYGKFSPSQHAIITDFLQSLVPTSKATALAPSVS  90

Query  402  SWWKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNV  238
            SWW T  KY      G     + +G QI++E  S+G++L+   I +LA+KG  T   V +
Sbjct  91   SWWGTLHKYTPAAKAGDAKGVVQLGTQIMDEAYSMGRSLERAAIPKLAAKGSGTANIV-L  149

Query  237  VLTDKDVSVDGFC-KRCGSHGS---TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
            V T  DV+V+GFC   CG HGS     G+ + AY WVGNSETQCPGQCAWPFH+PI GPQ
Sbjct  150  VFTAADVTVEGFCMSSCGFHGSDVSQVGKGKYAYIWVGNSETQCPGQCAWPFHQPIFGPQ  209

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            TPPL+APNGDV +DGM+INLA++
Sbjct  210  TPPLIAPNGDVAVDGMVINLASL  232



>ref|XP_007141206.1| hypothetical protein PHAVU_008G176100g [Phaseolus vulgaris]
 gb|ESW13200.1| hypothetical protein PHAVU_008G176100g [Phaseolus vulgaris]
Length=371

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 162/236 (69%), Gaps = 15/236 (6%)
 Frame = -1

Query  669  SIMAVINN-CATASAVALLFCFLAGIPEPS------FGELVKEPPVVLEYHKGTLLKGSI  511
            S MA++N  C     + L  C +  + +P+         LV++ P+VL+YHKGTLLKG+I
Sbjct  57   SKMAILNPFCFLLFFLLLSTCCVPNLSKPASRAPNRMLALVQKQPLVLKYHKGTLLKGNI  116

Query  510  TVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVES--WWKTTEKYKGGGPSTIVIGKQ  337
            T++L WYG FT TQRSI++DF++SL +  +         WW+TTE Y+GG P T+V+G Q
Sbjct  117  TLHLFWYGTFTSTQRSILIDFVQSLSSTSSSHTPSSVSSWWRTTESYRGG-PCTLVVGNQ  175

Query  336  ILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHG---STA  169
             L+   SLGK+L    ++ LASK  +    V+V++T  DV+V+ FC  +CG+HG   S  
Sbjct  176  TLDAKYSLGKSLNTSNLLALASKVNSEAHVVHVIMTSADVAVEDFCMNQCGTHGWGKSKH  235

Query  168  GEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            GE+ VAYAWVGN   QCPGQCAWPFH+P+ GPQTPPLVAPNGDVG+DGM+INLATV
Sbjct  236  GER-VAYAWVGNPIAQCPGQCAWPFHQPVYGPQTPPLVAPNGDVGVDGMVINLATV  290



>gb|KFK32101.1| hypothetical protein AALP_AA6G199000 [Arabis alpina]
Length=316

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 142/202 (70%), Gaps = 19/202 (9%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTP----SVESWWKTT  385
            +L+YHKG LL G I+VN+IWYGKF P+QR+II DF+ SL +    TP    SV +WWKTT
Sbjct  35   LLKYHKGALLSGKISVNIIWYGKFKPSQRAIISDFITSLSSHSKSTPLNQPSVATWWKTT  94

Query  384  EKY-KGGGPS--------TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            EKY K  G          ++ +GK IL+ENCSLGK+L D +I +LASKG +    VNVVL
Sbjct  95   EKYYKLAGADKNPSSSSLSLTLGKHILDENCSLGKSLTDREIRKLASKG-DQHDAVNVVL  153

Query  231  TDKDVSVDGF-CKRCGSHGSTAG----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
            T  DV+V GF   RCG+HG   G      + AY WVGNSETQCPGQCAWPFH P+ GPQ+
Sbjct  154  TSADVAVQGFGMSRCGTHGYAPGLGKRGTKFAYIWVGNSETQCPGQCAWPFHAPVYGPQS  213

Query  66   PPLVAPNGDVGIDGMIINLATV  1
            P LVAPN DVGIDGM+INLA++
Sbjct  214  PVLVAPNNDVGIDGMVINLASL  235



>ref|XP_004299652.1| PREDICTED: uncharacterized protein LOC101296960 [Fragaria vesca 
subsp. vesca]
Length=327

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 145/219 (66%), Gaps = 17/219 (8%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      +LV++   +L+YH G LL G I +NLIWYG F P Q++I+ DF+ SL +
Sbjct  29   FQVSLATRKLSQLVQDQTQLLKYHNGPLLNGKIAINLIWYGNFKPAQKAIVSDFITSLSS  88

Query  429  VDAPT----PSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLA  274
              +P     PSV +WWKTTEKY          +I +G QI  E  SLGK+L + QI++LA
Sbjct  89   SSSPAQAKQPSVATWWKTTEKYYHLTSKKSSLSIALGNQISNEKYSLGKSLTNKQIIKLA  148

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQC  118
            S G + +  +NVVLT  DV VDGFC  RCG+HGS +G   +       AY WVGNSETQC
Sbjct  149  SMG-DQKNAINVVLTSADVVVDGFCMNRCGTHGSASGSSHIRGKNYKFAYIWVGNSETQC  207

Query  117  PGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            PG CAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  208  PGLCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  246



>ref|XP_011074198.1| PREDICTED: protein EXORDIUM-like [Sesamum indicum]
Length=314

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 14/194 (7%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYK  373
            +L YH G LL G+I VNLIWYG F P+QR+I+ DF+ SL       PSV +WWK  EKY 
Sbjct  38   LLRYHNGALLHGTIAVNLIWYGNFKPSQRAIVADFITSLSVSSPTQPSVAAWWKAIEKYY  97

Query  372  GGGPS-------TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVS  214
                S       ++ +GKQ+L++  SLGK+L   QIVQLAS+G + +  +NVVLT  DV+
Sbjct  98   HLAGSKTSSSALSLYLGKQLLDDTYSLGKSLSQKQIVQLASRG-DQKNAINVVLTAADVT  156

