BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24532_g3_i1 len=4820 path=[8376:0-583 209:584-2107 13486:2108-4819]

Length=4820
                                                                      Score     E

emb|CCA66009.1|  hypothetical protein                                   418   0.0      
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764    369   0.0      
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    378   0.0      
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816    381   0.0      
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...    363   0.0      
ref|XP_008341993.1|  PREDICTED: uncharacterized protein LOC103404803    361   6e-179   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    335   3e-171   
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase     315   2e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...    309   1e-163   
emb|CAB10337.1|  reverse transcriptase like protein                     314   9e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CCA65997.1|  hypothetical protein                                   316   5e-149   
gb|ABD28627.2|  RNA-directed DNA polymerase (Reverse transcriptas...    320   2e-144   Medicago truncatula
dbj|BAE79385.1|  unnamed protein product                                273   8e-142   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                                271   3e-141   Ipomoea batatas [batate]
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085    296   8e-141   
dbj|BAE79384.1|  unnamed protein product                                274   1e-140   Ipomoea batatas [batate]
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...    304   2e-139   
ref|XP_010666276.1|  PREDICTED: uncharacterized protein LOC104883442    332   5e-139   
ref|XP_010668235.1|  PREDICTED: uncharacterized protein LOC104885230    343   6e-139   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             272   2e-138   
gb|AAS55787.1|  hypothetical protein                                    295   2e-134   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    281   6e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61581.1|  hypothetical protein OsJ_15963                          279   1e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    256   2e-132   
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             275   1e-129   
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             269   1e-129   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    266   2e-129   
gb|EEC79647.1|  hypothetical protein OsI_20882                          278   2e-129   Oryza sativa Indica Group [Indian rice]
gb|ABA96650.1|  retrotransposon protein, putative, unclassified         265   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    277   7e-129   
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794    261   3e-128   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         262   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    274   7e-128   
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    273   2e-127   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187    261   2e-127   
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885    271   8e-127   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    253   7e-126   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    251   1e-125   
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    247   2e-125   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    266   3e-125
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     281   9e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CCA65995.1|  hypothetical protein                                   274   1e-124   
gb|AAQ19327.1|  bZIP-like protein                                       263   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066197.2|  Os12g0156200                                       263   3e-124   Oryza sativa Japonica Group [Japonica rice]
gb|EPS63383.1|  hypothetical protein M569_11401                         280   6e-124   
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    243   1e-123   
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    270   1e-123   
emb|CCA66040.1|  hypothetical protein                                   249   1e-122   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764    240   1e-122   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     243   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    245   7e-122   
ref|XP_010676027.1|  PREDICTED: uncharacterized protein LOC104891937    241   7e-122   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     243   8e-122   Arabidopsis thaliana [mouse-ear cress]
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         243   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    262   1e-121   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526    254   4e-121   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191    249   4e-121   
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159    249   5e-121   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    243   8e-121   
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    243   1e-120   
emb|CAE04866.2|  OSJNBa0086O06.14                                       239   4e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg             239   1e-119   
gb|EEC84753.1|  hypothetical protein OsI_31756                          231   2e-119   Oryza sativa Indica Group [Indian rice]
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         232   5e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    238   1e-118   
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    229   3e-118   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    239   4e-118   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    234   5e-118   
gb|EEC68887.1|  hypothetical protein OsI_37529                          262   1e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg             247   2e-117   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    263   3e-117   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    232   6e-117   
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         252   8e-117   Oryza sativa Japonica Group [Japonica rice]
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         252   1e-116   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61425.1|  hypothetical protein M569_13371                         246   1e-116   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    251   1e-116   
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    237   2e-116   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              236   2e-116   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             229   4e-116   
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    230   6e-116   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    242   6e-116   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    229   1e-115   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737                 280   1e-115   
ref|XP_010480950.1|  PREDICTED: uncharacterized protein LOC104759762    230   1e-115   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    238   2e-115   
gb|AAG03119.1|AC004133_13  F5A9.24                                      253   2e-115   Arabidopsis thaliana [mouse-ear cress]
gb|AAF97969.1|AC000103_19  F21J9.30                                     253   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    225   1e-114   
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein               239   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    233   8e-114   
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296    228   1e-113   
ref|XP_010693613.1|  PREDICTED: uncharacterized protein LOC104906541    243   2e-113   
ref|XP_008387315.1|  PREDICTED: uncharacterized protein LOC103449768    258   2e-113   
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275    227   2e-113   
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    228   3e-113   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752                 272   4e-113   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    236   6e-113   
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880    246   1e-112   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    237   1e-112   
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    248   2e-112   
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    246   2e-112   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    239   2e-112   
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    248   3e-112   
gb|EPS72636.1|  hypothetical protein M569_02121                         228   3e-112   
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852    252   8e-112   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    226   1e-111   
gb|AFP55574.1|  non-ltr retroelement reverse transcriptase              256   2e-111   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    226   2e-111   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923                 268   4e-111   
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    231   4e-111   
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    225   5e-111   
gb|EAZ20803.1|  hypothetical protein OsJ_36426                          240   6e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     216   1e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CCA66050.1|  hypothetical protein                                   236   2e-110   
ref|XP_008801646.1|  PREDICTED: uncharacterized protein LOC103715697    248   3e-110   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    233   4e-110   
ref|XP_010513001.1|  PREDICTED: uncharacterized protein LOC104788939    238   4e-110   
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725    236   9e-110   
emb|CAB40051.1|  putative protein                                       221   9e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...    219   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622    222   1e-109   
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    246   1e-109   
ref|XP_009349611.1|  PREDICTED: uncharacterized protein LOC103941142    269   2e-109   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743    268   2e-109   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified         226   4e-109   Oryza sativa Japonica Group [Japonica rice]
emb|CCA66180.1|  hypothetical protein                                   233   9e-109   
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    227   1e-108   
gb|ABA98898.1|  retrotransposon protein, putative, unclassified         240   1e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202950.1|  hypothetical protein PRUPE_ppa016504mg             249   3e-108   
gb|EEC75227.1|  hypothetical protein OsI_11496                          214   3e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_011085143.1|  PREDICTED: uncharacterized protein LOC105167219    269   2e-107   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574    255   2e-107   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    219   6e-107   
ref|XP_010671205.1|  PREDICTED: uncharacterized protein LOC104888072    235   8e-107   
ref|XP_008794416.1|  PREDICTED: uncharacterized protein LOC103710479    222   2e-106   
gb|EEE52912.1|  hypothetical protein OsJ_35521                          228   2e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    211   6e-106   
ref|XP_010674085.1|  PREDICTED: uncharacterized protein LOC104890338    233   7e-106   
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758    228   9e-106   
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890    273   1e-105   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    207   2e-105   
emb|CCA66198.1|  hypothetical protein                                   240   3e-105   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254    213   3e-105   
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    211   6e-105   
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg             224   8e-105   
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    224   8e-105   
ref|XP_007214027.1|  hypothetical protein PRUPE_ppa016677mg             249   9e-105   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964    211   1e-104   
ref|XP_009114416.1|  PREDICTED: uncharacterized protein LOC103839673    232   1e-104   
gb|ABF95850.1|  retrotransposon protein, putative, unclassified         213   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    213   1e-104   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase     207   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    249   2e-104   
ref|XP_008350747.1|  PREDICTED: uncharacterized protein LOC103414113    223   2e-104   
ref|XP_010473926.1|  PREDICTED: uncharacterized protein LOC104753360    253   2e-104   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    240   2e-104   
ref|XP_008791119.1|  PREDICTED: uncharacterized protein LOC103708118    234   2e-104   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    207   3e-104   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330                 238   6e-104   
emb|CAN68838.1|  hypothetical protein VITISV_030956                     243   8e-104   Vitis vinifera
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    234   1e-103   
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356    228   1e-103   
ref|XP_010501912.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    248   2e-103   
ref|XP_007224290.1|  hypothetical protein PRUPE_ppa020085mg             237   2e-103   
ref|XP_009150035.1|  PREDICTED: uncharacterized protein LOC103873375    207   2e-103   
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896    215   3e-103   
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase    222   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990    227   1e-102   
emb|CAN68165.1|  hypothetical protein VITISV_008538                     232   2e-102   Vitis vinifera
ref|XP_007031312.1|  Uncharacterized protein TCM_016762                 240   3e-102   
emb|CAN74183.1|  hypothetical protein VITISV_034261                     212   6e-102   Vitis vinifera
ref|XP_007022832.1|  Uncharacterized protein TCM_026877                 236   1e-101   
ref|XP_010667308.1|  PREDICTED: uncharacterized protein LOC104884364    213   1e-101   
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    208   1e-101   
emb|CCA66188.1|  hypothetical protein                                   226   1e-101   
ref|XP_007212580.1|  hypothetical protein PRUPE_ppa015871mg             236   3e-101   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    214   3e-101   
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    211   4e-101   
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219    206   5e-101   
emb|CCA66140.1|  hypothetical protein                                   234   7e-101   
ref|XP_009353199.1|  PREDICTED: uncharacterized protein LOC103944460    201   8e-101   
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089    214   1e-100   
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182    275   3e-100   
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    231   4e-100   
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    213   5e-100   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323    254   8e-100   
gb|ABA91837.2|  retrotransposon protein, putative, unclassified         244   9e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             223   1e-99    
gb|AAX95129.1|  retrotransposon protein, putative, unclassified         243   1e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EEC83406.1|  hypothetical protein OsI_28856                          218   1e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_010058631.1|  PREDICTED: uncharacterized protein LOC104446483    235   1e-99    
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249    214   2e-99    
emb|CCA65974.1|  hypothetical protein                                   219   2e-99    
emb|CCA66235.1|  hypothetical protein                                   221   4e-99    
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737    216   7e-99    
gb|AAM01179.2|AC113336_31  Putative retroelement                        226   8e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010687808.1|  PREDICTED: uncharacterized protein LOC104901884    202   1e-98    
ref|XP_010681283.1|  PREDICTED: uncharacterized protein LOC104896266    204   3e-98    
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    239   3e-98    
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    214   4e-98    
gb|AAF69169.1|AC007915_21  F27F5.21                                     195   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390125.1|  PREDICTED: uncharacterized protein LOC103452416    248   7e-98    
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929    208   1e-97    
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    199   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             237   2e-97    
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    199   2e-97    
ref|XP_010674186.1|  PREDICTED: uncharacterized protein LOC104890406    218   2e-97    
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977    200   2e-97    
gb|EEE59033.1|  hypothetical protein OsJ_10782                          198   3e-97    Oryza sativa Japonica Group [Japonica rice]
emb|CAN65484.1|  hypothetical protein VITISV_029474                     215   3e-97    Vitis vinifera
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...    215   4e-97 
gb|EEE51789.1|  hypothetical protein OsJ_33245                          233   6e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...    256   2e-96    
ref|XP_002454941.1|  hypothetical protein SORBIDRAFT_03g001780          234   2e-96    Sorghum bicolor [broomcorn]
gb|EEC83100.1|  hypothetical protein OsI_28249                          230   3e-96    Oryza sativa Indica Group [Indian rice]
emb|CCA66020.1|  hypothetical protein                                   215   3e-96    
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    244   4e-96    
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075    238   6e-96    
gb|EEE50824.1|  hypothetical protein OsJ_31232                          224   7e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AAD15377.1|  putative non-LTR retroelement reverse transcriptase     192   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    215   1e-95    
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    213   1e-95    
emb|CAN67355.1|  hypothetical protein VITISV_002170                     221   2e-95    Vitis vinifera
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719    209   3e-95    
ref|XP_010692841.1|  PREDICTED: uncharacterized protein LOC104905886    342   3e-95    
emb|CCA66178.1|  hypothetical protein                                   226   4e-95    
ref|XP_008354730.1|  PREDICTED: uncharacterized protein LOC103418377    331   5e-95    
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579    218   1e-94    
ref|XP_010068169.1|  PREDICTED: uncharacterized protein LOC104455000    219   1e-94    
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    241   2e-94    
ref|XP_010058565.1|  PREDICTED: uncharacterized protein LOC104446406    204   2e-94    
ref|XP_010472440.1|  PREDICTED: uncharacterized protein LOC104752070    202   3e-94    
emb|CAN74843.1|  hypothetical protein VITISV_037042                     206   3e-94    Vitis vinifera
ref|XP_010675126.1|  PREDICTED: uncharacterized protein LOC104891166    208   3e-94    
gb|EPS64876.1|  hypothetical protein M569_09903                         216   5e-94    
gb|AAT58873.1|  hypothetical protein                                    201   6e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EEE55133.1|  hypothetical protein OsJ_02920                          190   7e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010692491.1|  PREDICTED: uncharacterized protein LOC104905603    211   7e-94    
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    219   1e-93    
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    225   2e-93    
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764    243   2e-93    
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase     200   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010681744.1|  PREDICTED: uncharacterized protein LOC104896672    204   3e-93    
emb|CAE04660.2|  OSJNBa0061G20.16                                       281   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148    198   4e-93    
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    202   6e-93    
emb|CAB75484.1|  putative protein                                       227   7e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424030.1|  PREDICTED: uncharacterized protein LOC104709061    299   2e-92    
emb|CCA66153.1|  hypothetical protein                                   228   2e-92    
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    217   2e-92    
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    219   3e-92    
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...    243   3e-92    
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714    201   3e-92    
emb|CAN81579.1|  hypothetical protein VITISV_023185                     186   6e-92    Vitis vinifera
emb|CAN69430.1|  hypothetical protein VITISV_024658                     196   6e-92    Vitis vinifera
ref|XP_007212615.1|  hypothetical protein PRUPE_ppa017091mg             218   8e-92    
ref|XP_010684619.1|  PREDICTED: uncharacterized protein LOC104899180    231   9e-92    
ref|XP_010666096.1|  PREDICTED: uncharacterized protein LOC104883306    206   9e-92    
emb|CAN65298.1|  hypothetical protein VITISV_008130                     199   1e-91    Vitis vinifera
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    210   1e-91    
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    210   1e-91    
ref|XP_004242524.1|  PREDICTED: uncharacterized protein LOC101258077    210   1e-91    
emb|CAN82456.1|  hypothetical protein VITISV_010028                     206   2e-91    Vitis vinifera
ref|XP_010549577.1|  PREDICTED: uncharacterized protein LOC104820715    223   2e-91    
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164    191   2e-91    
ref|XP_007224079.1|  hypothetical protein PRUPE_ppa015473mg             210   2e-91    
emb|CCA66222.1|  hypothetical protein                                   228   2e-91    
ref|XP_007210729.1|  hypothetical protein PRUPE_ppa021798mg             210   2e-91    
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    215   2e-91    
emb|CAN69126.1|  hypothetical protein VITISV_008195                     234   5e-91    Vitis vinifera
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    226   6e-91    
ref|XP_010034422.1|  PREDICTED: uncharacterized protein LOC104423658    215   6e-91    
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    218   9e-91    
emb|CAN75888.1|  hypothetical protein VITISV_023640                     193   1e-90    Vitis vinifera
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    187   1e-90    
ref|XP_010424324.1|  PREDICTED: uncharacterized protein LOC104709399    301   1e-90    
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961    191   2e-90    
emb|CAN77850.1|  hypothetical protein VITISV_020834                     195   2e-90    Vitis vinifera
emb|CAN76026.1|  hypothetical protein VITISV_027817                     204   2e-90    Vitis vinifera
emb|CAN68820.1|  hypothetical protein VITISV_009132                     199   4e-90    
emb|CAN82386.1|  hypothetical protein VITISV_029348                     213   4e-90    
emb|CAN82939.1|  hypothetical protein VITISV_013126                     201   5e-90    
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406    216   1e-89    
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    227   1e-89    
emb|CAN78577.1|  hypothetical protein VITISV_020585                     186   1e-89    
ref|XP_010668002.1|  PREDICTED: uncharacterized protein LOC104884990    194   1e-89    
emb|CAN70311.1|  hypothetical protein VITISV_022886                     228   1e-89    
ref|XP_010026295.1|  PREDICTED: uncharacterized protein LOC104416631    184   2e-89    
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg             219   4e-89    
ref|XP_008375089.1|  PREDICTED: uncharacterized protein LOC103438319    215   5e-89    
ref|XP_010436306.1|  PREDICTED: uncharacterized protein LOC104720031    220   7e-89    
ref|XP_010672625.1|  PREDICTED: uncharacterized protein LOC104889168    198   8e-89    
ref|XP_010645162.1|  PREDICTED: uncharacterized protein LOC104877807    211   1e-88    
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949    223   3e-88    
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             211   5e-88    
ref|XP_010694891.1|  PREDICTED: uncharacterized protein LOC104907631    193   5e-88    
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832    204   8e-88    
gb|EEC70889.1|  hypothetical protein OsI_02427                          182   1e-87    
ref|XP_010674612.1|  PREDICTED: uncharacterized protein LOC104890735    200   2e-87    
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    207   2e-87    
emb|CAN68860.1|  hypothetical protein VITISV_023024                     187   2e-87    
ref|XP_010675368.1|  PREDICTED: uncharacterized protein LOC104891381    221   3e-87    
ref|XP_010481107.1|  PREDICTED: uncharacterized protein LOC104759943    254   3e-87    
emb|CAN72097.1|  hypothetical protein VITISV_042083                     208   3e-87    
ref|XP_010673150.1|  PREDICTED: uncharacterized protein LOC104889591    180   4e-87    
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298    188   5e-87    
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    218   5e-87    
ref|XP_010695571.1|  PREDICTED: uncharacterized protein LOC104908184    217   5e-87    
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755    213   1e-86    
emb|CAN70538.1|  hypothetical protein VITISV_040070                     183   2e-86    
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    201   2e-86    
emb|CAN71912.1|  hypothetical protein VITISV_018965                     196   2e-86    
emb|CAN72707.1|  hypothetical protein VITISV_043786                     225   3e-86    
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    209   3e-86    
ref|XP_007212886.1|  hypothetical protein PRUPE_ppa021750mg             176   3e-86    
ref|XP_010692445.1|  PREDICTED: uncharacterized protein LOC104905555    191   4e-86    
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    220   4e-86    
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    191   6e-86    
emb|CAN71106.1|  hypothetical protein VITISV_000041                     201   1e-85    
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    224   1e-85    
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    176   1e-85    
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891    197   2e-85    
ref|XP_010530571.1|  PREDICTED: uncharacterized protein LOC104807...    183   2e-85    
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...    205   2e-85    
ref|XP_010451544.1|  PREDICTED: uncharacterized protein LOC104733678    195   2e-85    
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...    209   3e-85    
ref|XP_010694896.1|  PREDICTED: uncharacterized protein LOC104907635    179   3e-85    
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882    228   3e-85    
ref|XP_010513448.1|  PREDICTED: uncharacterized protein LOC104789452    182   4e-85    
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    196   5e-85    
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282    220   5e-85    
emb|CAN76604.1|  hypothetical protein VITISV_012933                     208   6e-85    
ref|XP_004233579.1|  PREDICTED: uncharacterized protein LOC101260201    226   8e-85    
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase     179   9e-85    
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg             174   9e-85    
ref|XP_010669873.1|  PREDICTED: uncharacterized protein LOC104886993    186   1e-84    
ref|XP_007036030.1|  Uncharacterized protein TCM_021518                 193   1e-84    
emb|CAN74986.1|  hypothetical protein VITISV_008771                     176   2e-84    
ref|XP_007217780.1|  hypothetical protein PRUPE_ppa020022mg             174   3e-84    
emb|CAN64256.1|  hypothetical protein VITISV_040148                     172   3e-84    
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    192   4e-84    
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    192   4e-84    
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    192   4e-84    
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285    172   4e-84    
emb|CAN77614.1|  hypothetical protein VITISV_035196                     179   5e-84    
ref|XP_008342824.1|  PREDICTED: putative ribonuclease H protein A...    179   7e-84    
gb|AAG50806.1|AC079281_8  unknown protein                               202   8e-84    
emb|CAN69474.1|  hypothetical protein VITISV_014375                     181   8e-84    
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321    204   9e-84    
ref|XP_010693172.1|  PREDICTED: uncharacterized protein LOC104906154    184   9e-84    
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...    198   1e-83    
gb|ABA91475.1|  retrotransposon protein, putative, unclassified         192   2e-83    
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    202   2e-83    
ref|XP_010672360.1|  PREDICTED: uncharacterized protein LOC104888944    256   3e-83    
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    211   3e-83    
emb|CAN80807.1|  hypothetical protein VITISV_023749                     184   3e-83    
emb|CAN75609.1|  hypothetical protein VITISV_002943                     174   3e-83    
gb|ABD33126.2|  RNA-directed DNA polymerase (Reverse transcriptase)     193   5e-83    
ref|NP_001175161.1|  Os07g0417700                                       199   5e-83    
ref|XP_010681460.1|  PREDICTED: uncharacterized protein LOC104896407    176   6e-83    
emb|CAN75646.1|  hypothetical protein VITISV_031269                     176   7e-83    
ref|NP_001174443.1|  Os05g0434000                                       201   7e-83    
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg             253   7e-83    
ref|XP_009139319.1|  PREDICTED: uncharacterized protein LOC103863313    189   8e-83    
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816    216   8e-83    
ref|XP_010523549.1|  PREDICTED: uncharacterized protein LOC104801863    183   8e-83    
ref|XP_002453763.1|  hypothetical protein SORBIDRAFT_04g014351          172   9e-83    
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    184   1e-82    
gb|AAT01370.1|  putative non-LTR retroelement reverse transcriptase     194   1e-82    
emb|CAN73982.1|  hypothetical protein VITISV_007640                     177   1e-82    
ref|XP_008776564.1|  PREDICTED: uncharacterized protein LOC103696659    253   1e-82    
ref|XP_010677875.1|  PREDICTED: uncharacterized protein LOC104893474    223   2e-82    
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    225   2e-82    
ref|XP_010468497.1|  PREDICTED: uncharacterized protein LOC104748579    176   2e-82    
emb|CAN69754.1|  hypothetical protein VITISV_024938                     181   2e-82    
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         224   3e-82    
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               224   3e-82    
gb|EEE50691.1|  hypothetical protein OsJ_30951                          226   4e-82    
ref|XP_008802031.1|  PREDICTED: putative ribonuclease H protein A...    196   6e-82    
ref|XP_007201486.1|  hypothetical protein PRUPE_ppa016462mg             196   6e-82    
emb|CAN71630.1|  hypothetical protein VITISV_015580                     178   7e-82    
emb|CAN77370.1|  hypothetical protein VITISV_033119                     174   8e-82    
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    195   9e-82    
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             218   1e-81    
ref|XP_008358855.1|  PREDICTED: uncharacterized protein LOC103422573    211   2e-81    
ref|XP_010686886.1|  PREDICTED: uncharacterized protein LOC104901041    176   2e-81    
ref|XP_008354602.1|  PREDICTED: uncharacterized protein LOC103418244    202   2e-81    
gb|KHN27546.1|  LINE-1 reverse transcriptase like                       184   2e-81    
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    233   4e-81    
ref|XP_010039996.1|  PREDICTED: uncharacterized protein LOC104428743    189   4e-81    
gb|ABW81175.1|  non-LTR retrotransposon transposase                     287   6e-81    
ref|XP_010530573.1|  PREDICTED: uncharacterized protein LOC104807...    168   6e-81    
ref|XP_010530575.1|  PREDICTED: uncharacterized protein LOC104807...    168   7e-81    
ref|XP_010530579.1|  PREDICTED: LINE-1 retrotransposable element ...    168   7e-81    
ref|XP_010530580.1|  PREDICTED: LINE-1 retrotransposable element ...    168   8e-81    
ref|XP_010530577.1|  PREDICTED: LINE-1 retrotransposable element ...    167   8e-81    
ref|XP_010530574.1|  PREDICTED: uncharacterized protein LOC104807...    167   8e-81    
ref|XP_008348238.1|  PREDICTED: uncharacterized protein LOC103411380    216   9e-81    
emb|CAN66193.1|  hypothetical protein VITISV_013311                     169   1e-80    
ref|XP_010530578.1|  PREDICTED: LINE-1 retrotransposable element ...    168   1e-80    
ref|XP_010681601.1|  PREDICTED: uncharacterized protein LOC104896541    166   2e-80    
gb|EEC75230.1|  hypothetical protein OsI_11503                          213   3e-80    
gb|EEC66671.1|  hypothetical protein OsI_32959                          219   3e-80    
ref|XP_002489165.1|  hypothetical protein SORBIDRAFT_0015s007030        218   4e-80    
dbj|BAH79979.1|  putative unclassified retrotransposon protein          211   4e-80    
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    235   5e-80    
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    233   5e-80    
ref|XP_007052625.1|  Uncharacterized protein TCM_005953                 185   7e-80    
emb|CAN65100.1|  hypothetical protein VITISV_039725                     176   7e-80    
gb|AAM82604.1|AF525305_2  putative AP endonuclease/reverse transc...    205   8e-80    
ref|XP_010667214.1|  PREDICTED: uncharacterized protein LOC104884289    187   9e-80    
ref|XP_008362180.1|  PREDICTED: uncharacterized protein LOC103425857    213   1e-79    
ref|XP_010666661.1|  PREDICTED: uncharacterized protein LOC104883796    197   1e-79    
emb|CAN74312.1|  hypothetical protein VITISV_037520                     166   1e-79    
ref|XP_008798809.1|  PREDICTED: putative ribonuclease H protein A...    195   1e-79    
ref|XP_011102248.1|  PREDICTED: uncharacterized protein LOC105180271    185   2e-79    
emb|CAN64220.1|  hypothetical protein VITISV_014001                     199   2e-79    
gb|EEC71228.1|  hypothetical protein OsI_03168                          181   2e-79    
ref|XP_008800872.1|  PREDICTED: uncharacterized protein LOC103715119    186   2e-79    
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg             169   2e-79    
ref|XP_011013113.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    202   3e-79    
emb|CAN78850.1|  hypothetical protein VITISV_013214                     166   4e-79    
ref|XP_008369981.1|  PREDICTED: uncharacterized protein LOC103433498    190   4e-79    
ref|XP_011004665.1|  PREDICTED: uncharacterized protein LOC105111104    207   4e-79    
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360    216   5e-79    
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...    182   5e-79    
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    223   5e-79    
gb|AAC28221.1|  similar to reverse transcriptases (PFam: rvt.hmm,...    199   5e-79    
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359    216   5e-79    
emb|CAN70922.1|  hypothetical protein VITISV_016266                     180   7e-79    
emb|CAN67932.1|  hypothetical protein VITISV_013913                     165   9e-79    
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             209   9e-79    
ref|XP_009127062.1|  PREDICTED: uncharacterized protein LOC103851934    195   5e-78    
gb|ABA97687.1|  retrotransposon protein, putative, unclassified         191   6e-78    
ref|XP_008779976.1|  PREDICTED: uncharacterized protein LOC103699749    282   7e-78    
dbj|BAF00918.1|  putative reverse transcriptase                         209   8e-78    
ref|XP_009118886.1|  PREDICTED: uncharacterized protein LOC103843858    190   1e-77    
ref|NP_001057661.2|  Os06g0484800                                       192   1e-77    
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    207   1e-77    
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687    198   1e-77    
ref|XP_009124790.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    233   2e-77    
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    187   2e-77    
ref|XP_010040552.1|  PREDICTED: uncharacterized protein LOC104429377    215   2e-77    
ref|XP_009335445.1|  PREDICTED: uncharacterized protein LOC103928158    188   2e-77    
ref|XP_008808644.1|  PREDICTED: putative ribonuclease H protein A...    189   3e-77    
ref|XP_008357937.1|  PREDICTED: putative ribonuclease H protein A...    177   4e-77    
emb|CAN79574.1|  hypothetical protein VITISV_017342                     163   7e-77    
emb|CAN78035.1|  hypothetical protein VITISV_031077                     174   8e-77    
ref|XP_010675063.1|  PREDICTED: uncharacterized protein LOC104891112    274   8e-77    
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    216   9e-77    
ref|XP_011101886.1|  PREDICTED: uncharacterized protein LOC105179931    192   1e-76    
ref|XP_010229884.1|  PREDICTED: uncharacterized protein LOC100821562    217   1e-76    
gb|EEE52364.1|  hypothetical protein OsJ_34428                          255   2e-76    
ref|XP_010068552.1|  PREDICTED: uncharacterized protein LOC104455464    165   2e-76    
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845    185   2e-76    
gb|EAZ03196.1|  hypothetical protein OsI_25347                          220   3e-76    
emb|CAN77861.1|  hypothetical protein VITISV_005457                     162   3e-76    
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...    273   4e-76    
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)     186   4e-76    
emb|CAN77480.1|  hypothetical protein VITISV_021632                     167   4e-76    
ref|XP_010676054.1|  PREDICTED: transposon TX1 uncharacterized 14...    160   4e-76    
ref|XP_010233096.1|  PREDICTED: uncharacterized protein LOC104583080    174   4e-76    
ref|XP_010495165.1|  PREDICTED: uncharacterized protein LOC104772227    192   4e-76    
emb|CAN68609.1|  hypothetical protein VITISV_012924                     161   5e-76    
ref|XP_009144617.1|  PREDICTED: uncharacterized protein LOC103868259    185   5e-76    
emb|CCA65979.1|  hypothetical protein                                   202   6e-76    
emb|CAN82094.1|  hypothetical protein VITISV_031210                     174   7e-76    
emb|CAN72456.1|  hypothetical protein VITISV_026051                     172   9e-76    
ref|XP_009150030.1|  PREDICTED: uncharacterized protein LOC103873368    189   1e-75    
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362    192   1e-75    
dbj|BAB09379.1|  non-LTR retroelement reverse transcriptase-like ...    175   1e-75    
emb|CCA65981.1|  hypothetical protein                                   211   1e-75    
ref|XP_010518579.1|  PREDICTED: uncharacterized protein LOC104793852    203   1e-75    
ref|XP_010038572.1|  PREDICTED: uncharacterized protein LOC104427129    160   1e-75    
ref|XP_010480531.1|  PREDICTED: uncharacterized protein LOC104759285    195   2e-75    
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...    160   2e-75    
ref|XP_009118133.1|  PREDICTED: uncharacterized protein LOC103843180    181   3e-75    
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222    168   3e-75    
ref|XP_008381797.1|  PREDICTED: uncharacterized protein LOC103444619    198   3e-75    
ref|XP_007207617.1|  hypothetical protein PRUPE_ppa019748mg             158   3e-75    
ref|XP_009103824.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    165   5e-75    
ref|XP_010054733.1|  PREDICTED: uncharacterized protein LOC104443069    159   6e-75    
ref|XP_002441856.1|  hypothetical protein SORBIDRAFT_08g003575          188   8e-75    
emb|CCA66036.1|  hypothetical protein                                   285   9e-75    
emb|CAN72890.1|  hypothetical protein VITISV_022310                     166   9e-75    
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500    162   9e-75    
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135    159   1e-74    
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312    179   1e-74    
ref|XP_010451627.1|  PREDICTED: uncharacterized protein LOC104733777    172   2e-74    
ref|XP_009140327.1|  PREDICTED: uncharacterized protein LOC103864320    181   2e-74    
emb|CAN71772.1|  hypothetical protein VITISV_002507                     175   3e-74    
emb|CAN84133.1|  hypothetical protein VITISV_000111                     196   4e-74    
ref|XP_010431573.1|  PREDICTED: uncharacterized protein LOC104715904    164   4e-74    
gb|ABO80459.1|  RNA-directed DNA polymerase (Reverse transcriptas...    169   5e-74    
ref|XP_010480636.1|  PREDICTED: uncharacterized protein LOC104759401    160   1e-73    
ref|XP_004295858.1|  PREDICTED: uncharacterized protein LOC101314838    190   1e-73    
ref|XP_009140437.1|  PREDICTED: uncharacterized protein LOC103864439    169   1e-73    
gb|EEE69906.1|  hypothetical protein OsJ_29747                          168   2e-73    
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339    154   2e-73    
gb|EEE67582.1|  hypothetical protein OsJ_25113                          228   2e-73    



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/599 (39%), Positives = 343/599 (57%), Gaps = 10/599 (2%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN QG  +      L+  +R++ P+++ L E  IS  QA  IC  +GF    RVEA G+ 
Sbjct  8     WNVQGVGTKL--TILRELMRINNPTVLALVETHISGDQAQRICDRIGFSGQTRVEAEGFR  65

Query  2888  GGIWLFC-SVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GGIWLF  S  + +    +H Q +  ++      PWL S +Y   D  LR+ L+ +L   
Sbjct  66    GGIWLFWKSEEVTVTPYGSHSQHLTVEIRRIGDDPWLFSAIYASPDSTLRKELWRELEQI  125

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSR-CTDFNDWIFMEELIDLGFTGSSYTWI  2535
                  G WL  GDFN  +   E +  E+  M R C DF +WI    LIDLGFTG ++TW 
Sbjct  126   KNQYTGPWLLAGDFNETSSLCERNGSESSEMQRRCKDFANWIENNALIDLGFTGPAHTWS  185

Query  2534  RGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITT-CPQQFCSSR  2358
             RGL   +FK ARLDR L+N E  L+F +  V +LP   SDH P+LIS +   P       
Sbjct  186   RGLSPTTFKSARLDRGLANSEWKLKFTEGVVRNLPKSQSDHCPILISTSGFAPVPRIIKP  245

Query  2357  FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             F+F  AW  H  F   V+  W +D  +     +  + L+ W+++ F NI +KK  L AR+
Sbjct  246   FRFQAAWLNHQVFCEFVRKNWNADAPIVPFLKSFADKLNKWNKEEFYNIFRKKSELWARI  305

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
              GVQ  LS G ++ L++LE +LR+E++  L  EE +WFQ+SR E I  GDRNTR++ ++T
Sbjct  306   SGVQALLSTGRQNHLIKLEAKLRREMDIVLDDEETLWFQKSRMEAICDGDRNTRYFHLST  365

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY---GCFPPL  1827
              ++R+++R+  L + DG  I +   +   V  Y+  LF+   D  ++NFC+     FP +
Sbjct  366   VIRRSRNRIDMLQNNDGEWISNPMEVKAMVLGYWKHLFSE--DSVQSNFCHLPRDFFPQI  423

Query  1826  LEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFE  1647
               +D+  +  P +  ++  AL  M P KA GPDGF P F+ + W  V  ++   V     
Sbjct  424   TADDFEKMMRPLSEVEVTLALKSMKPFKAPGPDGFQPLFYQRFWDLVKPNVMHLVSEILS  483

Query  1646  DGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPH  1467
                 P G NDT + LIPK+  P+    FRPIGLCN+VYK++TKV++ RLK ++  L+ P 
Sbjct  484   GRDFPEGFNDTFIVLIPKMDIPQLAKHFRPIGLCNIVYKIVTKVIINRLKPILPSLISPT  543

Query  1466  QSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
             Q SFV  RQITDN +  QE+ ++ R K+G+ G+MA+K+D EKAYDRL W FI ++L ++
Sbjct  544   QCSFVPNRQITDNVIIVQEMFHSMRNKQGKKGFMAVKIDFEKAYDRLRWTFIRESLMEL  602


 Score =   335 bits (860),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/420 (43%), Positives = 255/420 (61%), Gaps = 2/420 (0%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             +M CV+S  L  LWNG+  + I P +GLRQGDP+SP L+V+C ERL+H++D  V +GNWK
Sbjct  612   VMNCVSSANLQILWNGEPMEKICPTRGLRQGDPLSPYLYVICMERLAHLIDQEVTNGNWK  671

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              VK +R  P +S+L FADDL+ F EA+  QA  MK CLD FC  SG K+N  KS ++FS 
Sbjct  672   PVKASRNGPPISNLAFADDLILFSEASVEQAQVMKWCLDRFCEASGSKVNEDKSKIYFSA  731

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             NT+L  +  +  TL + +  D GK+LG+P+I+GR  K  +  +++RI  +L+G  ++TLS
Sbjct  732   NTHLDIRDAVCNTLAMEATADFGKYLGVPTINGRSSKREYQYLVDRINGKLAGWKTKTLS  791

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG   ++QS  S+IPYY+M+ST +P    D I+R  R FLWG +EGK + HLV W  ++
Sbjct  792   IAGRATLIQSAFSSIPYYTMQSTKLPRSTCDDIDRKSRSFLWGEQEGKRRVHLVAWENIS  851

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
              SK  GGLGI+S++  N AFL KL WRL  + + LW+ + +AKY  +      ++ K N+
Sbjct  852   KSKKEGGLGIRSMRQANSAFLVKLGWRLLAEPSSLWSRILRAKYCDNRCDIDMFKEKSNA  911

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN-LVA  187
             S+ W+GIL ++ + R GI   V NG  T FW   W    PL   AS PI P  L +  V 
Sbjct  912   SSTWRGILSSIDVVRKGINSAVGNGAKTLFWHHRWATSEPLISLAS-PIPPIELQDATVK  970

Query  186   NYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYELA  7
               W    GW  D+    LPE  L  ++   L +D    D + W   P+G F++ SA  + 
Sbjct  971   EMWDLVSGWKVDVFANYLPEATLKLIAAHELIDDEEAIDDIYWNGSPSGGFTIGSAMNIT  1030



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score =   369 bits (948),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/599 (36%), Positives = 323/599 (54%), Gaps = 8/599 (1%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN +GA    F  T K  +RL+K ++  + EP+IS  +A E+   LGF  +  V+A G+S
Sbjct  3     WNVRGAGGKPFSVTAKDLVRLNKVNIFAILEPRISGERAIEVIKGLGFSNYYVVDANGFS  62

Query  2888  GGIWLFCSVSI-NIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+WL  +  +  + ++    Q I   V D     W+++VVY      +R HL+  L   
Sbjct  63    GGVWLLWNNEVVKLTVVACSSQTITAVVMDG-QIQWMLTVVYASPCPRVRSHLWPYLDGV  121

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                    WL  GDFN +   SE   K    +++ +   +W     L+DLGF G+ +TW +
Sbjct  122   SAASNMPWLIAGDFNELMHSSE--KKGGRPVNKNSGLGNWSARNSLVDLGFIGAKFTWSK  179

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITT--CPQQFCSSR  2358
               +       RLDR L N+     F +A V HL  + SDH PLLI + +   P     + 
Sbjct  180   KNEHGEIVWERLDRGLCNIAWRHLFSEAYVRHLAKVKSDHCPLLIGLHSNHIPNPDLKA-  238

Query  2357  FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEA-LSVWSRDSFGNIPQKKRRLLAR  2181
             F+F   W  H  F+  V   W S    ++ K+  + + L  W+ + FG I QKKRRLLAR
Sbjct  239   FRFQAMWMLHPEFEPFVNDTWSSAQGDASCKTIFLSSELQSWNHNVFGCIFQKKRRLLAR  298

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVA  2001
             + G+Q +L +     L  LE++L  E    L QEEL W Q+SR  W++ GD+NT+F+ ++
Sbjct  299   ICGIQKALCICHVPYLFDLEKQLTTEYSTILEQEELFWLQKSRNTWLREGDKNTKFFHLS  358

Query  2000  TTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLE  1821
               V+R ++++  L +++G    D   L   V +YF  LF+  +           FP L++
Sbjct  359   AVVRRRKNKLEGLNNSEGVWTEDKETLKSIVVNYFKDLFSFRITTTTMENLPHLFPCLID  418

Query  1820  EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDG  1641
             ED   +N   T ++IK  +F +   KA GPDG    F+ K W   G  +   V   F   
Sbjct  419   EDLFVLNGEVTDDEIKACMFAIGGLKAPGPDGIPARFYQKFWHLCGKDVCDMVKVCFNTT  478

Query  1640  ILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQS  1461
              LP   N+T +SLIPKV NP  +TQ RPI LC+ +YK+I+K+++ +L+ ++ KLV P Q 
Sbjct  479   QLPDNINNTFISLIPKVDNPTSMTQLRPISLCSTLYKVISKILVGKLRPLLHKLVSPTQV  538

Query  1460  SFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             SFV GRQI DN +  QEIL+ +R  KG+ G++A K+DL KAYDRL W FI D L +IG 
Sbjct  539   SFVPGRQIIDNVIVAQEILHKYRNTKGKKGFIAWKIDLSKAYDRLQWSFIRDVLWEIGL  597


 Score =   321 bits (822),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/417 (42%), Positives = 257/417 (62%), Gaps = 2/417 (0%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CVT+    A+ NG+LTD  SP+ G+RQGDP+SP LFVLC E+LSH+++  + +  WK
Sbjct  605   IMQCVTTVNYQAIVNGELTDSFSPQCGIRQGDPLSPYLFVLCMEKLSHIINGCITTKKWK  664

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              VK++R  P +SHLFFADDL+ F EA+S QA  +K CLD+FC+ SGQ++N  KS ++ S 
Sbjct  665   PVKLSRYGPPVSHLFFADDLILFAEASSTQAKLLKDCLDIFCAVSGQQVNFDKSCIYCSP  724

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N +      IA   G P   D+G++LG+P +H R+ K+++ NI+E+++ RLS   S TLS
Sbjct  725   NISRSKAIEIANICGSPLTSDLGQYLGVPLLHSRVNKETYGNIVEKVQRRLSAWKSNTLS  784

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V +QSV SAIP YSM+ST +P  + D I++L R FLWG  E K+K HLVKW  V+
Sbjct  785   MAGRLVYLQSVASAIPIYSMQSTRLPISICDKIDKLNRNFLWGHTEDKSKVHLVKWETVS  844

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK-RN  367
               K+ GGLG+K    MN A LAK  W+L Q    LW  + K KY     +  +   K  N
Sbjct  845   TPKSMGGLGLKDTHAMNQALLAKTGWKLMQRDPGLWAQVLKGKYLKHHDMVGACSAKFTN  904

Query  366   SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVA  187
              S+ W+GIL    I  NG++W V +G    FW D+WL    L   A+ P++   L   V 
Sbjct  905   CSHTWRGILFGAQIIPNGMRWRVGSGSQIHFWKDNWLESGVLENFATIPLSADMLEWSVD  964