Query  213  VDGFC-KRCGSHGSTA----GEK-QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVA  52
            VDGFC  RCG+HGS +    G+K + AY WVGNSE+QCPG CAWPFH+PI GPQ+PPLVA
Sbjct  157  VDGFCVNRCGTHGSKSALVKGKKYKFAYIWVGNSESQCPGYCAWPFHQPIYGPQSPPLVA  216

Query  51   PNGDVGIDGMIINL  10
            PN DVG+DG+++NL
Sbjct  217  PNNDVGLDGIVMNL  230



>ref|XP_008386106.1| PREDICTED: uncharacterized protein LOC103448623 [Malus domestica]
Length=311

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 143/208 (69%), Gaps = 14/208 (7%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            +  E   +  +  +YH G LL G+ +VNLIWYG+FTP+QR+I+ DF+ SL    +  PSV
Sbjct  24   NLAETSNQNQMQFQYHNGPLLIGTFSVNLIWYGRFTPSQRAIVSDFISSLSKPTSDQPSV  83

Query  405  ESWWKTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVN  241
             +WWK+ EKY     K     ++ +G QIL+EN SLGK+L   QI QLASKG    G +N
Sbjct  84   ATWWKSIEKYYHLSKKPSSSLSLSLGTQILDENYSLGKSLTSRQIQQLASKGTQNYG-IN  142

Query  240  VVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-------AYAWVGNSETQCPGQCAWPFHKP  85
            VVLT  DV VDGFC  +CG+HGS+    Q+        Y WVGNSETQCPGQCAWPFH+P
Sbjct  143  VVLTSSDVLVDGFCMNQCGTHGSSNSGSQIRGSKTKFTYIWVGNSETQCPGQCAWPFHQP  202

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            I GPQ+PPLVAPN DVG+DG++INLA++
Sbjct  203  IYGPQSPPLVAPNNDVGLDGIVINLASL  230



>gb|ABK21569.1| unknown [Picea sitchensis]
Length=320

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 140/206 (68%), Gaps = 15/206 (7%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKG--SITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVES  400
            LV++ P+VL YH G LL    ++ V+LIWYG+F+P QRSI+ DF++SL+   A  PSV S
Sbjct  34   LVEQQPLVLTYHNGPLLTTIPTVDVHLIWYGRFSPAQRSIVGDFVQSLEASKATEPSVYS  93

Query  399  WWKTTEKYKGGGPSTIV-----IGKQILEENCSLGKTLKDDQIVQLASKG------GNTE  253
            WWKTTE+Y G   +        +GKQ L++  SLGK+LK  QI  L  +           
Sbjct  94   WWKTTERYSGASNNAAAMANTRLGKQKLDDGYSLGKSLKRSQIAALVERAIASRAVPENS  153

Query  252  GCVNVVLTDKDVSVDGFCKRCGSHGSTAGEKQVA--YAWVGNSETQCPGQCAWPFHKPIQ  79
              V +VLT  DV+V+GFC  CG HG     K+V   YAWVGNSETQCPGQCAWPFH+PI 
Sbjct  154  NAVYLVLTSDDVTVEGFCMSCGFHGDLMPRKKVPLPYAWVGNSETQCPGQCAWPFHQPIY  213

Query  78   GPQTPPLVAPNGDVGIDGMIINLATV  1
            GPQTPPLVAPNGD+GIDGMIIN+ATV
Sbjct  214  GPQTPPLVAPNGDMGIDGMIINIATV  239



>ref|XP_003526573.1| PREDICTED: uncharacterized protein LOC100793070 [Glycine max]
Length=319

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 144/205 (70%), Gaps = 14/205 (7%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVE  403
             LV+  PVVL YHKG LLKG++TV++ WYG FTPT RSIIVDF++SL ++      PS  
Sbjct  35   SLVQPDPVVLNYHKGPLLKGNVTVHIHWYGNFTPTHRSIIVDFIQSLGSIPHSRHHPSPF  94

Query  402  SWWKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCV-------  244
             WW+ T +Y+GG P T+ +G Q L+   SLGK+LK   ++ LASK   T   +       
Sbjct  95   LWWRITARYRGG-PCTLTVGNQTLDNTYSLGKSLKTSDLLALASKNSLTTTTIPISTHNE  153

Query  243  --NVVLTDKDVSVDGFC-KRCGSHGS-TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQG  76
              +V+LT  DV+VDGFC  RCG+HGS    +K+ A+AWVGN  TQCPG+CAWPFH+ + G
Sbjct  154  SMHVLLTSADVAVDGFCMSRCGTHGSGRVQKKRFAFAWVGNPATQCPGECAWPFHQQVYG  213

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQTPPLV PNGDVG+DGM+I+LATV
Sbjct  214  PQTPPLVPPNGDVGVDGMVISLATV  238



>ref|XP_010267357.1| PREDICTED: protein EXORDIUM-like [Nelumbo nucifera]
Length=321

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 151/216 (70%), Gaps = 24/216 (11%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDA------  421
              + V+E   +L+YH G LL G I+VNLIWYG F P+QR+II DF+ S+ T  A      
Sbjct  27   LADQVQEQAQLLQYHNGPLLYGKISVNLIWYGNFKPSQRAIISDFISSITTPSASKSTQT  86

Query  420  --PTPSVESWWKTTEKYKGGG----PS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGG  262
                PSV +WWKTTEKY   G    PS T+ +GKQIL++  S+GK+L   Q+VQLA+KG 
Sbjct  87   QQAQPSVATWWKTTEKYYHLGAKKHPSLTLQMGKQILDK-YSVGKSLTSKQLVQLAAKG-  144

Query  261  NTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTA--------GEKQVAYAWVGNSETQCPGQ  109
            + +  +N+VLT  DV+V+GFC  RCG+HGS++         + + AY WVGNSETQCPGQ
Sbjct  145  DQKNAINIVLTASDVAVEGFCSSRCGTHGSSSSGALVKKNNKYKFAYIWVGNSETQCPGQ  204

Query  108  CAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            CAWPFH+PI GPQ+PPLVAPN DVG+DG++INL ++
Sbjct  205  CAWPFHQPIYGPQSPPLVAPNNDVGVDGIVINLGSL  240



>ref|XP_010676117.1| PREDICTED: protein EXORDIUM-like [Beta vulgaris subsp. vulgaris]
Length=314

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 135/198 (68%), Gaps = 12/198 (6%)
 Frame = -1

Query  558  PVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVESWWKTTE  382
            P+  +YH G +L G  ++NLIWYGKF PTQR+II DF+ SL      + P V  WW T E
Sbjct  36   PMSFQYHNGPILSGRFSINLIWYGKFKPTQRAIISDFITSLSASQPESKPFVSMWWNTIE  95

Query  381  KY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            KY      K     ++  GKQ+++E CSLGK+L   Q+  LA+KG      +NVVLT  D
Sbjct  96   KYYHLANPKMSARLSLSTGKQVIDETCSLGKSLTTKQVEVLAAKGPKQPNTINVVLTAAD  155

Query  219  VSVDGFC-KRCGSHGSTAGEKQVA----YAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            V+V+GFC  RCG+HGS    K+ +    Y WVGNSETQCPGQCAWPFH+PI GPQ+PPLV
Sbjct  156  VAVEGFCMSRCGTHGSNYISKRASQKYTYIWVGNSETQCPGQCAWPFHQPIYGPQSPPLV  215

Query  54   APNGDVGIDGMIINLATV  1
            APN DVG+DGM+INLA++
Sbjct  216  APNNDVGLDGMVINLASL  233



>gb|ACJ84728.1| unknown [Medicago truncatula]
 gb|AFK48195.1| unknown [Medicago truncatula]
 gb|KEH28100.1| phosphate-responsive 1 family protein [Medicago truncatula]
Length=315

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 141/200 (71%), Gaps = 18/200 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAP----TPSVESWWKTTE  382
             ++HKG LL G I+VNLIWYGKF P+QR+II DF+ SL +   P     PSV +WWK+TE
Sbjct  36   FQFHKGPLLTGKISVNLIWYGKFKPSQRAIITDFITSLSSPIKPKTTTQPSVATWWKSTE  95

Query  381  KY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKD  220
            KY      K      + +G QIL+E  SLGK+L  +QI++LASKG   +  +NVVLT  D
Sbjct  96   KYYQLTNNKKSVNLALSLGTQILDEKYSLGKSLTTNQILKLASKG-QQQNAINVVLTAAD  154

Query  219  VSVDGFCK-RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
            V VDGFC  RCG+HGS+ G +      + AY WVGNSETQC GQCAWPFH+PI GPQ+ P
Sbjct  155  VLVDGFCSSRCGTHGSSYGARVNGKRNKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSAP  214

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+IN+A++
Sbjct  215  LVAPNNDVGLDGMVINVASL  234



>ref|XP_002513944.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48527.1| conserved hypothetical protein [Ricinus communis]
Length=317

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 147/225 (65%), Gaps = 20/225 (9%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLE  442
            L+  +L  I   +      E P+ L YH G LL G +++NLIWYGKF  +QR+I+ DF+ 
Sbjct  14   LVLVYLINISSAARKLSETEQPL-LHYHNGPLLNGKVSINLIWYGKFKSSQRAIVTDFIT  72

Query  441  SLKTVDAPTP----SVESWWKTTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDD  292
            SL +  +P      SV  WWK TEKY      K      +++G QIL+ N SLGK+L + 
Sbjct  73   SLSSSKSPPTQQQLSVAKWWKATEKYYHLIKSKKTPSLELLLGTQILDVNYSLGKSLSNK  132

Query  291  QIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEKQV-------AYAWVG  136
            QI+QLASKGG  +  +NVVLT  DV VD FC  RCG+HGS+   ++        AY WVG
Sbjct  133  QIIQLASKGGQKD-AINVVLTAADVLVDAFCSSRCGTHGSSMSAQKTNGKTSKFAYIWVG  191

Query  135  NSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            NSETQCPGQCAWPFH+PI GPQ PPLVAPN DVG+DGM+INLA++
Sbjct  192  NSETQCPGQCAWPFHQPIYGPQGPPLVAPNNDVGLDGMVINLASL  236



>emb|CDP01092.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 154/228 (68%), Gaps = 18/228 (8%)
 Frame = -1

Query  633  SAVALLFCFLAGIPEPSF-GELVKEPPVVL-EYHKGTLLKGSITVNLIWYGKFTPTQRSI  460
            S + L F  LA      F G +++E   +L +YHKG LL G IT+NLIWYG F P+QR+I
Sbjct  8    SKITLQFLLLAMSLNLVFAGRVLQEQETMLFQYHKGPLLMGKITINLIWYGNFRPSQRAI  67

Query  459  IVDFLESLKTVDAPT-PSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKD  295
            + DF+ +L +  +   PSV +W+ +T+KY    K      +V G Q+L+E  SLGK+LK 
Sbjct  68   VSDFITALSSPRSQVQPSVATWFSSTQKYYNLIKATNSVKLVAGSQVLDEQYSLGKSLKM  127

Query  294  DQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST---------AGEKQVAYA  145
             QI QLA+KG +    +NVVLT  DV+V+GFC  +CG+HGS          +  ++ AY 
Sbjct  128  QQIEQLAAKG-DQLNAINVVLTSSDVAVEGFCTSKCGTHGSLHSKSTVAKGSNNQKFAYI  186

Query  144  WVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            WVGNSETQCPGQCAWPFH+P+ GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  187  WVGNSETQCPGQCAWPFHQPLYGPQSPPLVAPNNDVGMDGMVINLASL  234



>ref|XP_003522788.2| PREDICTED: uncharacterized protein LOC100811449 [Glycine max]
Length=378

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 143/208 (69%), Gaps = 15/208 (7%)
 Frame = -1

Query  582  FGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL--ESLKTVDAPTPS  409
              ELV++   +L YH G LL G I VNLIWYG F P+Q++II DF+   S     +  PS
Sbjct  91   LNELVQDQSQLLHYHNGPLLYGKIAVNLIWYGNFKPSQKAIITDFVTSLSSPASQSSQPS  150

Query  408  VESWWKTTEKYKGGGPS----TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVN  241
            V +WWKTTEKY    P     ++ +G QIL+E  SLGK+L    +VQLASKGG     +N
Sbjct  151  VATWWKTTEKYYHLSPRKASLSLSLGDQILDETYSLGKSLTGKNLVQLASKGGQ-RNSIN  209