Query  186   NYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
             ++ ++++GW+ ++L   LP  I+  + +  +       D+++W    +G FSV +AY
Sbjct  965   DF-LTDDGWNVELLYSCLPPDIVEHIFSLHVGIANHREDKVIWSLTNSGTFSVKTAY  1020



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   378 bits (971),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/582 (37%), Positives = 321/582 (55%), Gaps = 35/582 (6%)
 Frame = -1

Query  3005  HKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSIN-IEILYTHP  2829
             HK   + LFE      +A +IC +LGFD   RV+A+G SGGIW+     +  I +L +  
Sbjct  512   HKTDFLALFETHAGGDKARKICQNLGFDSSFRVDAIGQSGGIWILWRDQLGVITVLESSD  571

Query  2828  QFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQS  2649
             QFI  +         +++V Y    ++ R  L+  L     N                  
Sbjct  572   QFIHVKGVFGTETLHIIAV-YAAPTVSRRSGLWRQLKRVLEN------------------  612

Query  2648  EVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*  2469
                      +       DWI    L+D+GF G+SYTW RG DT +F   RLDR L + + 
Sbjct  613   ---------IDEPVMVGDWINDLSLVDMGFKGNSYTWKRGKDTRNFVAKRLDRVLCSAQT  663

Query  2468  SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR---FKFNMAWTTHYSFQACVQSV  2298
              +R+ +A+V HLP + SDH+PL + +   P+Q  + R   F+F  AW  H  F+  + + 
Sbjct  664   RVRWQEAEVAHLPFLASDHAPLYVQLE--PEQKGNPRRRPFRFEAAWLKHDGFKELLSAS  721

Query  2297  WRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrler  2118
             W  ++  S   +A+   L  W+++ FG++ ++K +LL  ++ VQ ++       L+  E 
Sbjct  722   WNREMSTSEALAALKVKLKKWNKEIFGDVHKRKEKLLCEIKEVQEAVERNPSDALLLREE  781

Query  2117  rlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLI  1938
              L KE +  L QEE++W+Q+SRE+WI  GDRNT +Y   T V+R ++R+  L D +GH I
Sbjct  782   ALHKEFDVVLEQEEVLWYQKSREKWIVLGDRNTNYYHTTTIVRRKRNRIEMLKDDEGHWI  841

Query  1937  CDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALF  1761
                  L K   +Y+  L++TE + ++        F  L  ++  S+N PF+  +++ ++ 
Sbjct  842   EQPEQLEKLAMNYYKRLYSTEDISLDTEKLPMVGFTELTRDELESLNKPFSAVEMEASVR  901

Query  1760  DMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNP  1581
              M   KA GPDGF P F+ ++W  VG S+      FF  G+L  G ND +L LIPKV  P
Sbjct  902   SMGKFKAPGPDGFQPIFYQESWDVVGESVTRCGLEFFRTGVLQKGMNDAMLVLIPKVLKP  961

Query  1580  ERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILN  1401
             E+I QFRPI LCNV++K ITK M++RLK ++ KL+GP Q+SF+ GR  TDN +  QE ++
Sbjct  962   EKIMQFRPISLCNVLFKTITKAMVMRLKTLMSKLIGPAQASFIPGRLSTDNIVIVQEAVH  1021

Query  1400  AFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             + R KKG+ GWM LK+DLEKAYDR+ W F+EDTL       T
Sbjct  1022  SMRRKKGKKGWMLLKLDLEKAYDRIRWDFLEDTLHAAKLPQT  1063


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 254/425 (60%), Gaps = 4/425 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CVT+P +  LWNG+ T+   P++GLRQGDP+SP LFVLC ERL H ++ SV +
Sbjct  1064  WITWIMECVTNPGMSLLWNGERTEAFIPQRGLRQGDPLSPYLFVLCMERLCHQIELSVAN  1123

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK +K++R  P++SH+ FADDL+ F EA+  Q   ++K L+ FC  SGQK++L+KS +
Sbjct  1124  KEWKPIKLSRGGPSVSHICFADDLIMFAEASVAQIRVIRKVLEKFCGASGQKVSLEKSLI  1183

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS+N +      I+   GI +  D+GK+LG+P +  R+ K++F  I+ER+ ++L+G   
Sbjct  1184  FFSENVHRDLTTLISDESGIKATKDLGKYLGMPVLQKRINKETFGTIIERMSSKLAGWKR  1243

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LSLAG   + +SVLS+IP ++M S  +P   ++ ++++ R F+WGS +G  K HLV W
Sbjct  1244  RFLSLAGRITLTKSVLSSIPVHTMSSIALPMSTLNQLDKIARSFIWGSVDGDRKQHLVAW  1303

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW-Q  379
               V   +  GGLGI+S K MN+A LAKL WR+    + LW  + + K+       SSW  
Sbjct  1304  EKVCKPRREGGLGIRSAKEMNIALLAKLGWRVLNTHDDLWVQILRKKFRVGEIHESSWLV  1363

Query  378   PKRNSSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             PK   S  W+ I+  +      G  W + +GR  RFW D+WL+  PL   ++  I    L
Sbjct  1364  PKGTWSPTWRSIILGVGECVVPGTCWILGDGRRVRFWKDNWLMQEPLQSLSTVDIPEELL  1423

Query  201   NNLVANYWISNEGWDWDMLDRVLP-EHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
                  + W S  GW    ++  +  EH L  L++ V+ + T   DR+ W    +GLFSV 
Sbjct  1424  EAKARDLWQSGRGWLIQCIEPYISMEHRLC-LASVVIDDVTGARDRMSWGGSKDGLFSVK  1482

Query  24    SAYEL  10
             SAY L
Sbjct  1483  SAYAL  1487


 Score =   144 bits (363),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 110/196 (56%), Gaps = 0/196 (0%)
 Frame = -3

Query  4443  PVIRVTKEEKIRLRRPWRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFI  4264
             P I +  E    +   W++ +++RVLGR+V  + L ++L+ +W  +    ++ L   FF+
Sbjct  61    PSITIENEVLEAMNGMWKQCMVVRVLGRNVPITALSRKLRELWNPKGSMYVMDLPRQFFM  120

Query  4263  AKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDD  4084
              +FE   +Y     GGPW     YL+ + W P FDP  + +     W+R  ++P+ ++  
Sbjct  121   VRFEKEDEYLEALTGGPWRAFGSYLMVRAWSPEFDPLRDDIVTTPVWIRLTNIPVNFYHR  180

Query  4083  DFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKEYEGIH  3904
               L  I K +G+P+++D TT    + ++AR+CV++++ KPL    +ING  +   YEG+ 
Sbjct  181   SILMGIAKGLGKPIRVDQTTLKFERARYARICVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  3903  QICFKCSIYGHRMETC  3856
             +IC KC IYGH +  C
Sbjct  241   EICSKCGIYGHLVHGC  256



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score =   381 bits (978),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/592 (38%), Positives = 313/592 (53%), Gaps = 67/592 (11%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN QGA S SF  +LK  +RLH+P ++ L E  +   +A +I S L +    RV+A G+S
Sbjct  20    WNVQGAGSNSFAASLKELVRLHRPEVLALVETHMGGDRAQQIASILKYSGHTRVDARGFS  79

Query  2888  GGIWLFCSV-SINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GGIW++    ++ I+ +  H Q+I   +      PW  + VY   D   R  L+ +L  +
Sbjct  80    GGIWIYWHTENVTIDPIRQHNQYITMDIKKRDEQPWYFTAVYASPDPTRRHDLWRELKEF  139

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                    WL  GDFN     SE +   + +  R   FNDW+   +L+++ F G+SYTW R
Sbjct  140   AAQNNKPWLIAGDFNETRFPSERNTSCSETTRRSARFNDWVDEMDLLEIEFVGASYTWSR  199

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITT-CPQQFCSSRF  2355
             GL   + + ARLDRA  N E  L+   A+V HLP I SDH PLLIS     P    +  F
Sbjct  200   GLSPETRQCARLDRAFCNPEWGLQCSQARVKHLPAIASDHCPLLISPNGFVPLPSLNKPF  259

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLE  2175
             +F   W  H  FQ  VQS W+    + ++  ++ EAL  W+RD F NI Q+KR LLAR+E
Sbjct  260   RFQAMWLHHEKFQEFVQSKWKHSEPIMSSLHSLSEALQDWNRDVFKNIFQRKRLLLARIE  319

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
             GVQ ++       L++LE +LR+ELE+ L +EE  WFQ+SR  W+K GD           
Sbjct  320   GVQKNIGFSTHRGLIKLESKLRRELEDVLQEEETYWFQKSRITWLKDGD-----------  368

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
                             HL+ DD                                      
Sbjct  369   ----------------HLLPDD--------------------------------------  374

Query  1814  WASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
             W+ +  P+   +I+  +  +   KA GPDGF P FF K W  V   +   V +  E   L
Sbjct  375   WSRLTKPYNKLEIEEVVHSLGALKAPGPDGFQPLFFQKNWDLVKDDVTKAVTQALEGKGL  434

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
             P   N+T ++L+PKV NPE   QFRPIGLCNV+YK++TKV++ R+K ++ +L+   Q SF
Sbjct  435   PEKMNETFIALLPKVDNPETAAQFRPIGLCNVIYKVVTKVLVNRIKPVLPRLISNTQGSF  494

Query  1454  VHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             V GRQITDN +  QE+++  + K+GR G+MA+K+D EKAYDRL W FI DTL
Sbjct  495   VPGRQITDNIIIMQEVIHTMKRKQGRKGFMAIKIDFEKAYDRLRWKFIRDTL  546


 Score =   287 bits (734),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 233/421 (55%), Gaps = 4/421 (1%)
 Frame = -3

Query  1272  IRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSG  1093
             +  IM CV S  +  LWNG+ TD  SP +G+RQGDP+SP LFV+C ERL   ++ ++ + 
Sbjct  556   VDTIMECVCSASMRVLWNGEPTDSFSPSRGIRQGDPLSPYLFVMCMERLYQTIEEAIIAK  615

Query  1092  NWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLF  913
              WK +  +R  P++S+LFFADD+V F EA+  QA  ++  L  FC  SGQK++L KS ++
Sbjct  616   KWKPIHASRNGPSLSNLFFADDIVLFAEASIDQAQVIQDVLRRFCKASGQKLSLPKSRIY  675

Query  912   FSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssr  733
             FS+N        I   +GI    D    LG+P+   R+ +++ + + E+I  RL+G  ++
Sbjct  676   FSQNVLPEVPAQICDAIGIGGTTD----LGMPTFTSRISRETLNFLCEKIDRRLAGRKTK  731

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWG  553
              LSLAG   + +S +S++ YYSM++  IP  V D I+R  R F+WG  E   K HL+ W 
Sbjct  732   YLSLAGRITLAKSTVSSLAYYSMQTAKIPKTVCDDIDRKTRRFVWGGNEDTKKVHLIAWD  791

Query  552   IVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK  373
              +   K  GGLG+ S  H N AF+AKL WRL  + N LW+ + + KY         +QPK
Sbjct  792   ALQRPKDQGGLGLHSASHANKAFMAKLGWRLLTEPNALWSRVLRTKYCKGRCDSDMFQPK  851

Query  372   RNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNL  193
               +SN W  I +  +I   GI+  + NG  T FW   W+ + PL +  + P         
Sbjct  852   TGASNVWNRIAENSNILCEGIRSAIGNGIKTLFWDHKWMSNTPLIDCVTQPPPTEIAGAT  911

Query  192   VANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYE  13
             V+  W S  GW W++    L E  L  +   V+ +D  + D L W  +P G FS+ SA  
Sbjct  912   VSEMWESGGGWKWEVFSPYLSEDSLKLIQAHVVIDDPEVEDLLYWDGDPKGKFSIKSAIR  971

Query  12    L  10
             +
Sbjct  972   I  972



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score =   363 bits (931),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/433 (43%), Positives = 268/433 (62%), Gaps = 2/433 (0%)
 Frame = -1

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             LID+GF+G+ +TW RG    +F   RLDR L   +  L++ +A+VTHLP + SDH+PL +
Sbjct  3     LIDMGFSGNQFTWKRGKSASTFVAKRLDRVLCCAQSRLKWQEARVTHLPFLASDHAPLYL  62

Query  2396  SITTCPQ-QFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSF  2220
              +T   Q   C   F+F  AW  H  FQ  +   W  D+D       +   L  W+++ F
Sbjct  63    QLTPEVQGNACRRPFRFEAAWLQHSEFQELLTVSWDRDIDTREALVRLGLKLKKWNKEVF  122

Query  2219  GNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWI  2040
             GN+ Q+K +L+  ++ +Q  +   +  +L+  E  L KE E  L QEE+IWFQ+SR++W+
Sbjct  123   GNVQQRKEKLVTEIKEIQEKIEEDLSDELLVKEGELLKEFEIVLEQEEVIWFQKSRKKWV  182

Query  2039  KSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVN  1863
               GD+NT+F+ ++T ++R ++RV  L +     + D   L K   +YF  L++ E VD  
Sbjct  183   AHGDKNTKFFHMSTVIRRRRNRVEMLRNDANQWLTDAKELEKLAVNYFKTLYSLENVDTE  242

Query  1862  RTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVG  1683
               +     F  L  ++  S+N PF+ E+++ A+  M   KA GPDGF P F+ + W TVG
Sbjct  243   VQSLPMSGFVRLTSQEHTSLNRPFSAEEVEIAVRKMGSFKAPGPDGFQPVFYQRCWETVG  302

Query  1682  TSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIR  1503
              S+ SF+ RFFE G LP   ND ++ LIPKV  PE ITQFRPI LCNV++K+ITK M+ R
Sbjct  303   PSVISFILRFFEVGKLPENTNDALVVLIPKVSKPESITQFRPISLCNVLFKIITKAMVGR  362

Query  1502  LKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLS  1323
             LK +++KL+GP QSSF+ GR   DN +  QE +++ R KKG+ GWM LK+DLEKAYDRL 
Sbjct  363   LKGVMKKLIGPAQSSFIPGRLSADNIVVVQEAVHSMRKKKGQKGWMLLKLDLEKAYDRLR  422

Query  1322  WCFIEDTLRDIGF  1284
             W F+EDTLR  G 
Sbjct  423   WDFLEDTLRAAGL  435


 Score =   302 bits (773),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/427 (40%), Positives = 247/427 (58%), Gaps = 13/427 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV+ P +  LWNG+ TD   P +GLRQGDP+SP L VLC  RL HM+D +V  
Sbjct  439   WVGRIMECVSGPSMSILWNGEKTDSFKPSRGLRQGDPLSPYLLVLCMGRLCHMIDRAVMD  498

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK +K++R  P ++H+ FADDL+ F EA+  Q   ++  L+ FC  SGQK++L KS +
Sbjct  499   KKWKPIKLSRGGPQLTHICFADDLILFAEASVSQVRVIRDVLETFCRASGQKVSLPKSKI  558

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS N      + I+   GI S  ++GK+LG+P +  R+ K++F  +LE++ +RLSG   
Sbjct  559   FFSGNVTRERGELISRESGISSTRELGKYLGMPILQKRINKETFGEVLEKVASRLSGWKK  618

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLSLAG   M ++VLS+IP +SM +  +P   +D ++ L R F+WGS +     HL+ W
Sbjct  619   QTLSLAGRVTMTKAVLSSIPVHSMSTIHMPVSTLDKLDSLSRSFVWGSGQ-----HLISW  673

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ-  379
               V   KA+GGLGI+  + MN A LAK+ WRL  D   LW  + ++KY       SSW  
Sbjct  674   DRVCRPKADGGLGIRVSRDMNKALLAKVGWRLLNDKEGLWARVLRSKYSVGDMHDSSWMV  733

Query  378   PKRNSSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
                N S+ W+ ++  +  +   G  W + NGR  +FW D WL  +PL  E    + P   
Sbjct  734   AGSNVSSTWRSVVMGIREVVAKGHSWVIGNGREIKFWTDKWLSRQPLMGEVLGDL-PEGY  792

Query  201   NNLVA-NYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFS  31
              N+ A   W+   GWD   +   +P+    +L    +  DT+ G  DRL W + PNG F+
Sbjct  793   ENITARELWLDGGGWDLSRISPYIPDE--RRLERVAVVVDTVSGVKDRLAWGEVPNGQFT  850

Query  30    VSSAYEL  10
             V +AY+L
Sbjct  851   VKTAYDL  857



>ref|XP_008341993.1| PREDICTED: uncharacterized protein LOC103404803 [Malus domestica]
Length=1433

 Score =   361 bits (927),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 215/596 (36%), Positives = 314/596 (53%), Gaps = 8/596 (1%)
 Frame = -1

Query  3059  QGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGI  2880
             +GA    F  T K  +RL+K ++  + EP+IS  +A E+   LGF  +  V+A G+SGG+
Sbjct  134   EGAGGKPFSVTAKDLVRLNKVNIFAILEPRISGERAIEVIKGLGFSNYYVVDANGFSGGV  193

Query  2879  WLFCSVSI-NIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFN  2703
             WL  +  +  + ++    Q I   V D     W+++VVY      +R HL+  L      
Sbjct  194   WLLWNNEVVKLTVVACSSQTITAVVLDG-QTQWMLTVVYASPCPRVRSHLWPYLDGVSAA  252

Query  2702  PQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLD  2523
                 WL  GDFN +   SE   K    +++ +   +WI    L+DLGF G+ +TW +  +
Sbjct  253   SNMPWLIAGDFNELIHSSE--KKGGRPVNKNSGLGNWISRNSLVDLGFIGAKFTWSKKNE  310

Query  2522  TPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITT--CPQQFCSSRFKF  2349
                    RLDR L N+     + +A V HL  + SDH PLLI + +   P     + F+F
Sbjct  311   YGDIVWERLDRGLCNIAWRHLYSEAYVRHLAKVNSDHCPLLIGLXSXHIPXPDLKA-FRF  369

Query  2348  NMAWTTHYSFQACVQSVWRS-DLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
                W  H  F+  V   W S   D S     +  AL  W+ + FG I QKKRR LAR+ G
Sbjct  370   QAMWMLHQEFEXFVNDTWNSAQGDASCKSITLSSALQSWNHNVFGCIFQKKRRXLARICG  429

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
             +Q +L +     L  LE +L  E    L QEEL W Q+SR  W++ GD+NT+F+ ++  V
Sbjct  430   IQKALCVRHVPYLFALENQLTNEYNTILEQEELFWLQKSRNTWLREGDKNTKFFHLSAVV  489

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++++    +++G    +   L   V +YF  LF+  +           FP L  ED 
Sbjct  490   RRRKNKLEGXNNSEGVWTBEKENLKSIVVNYFKDLFSFRITTTXMESLPHLFPCLSGEDL  549

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
             A +N   T ++IK  +F +   KA GPDG    F+ K W   G  +   V   F    LP
Sbjct  550   AILNGEVTDDEIKDCMFAIGGLKAPGPDGIXARFYQKFWHLCGKDISDMVKVCFNSTQLP  609

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
                N+T +SLIPKV NP  +TQ RPI LC+ +YK+I+K+++ +L+ +  KLV P Q SFV
Sbjct  610   DNINNTFISLIPKVDNPTSMTQLRPISLCSTLYKVISKILVGKLRPLXHKLVSPTQVSFV  669

Query  1451  HGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              GRQI D  +  QEIL+ +R  KG+ G++A K+DL KAYDRL W FI D L +IG 
Sbjct  670   PGRQIIDXVIVAQEILHKYRNTKGKKGFIAWKIDLSKAYDRLQWSFIRDVLWEIGL  725


 Score =   297 bits (761),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 166/388 (43%), Positives = 233/388 (60%), Gaps = 6/388 (2%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CVT+ +  A+ NG++TD  SP  G+RQGDP+SP LFVLC E+L H++   + +  WK
Sbjct  733   IMQCVTTVKYQAIVNGEITDSFSPHCGIRQGDPLSPYLFVLCMEKLXHIIXGCITTKKWK  792

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              VK+ R  P++SHLFFADDL+ F EA+S QA  +K CLD+FC  SGQ++N  KS ++ S 
Sbjct  793   PVKLXRNGPSVSHLFFADDLILFAEASSTQARILKDCLDIFCDVSGQQVNFDKSCIYCSP  852

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N +      IA   G P   D+G +LG+P +H R+ K+++ NI+E+++ RLS   S TLS
Sbjct  853   NISRSKAXEIANICGSPLTSDLGHYLGVPLLHSRVNKETYGNIVEKVQRRLSAWKSNTLS  912

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V +QSV SAIP YSM+ST +   + D I++L R FLWG  E  +K HLVKW  V 
Sbjct  913   MAGRLVYLQSVXSAIPIYSMQSTRLXISICDKIDKLNRNFLWGHTEENSKVHLVKWETVC  972

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK-RN  367
               K  GGLG+K    MN A LAK  W+L Q  +  W  + K KY       S+   K  N
Sbjct  973   TPKFMGGLGLKDTHVMNQALLAKTXWKLMQRDSGJWAQVLKGKYLKHYDXVSACSAKYTN  1032

Query  366   SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVA  187
              S+ W GIL    I  NG++W V +G    FW D+WL    L +  +  ++   L+  V 
Sbjct  1033  CSHTWXGILFGAQILPNGMRWRVGSGSQIHFWKDNWLECGVLXDFXTISLSDDMLDXTVE  1092

Query  186   NYWISNEGWDWDMLDRVLP----EHILN  115
             ++ +++ GW+ D+L   LP    EHI +
Sbjct  1093  DF-LTBSGWNVDLLYSCLPPDVVEHIFS  1119



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score =   335 bits (860),  Expect(2) = 3e-171, Method: Compositional matrix adjust.
 Identities = 192/540 (36%), Positives = 296/540 (55%), Gaps = 38/540 (7%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFC-SVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHL  2733
             ++AVG SGGIWL     +  I I+ +  Q+I  +V        +++V Y    ++ R  L
Sbjct  515   IDAVGQSGGIWLLWRDQACAITIVGSSDQYIHARVVIGTELIHIIAV-YAAPTVSRRSGL  573

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             +  L                                  +   D ++ + +  L+D+GF G
Sbjct  574   WGQLK---------------------------------AVLEDIDEPVLVA-LVDMGFKG  599

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQ  2373
             S++TW RG ++ +F   RLDR L N +  +R+ +A V+HL  + SDH+P+ + +    + 
Sbjct  600   STFTWRRGKESHNFVAKRLDRVLCNAQTRVRWQEAVVSHLLFLASDHTPIYVQLEPVRKG  659

Query  2372  FCSSR-FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                 R F+F  AW  H  F+  + + W  ++       ++ E L  W+++ FGN+  +K 
Sbjct  660   NPRRRPFRFEAAWLKHDGFKELLLASWNGEMSTPEALVSLKEKLKKWNKEIFGNVTIRKE  719

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             +LL  ++ +Q  L       L+  E  L+KE +  L QEE++W+Q+SRE+WI  GDRNT+
Sbjct  720   KLLGEIKEIQEELERNPNDMLIARETVLQKEFDIVLEQEEVLWYQKSREKWIVLGDRNTK  779

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGC  1839
             FY   T V+R ++R+  L D +G  I     L K   +Y+  L++T+ + ++        
Sbjct  780   FYHTTTIVRRKRNRIEMLKDENGRWIEQSEELEKLAIEYYKRLYSTQDISMDTDKLPQQG  839

Query  1838  FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
             F  L  ++   +  PF+  D++ +   M   KA GPDGF P F+  +W  VG S+  F  
Sbjct  840   FTDLKSDELECLIKPFSAADMEASARSMGKYKAPGPDGFQPVFYQDSWDVVGESVARFGL  899

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
              FFE G L  G ND ++ LIPKV  PERI QFRPI LCNV++K+ITK M++RLK ++  L
Sbjct  900   EFFESGKLTEGMNDAMVVLIPKVLKPERIAQFRPISLCNVLFKIITKAMVLRLKSLMPVL  959

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             +GP Q+SF+ GR  TDN +  QE +++ R KKGR GWM LK+DLEKAYDR+ W F+EDTL
Sbjct  960   IGPAQASFIPGRLSTDNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRIRWDFLEDTL  1019


 Score =   298 bits (762),  Expect(2) = 3e-171, Method: Compositional matrix adjust.
 Identities = 165/426 (39%), Positives = 255/426 (60%), Gaps = 10/426 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV +P +  LWNG+ T+  +P++GLRQGDP+SP LFVLC ERL H+++ SV  
Sbjct  1028  WIKWIMECVMNPGMSLLWNGERTEAFTPQRGLRQGDPLSPYLFVLCMERLCHLIEFSVAK  1087

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK ++++R  P++SH+ FADDL+ F EA+  Q   ++K L+ FC  SGQK++L+KS +
Sbjct  1088  KEWKPIRLSRGGPSLSHICFADDLILFAEASISQIRVIRKVLESFCGASGQKVSLEKSLI  1147

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS+N +      I+   GI    D+GK+LG+P +  R+ K++F  ++E++ ++L+G   
Sbjct  1148  FFSENVHRDLASAISHESGIKGTKDLGKYLGMPVLQKRINKETFGAVIEKVSSKLAGWKR  1207

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LSLAG   + +SVLS++P ++M +  +PS  ++ ++++ R F+WGS +G  K HLV W
Sbjct  1208  RFLSLAGRITLTKSVLSSVPVHTMSTIALPSSTLNQLDKIARAFIWGSIDGTRKQHLVSW  1267

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW-Q  379
               +   K  GGLGI+  K MN+A LAKL WR+    + LW N+   K+       +SW  
Sbjct  1268  EKICKPKREGGLGIRLAKEMNVALLAKLGWRMLNTEDGLWVNILCKKFRVGELDDASWLV  1327

Query  378   PKRNSSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             P+   S  W+ ++  +  +   G+ W + +GR  RFW D WLL  PL E  S    P  L
Sbjct  1328  PQGRWSPTWRSLVMGIREVVAPGVSWILGDGRRVRFWRDRWLLKEPL-EALSLIDIPEEL  1386

Query  201   NNL-VANYWISNEGWDWDMLDRVLPEHILN---KLSTFVLQEDTLLGDRLVWYKEPNGLF  34
                   + W    GW   +L ++ P   L    +L++ V+ E T   DR+ W +  +GLF
Sbjct  1387  EEAKTRDLWQQGIGW---ILQQIEPYTSLQNRLQLASLVIDEVTGARDRMSWGEAKDGLF  1443

Query  33    SVSSAY  16
             SV +AY
Sbjct  1444  SVKAAY  1449


 Score =   149 bits (376),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 123/229 (54%), Gaps = 1/229 (0%)
 Frame = -3

Query  4443  PVIRVTKEEKIRLRRPWRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFI  4264
             P I +  E    +   W++ +I+RVLGR+V    L ++L+ +W  +    ++ L   FF+
Sbjct  61    PSITIENEVLEAMNGMWKQCMIVRVLGRNVPIVALNRKLRELWNPKGAMYVMDLPRQFFM  120

Query  4263  AKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDD  4084
              +FE   +Y A   GGPW     YL+ + W P FDP  + +     W+R  ++P+ ++  
Sbjct  121   VRFEKEEEYLAALTGGPWRAFGSYLMVRAWSPEFDPLRDDIVTTPVWIRLTNIPVNFYHR  180

Query  4083  DFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKEYEGIH  3904
               L  I K +G+P+++D TT    + +FARVCV++++ KPL    +ING  +   YEG+ 
Sbjct  181   SILMGIAKGLGKPIRVDSTTLNFERARFARVCVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  3903  QICFKCSIYGHRMETCGLSVPIPAAS-VDGTAGTSSTTGIDIPLPKPKE  3760
             +IC +C IYGH +  C  ++   AAS    T  T      ++  P+ +E
Sbjct  241   EICPRCGIYGHLIHGCPRTLAERAASPTTQTVATRKVETANLQAPQLQE  289



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score =   315 bits (806),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 170/424 (40%), Positives = 251/424 (59%), Gaps = 2/424 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   IM  VT P +  LWNG+ TD   P +GLRQGDP+SP LFVLC ERL H++++SV  
Sbjct  465   WTSRIMAGVTDPSMSVLWNGERTDSFVPARGLRQGDPLSPYLFVLCLERLCHLIEASVGK  524

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK + V+     +SH+ FADDL+ F EA+  Q   +++ L+ FC  SGQK++L+KS +
Sbjct  525   REWKPIAVSCGGSKLSHVCFADDLILFAEASVAQIRIIRRVLERFCEASGQKVSLEKSKI  584

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS N +   +Q I+   GI    ++GK+LG+P +  R+ K++F  +LER+ ARL+G   
Sbjct  585   FFSHNVSREMEQLISEESGIGCTKELGKYLGMPILQKRMNKETFGEVLERVSARLAGWKG  644

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R+LSLAG   + ++VLS+IP + M + L+P   +D+++R  R FLWGS   K K HL+ W
Sbjct  645   RSLSLAGRITLTKAVLSSIPVHVMSAILLPVSTLDTLDRYSRTFLWGSTMEKKKQHLLSW  704

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW-Q  379
               +   KA GG+G++S + MN A +AK+ WRL QD   LW  + + KY       +SW +
Sbjct  705   RKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKESLWARVVRKKYKVGGVQDTSWLK  764

Query  378   PKRNSSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             P+   S+ W+ +   L  +   G+ W   +G   RFWLD WLL  PL E  +  I     
Sbjct  765   PQPRWSSTWRSVAVGLREVVVKGVGWVPGDGCTIRFWLDRWLLQEPLVELGTDMIPEGER  824

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
               + A+YW+   GW+ ++L   LPE +  +L + V+Q     GD + W    +G F+V S
Sbjct  825   IKVAADYWLPGSGWNLEILGLYLPETVKRRLLSVVVQVFLGNGDEISWKGTQDGAFTVRS  884

Query  21    AYEL  10
             AY L
Sbjct  885   AYSL  888


 Score =   305 bits (782),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 183/500 (37%), Positives = 267/500 (53%), Gaps = 42/500 (8%)
 Frame = -1

Query  2774  VVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFND  2595
             VVY    ++ R  L+ +L       +G  L  GDFN++    E              F D
Sbjct  5     VVYAAPSVSRRSGLWGELKDVVNGLEGPLLIGGDFNTILWVDERMGGNGRLSPDSLAFGD  64

Query  2594  WIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSD  2415
             WI    LIDLGF G+ +TW RG    +    RLDR        L++ +A V+HLP + SD
Sbjct  65    WINELSLIDLGFKGNKFTWRRGRQESTVVAKRLDRVFVCAHARLKWQEAVVSHLPFMASD  124

Query  2414  HSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVW  2235
             H+PL + +    Q+                                          L  W
Sbjct  125   HAPLYVQLEPLQQR-----------------------------------------KLRKW  143

Query  2234  SRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRS  2055
             +R+ FG+I  +K +L+A ++ VQ  L + +  DL+  E  L KE++  L QEE +WFQ+S
Sbjct  144   NREVFGDIHVRKEKLVADIKEVQDLLGVVLSDDLLAKEEVLLKEMDLVLEQEETLWFQKS  203

Query  2054  REEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE  1875
             RE++I+ GDRNT F+  +T ++R ++R+  L   D   + D   L      Y+  L++ E
Sbjct  204   REKYIELGDRNTTFFHTSTIIRRRRNRIESLKGDDDRWVTDKVELEAMALTYYKRLYSLE  263

Query  1874  -VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKT  1698
              V   R     G F  + E + A++   FT  ++ +A+  M   KA GPDG+ P F+ + 
Sbjct  264   DVSEVRNMLPTGGFASISEAEKAALLQAFTKAEVVSAVKSMGRFKAPGPDGYQPVFYQQC  323

Query  1697  WPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITK  1518
             W TVG S+  FV  FFE G+LP   ND +L LI KV  PERI QFRP+ LCNV++K+ITK
Sbjct  324   WETVGPSVTRFVLEFFETGVLPASTNDALLVLIAKVAKPERIQQFRPVSLCNVLFKIITK  383

Query  1517  VMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKA  1338
             +M+ RLK+++ KL+GP Q+SF+ GR   DN +  QE +++ R KKGR GWM LK+DLEKA
Sbjct  384   MMVTRLKNVISKLIGPAQASFIPGRLSIDNIVLVQEAVHSMRRKKGRKGWMLLKLDLEKA  443

Query  1337  YDRLSWCFIEDTLRDIGFNH  1278
             YDR+ W F+++TL   G + 
Sbjct  444   YDRVRWDFLQETLEAAGLSE  463



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score =   309 bits (792),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 252/424 (59%), Gaps = 2/424 (0%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI+ IM CVT+P +  LWNG+ T+   P++GLRQGDP+SP LFVLC ERL H ++ +V
Sbjct  463   PVWIKWIMECVTNPGMSLLWNGERTEAFKPQRGLRQGDPLSPYLFVLCMERLCHQIEFAV  522

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
                +WK +K++R  P +SH+ FADDL+ F EA+  Q   ++K L+ FC  SGQK++L+KS
Sbjct  523   AKEDWKPIKLSRGGPALSHICFADDLILFAEASVSQVRVIRKVLENFCEASGQKVSLEKS  582

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
              +FFS+N +      I+   GI    ++GK+LG+P +  ++ K++F  ++E++ ++L+G 
Sbjct  583   VIFFSENVHRDLATLISNESGIKGTKELGKYLGMPVLQKKINKETFGEVVEKVSSKLAGW  642

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
               + LSLAG   + +SV+S+IP ++M +  +P+  +  ++++ R F+WGS EG  K HL+
Sbjct  643   KRKFLSLAGRITLTKSVISSIPVHTMSTIALPASTLGQLDKIARSFIWGSSEGNRKQHLI  702

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K  GGLGI+  K MN+A L KL WRL    + LW  + + K+         W
Sbjct  703   AWEKICTPKREGGLGIRKAKEMNVALLGKLGWRLLNTHDALWVRILQKKFRVGELYDPCW  762

Query  381   QPKR-NSSNAWKG-ILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
                R N S  W+  IL    +   G  W + +GR  RFW D+WLLD+PL+E ++A I   
Sbjct  763   MVSRGNWSPTWRSLILGIREVVVPGTCWILGDGRRVRFWRDNWLLDQPLYELSTADIPEE  822

Query  207   SLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
              +     + W    GW   +++  +  H   +L++ V+ E T   DR+ W    +G FSV
Sbjct  823   IIEAKARDLWQHGTGWLTQLMEPYMSTHNSLRLASVVIDEVTGARDRMSWSGSNDGQFSV  882

Query  27    SSAY  16
              SAY
Sbjct  883   KSAY  886


 Score =   298 bits (764),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 176/495 (36%), Positives = 262/495 (53%), Gaps = 42/495 (8%)
 Frame = -1

Query  2780  MSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDF  2601
             +  VY    ++ R  L+  L     N     +  GDFN++    E +            F
Sbjct  3     LVAVYAAPTVSRRSGLWGQLKRVLENIDEPVMVGGDFNTILRLDERTGGNGRLSPDSLAF  62

Query  2600  NDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIG  2421
              DWI    L+D+GF G+++TW RG +T +F   RLDR   N +  +R+ +A V+      
Sbjct  63    GDWINELALVDMGFRGNTFTWRRGKETQNFVAKRLDRVFCNAQARVRWQEAVVS------  116

Query  2420  SDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALS  2241
                                           H  F A   +     L+    +        
Sbjct  117   ------------------------------HLPFLASDHAPVYVQLEPEKKEKLKKWNKE  146

Query  2240  VWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQ  2061
             +     FGN+ ++K +LL  ++ +Q  L    R DL+  E  L+KEL+  L QEE++W+Q
Sbjct  147   I-----FGNVMKRKEKLLGEIKDIQEKLEQNPRDDLLLRESVLQKELDVALEQEEVLWYQ  201

Query  2060  RSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT  1881
             +SRE+W+  GDRNT++Y  +T V+R ++R+  L D DG  I     L K    Y+  L++
Sbjct  202   KSREKWVVLGDRNTKYYHTSTIVRRKRNRIEMLRDEDGRWIDQSEELEKLAISYYKRLYS  261

Query  1880  TE-VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFH  1704
             TE ++++        F     E+   ++ PF+  +I+ ++  M   KA GPDGF P F+ 
Sbjct  262   TEDLNLDTRKLPQQGFTGFTREEVQILDEPFSEVEIEASVKSMGKFKAPGPDGFQPVFYQ  321

Query  1703  KTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLI  1524
              +W  VG S+  F   FFE G+L  G ND ++ LIPKV  PERI QFRPI LCNV++K+I
Sbjct  322   DSWEVVGASVTRFGLEFFESGVLTEGMNDALVVLIPKVLKPERIMQFRPISLCNVLFKII  381

Query  1523  TKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLE  1344
             TK M++RLK ++ KL+GP Q+SF+ GR  +DN +  QE +++ R KKGR GWM LK+DLE
Sbjct  382   TKTMVLRLKKLMSKLIGPSQASFIPGRLSSDNIVIVQEAVHSMRRKKGRRGWMLLKLDLE  441

Query  1343  KAYDRLSWCFIEDTL  1299
             KAYDR+ W F+EDTL
Sbjct  442   KAYDRIRWDFLEDTL  456



>emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana]
 emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana]
Length=929

 Score =   314 bits (804),  Expect(2) = 9e-162, Method: Compositional matrix adjust.
 Identities = 170/434 (39%), Positives = 253/434 (58%), Gaps = 23/434 (5%)
 Frame = -1

Query  2567  LGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISIT  2388
             +GF G+ +TW RGL   +F   RLDR L      L++ +A +                  
Sbjct  1     MGFKGNRFTWRRGLVESTFVAKRLDRVLFCAHARLKWQEALL------------------  42

Query  2387  TCPQQFCSSR---FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFG  2217
              CP Q   +R   F+F  AW +H  F+  + + W + L      + +   L  W+++ FG
Sbjct  43    -CPAQNVDARRRPFRFEAAWLSHEGFKELLTASWDTGLSTPVALNRLRWQLKKWNKEVFG  101

Query  2216  NIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIK  2037
             NI  +K ++++ L+ VQ  L +    DL+  E  L KE +  L+QEE +WFQ+SRE+ + 
Sbjct  102   NIHVRKEKVVSDLKAVQDLLEVVQTDDLLMKEDTLLKEFDVLLHQEETLWFQKSREKLLA  161

Query  2036  SGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNR  1860
              GDRNT F+  +T ++R ++R+  L D++   + +   L K   DY+  L++ E V V R
Sbjct  162   LGDRNTTFFHTSTVIRRRRNRIEMLKDSEDRWVTEKEALEKLAMDYYRKLYSLEDVSVVR  221

Query  1859  TNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGT  1680
                    FP L  E+  ++N PFT +++  A+  M   KA GPDG+ P F+ + W TVG 
Sbjct  222   GTLPTEGFPRLTREEKNNLNRPFTRDEVVVAVRSMGRFKAPGPDGYQPVFYQQCWETVGE  281

Query  1679  SLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRL  1500
             S+  FV  FFE G+LP   ND +L L+ KV  PERITQFRP+ LCNV++K+ITK+M+IRL
Sbjct  282   SVSKFVMEFFESGVLPKSTNDVLLVLLAKVAKPERITQFRPVSLCNVLFKIITKMMVIRL  341

Query  1499  KDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSW  1320
             K+++ KL+GP Q+SF+ GR   DN +  QE +++ R KKGR GWM LK+DLEKAYDR+ W
Sbjct  342   KNVISKLIGPAQASFIPGRLSFDNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRIRW  401

Query  1319  CFIEDTLRDIGFNH  1278
              F+ +TL   G + 
Sbjct  402   DFLAETLEAAGLSE  415


 Score =   287 bits (735),  Expect(2) = 9e-162, Method: Compositional matrix adjust.
 Identities = 166/423 (39%), Positives = 240/423 (57%), Gaps = 34/423 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV  P +  LWNG+ TD  +P +GLRQGDPISP LFVLC ERL H ++++V  
Sbjct  417   WIKRIMECVAGPEMSLLWNGEKTDSFTPERGLRQGDPISPYLFVLCIERLCHQIETAVGR  476

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+WK + +++  P +SH+ FADDL+ F EA+                   QK++L+KS +
Sbjct  477   GDWKSISISQGGPKVSHVCFADDLILFAEAS-----------------VAQKVSLEKSKI  519

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS N +   +  I A  GI S  ++GK+LG+P +  R+ KD+F  +LER+ +RLSG  S
Sbjct  520   FFSNNVSRDLEGLITAETGIGSTRELGKYLGMPVLQKRINKDTFGEVLERVSSRLSGWKS  579

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R+LSLAG   + ++VL +IP ++M S L+P+ +++ ++++ R FLWGS   K K HL+ W
Sbjct  580   RSLSLAGRITLTKAVLMSIPIHTMSSILLPASLLEQLDKVSRNFLWGSTVEKRKQHLLSW  639

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW-Q  379
               V   KA GGLG+++ K MN A LAK+ WRL  D   LW  + + KY       SSW  
Sbjct  640   KKVCRPKAAGGLGLRASKDMNRALLAKVGWRLLNDKVSLWARVLRRKYKVTDVHDSSWLV  699

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             PK   S+ W+ I   L   R G+                W+L  PL   A+  ++P  LN
Sbjct  700   PKATWSSTWRSIGVGL---REGVA-------------KGWILHEPLCTRATCLLSPEELN  743

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V  +W    GWD   L + LP  + ++L   V++    L DR+ W    +G F+V SA
Sbjct  744   ARVEEFWTEGVGWDMVKLGQCLPRSVTDRLHAVVIKGVLGLRDRISWQGTSDGDFTVGSA  803

Query  18    YEL  10
             Y L
Sbjct  804   YVL  806



>emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1363

 Score =   316 bits (809),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 214/604 (35%), Positives = 315/604 (52%), Gaps = 16/604 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN +GA S +F       +++HKP L+ L E K S  +A++    LG+  +  + A G  
Sbjct  6     WNVRGANSKAFLWHALDLVKMHKPDLLILLETKCSSLRADQATKRLGYVNFRIIPAFGKR  65