Query  240  VVLTDKDVSVDGFC-KRCGSHGSTAGE-------KQVAYAWVGNSETQCPGQCAWPFHKP  85
            VVLT  DV+V+GFC  RCG+HGS+A          + AY WVGNSETQCPGQCAWPFH+P
Sbjct  210  VVLTSADVAVEGFCMSRCGTHGSSASHLKKNSKSYKFAYIWVGNSETQCPGQCAWPFHQP  269

Query  84   IQGPQTPPLVAPNGDVGIDGMIINLATV  1
            I GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  270  IYGPQSPPLVAPNNDVGLDGMVINLASL  297



>ref|XP_007222578.1| hypothetical protein PRUPE_ppa008439mg [Prunus persica]
 gb|EMJ23777.1| hypothetical protein PRUPE_ppa008439mg [Prunus persica]
Length=332

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 148/223 (66%), Gaps = 21/223 (9%)
 Frame = -1

Query  609  FLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT  430
            F   +      ELV++   +L+YH G LL G I +NLIWYG F P+Q++II DF+ SL +
Sbjct  30   FQVSLATRRLSELVQDQTQLLKYHNGPLLSGKIAINLIWYGNFKPSQKAIISDFITSLSS  89

Query  429  VDAPTPS---VESWWKTTEKYKGGGPS-----TIVIGKQILEENCSLGKTLKDDQIVQLA  274
                  +   V +WWKTTEKY     +     ++ +G+QIL+E  SLGK+L   QIVQLA
Sbjct  90   SSPSKTTPPSVATWWKTTEKYYHLSSNKKTSLSLSLGRQILDEKYSLGKSLTTKQIVQLA  149

Query  273  SKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST-----------AGEKQVAYAWVGNS  130
            SKG + +  +NVVLT  DV+VDGFC  RCG+HGS            +   + AY WVGNS
Sbjct  150  SKG-DQKNAINVVLTSADVAVDGFCMNRCGTHGSALASTKTGLIKGSKRSKFAYIWVGNS  208

Query  129  ETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            ETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  209  ETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  251



>ref|XP_009372924.1| PREDICTED: uncharacterized protein LOC103961987 [Pyrus x bretschneideri]
Length=314

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 139/211 (66%), Gaps = 17/211 (8%)
 Frame = -1

Query  585  SFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSV  406
            +  E+  +  +  +YH G LL G  +VNLIWYG FTP+QR+I+ DF  SL    +  PSV
Sbjct  24   NLAEISDKNQMQFQYHNGPLLTGQFSVNLIWYGHFTPSQRAIVSDFFTSLSKPTSDQPSV  83

Query  405  ESWWKTTEKYKG-------GGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGC  247
             +WWK+ EKY             ++ +G QIL+EN SLGK+L   QI QLASKG      
Sbjct  84   ATWWKSIEKYYHLAHLNTPSSSLSLSLGTQILDENYSLGKSLTSRQIQQLASKGA-LNSA  142

Query  246  VNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV--------AYAWVGNSETQCPGQCAWPF  94
            +NVVLT  DV VDGFC   CG+HGS+    Q+        AY WVGNSE+QCPGQCAWPF
Sbjct  143  INVVLTSSDVLVDGFCMNSCGTHGSSNDASQIRGSKSNKFAYIWVGNSESQCPGQCAWPF  202

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  203  HQPIYGPQSPPLVAPNNDVGLDGMVINLASL  233



>ref|XP_010676127.1| PREDICTED: protein EXORDIUM-like [Beta vulgaris subsp. vulgaris]
Length=320

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 17/199 (9%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-------PSVESWW  394
            +L+YH+G LL G ITVNLIWYGKFTP+Q+++I DF+ SL + + PT       PSV +WW
Sbjct  43   LLQYHQGPLLSGKITVNLIWYGKFTPSQKAVISDFVTSL-SPNTPTTKSHIHHPSVSTWW  101

Query  393  KTTEKY-----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
             +  +Y     K     ++ +GKQI +E+ SLGK+L    +V+LASKG  +   VNVVLT
Sbjct  102  NSIGRYYHIANKKASTLSLSLGKQISDESYSLGKSLTSKHLVELASKGAKSN-AVNVVLT  160

Query  228  DKDVSVDGFCK-RCGSHGSTA--GEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPL  58
              DV+VDGFC  RCG+HGS +  G  + AY WVGNSETQC GQCAWPFH+PI GPQ  PL
Sbjct  161  ASDVAVDGFCSSRCGTHGSNSRVGRDKFAYIWVGNSETQCAGQCAWPFHQPIYGPQNSPL  220

Query  57   VAPNGDVGIDGMIINLATV  1
            VAPN DVG+DGMIINLA++
Sbjct  221  VAPNNDVGLDGMIINLASL  239



>ref|XP_010676103.1| PREDICTED: protein EXORDIUM-like [Beta vulgaris subsp. vulgaris]
Length=310

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 135/198 (68%), Gaps = 12/198 (6%)
 Frame = -1

Query  558  PVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVD-APTPSVESWWKTTE  382
            P+  +YHKG LL G I +NLIWYG+F P QR+II DF+ SL +      PSV +WWK+  
Sbjct  32   PMTFQYHKGPLLNGKIQINLIWYGQFKPAQRAIISDFVTSLSSTRIEAQPSVATWWKSIG  91

Query  381  KYKGGG-------PSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
             Y           P ++ IGKQ++ +   LGK+L +  +V+LASKG      +N+VLT  
Sbjct  92   NYHRLANPKTKTTPLSLSIGKQVVLKAYPLGKSLTNKHLVELASKGAQQANAINIVLTAS  151

Query  222  DVSVDGFCK-RCGSHGST---AGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLV  55
            DV VDGFC+ RCG+H ST      ++  Y WVGNSETQCPGQCAWPFH+PI GPQ+PPLV
Sbjct  152  DVIVDGFCRSRCGTHSSTYISKNSQKFTYIWVGNSETQCPGQCAWPFHQPIYGPQSPPLV  211