Query  2888  GGIWLFCSVSINIEIL--YTHPQFIA-FQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS  2718
             GGIWL     I +     Y    F A F++  ++    L++ ++    ++ R   + DL+
Sbjct  66    GGIWLMWKADIALVHYADYQPNHFHALFKLRSDIPEV-LLTGMHAPSVVSERNKYWVDLT  124

Query  2717  *YFFNPQGT-WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
                  P+GT WL  GD N V   +E          +     DWI    L+DLGF G  +T
Sbjct  125   -EDSPPRGTPWLVAGDMNEVLHGNEKMGGRQVGKEQGKQCKDWIAANALLDLGFQGPKFT  183

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSS  2361
             W  G    S    RLDRAL N E    FPD KV HLP   SDH PLLI     P+   S 
Sbjct  184   WTNGRTGGSLIKERLDRALVNSEWLDLFPDTKVIHLPRTFSDHCPLLILFNENPRS-ESF  242

Query  2360  RFKFNMAWTTHYSFQACVQSVWRSDLD-LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLA  2184
              F+    W  H  F   ++  W S  +     +   + ++  WS+  FG+I QKK+R+LA
Sbjct  243   PFRCKEVWAYHPDFTNVIEETWGSHHNSYVAARDLFLSSVKSWSKYVFGSIFQKKKRILA  302

Query  2183  RLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQV  2004
             RL G+Q SLS+     L +LE  L  EL E   QE + W Q++  +  K GD NT+++  
Sbjct  303   RLGGIQKSLSIHPSVFLSKLEIDLLVELNELSKQERVFWAQKAGIDRAKLGDMNTKYFHT  362

Query  2003  ATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTN--FCYGCFPP  1830
                ++  + ++S L + +   + ++  L K +  +F  +FTT +  ++ N  F   C   
Sbjct  363   LAKIRTCKRKISCLKNDNHDWVSNNEDLKKMMMSHFEKIFTTSMYSHQRNNSFRGEC---  419

Query  1829  LLEEDWASVNAPFTPED-IKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRF  1653
              + ++W    A    ED IK AL  M P K+ GPDG    FF K W  +G S+ S + R 
Sbjct  420   RISDEWNKRLARRVEEDEIKEALAQMAPLKSPGPDGIQAFFFKKYWEQMGPSVVSLIIRA  479

Query  1652  FEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVG  1473
             FE+  +P G +D+ L+LIPK+++P     FRPIGLCN VYK+ITKV+  R+K ++ +L+ 
Sbjct  480   FENNRIPSGLSDSFLALIPKIESPVCCKDFRPIGLCNTVYKMITKVIANRIKPILGELIH  539

Query  1472  PHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRD  1293
             P Q+SFV GR I +N +  +E+   F+    +   MALK+DL KAYD L W FI +TL+ 
Sbjct  540   PSQTSFVPGRNIQENIIIAKEMAFLFKKSNPKRNIMALKIDLSKAYDSLEWGFIRETLQ-  598

Query  1292  IGFN  1281
              GFN
Sbjct  599   -GFN  601


 Score =   243 bits (621),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 137/418 (33%), Positives = 234/418 (56%), Gaps = 3/418 (1%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM C++SP +  +WNG++T   SP +G+RQGDP+SP +FVLC ERLS ++   +R G+WK
Sbjct  610   IMDCISSPAISLIWNGEVTQSFSPSRGIRQGDPLSPYIFVLCMERLSMLISDRIRDGSWK  669

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              +K++     +SH+F+ADD+  FG+A+      ++  L+ F + SG ++N+ KS   F  
Sbjct  670   PIKISSDL-GVSHIFYADDVFLFGQASVRNGGVIQNVLEEFGNISGLRVNMSKSLAIFPP  728

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
               N   ++ +A  L +      GK+LG   +  +L++  +D +LE++K+ ++G  ++ L+
Sbjct  729   KMNPQRRRMLADFLTMKGSTSFGKYLGCNILPNKLRRGDYDGLLEKVKSAINGWQAKYLN  788

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG   +++SV+S+ P Y M+S+L+P  V++ IE+  R FLW   +  +    + W  + 
Sbjct  789   MAGRCTLIKSVVSSFPVYGMQSSLLPVSVMNEIEKDCRKFLWNKMDKSHYLARMSWDRIC  848

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
             +    GGLG + L + NLAF+AKL W + +D   LW  + KA+Y ++   + S   K + 
Sbjct  849   SPTGKGGLGFRRLHNWNLAFMAKLGWMIIKDETKLWVRILKARY-WERGSFLSAVGKNHH  907

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  W+ I++   +   G+   + NGR+T  W   W+   PL +   + I P  +++   +
Sbjct  908   SPIWRDIVKGRELLEKGLVRRIGNGRSTSLWYHWWVGGGPLVDVMGSNI-PEFMSHWQVS  966

Query  183   YWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
               I    WD   +  +LP  IL ++    L   + + D   W  E NG FSV SAY L
Sbjct  967   NIIKRGRWDTKKISHLLPPDILKQIKEIPLASMSEVEDDFTWNFEKNGTFSVKSAYYL  1024



>gb|ABD28627.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease 
H [Medicago truncatula]
Length=1296

 Score =   320 bits (819),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/570 (34%), Positives = 303/570 (53%), Gaps = 5/570 (1%)
 Frame = -1

Query  2984  LFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINI-EILYTHPQFIAFQV  2808
               +P +S A+ +    ++G+     +EA G+SGG+WL    + NI   +    Q+    +
Sbjct  33    FLKPHVSFARLSSFWINIGYTPVHIIEANGHSGGVWLLKHSTTNITSTVLDFNQYSITFI  92

Query  2807  YDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKET  2628
                 +A    + +Y   + ++R +L+  L        G W+ +GDFN     SE     T
Sbjct  93    IGRGAAITTCTCIYASPNYSMRPNLWNYLVNINDTITGPWMLIGDFNETHLPSE-QRGGT  151

Query  2627  FSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDA  2448
             F  +R   F++++    L+DL  TG  +TW +  +       +LDR ++NV+  L FP+A
Sbjct  152   FHHNRAATFSNFMNNCNLLDLTTTGGRFTWHKNNNGIRILSKKLDRGMANVDWRLSFPEA  211

Query  2447  KVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTN  2268
              V  L  + SDH+PLL+     P       F+F  AW  HY +   V+  W +     T 
Sbjct  212   FVEVLCRLHSDHNPLLLRFGGLPLTRGPRPFRFEAAWIDHYDYGNVVKRSWSTHTHNPTA  271

Query  2267  KSAMV-EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleET  2091
                 V E   +++ D FGNI Q+K R+  RL+GVQ  L          LE+ L+ E    
Sbjct  272   SLIKVMENSIIFNHDVFGNIFQRKSRVEWRLKGVQSYLERVDSYRHTLLEKELQDEYNHI  331

Query  2090  LYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKH  1911
             L+QEE++W+Q+SRE+W+K GD+NT F+   T ++R  +++ KL   +G    D  +L + 
Sbjct  332   LFQEEMLWYQKSREQWVKLGDKNTAFFHAQTVIRRKWNKIHKLQLPNGISTSDSNILQEE  391

Query  1910  VYDYFLGLFT-TEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASG  1734
                YF   F  +++  +R  F  G  P L +    S+ +P T +++  AL  M P KA G
Sbjct  392   ALKYFKKFFCGSQIPYSRF-FNEGRHPALDDTGKTSLTSPITKKEVFAALNSMKPYKAPG  450

Query  1733  PDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPI  1554
             PDGF   FF + W  VG  +F  V   F  G   P  ++T+++LIPK+ +P     FRPI
Sbjct  451   PDGFHCIFFKQYWHIVGDDVFHLVRSAFLTGHFDPAISNTLIALIPKIDSPNTYKDFRPI  510

Query  1553  GLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRV  1374
              LCN +YK+ITKV++ RL+  +  L+GP+QSSF+ GR   DN++  QEIL+  +  K + 
Sbjct  511   SLCNTLYKIITKVLVHRLRPFLNNLIGPYQSSFLPGRGTADNSIILQEILHFMKRSKRKK  570

Query  1373  GWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             G++A K+DLEKA+D ++W F+   L D GF
Sbjct  571   GYVAFKLDLEKAFDNVNWDFLNSCLLDFGF  600


 Score =   224 bits (570),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 178/328 (54%), Gaps = 2/328 (1%)
 Frame = -3

Query  1272  IRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSG  1093
             ++ IM CV+S     LWNG       P  GLRQGDP+SP LF+LC E+LS  +  +V  G
Sbjct  605   VKLIMHCVSSANYSLLWNGNKMPPFKPTHGLRQGDPLSPYLFILCMEKLSVAIQDAVLQG  664

Query  1092  NWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLF  913
             +W+ + +    P +SHL FADD++ F +A S Q   +    D F   SG KIN+ KS  +
Sbjct  665   SWEPIHIINDGPQISHLLFADDVLLFTKAKSSQLQFITNLFDRFSRASGLKINISKSRAY  724

Query  912   FSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssr  733
             +S  T  G   N+ A  GI S   +GK+LG P + GR K+  F+ ILE+++ RL+   +R
Sbjct  725   YSSGTPNGKINNLTAISGIQSTTTLGKYLGFPMLQGRPKRSDFNFILEKMQTRLASWKNR  784

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWG  553
              L+  G   +  SVLS IP Y M+   +P  + DSI++  R FLW     K   HLV W 
Sbjct  785   LLNRTGRLTLATSVLSTIPTYYMQINWLPQNICDSIDQTARNFLWKGSNNKG-IHLVNWK  843

Query  552   IVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK  373
              +T  K+ GGLGI+S +  N+  L KL W + Q  N LW NL   KY    S+  +    
Sbjct  844   TITRPKSIGGLGIRSARDANICLLGKLVWDMVQSTNKLWVNLLAKKYSSGTSLLEA-NVN  902

Query  372   RNSSNAWKGILQALHIFRNGIKWHVRNG  289
              NSS +W  I++A  I + G  W    G
Sbjct  903   SNSSPSWFSIIRAKDILKTGYSWRAGAG  930



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   273 bits (697),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 194/608 (32%), Positives = 317/608 (52%), Gaps = 24/608 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQAN-EICSSLGFDEWIRVEAVGY  2892
             WNC+G A+   RR +K  L   K   +CL E + S+A+    + S LG      V  +G+
Sbjct  6     WNCRGIANSRVRRFVKDLLSTTKADALCLLEIRSSKAEKMIALASRLGLTNHFIVNPLGF  65

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             +GG+ L    ++N+ ++  + Q I   +  +      ++  Y      +R + FA    +
Sbjct  66    AGGLLLLWKPALNLSVISHNSQAI-HTLASHRLGNCFITFAY------IRPNTFAKCRFW  118

Query  2711  FF------NPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
              +      + Q  W+ +GD N +    E     + + +   +F D      L+D G +G 
Sbjct  119   EYCKQLANSIQSPWMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGP  178

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL-ISITTCPQQ  2373
             ++TW R +     +  RLDR L NV   L FP+AKV+ LP + SDH+P+L +     P  
Sbjct  179   NFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPV  238

Query  2372  FCSSRFKFNMAWTTHYSFQAC-VQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                   +F  AW T   ++    ++  R   +L    + + +   +W+R+ FGNI  +KR
Sbjct  239   RSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRNVFGNIFNRKR  298

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             ++  R+ G+Q + +      L  LE+RL  EL E L QEE +WFQ++R +WI++GDRNT 
Sbjct  299   KIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTT  358

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             FY  +  +KRN++RV + +   G    D  LL +H+ ++F  LF   VD +      G  
Sbjct  359   FYHRSALIKRNRNRV-RFLKLQGAWTDDADLLTEHIINFFSTLFC-RVDRDSQPPRQGL-  415

Query  1835  PPL---LEEDWAS-VNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
              P+   +  D AS +    + E++K A+F M    + GPDG    F+ + W  VG ++  
Sbjct  416   -PMDFQIPRDQASTLLRRASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTD  474

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V+  FE+G          ++LIPK   PE    FRPI L NV +K+I+KV++ RL+ ++
Sbjct  475   MVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLLNVSFKVISKVLVNRLRPIM  534

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
               ++GPHQ+SF+ GR   DN +  QE++++    + +   M LKVDL+KAYD +SW ++E
Sbjct  535   SNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLE  594

Query  1307  DTLRDIGF  1284
             +TL D GF
Sbjct  595   ETLEDFGF  602


 Score =   262 bits (670),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 144/418 (34%), Positives = 227/418 (54%), Gaps = 1/418 (0%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+  +    L  LWNG       P +GLRQGDP++P LF L  ERL+H + + V +  WK
Sbjct  610   ILFSLQESSLAILWNGGRLPPFKPGRGLRQGDPLAPYLFNLVMERLAHDIQTRVNARTWK  669

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              V +TR    +SHLFFADDL+ FGEA+  QA  M  CLD F + SG K+N  KS LF S 
Sbjct  670   PVHITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSS  729

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N N G ++ I + L +P    +G +LG+P +  R+ +++F+ ++++++ +LS   + +L+
Sbjct  730   NVNAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLN  789

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V+VQ+ L+ +P Y+M+   +P    + I++  R FLWG      K H V W  + 
Sbjct  790   MAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEIC  849

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               +  GGLG++  +  N AFL K+AW++  + + LW  + + KY    + +   Q + N 
Sbjct  850   KPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKY-VKNADFLHLQSQSNC  908

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  W+ I++   +    IKW+V NGR   FW D W+ D PL         P   +  V +
Sbjct  909   SWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVED  968

Query  183   YWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
                S   WD   L  +LP ++++ +    +  ++   D L W     G+ +VSSAY L
Sbjct  969   LITSQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSL  1026



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score =   271 bits (693),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/608 (32%), Positives = 316/608 (52%), Gaps = 24/608 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQAN-EICSSLGFDEWIRVEAVGY  2892
             WNC+G A+   RR +K  L   K   +CL E + S+A+    + S LG      V  +G+
Sbjct  6     WNCRGIANSRVRRFVKDLLSTTKADALCLLEIRSSKAEKMIALASRLGLTNHFIVNPLGF  65

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             +GG+ L    ++N+ ++  + Q I   +  +      ++  Y      +R + FA    +
Sbjct  66    AGGLLLLWKPALNLSVISHNSQAI-HTLASHRLGNCFITFAY------IRPNTFAKCRFW  118

Query  2711  FF------NPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
              +      + Q  W+ +GD N +    E     + + +   +F D      L+D G +G 
Sbjct  119   EYCKQLANSIQSPWMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGP  178

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL-ISITTCPQQ  2373
             ++TW R +     +  RLDR L NV   L FP+AKV+ LP + SDH+P+L +     P  
Sbjct  179   NFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPV  238

Query  2372  FCSSRFKFNMAWTTHYSFQAC-VQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                   +F  AW T   ++    ++  R   +L    + + +   +W+R+ FGNI  +KR
Sbjct  239   RSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATVTQKSLLWNRNVFGNIFNRKR  298

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             ++  R+ G+Q + +      L  LE+RL  EL E L QEE +WFQ++R +WI++GDRNT 
Sbjct  299   KIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTT  358

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             FY  +  +KRN++RV + +   G    D  LL +H+ ++F  LF   VD +      G  
Sbjct  359   FYHRSALIKRNRNRV-RFLKLQGAWTDDADLLTEHIINFFSTLFC-RVDRDSQPPRQGL-  415

Query  1835  PPL---LEEDWAS-VNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
              P+   +  D AS +    + E++K A+F M    + GPDG    F+ + W  VG ++  
Sbjct  416   -PMDFQIPRDQASTLLRRASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTD  474

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V+  FE+G          ++LIPK   PE    FRPI L N  +K+I+KV++ RL+ ++
Sbjct  475   MVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLLNASFKVISKVLVNRLRPIM  534

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
               ++GPHQ+SF+ GR   DN +  QE++++    + +   M LKVDL+KAYD +SW ++E
Sbjct  535   SNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLE  594

Query  1307  DTLRDIGF  1284
             +TL D GF
Sbjct  595   ETLEDFGF  602


 Score =   262 bits (669),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 144/418 (34%), Positives = 227/418 (54%), Gaps = 1/418 (0%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+  +    L  LWNG       P +GLRQGDP++P LF L  ERL+H + + V +  WK
Sbjct  610   ILFSLQESSLAILWNGGRLPPFKPGRGLRQGDPLAPYLFNLVMERLAHDIQTRVNARTWK  669

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              V +TR    +SHLFFADDL+ FGEA+  QA  M  CLD F + SG K+N  KS LF S 
Sbjct  670   PVHITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSNASGLKVNFSKSLLFCSS  729

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N N G ++ I + L +P    +G +LG+P +  R+ +++F+ ++++++ +LS   + +L+
Sbjct  730   NVNAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLN  789

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V+VQ+ L+ +P Y+M+   +P    + I++  R FLWG      K H V W  + 
Sbjct  790   MAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEIC  849

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               +  GGLG++  +  N AFL K+AW++  + + LW  + + KY    + +   Q + N 
Sbjct  850   KPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKY-VKNADFLHLQSQSNC  908

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  W+ I++   +    IKW+V NGR   FW D W+ D PL         P   +  V +
Sbjct  909   SWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVED  968

Query  183   YWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
                S   WD   L  +LP ++++ +    +  ++   D L W     G+ +VSSAY L
Sbjct  969   LITSQRRWDTGALHNILPTNMIDMVRATPIAINSEQEDFLSWPHSTTGMVTVSSAYSL  1026



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score =   296 bits (758),  Expect(2) = 8e-141, Method: Compositional matrix adjust.
 Identities = 170/449 (38%), Positives = 254/449 (57%), Gaps = 6/449 (1%)
 Frame = -1

Query  2627  FSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDA  2448
             F + R      W+    +  + F G  YTW RG  +      RLDR + N    L+ P+A
Sbjct  651   FKLKRNNVLTSWVTAVYVSPVLFKGPKYTWSRGSLS-----KRLDRVVCNKAWFLQNPNA  705

Query  2447  KVTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRSDLDLST  2271
              V HLP + SDH P+LI      +     + F+F  AW T   F   +++ W++ +    
Sbjct  706   SVLHLPKVASDHRPVLIRFDQNSRNNNFPKLFRFMAAWLTDSRFADFMKTHWQNGVPYDR  765

Query  2270  NKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleET  2091
               S  ++ +  W+++ FGNI Q+K+ LLAR+ GVQ +L       L RLE +L+KELEE 
Sbjct  766   AVSEFIQQVQHWNKNIFGNIFQRKKILLARIGGVQRALERRPLCSLYRLEIKLKKELEEV  825

Query  2090  LYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKH  1911
             L QEEL+W QRSR +WI  GDRNT ++   T  +R+ +R+  ++  DG    D   + + 
Sbjct  826   LMQEELLWLQRSRRDWILFGDRNTAYFHQKTITRRHHNRIDAIMAEDGRWFYDMEAIKQQ  885

Query  1910  VYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGP  1731
               ++F  L+T E    +     G F  + +     +      E+I+ A+F+M P KA G 
Sbjct  886   ATNFFSNLYTPEQGGYKPYQICGAFLRVDDYRLKFLATEIEEEEIRHAVFNMSPLKAPGV  945

Query  1730  DGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIG  1551
             DG    F+   W  VG S    +   F+   LP   N T+L LIPK++ P   + +RPI 
Sbjct  946   DGLHAIFYQSQWHIVGESFCKAIKEVFQTQCLPAEVNRTVLVLIPKIEQPTSFSMYRPIS  1005

Query  1550  LCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVG  1371
             LC V+YK ITK++  RL++++ +L+GPHQ+SFV GR IT+N +  QEI+++ R KKGR G
Sbjct  1006  LCTVMYKTITKIIANRLQELLPELIGPHQTSFVPGRHITENIIVAQEIIHSMRRKKGRKG  1065

Query  1370  WMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +MA+KVDL KAYDRLSW FI++TL+++  
Sbjct  1066  FMAIKVDLGKAYDRLSWTFIQETLQELNL  1094


 Score =   236 bits (601),  Expect(2) = 8e-141, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 216/418 (52%), Gaps = 45/418 (11%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM C+T+  +  LWNG+L+    P +G+RQGDP+SP +FVLC ERLSH +  S++ G+WK
Sbjct  1102  IMECITTATMNVLWNGELSSEFCPGRGVRQGDPLSPYIFVLCIERLSHGISRSIQQGHWK  1161

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              +++ R+   +SHLFFADDL+F  EA+S QA+ + K +D F + SG K+N  K+ ++FS 
Sbjct  1162  PIRLARMGTPLSHLFFADDLLFLSEASSQQAIIINKIIDEFSASSGAKVNKSKTLVYFSA  1221

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N +      I + LG     ++GK+LG+P  H R+ K ++ +I+++I  RLSG ++  L+
Sbjct  1222  NISAMEASRIGSDLGYSVTDNLGKYLGVPLCHSRISKQTYQSIVDKIDQRLSGWNASHLT  1281

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             LAG   + QSVL AI  Y+M++T +P  +   I++L R F+W       K  LV W ++ 
Sbjct  1282  LAGRITLAQSVLQAISVYAMQTTKLPRSIKMKIDQLCRRFIWSGSAEHQKMSLVNWDMIC  1341

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K  GGLG K L  MN A L K  WRL  +   L   +   KY      + +  P R  
Sbjct  1342  TPKCKGGLGFKKLDIMNHALLMKNTWRLITEPTKLSNQVLLTKYGVHLDEFPTSLPTRYG  1401

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S+ WK +       R G+ W++ +G+  R+                              
Sbjct  1402  SHLWKAMGSTWEQTRVGMCWNIGDGKRVRY------------------------------  1431

Query  183   YWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
                            +LP +IL K+++      +   D   W    NG FSV SAYEL
Sbjct  1432  ---------------LLPNNILLKIASVHPPTASHGADSFFWGASSNGNFSVKSAYEL  1474


 Score =   171 bits (434),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 137/250 (55%), Gaps = 9/250 (4%)
 Frame = -3

Query  4443  PVIRVTKEEKIRLRRPWRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFI  4264
             P I+ +   + +L +PW+ S+++++LGR++ Y  L  RL  MWK   G+ +I L +++F+
Sbjct  88    PSIKFSARIQEKLIQPWKNSVVVKLLGRNIGYKALCARLASMWKPSMGYSVIDLENNYFL  147

Query  4263  AKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDD  4084
              +F    D       GPW++L  YL  Q+W P FD ++   D +  W+R P L +  +  
Sbjct  148   VRFRNAGDALDALTRGPWIILGHYLTVQQWTPEFDSKVTDFDYVNVWIRLPGLGLHLYHQ  207

Query  4083  DFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKEYEGIH  3904
               L +IGK++G  +K+D +T  +++GKFARV V++ + KPL+S   +NG     EYEG+ 
Sbjct  208   KTLNRIGKLVGEVIKLDDSTESSTRGKFARVAVRISLAKPLVSQVELNGRIQKIEYEGLP  267

Query  3903  QICFKCSIYGHRMETCGLSVPIPAASVDGTAGTSSTTGIDIPLPKPKEK--------YGA  3748
              ICFKC  YGH    C  ++       +  +G  S  G D+ + +   +        +G 
Sbjct  268   VICFKCGRYGHNSGECSANMQNGQPGGEEISGKDSQQG-DVHIVQENGRAEDNHFKPFGP  326

Query  3747  WMLVTRRDRR  3718
             WM+  RR R+
Sbjct  327   WMVAYRRGRK  336


 Score = 88.6 bits (218),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -1

Query  3056  GAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIW  2877
             GAAS SFR+T K  +  +KP+++ L EP+IS  +A+    + GFD   RVEAVG+SGGIW
Sbjct  571   GAASHSFRQTFKSIIHSYKPAMVVLMEPRISGRKADNFIKASGFDRSHRVEAVGFSGGIW  630

Query  2876  LFCSVSINIEILYTHPQFIAFQVY-DNVSAPWLMSV  2772
             L       +EI++ H QFI F++  +NV   W+ +V
Sbjct  631   LLWRNQFEVEIIFNHKQFIHFKLKRNNVLTSWVTAV  666



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   274 bits (700),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/608 (32%), Positives = 316/608 (52%), Gaps = 24/608 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQAN-EICSSLGFDEWIRVEAVGY  2892
             WNC+G A+   RR +K  L   K   +CL E + S+A+    + S LG      V  +G+
Sbjct  538   WNCRGIANSRVRRFVKDLLSTTKADALCLLEIRSSKAEKMIALASRLGLTNHFIVNPLGF  597

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             +GG+ L    ++N+ ++  + Q I   +  +      ++  Y      +R + FA    +
Sbjct  598   AGGLLLLWKPALNLSVISHNSQAI-HTLASHRLGNCFITFAY------IRPNTFAKCGFW  650

Query  2711  FF------NPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
              +      + Q  W+ +GD N +    E     + + +   +F D      L+D G +G 
Sbjct  651   EYCKQLANSIQSPWMVVGDLNDIATSDEQWGSSSLNYTSLQNFVDAYSDCGLLDPGSSGP  710

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL-ISITTCPQQ  2373
             ++TW R +     +  RLDR L NV   L FP+AKV+ LP + SDH+P+L +     P  
Sbjct  711   NFTWCRFIGNRVVQRRRLDRVLWNVSAQLTFPEAKVSVLPRLCSDHNPILFLDEAGNPPD  770

Query  2372  FCSSRFKFNMAWTTHYSFQAC-VQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                   +F  AW T   ++    ++  R   +L    +   +   +W+R+ FGNI  +KR
Sbjct  771   RSLRPVRFEAAWLTSEDYKHIWKEATEREGSNLEDIIATATQKSLLWNRNVFGNIFNRKR  830

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             ++  R+ G+Q + +      L  LE+RL  EL E L QEE +WFQ++R +WI++GDRNT 
Sbjct  831   KIENRILGIQRAWNYNTSVRLQDLEKRLLSELNEVLVQEETLWFQKARTDWIRNGDRNTT  890

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             FY  +  +KRN++RV + +   G    D  LL +H+ ++F  LF   VD +      G  
Sbjct  891   FYHRSALIKRNRNRV-RFLKLQGAWTDDADLLTEHIINFFSTLFC-RVDRDSQPPRQGL-  947

Query  1835  PPL---LEEDWAS-VNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
              P+   +  D AS +    + E++K A+F M    + GPDG    F+ + W  VG ++  
Sbjct  948   -PMDFQIPRDQASTLLRRASLEEVKKAVFGMKKYGSPGPDGIPAVFYQQFWGEVGPAMTD  1006

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V+  FE+G          ++LIPK   PE    FRPI L NV +K+I+KV++ RL+ ++
Sbjct  1007  MVNHAFENGSTYISQLQAFMTLIPKKDTPETAADFRPITLPNVSFKVISKVLVNRLRPIM  1066

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
               ++GPHQ+SF+ GR   DN +  QE++++    + +   M LKVDL+KAYD +SW ++E
Sbjct  1067  SNIIGPHQNSFLPGRSTMDNVILTQEVVHSMNNPRRKKKQMILKVDLQKAYDSVSWDYLE  1126

Query  1307  DTLRDIGF  1284
             +TL D GF
Sbjct  1127  ETLEDFGF  1134


 Score =   257 bits (656),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 224/418 (54%), Gaps = 1/418 (0%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+  +    L  LWNG       P +GLRQGDP+ P LF L  ERL+H + + V +  WK
Sbjct  1142  ILFSLQESSLAILWNGGRPPPFKPGRGLRQGDPLVPYLFNLVMERLAHDIQTRVNARTWK  1201

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              V +TR    +SHLFFADDL+ FGEA+  QA  M  CLD F   SG K+N  KS LF S 
Sbjct  1202  PVHITRGGTGISHLFFADDLMLFGEASEHQAQIMFDCLDSFSDASGLKVNFSKSLLFCSS  1261

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             N N G ++ I + L +P    +G +LG+P +  R+ +++F+ ++++++ +LS   + +L+
Sbjct  1262  NVNAGLKRAIGSILQVPVAESLGTYLGIPMLKERVSRNTFNAVIDKMRTKLSSWKASSLN  1321

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V+VQ+ L+ +P Y+M+   +P    + I++  R FLWG      K H V W  + 
Sbjct  1322  MAGRRVLVQASLATVPTYTMQVMALPVSTCNEIDKTCRNFLWGHDTNTRKLHSVNWAEIC  1381

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               +  GGLG++  +  N AFL K+AW++  + + LW  + + KY    + +   Q + N 
Sbjct  1382  KPRNEGGLGLRMARDFNRAFLTKMAWQIFSNIDKLWVKVLREKY-VKNADFLHLQSQSNC  1440

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  W+ I++   +    IKW+V NGR   FW D W+ D PL         P   +  V +
Sbjct  1441  SWGWRSIMKGKDVLAGAIKWNVGNGRKINFWNDWWVGDGPLASNTDCINQPHMTDIKVED  1500

Query  183   YWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
                S   WD   L  +LP ++++ +    +  ++   D   W     G+ +VSSAY L
Sbjct  1501  LTTSQRRWDTGALHNILPINMIDMVRATPIAINSEQEDFPSWPHSTTGMVTVSSAYSL  1558


 Score =   194 bits (492),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 153/277 (55%), Gaps = 15/277 (5%)
 Frame = -3

Query  4443  PVIRVTKEEKIRLRRPWRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFI  4264
             PV++ +K  +  L R WR +LI++ LG++++ + L QR   +W+L+   ++I +    F+
Sbjct  84    PVVKFSKALRQELCREWRMALIVKYLGKNLTANVLNQRAPSLWQLKGRVQIIDIGFGCFV  143

Query  4263  AKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDD  4084
              +F+   DY  V   GPW + D+YL+TQ W P+F PR  K  K+  W+R   L +EYF D
Sbjct  144   MRFDDKKDYLHVLLDGPWRIFDNYLITQRWVPDFKPRTAKFQKMAVWVRLSELSMEYFRD  203

Query  4083  DFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKEYEGIH  3904
             D +K I + IG+P+ +D TT    +G+FAR  V++D+ KPL+S   + G     EYEG+H
Sbjct  204   DTIKAILENIGKPLGLDRTTMARERGRFARAAVEIDLDKPLVSEIWVMGDVQKVEYEGLH  263

Query  3903  QICFKCSIYGHRMETCGLSVPIPAASVDGTAGTSSTTGIDIPLPKPKE------------  3760
              +CF C + GHR + C L+ P    ++    G+++ T  D   P+P E            
Sbjct  264   VVCFGCGVVGHREQACPLARPTAPETM--ATGSNTETAADTAEPQPAEGPADAVTQPAER  321

Query  3759  -KYGAWMLVTRRDRRNQNRATPHPGSSLPV*RNQQAS  3652
              +YG WM+VTR+ +   N       ++ P   N+  S
Sbjct  322   RRYGPWMIVTRKQQATTNNPPRQQATNKPNQNNRNIS  358



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score =   304 bits (779),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 245/424 (58%), Gaps = 7/424 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R +M CV+ P +  LWNG+ T+   P +GLRQGDP+SP LFVLC ERL H+++ +V  
Sbjct  246   WVRRVMECVSGPSMCILWNGEKTESFKPSRGLRQGDPLSPYLFVLCMERLCHLIEEAVEE  305

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK +K++R  P +SH+ FADDL+ F EA+  Q   ++K L+ FC  SGQK++L KS +
Sbjct  306   KRWKPIKLSRGGPELSHICFADDLILFAEASVTQVRVIRKVLEKFCKASGQKVSLPKSKI  365

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS N      + I+   GI +  D+GK+LG+P +  R+ KD+F  +LE++ +RLSG   
Sbjct  366   FFSNNVTTERGERISRASGIAATRDLGKYLGMPILQKRINKDTFGEVLEKVASRLSGWKK  425

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLSLAG   M ++VLS+IP ++M +  +P   ++ ++ L R F+WGS +     HLV W
Sbjct  426   QTLSLAGRVTMTKAVLSSIPVHTMSTINLPVSTLEKLDSLSRSFVWGSGQ-----HLVSW  480

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GGLGI+  + MN A +AK+ WRL +D   LW  + ++KY+       SW  
Sbjct  481   EKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVLRSKYNVGSIHDLSWTG  540

Query  375   KR-NSSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             +R N S+ W  ++  +  +   G  W + NGR  +FW D WL ++PL       +     
Sbjct  541   RRSNGSSTWSSVVLGIREVVMTGHSWAIGNGRDIKFWTDRWLSNQPLSSVTIGELPEGYE  600

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
             +  V   W+   GWD   +   + +    +L+  V+       DRL W +  NG F+V S
Sbjct  601   DVTVREMWVVGGGWDLAHIAPFVTDETRLELAAVVVDTVNDSEDRLAWSQTNNGQFTVKS  660

Query  21    AYEL  10
             AY L
Sbjct  661   AYAL  664


 Score =   223 bits (567),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 154/245 (63%), Gaps = 1/245 (0%)
 Frame = -1

Query  2006  VATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFPP  1830
             ++T ++R ++RV  L + +   + D   L +   +YF  L++ E VD +        F  
Sbjct  1     MSTVIRRRRNRVEMLKNNENRWVSDAQELEELAVNYFRKLYSLEDVDTDVQGLSERRFVS  60

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             L   D+  +N  F+ E+++ A+ DM   KA GPDGF P F+ + W TVG S+  F   FF
Sbjct  61    LTSHDYELLNKTFSVEEVERAVRDMGSFKAPGPDGFQPVFYQRCWETVGNSVARFATLFF  120

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
             E G LP   ND ++ LIPKV  PE ITQFRPI LCNV++K+ITK M+ RLK +++KL+GP
Sbjct  121   ETGKLPEDTNDALVVLIPKVTKPESITQFRPISLCNVLFKIITKAMVGRLKGVMKKLIGP  180

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
              QSSF+ GR   DN +  QE +++ R KKGR GWM LK+DLEKAYDRL W F+EDTLR  
Sbjct  181   AQSSFIPGRLSADNIVVVQEAVHSMRRKKGRKGWMLLKLDLEKAYDRLRWDFLEDTLRAA  240

Query  1289  GFNHT  1275
             G +  
Sbjct  241   GLSEV  245



>ref|XP_010666276.1| PREDICTED: uncharacterized protein LOC104883442 [Beta vulgaris 
subsp. vulgaris]
Length=1944

 Score =   332 bits (852),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 201/595 (34%), Positives = 309/595 (52%), Gaps = 18/595 (3%)
 Frame = -1

Query  3041  SFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWL-FCS  2865
             +F+  +++ +  H P L+ + E  +SR     I  SL FD W  VE  G++GGI L + S
Sbjct  525   TFKPNMRHLISNHYPDLVVIVETWVSRKNTETIVKSLNFDSWHLVEPTGFAGGILLAWNS  584

Query  2864  VSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTW  2688
               I I IL    Q +   V   +   P++ S +Y      +R  L+ +L  +  N    W
Sbjct  585   QRIKIHILGESKQGVHTLVEVSSHKTPFVFSAIYASPKYKVRNQLWDELIMFAANMNYPW  644

Query  2687  LAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI-RGLDTPSF  2511
             +  GDFN VTCQSE          R   + + + + +L+DLG+ GS +TW  +    P  
Sbjct  645   IIAGDFNEVTCQSEKFGGRPIIKKRVEMYVETMDLCKLVDLGYVGSKFTWTNKRRRNPVL  704

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
             +  RLDR  +N E    FP+A VTHLP I SDH P+ +++   P+   S  F+F   W +
Sbjct  705   E--RLDRGWANAEWLSCFPNASVTHLPRITSDHCPIHVTLNPSPKVHGSKPFRFEPMWLS  762

Query  2330  HYSFQACVQSVW---RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*S  2160
               SF   V   W   R +++L      +   L  W+  +FGN+ ++KRR+LARL+GVQ +
Sbjct  763   DPSFNDVVTKAWGKEREEIELKLYNVGI--ELQEWNETNFGNVYKRKRRVLARLKGVQNA  820

Query  2159  LSMGIRSD-lvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRN  1983
             L     SD    LE  L+ E+   L QEE +W  +SR +W+  G+RNT ++  +  + R+
Sbjct  821   LHDNPTSDFYHNLENELQNEMINILNQEEWLWKMKSRTKWLAEGERNTSYFHKSVIISRH  880

Query  1982  QSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASV  1803
              +R+  L +  G  + +   ++  +  +F  L+T+E       F Y      +      +
Sbjct  881   ANRILTLRNNSGEELHEPAQIVNLITTFFRDLYTSE-------FVYAKNNQSMSNQEIKI  933

Query  1802  NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGC  1623
             +     E+I  AL  M P KA GPDGF P FF + W  VG  +   + ++FE+  +P   
Sbjct  934   SMRPDDEEIYRALVGMKPFKAPGPDGFHPIFFQEKWNVVGEEVCKNLGKWFEEKRVPETL  993

Query  1622  NDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGR  1443
                ++ LIPK   PE +   RPI LCN +YKL+TK+++ RLK ++   +  +Q+SF+ GR
Sbjct  994   CQALVCLIPKQPCPEVVKHLRPISLCNTMYKLVTKIIVNRLKPLIPNWISHNQNSFIKGR  1053

Query  1442  QITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
                 N +   EIL++   KKG+ GW ALKVDLEKAYDR+ W FI+  L     + 
Sbjct  1054  GPEVNMVVAAEILHSMHKKKGKWGWFALKVDLEKAYDRMEWQFIKRCLESFNLDE  1108


 Score =   193 bits (491),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 132/390 (34%), Positives = 211/390 (54%), Gaps = 7/390 (2%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CV+      L NG+ +   +  +GLRQGDP+SP +F LC E L+ +V+ +  +  W 
Sbjct  1114  IMSCVSQASSSILVNGRKSVSFTHSRGLRQGDPMSPYIFNLCLEYLTTLVNIACETKQWT  1173

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
                V R    +SHL FADDL+ FG  +   A ++++ LD FC  SGQKIN +KS L FS 
Sbjct  1174  PFWVGRKKVPISHLLFADDLLLFGRVDEQTAFKVREILDTFCGESGQKINEEKSRLIFSP  1233

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             NT   T++     + +    ++G +LG+P  H R +K     I+E+++ +L+   S+ LS
Sbjct  1234  NTPNDTKELFQEKISVKENENLGTYLGMPISHKRPRKGEVQFIVEKVRKKLANWKSKFLS  1293

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG  V++QS L+ IP Y M++  +P   ++ ++R+   FLWG  EGK+K HLV   +  
Sbjct  1294  RAGRLVLIQSTLNTIPNYYMQANFLPIATLNDLDRICNNFLWGEVEGKSKLHLVSKEVSF  1353

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK-RN  367
             + K  GGLGI+S +++N   ++KL W++      L     ++KY     V SS+  K   
Sbjct  1354  SPKTLGGLGIRSHRNLNTILMSKLGWKMCHGNPNLAQQCIQSKY-----VHSSYITKFTK  1408

Query  366   SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVA  187
              S+ W+ I +   +      W + NG+ T FW D+WL    L  +   P+  +     V+
Sbjct  1409  GSHIWQDIGRGWELLSRHCTWVLGNGKDTLFWEDNWLGLGSLRSQLYGPLNKNEDKITVS  1468

Query  186   NYWISNEGWDWDMLDRVLPEHILNKLSTFV  97
                + N+ W++D+L   LP  I +K+   V
Sbjct  1469  QCRVLND-WNFDILSFQLPVEIRDKIVGLV  1497



>ref|XP_010668235.1| PREDICTED: uncharacterized protein LOC104885230 [Beta vulgaris 
subsp. vulgaris]
Length=1607

 Score =   343 bits (879),  Expect(2) = 6e-139, Method: Compositional matrix adjust.
 Identities = 209/602 (35%), Positives = 318/602 (53%), Gaps = 14/602 (2%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN +G A PSF+   +  +  H PSL+ L E  + R + + I S LGFD W  +E  G+ 
Sbjct  265   WNVRGLARPSFKPNFRLLMNQHYPSLVILAETWVGREKTDAIISDLGFDSWHLLEPDGFV  324

Query  2888  GGIWL-FCSVSINIEILYTHPQFIAFQVYDNVSA-PWLMSVVYGCLDMALRRHLFADLS*  2715
             GGI L + S  ++  ++    Q +   V  + S   ++ + +Y      +R+ L+ +L  
Sbjct  325   GGILLMWKSHVLDFHVIGEGAQGVYGVVEVHASNLSFVFTAIYASPKFHIRKTLWHELES  384

Query  2714  YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI  2535
             +  N    WL +GDFN VTCQ+E       S  R   F + +    LIDLGF G  +TW 
Sbjct  385   FAQNLNKPWLVLGDFNEVTCQNEKLGGRLASRKRMDLFANTMDNCNLIDLGFNGPRFTWT  444

Query  2534  RGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRF  2355
                        RLDR   N+E    FP+A + HLP I SDH P+L+     P       F
Sbjct  445   NKRKLNPIM-ERLDRGWVNMEWIQMFPNANLWHLPRITSDHCPILLKFQNVPFVHGEKPF  503

Query  2354  KFNMAWTTHYSFQACVQSVW-RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             +F   W     F+      W      +  + S   E L  W+  +FGN+ ++KRRL+ RL
Sbjct  504   RFEPMWLLDSRFRESALPKWPNPSSSIQASLSTFRETLIEWNHSTFGNVYRRKRRLVGRL  563

Query  2177  EGVQ*SLSMGIRSD-lvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVA  2001
             +G Q  L     S   + LE  L++EL +TL QEE +W  +SR   I  G+RNTR++  +
Sbjct  564   KGTQLYLQDHPTSPFHLNLESELQQELMDTLQQEETLWKTKSRMSRIGEGERNTRYFHRS  623