Query  54   APNGDVGIDGMIINLATV  1
            APN DVG+DGMIINLA++
Sbjct  212  APNNDVGLDGMIINLASL  229



>gb|ACU19080.1| unknown [Glycine max]
Length=314

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 13/199 (7%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWK  391
            +P +  +YH+G LL G I+VNLIWYGKF P+Q++I+ DF+ SL +    T  PSV +WWK
Sbjct  35   DPQLQFQYHRGPLLTGKISVNLIWYGKFKPSQKAIVADFITSLSSSKPLTAQPSVATWWK  94

Query  390  TTEKY-KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
             T+KY K   P   + +G QI++EN SLGK+L  +QI++LASKG      +N+V T  +V
Sbjct  95   ATDKYYKNSFPKLALFLGSQIVDENYSLGKSLTTNQILKLASKGPQ-RNAINIVPTSAEV  153

Query  216  SVDGFCK-RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTP-P  61
            +V+GFC  RCG+HGS+ G +      + AY WVGNSETQCPGQCAWPFH+PI GPQ P P
Sbjct  154  AVEGFCSSRCGTHGSSVGARVNGKRYKFAYMWVGNSETQCPGQCAWPFHQPIYGPQNPAP  213

Query  60   LVAPNGDVGIDGMIINLAT  4
            LVAPN DVG+DGM+IN+A+
Sbjct  214  LVAPNNDVGLDGMVINVAS  232



>emb|CBI19186.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 134/177 (76%), Gaps = 5/177 (3%)
 Frame = -1

Query  576  ELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESW  397
             LV+E P++L+YH G LLKG+IT+NL+WYG F+P QRSI+VDFL+SL +      SV SW
Sbjct  93   SLVQEQPLILKYHNGPLLKGNITLNLVWYGNFSPIQRSILVDFLQSLNSHTTTPHSVSSW  152

Query  396  WKTTEKYKGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDV  217
            W+T +KYKG    T+ +G QIL+E+ SLGK+L+   I+ LAS+  N    + VV T  DV
Sbjct  153  WQTIQKYKGVS-CTLAVGNQILDEDYSLGKSLRSSDIISLASR-SNQRSEITVVFTSADV  210

Query  216  SVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAP  49
            +V+GFC  RCG+HGST  + + AYAWVGNSETQCPGQCAWPFH+P+ GPQTPPLVAP
Sbjct  211  AVEGFCMSRCGTHGST--QSKWAYAWVGNSETQCPGQCAWPFHQPMYGPQTPPLVAP  265



>emb|CDY05033.1| BnaC03g28310D [Brassica napus]
Length=314

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 137/200 (69%), Gaps = 18/200 (9%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTP---SVESWWKTTEK  379
            L+YHKG LL G I++NLIWYG+F P QR+II DF+ SL    + TP   SV +WWKTTEK
Sbjct  35   LKYHKGALLSGKISINLIWYGEFKPAQRAIISDFITSLSHSSSKTPNQPSVATWWKTTEK  94

Query  378  Y-------KGGGPS-TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDK  223
            Y       K   PS ++ +  QIL+E  SLGK+L D  I +LASKG   +  VNVVLT  
Sbjct  95   YYKLAAGDKTPSPSLSLTLKSQILDETYSLGKSLTDRDIRKLASKGDQYD-AVNVVLTSA  153

Query  222  DVSVDGF-CKRCGSHGSTAGE-----KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
            DV+V GF   RCG+HG   G       + AY WVGNSETQCPGQCAWPFH P+ GPQ PP
Sbjct  154  DVAVTGFGMSRCGTHGHARGNTGKRGSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQNPP  213

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGM+INLA++
Sbjct  214  LVAPNNDVGLDGMVINLASL  233



>ref|XP_010543912.1| PREDICTED: protein EXORDIUM-like [Tarenaya hassleriana]
Length=316

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 141/205 (69%), Gaps = 22/205 (11%)
 Frame = -1

Query  552  VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT--PSVESWWKTTEK  379
            +L+YH G LL G ITVNLIWYGKF P+QR+I+ DF+ SL    A T  PSV +WWKTTEK
Sbjct  32   LLKYHNGPLLSGKITVNLIWYGKFKPSQRAIVSDFITSLSHSPANTHQPSVATWWKTTEK  91

Query  378  Y--------KGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            Y        K   P    ++ +GKQIL+E  SLGK+L + QI++LA +G +    VNVVL
Sbjct  92   YYKLASGDKKNPSPRPSLSMSLGKQILDEGYSLGKSLSEKQILKLAYRG-DQHDAVNVVL  150

Query  231  TDKDVSVDGFC-KRCGSHGSTAGEK-------QVAYAWVGNSETQCPGQCAWPFHKPIQG  76
            T  DV+V GFC  +CG+HGS  G         + AY WVG+S TQCPGQCAWPFH P+ G
Sbjct  151  TANDVAVQGFCMSKCGTHGSAPGRSLKGKRSSKFAYIWVGDSATQCPGQCAWPFHAPVYG  210

Query  75   PQTPPLVAPNGDVGIDGMIINLATV  1
            PQ PPLV+PN DVGIDG+IINLA++
Sbjct  211  PQNPPLVSPNNDVGIDGVIINLASL  235



>emb|CDP21256.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   221 bits (563),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 145/211 (69%), Gaps = 19/211 (9%)
 Frame = -1

Query  579  GELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT-PSVE  403
            G ++ +  ++ +YHKG LL G +++NLIWYG+F P+QR++I DF+ SL +  +   PSV 
Sbjct  26   GRVLLQENMLFQYHKGPLLTGKVSINLIWYGQFKPSQRAVISDFITSLSSPQSQVQPSVA  85

Query  402  SWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVV  235
            +W K+T+KY    K   P  + +G QIL+E  SLGK LK  QI QLA+K G     +NVV
Sbjct  86   AWIKSTDKYYSLIKSKNPVELALGTQILDEKYSLGKPLKMQQIEQLAAKNGQVNA-INVV  144

Query  234  LTDKDVSVDGFCK-RCGSHGS------------TAGEKQVAYAWVGNSETQCPGQCAWPF  94
            LT  DV+V+GFC  +CG+HGS             +  ++  Y WVGNSETQCPGQCAWPF
Sbjct  145  LTSSDVAVEGFCSSKCGTHGSLPSKQTTIVQKNKSNAQKFTYIWVGNSETQCPGQCAWPF  204

Query  93   HKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            H+P+ GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  205  HQPLYGPQSPPLVAPNNDVGMDGMVINLASL  235



>ref|XP_010676090.1| PREDICTED: protein EXORDIUM-like [Beta vulgaris subsp. vulgaris]
Length=311

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 140/200 (70%), Gaps = 15/200 (8%)
 Frame = -1

Query  558  PVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKT--VDAPTPSVESWWKTT  385
            P+  +YHKG LL G I +NLIWYG+F P QR+I+ +F+ SL +  V+A  PSV +WW + 
Sbjct  32   PMTFQYHKGPLLNGKIQINLIWYGQFKPAQRTILSNFITSLSSSQVEA-QPSVATWWDSI  90

Query  384  EKYKGGG-------PSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTD  226
             KY           P ++ +GKQ+++E   LGK+L +  ++ LASKGG     +N+VLT 
Sbjct  91   AKYHHLANPKTKTTPLSLSLGKQVIDEAYPLGKSLTNKHLIDLASKGGQQVNSINIVLTA  150

Query  225  KDVSVDGFCK-RCGSHGSTA----GEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPP  61
             DV+VDGFC+ RCG+HGS+       K+  Y WVGNSE+ CPGQCAWPFH+PI GPQ+PP
Sbjct  151  SDVAVDGFCRSRCGTHGSSYISKNTSKKFNYIWVGNSESLCPGQCAWPFHQPIYGPQSPP  210

Query  60   LVAPNGDVGIDGMIINLATV  1
            LVAPN DVG+DGMIINLA++
Sbjct  211  LVAPNNDVGLDGMIINLASL  230



>ref|XP_009125761.1| PREDICTED: uncharacterized protein LOC103850725 [Brassica rapa]
Length=302

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 134/178 (75%), Gaps = 5/178 (3%)
 Frame = -1

Query  522  KGSITVNLIWYGKFTPTQRSIIVDFLESLKT-VDAPTPSVESWWKTTEKYKGGGPSTIVI  346
            K +I++N++WYGKFTP QR++IVDF+ SL +  DA  PSV SWWKTTEKYKGG  S IV+
Sbjct  58   KDNISLNIVWYGKFTPIQRAVIVDFIRSLNSPSDAKGPSVASWWKTTEKYKGGA-SKIVL  116

Query  345  GKQILEENCSLGKTLKDDQIVQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGST  172
            GKQ+L E+   GK+LK   +  L+ K  G   G +  VLT KDV+V+GFC  RCG+HGS 
Sbjct  117  GKQLLLEDYPFGKSLKSPHLKALSGKLNGGGVGAITAVLTAKDVTVEGFCMNRCGTHGSK  176

Query  171  AGE-KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            +      AY WVGNSE QCPG CAWPFH+P+ GPQ+PPL+APNGDVG+DGMIINLAT+
Sbjct  177  SSSLDGGAYVWVGNSEKQCPGYCAWPFHQPLSGPQSPPLIAPNGDVGVDGMIINLATL  234



>ref|XP_010538937.1| PREDICTED: protein EXORDIUM-like 1 [Tarenaya hassleriana]
Length=310

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 10/192 (5%)
 Frame = -1

Query  549  LEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESL---KTVDAPTPSVESWWKTTEK  379
              YHKG LL G ++VNLIWYGKF P+QR+II DF+ SL   +T     PSV +WWKT E 
Sbjct  39   FRYHKGALLTGDVSVNLIWYGKFRPSQRAIITDFIASLASHRTKMTVQPSVATWWKTVEN  98

Query  378  Y---KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVD  208
            Y         ++ +GKQIL+E  S+GK+L +  I  LA KGG     VNVVLT  DV+V 
Sbjct  99   YYHVSKSRLLSLSLGKQILDEEYSMGKSLSEKHIKALAGKGGQNY-AVNVVLTAADVAVT  157

Query  207  GFC-KRCGSHGS--TAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDV  37
            GFC  RCGSHGS  ++   + AY WVGNSETQCPGQCAWPFH P+ GPQ PPLVAPN DV
Sbjct  158  GFCVNRCGSHGSGTSSRRSKFAYIWVGNSETQCPGQCAWPFHAPVYGPQNPPLVAPNNDV  217

Query  36   GIDGMIINLATV  1
            GIDG+IINLA++
Sbjct  218  GIDGVIINLASL  229



>ref|XP_002525844.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36538.1| conserved hypothetical protein [Ricinus communis]
Length=284

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = -1

Query  525  LKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPTPSVESWWKTTEKYKGGGPSTIVI  346
            L  ++TVNLIWYG+FTPTQRSII D + SL +  +P PS  SWWKTTEKY+GG  S + +
Sbjct  29   LVXNVTVNLIWYGRFTPTQRSIITDLITSLSSSKSPLPSASSWWKTTEKYRGGSCS-LKV  87

Query  345  GKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTA  169
            G QIL E  +LGKTLK   ++ LASK       +NVVLT  DV VDGFC  RCG+HGS+ 
Sbjct  88   GHQILHEQYTLGKTLKTYHLLALASKVNFAMNSINVVLTSDDVVVDGFCMSRCGTHGSSR  147

Query  168  GEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            G  +  Y WVGNS TQCPGQCAWPFH+PI GPQTPPL APNGDVGIDGMIINL+T+
Sbjct  148  GSVKGTYIWVGNSVTQCPGQCAWPFHQPIYGPQTPPLAAPNGDVGIDGMIINLSTL  203



>ref|XP_004299654.1| PREDICTED: uncharacterized protein LOC101297541 [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 17/204 (8%)
 Frame = -1