Query  2000  TTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLE  1821
               +KRN+SR++ L D  G+ + D G +   +  ++  L++T    ++ N      P L  
Sbjct  624   VLIKRNRSRINSLRDNVGNEVRDQGGIHDLILAFYKDLYSTGKLFSQWN-SNSPVPNL--  680

Query  1820  EDWASVNAPFTPE--DIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFE  1647
                  +N  F P   +IK A+F M P KA GPDGF P FF KTW  +G  + S V ++F 
Sbjct  681   ----GLNVGFEPSPLEIKMAMFSMKPHKAPGPDGFHPIFFQKTWDVIGHDVCSDVQKWFR  736

Query  1646  DGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPH  1467
                +P      ++ LIPK  +PE + QFRPI LCN +YKL+TK+++ RLK ++   +  +
Sbjct  737   QSKVPEDLCQALICLIPKQNSPETVKQFRPISLCNTIYKLVTKILVTRLKPLIPDWISHN  796

Query  1466  QSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIG  1287
             Q+SF+ GR    N +   E+L++ + K+G+ GW ALK+DLEKAYDR+ W F+ + L+++ 
Sbjct  797   QNSFIKGRGPDINLVVASEVLHSMQKKQGKWGWFALKIDLEKAYDRVEWAFVRECLQNLQ  856

Query  1286  FN  1281
              +
Sbjct  857   LD  858


 Score =   182 bits (463),  Expect(2) = 6e-139, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 196/386 (51%), Gaps = 7/386 (2%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM C++      L NG  ++     +GLRQGDP+SP LF +C E L+  ++ S   G W 
Sbjct  865   IMSCISQASSRVLINGCKSEEFKHSRGLRQGDPMSPYLFNICLEALTGRINESCHQGEWT  924

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
                V R    +SHL FADDL+ FG  +   A  ++  LD FC  SG++IN  KS L FS 
Sbjct  925   PFGVGRGQVPISHLLFADDLLLFGRVDESTAFAVRSVLDRFCRDSGERINEAKSKLMFSP  984

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             NT    +     TL I    ++G +LGLP  H R  +     I+++++ARL+   S+ LS
Sbjct  985   NTPSDHKVLFTETLNIVESPNLGVYLGLPISHKRPTRRQVQFIVDKVRARLATWKSKFLS  1044

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG   ++ S LS IP Y M++  +P   +  ++ +   FLWG    K K HLV   +  
Sbjct  1045  RAGRLCLISSTLSTIPAYYMQAISLPISTLSDLDSICNNFLWGEEGEKKKMHLVNKQMTF  1104

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K  GGLGI+S + MN A++AKL W+L+QD   L     ++KY  +  V       RN 
Sbjct  1105  LPKNKGGLGIRSQRIMNKAYMAKLGWKLAQDQPSLAQQCIRSKYLQNNRVTKF----RNG  1160

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  WK I Q   + ++   W + +G+   FW D WL   PL      P+  S   N    
Sbjct  1161  SVIWKSIGQGWDLIQDNSSWFLGDGKIISFWHDDWLGIGPLRGWVQGPM--SMDENTRKV  1218

Query  183   YWISNEG-WDWDMLDRVLPEHILNKL  109
             + +S+ G WD   L   +P  + N++
Sbjct  1219  HSLSHHGRWDLTPLTIHIPSDLRNRI  1244



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   272 bits (696),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 179/549 (33%), Positives = 272/549 (50%), Gaps = 17/549 (3%)
 Frame = -1

Query  2897  GYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADL  2721
             GYSGG+ L     +++ +      FI  Q+  N     W ++V YG   +  R   +  L
Sbjct  474   GYSGGLALLWKEEVDVHVCAFSDHFIDVQIGSNGGGDRWRLTVFYGFPAVQDREKSWILL  533

Query  2720  S*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
                  + Q  WL +GDFN +    E       +  +   F + +      DLGF G  +T
Sbjct  534   DQLGHHNQLPWLCVGDFNEILSTDEKEGGPLRNNRQMQGFRNIVDKLGFRDLGFNGYKFT  593

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI--TTCPQQFC  2367
             W +      F   RLDRAL+       FP   V HL    SDH P+L+ I   TC Q+  
Sbjct  594   W-KCRFGDGFVRVRLDRALATTSWQNLFPGFSVQHLDPSRSDHLPILVRIRHATC-QKSR  651

Query  2366  SSRFKFNMAWTTHYSFQACVQSVWRS--DLD----LSTNKSAMVEALSVWSRDSFGNIPQ  2205
               RF F   WTTH   +  ++ VW S  +LD    L      M   L  WS+ +FG+I +
Sbjct  652   YRRFHFEAMWTTHVDCEKTIKQVWESVGNLDPMVGLDKKIKQMTWVLQRWSKSTFGHIKE  711

Query  2204  KKRRLLARLEGV-Q*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGD  2028
             + R L A+L  + Q   S  +  D   +++ L +     L + EL W QRSRE W+K+GD
Sbjct  712   ETRVLRAKLASLFQAPYSERVEEDRRVVQKSLDEL----LAKNELYWCQRSRENWLKAGD  767

Query  2027  RNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFC  1848
             +NT ++    T +R ++ +  L D++G        +   V DYF  LF +          
Sbjct  768   KNTSYFHQKATNRRRRNIIKGLEDSNGCWRTSRQGITSIVIDYFGDLFRSSGSSMMEEIL  827

Query  1847  YGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
                 P +  +    + A F+ ++IK A+F M P KA GPDG  P F+ K W  VG  + +
Sbjct  828   SALEPKVTADMQQVLIADFSYQEIKDAVFQMQPSKAPGPDGLPPLFYQKYWRIVGDDVVA  887

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V  F +   +    N T ++LIPKV+ P  + Q RPI LCNV+Y++  K +  R+K ++
Sbjct  888   AVRAFLQSNEMLRQLNHTFVTLIPKVKEPRTMAQLRPISLCNVLYRIGAKTLANRMKFVM  947

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAYDRLSWCFI  1311
             + ++   QS+FV GR ITDN++   EI +  +  ++GR G +ALK+D+ KAYDR+ W F+
Sbjct  948   QSVISESQSAFVPGRLITDNSIVAFEIAHFLKQRRRGRKGSLALKLDMSKAYDRVEWEFL  1007

Query  1310  EDTLRDIGF  1284
             E  +  +GF
Sbjct  1008  EKMMLAMGF  1016


 Score =   251 bits (642),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 152/428 (36%), Positives = 235/428 (55%), Gaps = 9/428 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R +M CVT+     L NG+ T  + P +GLRQGDP+SP LF+LCAE  + ++  + R 
Sbjct  1020  WVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQGDPLSPYLFLLCAEGFTTLLSKAERQ  1079

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+ + R AP +SHLFFADD   F +A       +K   +++   SGQ+IN QKS +
Sbjct  1080  GQLQGIVICRGAPTVSHLFFADDSFVFAKATDNNCGVLKHIFEVYEHASGQQINCQKSCV  1139

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS N ++ TQ  +A+ LG+P V     +LGLP + GR K   F  + ER+  +L G   
Sbjct  1140  AFSANIHMDTQSRLASVLGVPRVDSHATYLGLPMMLGRNKTVCFRYLKERVWKKLQGWRE  1199

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLS+AG  V+++ V  +IP Y M   L+P G+   IE+++  F WG +    K H ++W
Sbjct  1200  QTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWWGQQGENRKIHWMRW  1259

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  +K  GG+G + L+  N+A LAK  WRL  + + L + L KAKY    + W +   
Sbjct  1260  ERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPQTNFWEATLG  1319

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R S   WK I  A  +   G ++ + +G++ R W D W+     F   ++P+    + N
Sbjct  1320  SRPSC-VWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITSPL--DGMEN  1376

Query  195   LVANYWISNEG---WDWDMLDRV-LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
                +  I NEG   WD   L+ + LP  +++ +   +        DR+VW  + +GLF+V
Sbjct  1377  TKVSELICNEGSPQWDLQKLNNLFLPVDVVDIVR--IPLSIRAPPDRIVWNYDKHGLFTV  1434

Query  27    SSAYELAL  4
              SAY +AL
Sbjct  1435  KSAYRVAL  1442


 Score = 65.1 bits (157),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 77/182 (42%), Gaps = 6/182 (3%)
 Frame = -3

Query  4383  LILRVLGR-SVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWM  4207
             L+ +VL R S++     + +  +W+ +A  ++  L  D F+  F+T      +  GGPW 
Sbjct  39    LVGKVLSRQSINKEAFKRTMHMLWRPKAEVDIADLEADLFVFSFKTNAARATILRGGPWT  98

Query  4206  VLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLT  4027
                  LV  E           + +   W++   LP+ Y   +  K IG+ IG  V  D +
Sbjct  99    FNHFLLVLAEADDLVHSTRIPLCQQEFWVQVKGLPLIYMTREMGKMIGQQIGEYVVTDQS  158

Query  4026  TGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKE-----YEGIHQICFKCSIYGHRME  3862
                   G + R+ V LDITKPL     I   E   E     YE +  +C+ C  + H   
Sbjct  159   KRGQCFGSYLRIRVVLDITKPLRRCLPIQLQEGKVEWVDLRYEKLPHVCYLCGCFDHIES  218

Query  3861  TC  3856
              C
Sbjct  219   QC  220



>gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAV32224.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1936

 Score =   295 bits (754),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/609 (30%), Positives = 311/609 (51%), Gaps = 21/609 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  + +  + L+  ++     L+ L E + S  + + +   L F  ++ V + G S
Sbjct  641   WNCRGLGNTATVQDLRALIQKAGSQLVFLCETRQSVEKMSRLRRKLAFRGFVGVSSEGKS  700

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ L+   S+++++   + ++I   V  +   P W ++ VYG   +  R  +++ L   
Sbjct  701   GGLALYWDESVSVDVKDINKRYIDAYVRLSPDEPQWHITFVYGEPRVENRHRMWSLLRTI  760

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +    W+ +GDFN    Q E  +K     ++  +F D ++  +L DLGF G  +T+  
Sbjct  761   RQSSALPWMVIGDFNETLWQFEHFSKNPRCETQMQNFRDALYDCDLQDLGFKGVPHTYDN  820

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI----TTCPQQFCS  2364
               D       RLDRA+++ +    FP+A+V+HL    SDHSP+L+      TT P+Q C 
Sbjct  821   RRDGWRNVKVRLDRAVADDKWRDLFPEAQVSHLVSPCSDHSPILLEFIVKDTTRPRQKC-  879

Query  2363  SRFKFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGNIPQK  2202
                 + + W         ++  W     ++DL D++     ++ AL  WS+    N+ ++
Sbjct  880   --LHYEIVWEREPESVQVIEEAWINAGVKTDLGDINIALGRVMSALRSWSKTKVKNVGKE  937

Query  2201  KRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRN  2022
               +   +LE +    S   RS + +    + +     LY+EE++W QRSR  W+K GDRN
Sbjct  938   LEKARKKLEDL--IASNAARSSIRQATDHMNE----MLYREEMLWLQRSRVNWLKEGDRN  991

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYG  1842
             TRF+      +  ++++SKL D +G +     +L     +YF G++  +  +N  +    
Sbjct  992   TRFFHSRAVWRAKKNKISKLRDENGAIHSTTSVLETMATEYFQGVYKADPSLNPESVTRL  1051

Query  1841  CFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
                 + +     +   F  E+I  A+F + P K+  PDGF   F+ + W T+ + +   V
Sbjct  1052  FQEKVTDAMNEKLCQEFKEEEIAQAIFQIGPLKSPRPDGFPARFYQRNWGTLKSDIILAV  1111

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               FF+ G++P G NDT + LIPK   P  +  +RPI LCNVVYK+++K ++ RL+ ++  
Sbjct  1112  RNFFQSGLMPKGVNDTAIVLIPKKDQPIDLKDYRPISLCNVVYKVVSKCLVNRLRPILDD  1171

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIED  1305
             LV   QS+F+ GR ITDN L   E  ++  + KK      A K+DL KAYDR+ W F+E 
Sbjct  1172  LVSKEQSAFIQGRMITDNALLAFECFHSIQKNKKANSAACAYKLDLSKAYDRVDWRFLEL  1231

Query  1304  TLRDIGFNH  1278
              L  +GF H
Sbjct  1232  ALNKLGFAH  1240


 Score =   216 bits (550),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 137/432 (32%), Positives = 217/432 (50%), Gaps = 18/432 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CVT+ R    +NG L    +P +GLRQG+P+SP LF+  A+ LS ++   V  
Sbjct  1242  WVSWIMLCVTTVRYSVKFNGTLLRSFAPTRGLRQGEPLSPFLFLFVADGLSLLLKEKVAQ  1301

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +   +K+ R AP +S+L FADD + F +A   +A  +K+ L  +   +GQ IN  K S+
Sbjct  1302  NSLTPLKICRQAPGISYLLFADDTLLFFKAEKKEAEVVKEVLTNYAQGTGQLINPAKCSI  1361

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F + +     ++I  TL +       ++LG P+  GR+ K  F ++  +I  R+     
Sbjct  1362  LFGEASPSSVSEDIRNTLQVERDNFEDRYLGFPTPEGRMHKGRFQSLQAKIAKRVIQWGE  1421

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  +++++V+ AIP Y M     P  V D + ++ R F WG+  G+ + H   W
Sbjct  1422  NFLSSGGKEILIKAVIQAIPVYVMGLFKFPDSVYDELTKMTRNFWWGADNGRRRTHWRAW  1481

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T +K NGGLG +  K  N A L + AWRL +  N L   + KAKY F     +    
Sbjct  1482  DSLTKAKINGGLGFRDYKLFNQALLTRQAWRLIEFPNSLCAQVLKAKY-FPHGSLTDTTF  1540

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSW----LLDRPLFEEASAPIAPS  208
               N+S  W GI   L + + GI W + NG + R W D W    L  RP+  +A+  +   
Sbjct  1541  SANASPTWHGIEYGLDLLKKGIIWRIGNGNSVRIWRDPWIPRDLSRRPVSSKANCRL---  1597

Query  207   SLNNLVANYWISNEGWDWDMLDRV---LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGL  37
                  V++    +  WD   +++    +   I+ K+      E+    D + W+ +  G 
Sbjct  1598  ---KWVSDLIAEDGTWDSAKINQYFLKIDADIIQKICISARLEE----DFIAWHPDKTGR  1650

Query  36    FSVSSAYELALE  1
             FSV SAY+LAL+
Sbjct  1651  FSVRSAYKLALQ  1662



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   281 bits (720),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 197/611 (32%), Positives = 299/611 (49%), Gaps = 22/611 (4%)
 Frame = -1

Query  3065  NCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSG  2886
             NC+G  S +    L++ ++  +PSL+ L E K+   QA  +  SLGF     V   G SG
Sbjct  12    NCRGLGSAATVGELRWLVKSLRPSLVFLSETKMRDKQARNLMWSLGFSGSFAVSCEGLSG  71

Query  2885  GIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFF  2706
             G+ LF + +  + +   +  FI   V      PW +S VYG     LR H F +L     
Sbjct  72    GLALFWTTAYTVSLRGFNSHFIDVLVSTEELPPWRISFVYGEPKRELR-HFFWNLLRRLH  130

Query  2705  NP-QGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
             +  +G WL  GDFN V C  E       S      F   +    LIDLGF G  +TW   
Sbjct  131   DQWRGPWLCCGDFNEVLCLDEHLGMRERSEPHMQHFRSCLDDCGLIDLGFVGPKFTWSNK  190

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR---  2358
              D  S    RLDRA++N E S  F D  V ++    SDH    ISI    +     R   
Sbjct  191   QDANSNSKVRLDRAVANGEFSRYFEDCLVENVITTSSDH--YAISIDLSRRNHGQRRIPI  248

Query  2357  ---FKFNMAWTTHYSFQACVQSVWRSD----LDLSTNKSAMVE---ALSVWSRDSFGNIP  2208
                F+F  AW     ++  V++ WR      + L    S + +   +L  WS+ SFG++ 
Sbjct  249   QQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRGVWSVLQQVAVSLKDWSKASFGSV-  307

Query  2207  QKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSG  2031
                RR + ++E    SL     +D+V  E +L ++    L++ EE++  QRSR +W++ G
Sbjct  308   ---RRKILKMERKLKSLRQSPVNDVVIQEEKLIEQQLCELFEKEEIMARQRSRVDWLREG  364

Query  2030  DRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNF  1851
             DRNT F+    + +R  +R+ +LV  DG        + +    ++  LF++E   +    
Sbjct  365   DRNTAFFHARASARRRTNRIKELVRDDGSRCISQEGIKRMAEVFYENLFSSEPCDSMEEV  424

Query  1850  CYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLF  1671
                    + +     +   +T E+IKTALF M   KA GPDGF   F+   W  +   + 
Sbjct  425   LDAIPNKVGDFINGELGKQYTNEEIKTALFQMGSTKAPGPDGFPALFYQTHWGILEEHIC  484

Query  1670  SFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDM  1491
             + V  F     +P G  D+++ LIPKV N   +++FRPI LCNV+YK+ +KV+  RLK  
Sbjct  485   NAVRGFLLGEEIPEGLCDSVVVLIPKVNNASHLSKFRPISLCNVLYKIASKVLANRLKPF  544

Query  1490  VRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFI  1311
             +  +V   QS+FV GR ITD+ L   E L+  R +  +  + ALK+D+ KAYDR+ W ++
Sbjct  545   LPDIVSEFQSAFVPGRLITDSALVAYECLHTIRKQHNKNPFFALKIDMMKAYDRVEWAYL  604

Query  1310  EDTLRDIGFNH  1278
                L  +GF+ 
Sbjct  605   SGCLSKLGFSQ  615


 Score =   227 bits (579),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 142/424 (33%), Positives = 219/424 (52%), Gaps = 5/424 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CV+S R     NG+LT  + P +G+RQGDPISP LF+LC E LS ++     +
Sbjct  617   WINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVA  676

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+K  R  P +SHL FADD +FF +A+S     +K  L  +CS SGQKINL KSS+
Sbjct  677   GELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSI  736

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF K      + ++ + L + + +    +LG+P+  G    + F  + ERI  R++G + 
Sbjct  737   FFGKRCPDAVKISVKSCLQVDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTD  796

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M+++V  AIP Y M    IP  + + ++  I    WG  +GK K H   W
Sbjct  797   RPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSW  856

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++  K  GG+G +     N A L +  WRL  D + L + + K +Y  + S W + QP
Sbjct  857   SWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQP  916

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAPSSLN  199
             K + S  W+ +L    +   G++W V +G+  + + D+W+   RP      +P    +  
Sbjct  917   K-SPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFPTDATV  975

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             + + N       WD D++  + P  I  ++    +       D   W  +  GL+SV SA
Sbjct  976   SCLMNE--DARCWDGDLIRSLFPVDIAKEILQIPISRHG-DADFASWPHDKLGLYSVRSA  1032

Query  18    YELA  7
             Y LA
Sbjct  1033  YNLA  1036



>gb|EEE61581.1| hypothetical protein OsJ_15963 [Oryza sativa Japonica Group]
Length=1494

 Score =   279 bits (713),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 173/541 (32%), Positives = 269/541 (50%), Gaps = 12/541 (2%)
 Frame = -1

Query  2876  LFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQ  2697
             LF   S+ +E+   + + I   + +   A W  + VYG      R  ++  L     N  
Sbjct  316   LFWDESLKVELKSYNMRHIDVIITEPEGARWTATFVYGEPKAQNRHEMWNLLRRIRLNAS  375

Query  2696  GTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTP  2517
               WL +GDFN    Q E  ++   S  +  DF + +   +L D+GF G  +T+     +P
Sbjct  376   DPWLMIGDFNEAMWQIEHRSRVKHSERQMRDFREVLVECDLQDIGFQGVPWTYDNNQASP  435

Query  2516  SFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK-FNMA  2340
             +    RLDRA+++      F  A + HL    SDH PLL+      QQ   S+   F   
Sbjct  436   NNVKVRLDRAVASPVWRAMFDQANIMHLTTACSDHVPLLLEKGGNMQQRRRSKINCFEAV  495

Query  2339  WTTHYSFQACVQSVW------RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             W    SF +     W      ++  D+ T  +  +E L  WSRD  GNI +   R    L
Sbjct  496   WERVKSFNSIEHESWDDGGLAKNLGDVRTKLAYTMENLKRWSRDKIGNIKKSIERCRREL  555

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
             E     + M  R D      RL+  L+E L++EE+ W QRSR  W+K GDRNTR++ +  
Sbjct  556   E----EMRMRGREDSEPDVHRLKIFLQELLHREEIWWKQRSRITWLKEGDRNTRYFHLKA  611

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
             + +  ++ + KL  +DG +   +  L +    +F  L+T +  +N         P + +E
Sbjct  612   SWRARKNLIKKLRRSDGMMCSKEEELGEIARSFFRDLYTKDESLNPGELLNMFEPKITDE  671

Query  1817  DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
                 +  PFT E+I  ALF + P KA GPDGF   FF + W  +   +   V  FFE G 
Sbjct  672   MNGMLTKPFTDEEISDALFQIGPLKAPGPDGFPARFFQRNWGVLKRDVIEGVREFFETGE  731