Query  564  EPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT---PSVESWW  394
            + P++ +YH G LL G I++NLIWYGKF P+QR+I+ DF+ SL T   P+   PSV +WW
Sbjct  37   QQPMLFQYHNGPLLTGKISINLIWYGKFKPSQRAIVSDFITSLSTSSPPSKNQPSVATWW  96

Query  393  KTTEKY------KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVL  232
            K+ EKY      K     ++ +G QIL+E+ S+GK+L    I +LA+KGG +   +NVVL
Sbjct  97   KSIEKYYHLSNAKKTSSLSLSLGTQILDESYSMGKSLSQTHIKKLAAKGGQSN-AINVVL  155

Query  231  TDKDVSVDGFCK-RCGSHGSTAGE------KQVAYAWVGNSETQCPGQCAWPFHKPIQGP  73
            T  DV +DGFC  +CG+HGS+          + AY WVGNSETQCPGQCAWPFH+PI GP
Sbjct  156  TSSDVLIDGFCSSKCGTHGSSTSSLIRGKSSKFAYIWVGNSETQCPGQCAWPFHQPIYGP  215

Query  72   QTPPLVAPNGDVGIDGMIINLATV  1
            Q+PPLVAPN DVG+DGMIINLA++
Sbjct  216  QSPPLVAPNNDVGVDGMIINLASL  239



>ref|XP_003570605.1| PREDICTED: protein EXORDIUM-like [Brachypodium distachyon]
Length=311

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 148/224 (66%), Gaps = 13/224 (6%)
 Frame = -1

Query  642  ATASAVALLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRS  463
            AT    ALL C    +       LV+E P+ ++YHKG LL G I VNL+WYG F+ +QR+
Sbjct  10   ATLVVCALLLCQTC-LATRKLTALVQEQPITMKYHKGALLSGRIAVNLVWYGNFSASQRA  68

Query  462  IIVDFLESLKTVD---APTPSVESWWKTTEKY----KGGGPSTIVIGKQILEENCSLGKT  304
            +I DFL SL T      P PSV +W+KT +KY    K   P+ + +G  +L+ +CSLGK 
Sbjct  69   VITDFLSSLSTTAPSPQPEPSVATWFKTAQKYYSTSKARFPA-LTMGAHVLDSSCSLGKR  127

Query  303  LKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK--QVAYAWVGN  133
            L++  +V+LAS+G  +   +NVVLT  DV+VDGFC  RCGSHG++   +  + AY WVGN
Sbjct  128  LREKDLVKLASRGSPSRA-INVVLTADDVAVDGFCSSRCGSHGASPRSRAGRFAYVWVGN  186

Query  132  SETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
              TQC GQCAWP+H+P  GPQ  PL  PNGDVG+DGM+++LA++
Sbjct  187  PATQCAGQCAWPYHQPQYGPQAAPLTPPNGDVGVDGMVVSLASM  230



>ref|XP_011083391.1| PREDICTED: protein EXORDIUM-like [Sesamum indicum]
Length=348

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 13/200 (7%)
 Frame = -1

Query  570  VKEPPV-VLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFLESLKTV--DAPTPSVES  400
            V++P   ++ YHKG LL G I+VNLIWYG F P+QR+I+ DF+ SL +       PSV +
Sbjct  67   VEDPQTQLIRYHKGALLHGRISVNLIWYGNFKPSQRAIVSDFITSLSSSMPAQSQPSVAA  126

Query  399  WWKTTEKYKGGGPS---TIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLT  229
            WWKTTEKY     S   ++ +GKQ+L+++ SLGK+L + QI+QLASKG      +NVVLT
Sbjct  127  WWKTTEKYYHLANSKSVSLYLGKQLLDQSYSLGKSLSEKQILQLASKGEQMNA-INVVLT  185

Query  228  DKDVSVDGFC-KRCGSHGSTAG-----EKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQT  67
              DV+V GFC  RCGSHGS +        + AY WVGNSETQCPG CAWPFH+P+ GPQ+
Sbjct  186  ASDVTVGGFCVNRCGSHGSKSAVVNGKNSKFAYIWVGNSETQCPGFCAWPFHQPVYGPQS  245

Query  66   PPLVAPNGDVGIDGMIINLA  7
             PLVAPN D+G+DGM+INL+
Sbjct  246  LPLVAPNNDLGMDGMVINLS  265



>ref|XP_009125760.1| PREDICTED: uncharacterized protein LOC103850724 [Brassica rapa]
Length=295

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = -1

Query  525  LKGSITVNLIWYGKFTPTQRSIIVDFLESLKT--VDAPTPSVESWWKTTEKYKGGGPSTI  352
            ++ +I +N++WYGKFTP QR++IVDF+ SL +    A  PSV SWWKTTEKYKGG  STI
Sbjct  50   VQKNINLNIVWYGKFTPIQRTVIVDFIRSLNSPAAAAKDPSVASWWKTTEKYKGGA-STI  108

Query  351  VIGKQILEENCSLGKTLKDDQIVQLASK-GGNTEGCVNVVLTDKDVSVDGFC-KRCGSHG  178
            V+GKQ+L E+  LGK+LK   +  L+ K  G   G +  VLT KDV+V+GFC  RCG+HG
Sbjct  109  VLGKQLLLEDYPLGKSLKSPHLRPLSGKLKGGGVGSITAVLTAKDVTVEGFCMNRCGTHG  168

Query  177  STAGE-KQVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
            S +      AY WVGNSE QCPG CAWPFH+P+ GPQTPPL+APNGDVG+DGMIINLAT+
Sbjct  169  SKSSTVDGGAYLWVGNSEEQCPGYCAWPFHQPLYGPQTPPLIAPNGDVGVDGMIINLATL  228



>ref|XP_010273029.1| PREDICTED: protein EXORDIUM-like [Nelumbo nucifera]
Length=316

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  573  LVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL-------ESLKTVDAPT  415
            L + PP+VL YH G LL+G + V+++WYGKFTP Q+SI+ DFL       + L +     
Sbjct  34   LYQPPPMVLAYHMGALLEGELPVSILWYGKFTPAQKSIVADFLVSLTPQQQKLSSSTLTA  93

Query  414  PSVESWWKTTEKY---KGGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTE-GC  247
            PSV  WWK  E Y    G   + IV+  QI +E+ S+GKTLK  QI QLA K  + + G 
Sbjct  94   PSVSQWWKPIETYMKDAGKKGTRIVLSDQITDESYSMGKTLKRSQISQLAQKASSKQPGR  153

Query  246  VNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQVAYAWVGNSETQCPGQCAWPFHKPIQGPQ  70
            + +VLT KDV+++GFC   CG HGS + +K+ A+ WVGNSETQCPGQCAWPFH+PI GPQ
Sbjct  154  LVLVLTAKDVALEGFCMSSCGFHGSDS-KKKSAFIWVGNSETQCPGQCAWPFHQPIYGPQ  212

Query  69   TPPLVAPNGDVGIDGMIINLATV  1
            TPPL APNGDVG+DGM+IN+AT+
Sbjct  213  TPPLGAPNGDVGLDGMVINIATL  235



>ref|XP_003526575.1| PREDICTED: uncharacterized protein LOC100794117 [Glycine max]
Length=324

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 146/229 (64%), Gaps = 23/229 (10%)
 Frame = -1

Query  621  LLFCFLAGIPEPSFGELVKEPPVVLEYHKGTLLKGSITVNLIWYGKFTPTQRSIIVDFL-  445
            L+  F          +LV++   +L YH G LL G I VNLIWYG F P+Q++II DF+ 
Sbjct  16   LISVFQLSFAARRLNQLVQDQSQLLHYHNGPLLYGKIAVNLIWYGHFKPSQKAIITDFVT  75

Query  444  -ESLKTVDAPTPSVESWWKTTEKY--------KGGGPSTIVIGKQILEENCSLGKTLKDD  292
              S  +  +  PSV +WWKTTEKY        K     ++ +G Q L+E  SLGK+L   
Sbjct  76   SLSSPSSQSSQPSVATWWKTTEKYYHLSPKNKKAASSLSLSLGDQFLDEGFSLGKSLTSK  135

Query  291  QIVQLASKGGNTEGCVNVVLTDKDVSVDGFC-KRCGSHGSTAGEKQV-----------AY  148
             +V+LASKGG     +NVVLT  DV+V+GFC  RCG+HGS++    V           AY
Sbjct  136  NLVELASKGGQ-RNAINVVLTSADVAVEGFCMSRCGTHGSSSSASHVKKNNNGKNYKFAY  194

Query  147  AWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
             WVGNSETQCPGQCAWPFH+PI GPQ+PPLVAPN DVG+DGM+INLA++
Sbjct  195  IWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVGLDGMVINLASL  243



>ref|XP_003615142.1| hypothetical protein MTR_5g064340 [Medicago truncatula]
Length=808

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 161/251 (64%), Gaps = 23/251 (9%)
 Frame = -1

Query  687  LKALALSIMAVINN-CATASAVALLFCFLAGIPEPSFGELVK----EPPVVLEYHKGTLL  523
            LKAL L   A +N  C T + ++++F     I         K    +  +  ++HKG LL
Sbjct  478  LKALRLKEHASLNALCHTGAPLSVIFTLFLTISLLQLSSARKLTESDQQLKFQFHKGPLL  537

Query  522  KGSITVNLIWYGKFTPTQRSIIVDFLESLKTVDAPT----PSVESWWKTTEKY------K  373
             G I+VNLIWYGKF P+QR+II DF+ SL +   P     PSV +WWK+TEKY      K
Sbjct  538  TGKISVNLIWYGKFKPSQRAIITDFITSLSSPIKPKTTTQPSVATWWKSTEKYYQLTNNK  597

Query  372  GGGPSTIVIGKQILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-  196
                  + +G QIL+E  SLGK+L  +QI++LASKG   +  +NVVLT  DV VDGFC  
Sbjct  598  KSVNLALSLGTQILDEKYSLGKSLTTNQILKLASKG-QQQNAINVVLTAADVLVDGFCSS  656

Query  195  RCGSHGSTAGEK------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVG  34
            RCG+HGS+ G +      + AY WVGNSETQC GQCAWPFH+PI GPQ+ PLVAPN DVG
Sbjct  657  RCGTHGSSYGARVNGKRNKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSAPLVAPNNDVG  716

Query  33   IDGMIINLATV  1
            +DGM+IN+A++
Sbjct  717  LDGMVINVASL  727


 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 159/239 (67%), Gaps = 23/239 (10%)
 Frame = -1

Query  663  MAVINNCATASAVALLFCFLAGIPEPSFGELVK-EPPVVLEYHKGTLLKGSITVNLIWYG  487
            MA  N     SA+ +LF  ++ +   S  +L + +  +  +YHKG LL G I+VNLIWYG
Sbjct  1    MASFNK----SAIFILFLTISLLQLSSARKLTESDQQLKFQYHKGPLLTGKISVNLIWYG  56

Query  486  KFTPTQRSIIVDFLESLKTVDAPT----PSVESWWKTTEKY------KGGGPSTIVIGKQ  337
            KF P+QR+II DF+ SL +   PT    PSV +WWK+TEKY      K      + +G Q
Sbjct  57   KFKPSQRAIITDFITSLSSPIKPTTASQPSVATWWKSTEKYYQLTNNKKSVNLALSLGSQ  116

Query  336  ILEENCSLGKTLKDDQIVQLASKGGNTEGCVNVVLTDKDVSVDGFCK-RCGSHGSTAGEK  160
            IL+E  SLGK+L  +QI+ LASKG   +  +NVVLT  DV VDGFC  RCG+HGS+ G +
Sbjct  117  ILDEKYSLGKSLTTNQILNLASKG-QQQNAINVVLTAADVLVDGFCSSRCGTHGSSYGAR  175

Query  159  ------QVAYAWVGNSETQCPGQCAWPFHKPIQGPQTPPLVAPNGDVGIDGMIINLATV  1
                  + AY WVGNSETQC GQCAWPFH+PI GPQ+ PLVAPN DVG+DGM+IN+A++
Sbjct  176  VNGKRNKFAYIWVGNSETQCAGQCAWPFHQPIYGPQSAPLVAPNNDVGLDGMVINVASL  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1130594545322