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
                G NDT++ +IPK   P  +  FRP+ LCNV+YK++ K ++ RL+ ++++++   QS+
Sbjct  732   WKEGMNDTVIVMIPKTNAPVEMKDFRPVSLCNVIYKVVAKCLVNRLRPLLQEIISETQSA  791

Query  1457  FVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             FV GR ITDN L   E  ++  +  +    + ALK+DL KAYDR+ W F++  L+ +GF 
Sbjct  792   FVPGRMITDNALVAFECFHSIHKCTRESQDFCALKLDLSKAYDRVDWGFLDGALQKLGFG  851

Query  1280  H  1278
             +
Sbjct  852   N  852


 Score =   225 bits (574),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 225/427 (53%), Gaps = 11/427 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + IM CVTS R     NG + +   P +GLR+GDP++P LF+  A+ LS+++      
Sbjct  854   WRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFLFIADGLSNILQRRRDE  913

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                + +KV R AP +SHL FADD + F +A  IQA  +K+ LDL+  C+GQ IN ++ SL
Sbjct  914   RQIQPLKVCRSAPGVSHLLFADDSLLFFKAEVIQATRIKEALDLYERCTGQLINPKECSL  973

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS       Q  I A L +       K LGLP+  GR+K + F  I ER + RL+  S 
Sbjct  974   LFSALCPQERQDGIKAVLQVERTCFDDKCLGLPTPDGRMKAEQFQPIKERFEKRLTDWSE  1033

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LSLAG   +++SV  A+P Y+M    +P    +  E+L+R F WG  +G+ K H + W
Sbjct  1034  RFLSLAGKEALIKSVAQALPTYTMGVFKMPERFCEEYEQLVRNFWWGHEKGEKKVHWIAW  1093

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T+ K  GGLG + ++  N A LA+ AWRL +  + L   + KAKY  + ++  +  P
Sbjct  1094  EKLTSPKLLGGLGFRDIRCFNQALLARQAWRLIESPDSLCARVLKAKYYPNGTITDTAFP  1153

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                SS  WKGI+  L + + G+ W + +G  T+ W + W+       E    +   + N 
Sbjct  1154  S-VSSPTWKGIVHGLELLKKGLIWRIGDGSKTKIWRNHWV----AHGENLKILEKKTWNR  1208

Query  195   LVANYWI---SNEGWDWDMLDRVLPEHILNK-LSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             L+    +     + W+  ++  ++ E   ++ L   + Q +    D   W+ E  G+FSV
Sbjct  1209  LIYVRELIVTDTKTWNEPLIRHIIREEDADEILKIRIPQREE--EDFPAWHYEKTGIFSV  1266

Query  27    SSAYELA  7
              S Y LA
Sbjct  1267  RSVYRLA  1273



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score =   256 bits (655),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/608 (29%), Positives = 295/608 (49%), Gaps = 25/608 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S +  R L   +R  +PS+I L E K+   +   +   LG+     V  +G +
Sbjct  441   WNCRGLGSNTTVRALHGLIRKKRPSMIFLSETKMKDHRILGVRRRLGYVHGFDVSPIGSA  500

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPW-LMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ L+   ++ + I+++    I   +       W   + VYG     + ++LF +    
Sbjct  501   GGLSLWWEDNLEVNIIFSSKHTIDAVMRIKGQTHWSRFTGVYGT-PYRVEKNLFWEWMVN  559

Query  2711  FFNPQGT-WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI  2535
             +F P    W+  GDFN      E S       +R     +++   +LIDLGF G ++TW 
Sbjct  560   YFTPTDIPWICGGDFNEFLWDHEKSGGVEVLYNRPRFLEEFLSSSQLIDLGFNGPAFTW-  618

Query  2534  RGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRF  2355
             RG+    +   RLDR ++N +    +P ++V H  ++ SDH P+++ I+   +Q     F
Sbjct  619   RGMRKGDWVEERLDRVMANEKWQQLWPHSQVMHETVLASDHCPVIL-ISNIEEQKGRKMF  677

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVE----------ALSVWSRDSFGNIPQ  2205
             +F   W      +  V+  W    D   N S +             LS W+R  F  + +
Sbjct  678   RFEAYWVAEEECKNLVEKCW----DRRHNGSPVNRWVRSLNDCRYRLSRWNRTKF--MGR  731

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
               R      +        G   D +R   R   EL     QEE  W QRSR +W++ GD 
Sbjct  732   GSRIHDLLSQLDLLQRDWGPNYDEIREISRRIDELR---LQEESYWCQRSRVKWLREGDA  788

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             NT+F+  +T  +R ++++ KL D +G+ +     +   V ++F  +F++  D N  +   
Sbjct  789   NTQFFHSSTLQRRRRNKIVKLRDENGNWVESPAQVRHLVDNHFTSVFSSAGDRNWGSLLD  848

Query  1844  GCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSF  1665
                P +  E    + AP T E+IK A  +M   KA GPDGF   F+   W  V   + + 
Sbjct  849   CINPSVSPEMNEVLIAPVTEEEIKAAAGNMGGLKAPGPDGFQGIFYQTYWEIVREGVSAL  908

Query  1664  VHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVR  1485
             V    +D       N T + LIPKV NPE ++QFRPI LCN  YK+++K++  RLK ++ 
Sbjct  909   VRDLIQDAAGSRLINQTHVVLIPKVPNPEFVSQFRPISLCNYSYKILSKILANRLKVLLP  968

Query  1484  KLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIE  1308
             K++ P Q++FV GRQI D      E+ +  + +K +  + M +K+D++KAYDR+ W F++
Sbjct  969   KIISPSQNAFVPGRQIQDCIGIAHEMFHYLKGRKAQNRFEMGIKLDMQKAYDRVEWDFLD  1028

Query  1307  DTLRDIGF  1284
               +  +GF
Sbjct  1029  AVMERMGF  1036


 Score =   247 bits (631),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 153/426 (36%), Positives = 222/426 (52%), Gaps = 13/426 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   I  CV+S +   L NGQ     +P +GLRQGDPISP LF+L  E LS ++  +V  
Sbjct  1040  WRSLIGGCVSSVKFAVLLNGQAGKSFAPSRGLRQGDPISPYLFILVGEVLSKLIQGAVDQ  1099

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +GVK+    P +SHLFFADD + F  A+      ++  LD FC  SGQK+NL+KSS+
Sbjct  1100  GRLEGVKIGGSGPVISHLFFADDTLLFLRADMENCGNLRNLLDRFCVASGQKVNLEKSSV  1159

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF  N      + +   LG+  V++ G +LG+P+I GR KK     +  R+  +L G   
Sbjct  1160  FFGANVPKVNVEQMGNALGMKVVINPGTYLGVPTIWGRSKKRGLAYVKGRVMEKLQGWKQ  1219

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              TLS AG  V++++V+ AIP Y M     P  V   ++ L+ GF WG +EG +K H V  
Sbjct  1220  NTLSRAGKEVLIKAVIQAIPAYPMCIFKFPGAVCKELDALVAGFWWGCKEGAHKIHWVSK  1279

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
             G++   K  GGLG ++ +  N A LAK  WRL  + + LW  + KA+Y    S+W + + 
Sbjct  1280  GVLGLPKDMGGLGFRNFQEFNEALLAKQCWRLITEPDSLWAKVIKARYFPHSSIWDAKKG  1339

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPL-FEEASAPIAPSSLN  199
              R +S AW  ++    + R G  W +  G+  R W D WL   PL   E    +A +   
Sbjct  1340  GR-ASWAWSSLICGRGLVREGSHWQILGGQEVRVWQDRWLPSLPLGHPEPVGQVAVTPSL  1398

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG-----DRLVWYKEPNGLF  34
              + A     +  W+ + L   + E  +  +      E+T LG     DRL+W    NG +
Sbjct  1399  RVSALICPESGRWNINFLQPFISEEAMQAI------EETPLGDLSRKDRLIWDTSKNGAY  1452

Query  33    SVSSAY  16
             SV S Y
Sbjct  1453  SVKSGY  1458



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score =   275 bits (703),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/566 (32%), Positives = 278/566 (49%), Gaps = 17/566 (3%)
 Frame = -1

Query  2948  EICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSV  2772
             ++   LGF     V + GYSGG+ L     +++ +      FI  ++  N     W ++V
Sbjct  3     KLSKQLGFRGVTSVSSRGYSGGLALLWKEEVDVHVCAFSDHFIDVKIGSNGGGDRWRLTV  62

Query  2771  VYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDW  2592
              YG   +  R   +  L     + Q  WL +GDFN +    E       +  +   F + 
Sbjct  63    FYGFPAVQDREKSWILLDQLGHHNQLPWLCVGDFNEILSTDEKEGGPLRNNRQMQGFRNI  122

Query  2591  IFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDH  2412
             +      DLGF G  +TW +      F   RLDRAL+       FP   V HL    SDH
Sbjct  123   VDKLGFRDLGFNGYKFTW-KCRFGDGFVRVRLDRALATTSWQNLFPGFSVQHLDPSRSDH  181

Query  2411  SPLLISI--TTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRS--DLD----LSTNKSAM  2256
              P+L+ I   TC Q+    RF F   WTTH   +  ++ VW S  DLD    L      M
Sbjct  182   LPILVRIRHATC-QKSRYHRFHFEAMWTTHVDCEKTIKQVWESVGDLDPMVGLDKKIKQM  240

Query  2255  VEALSVWSRDSFGNIPQKKRRLLARLEGV-Q*SLSMGIRSDlvrlerrlrkeleETLYQE  2079
                L  WS+ +FG+I ++ R L A+L  + Q   S  +  D   +++ L +     L + 
Sbjct  241   TWVLQRWSKSTFGHIKEETRVLRAKLASLFQAPYSERVEEDRRVVQKSLDEL----LAKN  296

Query  2078  ELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDY  1899
             EL W QRSRE W+K+GD+NT ++    T +R ++ +  L D++G        +   V DY
Sbjct  297   ELYWCQRSRENWLKAGDKNTSYFHQKATNRRRRNIIKGLEDSNGCWRTSRQGITSIVIDY  356

Query  1898  FLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFT  1719
             F  LF +              P +  +    + A F+ ++IK A+F M P KA GPDG  
Sbjct  357   FGDLFRSSGSSMMEEILSALEPKVTADMQQVLIADFSYQEIKDAVFQMQPSKAPGPDGLP  416

Query  1718  PGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNV  1539
             P F+ K W  VG  + + V  F +   +    N T ++LIPKV+ P  + Q RPI LCNV
Sbjct  417   PLFYQKYWRIVGDDVVAAVRAFLQSNEMLRQLNHTFVTLIPKVKEPRTMAQLRPISLCNV  476

Query  1538  VYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRT-KKGRVGWMA  1362
             +Y++  K +  R+K +++ ++   QS+FV GR I DN++   EI +  +  ++GR G +A
Sbjct  477   LYRIGAKTLANRMKFVMQSVISESQSAFVPGRLIIDNSIVAFEIAHFLKQRRRGRKGSLA  536

Query  1361  LKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             LK+D+ KAYDR+ W F+E  +  +GF
Sbjct  537   LKLDMSKAYDRVEWEFLEKMMLAMGF  562


 Score =   219 bits (558),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 143/429 (33%), Positives = 221/429 (52%), Gaps = 35/429 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R +M CVT+     L NG+ T  + P +GLRQGDP+SP LF+LCAE  + ++  + R 
Sbjct  566   WVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQGDPLSPYLFLLCAEGFTTLLSKAERQ  625

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+ + R AP +SHLFFADD   F +A            D  C  +           
Sbjct  626   GQLQGIVICRGAPTVSHLFFADDSFVFAKAT-----------DNNCGVA-----------  663

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                 N ++ TQ  +A+ LG+P V     +LGLP + GR K   F  + ER+  +L G   
Sbjct  664   ----NIHMDTQSRLASVLGVPRVDSHATYLGLPMMLGRNKTVCFRYLKERVWKKLQGWRE  719

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLS+AG  V+++ V  +IP Y M   L+P G+   IE+++  F WG +    K H ++W
Sbjct  720   QTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWWGQQGENRKIHWMRW  779

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  +K  GG+G + L+  N+A LAK  WRL  + + L + L KAKY    + W +   
Sbjct  780   ERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFPQTNFWEATLG  839

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R S   WK I  A  +   G ++ + +G++ R W D W+     F   ++P+    + N
Sbjct  840   SRPSC-VWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITSPL--DGMEN  896

Query  195   LVANYWISNEG---WDWDMLDRV-LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
                +  I NEG   WD   L+ + LP  +++ +   +        DR+VW  + +GLF+V
Sbjct  897   TKVSELICNEGSPQWDLQKLNNLFLPVDVVDIVR--IPLSIRAPPDRIVWNYDKHGLFTV  954

Query  27    SSAYELALE  1
              SAY +AL 
Sbjct  955   KSAYRVALR  963



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score =   269 bits (687),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/551 (33%), Positives = 269/551 (49%), Gaps = 40/551 (7%)
 Frame = -1

Query  2912  RVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRH  2736
             R+++ G SGG+ L  +  + +         I  +V    V   W  +  YGC   A R  
Sbjct  443   RIDSHGASGGLCLMWTEELVVTARSFGTNHIDTEVEILGVRGKWRFTGFYGCPVTAERHR  502

Query  2735  LFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFT  2556
              +  L          WL  GDFN +     +   E  ++  C             DLG+T
Sbjct  503   SWDLLRRLGATNYLPWLCCGDFNEI-----LRADEKLAIDTC----------RFKDLGYT  547

Query  2555  GSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQ  2376
             G  YTW R  + P     RLDRAL+  +   RF   KV HL    SDH PL         
Sbjct  548   GPKYTWWR--NNPMEIRIRLDRALATADWCSRFLGTKVIHLNPTKSDHLPL---------  596

Query  2375  QFCSSRFKFNMAWTTHYSFQACVQSVW----RSDLDLSTNKSAMV--EALSVWSRDSFGN  2214
                   F+F   W  H +    +Q  W    R     +T +        L  WS+ +FG+
Sbjct  597   ---KKLFRFEEMWAEHVNCMQTIQDGWQRTCRGSAPFTTTEKLKCTRHKLLGWSKCNFGH  653

Query  2213  IPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKS  2034
             +P + +    +L  +   L          L   L K+L+  + + E+ W Q SR  W+K+
Sbjct  654   LPNQIKITREKLGEL---LDAPPSHHTAELRNALTKQLDSLMAKNEVYWRQCSRATWLKA  710

Query  2033  GDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTN  1854
             GDRN++F+    + +R ++ +S L D  GH    +  L + V +YF  LF++      T 
Sbjct  711   GDRNSKFFHYKASSRRRRNTISALEDEHGHWQTTEQGLTQTVVNYFQHLFSSTGSSEYTE  770

Query  1853  FCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSL  1674
                G    + EE   ++ A FTPE+IK ALF M P KA GPDGF+P F+ K WP VG  +
Sbjct  771   VVDGVRGRVTEEMNQALLAVFTPEEIKIALFQMHPSKAPGPDGFSPFFYQKYWPIVGEDV  830

Query  1673  FSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKD  1494
              + V  FF+ G L    N T ++LIPKV  P+ + Q RPI LCNV+YK+  KV+  RLK 
Sbjct  831   VAAVLHFFKTGKLLKRINFTHVALIPKVHEPKNMMQLRPISLCNVLYKIGAKVLTTRLKA  890

Query  1493  MVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWC  1317
             ++  L+   QS+FV GR I+DN++   E+L+    K +GR G++ALK+D+ KAYDR+ W 
Sbjct  891   ILPTLISDTQSAFVPGRAISDNSIVAFELLHMMHKKNQGRQGYLALKIDMSKAYDRVEWS  950

Query  1316  FIEDTLRDIGF  1284
             F+E  ++ +GF
Sbjct  951   FLEALMKGMGF  961


 Score =   226 bits (575),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 144/437 (33%), Positives = 235/437 (54%), Gaps = 14/437 (3%)
 Frame = -3

Query  1308  GYSPRYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAER  1129
             G++PR      WI+ IM CVT+     + NG    ++ P++GLRQGDP+SP LF+LCAE 
Sbjct  960   GFAPR------WIQLIMECVTTVSYSFMLNGNPVGYVIPQRGLRQGDPLSPYLFLLCAEA  1013

Query  1128  LSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCS  949
             LS ++  + R     GV + R AP++SHLFFADD   F  A+     ++      +   S
Sbjct  1014  LSSLILQAERRNLLHGVNLCRGAPSVSHLFFADDSFLFLRADQQDCEQLSIIFQKYEMVS  1073

Query  948   GQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILE  769
             GQKI+L+KS + FS N +   Q N+AA LG+  V     +LGLP+  GR ++  F+++ E
Sbjct  1074  GQKIHLEKSCVSFSINMDRTDQDNLAAVLGVRRVDQHDVYLGLPTHVGRSRRQCFNSLKE  1133

Query  768   RIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSR  589
             RI  ++ G  ++ LS AG  ++++ V  A+P Y M   LIP  + + I++++  + W  +
Sbjct  1134  RIWKKIQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCNEIQQVMARYWWVEQ  1193

Query  588   EGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYD  409
             +G+ K H + W  +   K  GGLG ++L   N+A LAK  WRL Q  N L   + KA+Y 
Sbjct  1194  DGQRKIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVACILKARYF  1253

Query  408   FDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEA  229
              + S+  + Q   + S  W+ + +A  +   G +W + NG + R W D WL +   F+ +
Sbjct  1254  KNCSILEA-QIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVS  1312

Query  228   SAPI---APSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVW  58
             S  +     + +N+L+    +    W  D+L        +N +    L       D L+W
Sbjct  1313  SPQVEGFEEAKVNSLINPVTLQ---WKEDLLQAWFSAEEVNCIRNIPLSFRH-PPDILIW  1368

Query  57    YKEPNGLFSVSSAYELA  7
             + E +G ++V S +++A
Sbjct  1369  HFERDGQYTVRSGHDVA  1385



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   266 bits (681),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/637 (30%), Positives = 294/637 (46%), Gaps = 62/637 (10%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQA--------------------N  2949
             WNCQG  S    R+L+  ++  +PS++ L E K  + +                     +
Sbjct  6     WNCQGLGSDLTIRSLRETIKGKRPSIVFLMETKQKQNRLTRLARDVGFDHEGSSGGYHLS  65

Query  2948  EICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVS-----APW  2784
              +   +GFD  +  + VG SGG+ L+    + +E+       I   V +  S     A W
Sbjct  66    RLARDVGFDHEVYADPVGTSGGLCLWWDDRVQVEVTICSKYLIDSWVTEQGSGVRFRASW  125

Query  2783  LMSVVY--------GCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKET  2628
             +    Y        G LD  L   +F             WL +GDFN +    E      
Sbjct  126   VYGSPYRDEKEACWGWLDSVLGSVVFP------------WLCIGDFNDMLWDFEKRGGRR  173

Query  2627  FSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDA  2448
                +R     +++  +EL+DLG+ GSS+TW            RLDR L NV     +P++
Sbjct  174   LDNNRRRYLQEFLDKKELVDLGYQGSSFTWRGTRADGVVVQERLDRGLINVPWQETWPNS  233

Query  2447  KVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW------RSD  2286
                HLP +GSDH P+LI +T    +     FKF   W +    +  V   W       S 
Sbjct  234   HAIHLPAVGSDHCPVLI-LTEINVRRGLKPFKFEAFWASDPECREVVDRSWGLCSPAASC  292

Query  2285  LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrk  2106
                 T        L  WS   F N       LL+ L+ +Q         +     + + +
Sbjct  293   FSWDTKLGTCRTELKQWSDGKFKNNRIMATALLSDLDSLQRDW-----EENTVKIKEVER  347

Query  2105  eleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDG  1926
              L +    EEL W QR++ +W+K GD NT F+   T  KR ++ + ++ +  G     + 
Sbjct  348   SLNQVWRCEELYWKQRAKIQWLKHGDANTAFFHNCTIQKRRRNYLGRIRNLAGDWEMGED  407

Query  1925  LLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED--WASVNAPFTPEDIKTALFDMV  1752
              +   + DYF  LFT+E   +  +     F P++  D   AS+ AP + E+I+  +F M 
Sbjct  408   HVRSIIEDYFKNLFTSEGPRDWGDIL--AFVPVVISDNINASLLAPISDEEIRITVFQMG  465

Query  1751  PCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERI  1572
               K+ GPDGF+  F+ K W  VG  +   V  FF + +     N T ++LIPKV +PE +
Sbjct  466   ALKSPGPDGFSGIFYQKYWSIVGNDVCRLVKNFFSNTMSMETLNRTEIALIPKVPHPEWV  525

Query  1571  TQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFR  1392
             TQFRPI LCN  YK+I+K++  RL+  + K++ P Q +F+ GRQI DN L   E  ++ +
Sbjct  526   TQFRPISLCNYSYKIISKILANRLQPFLDKIISPQQCAFIPGRQIQDNVLVAHEAFHSLK  585

Query  1391  T-KKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
               KK ++  M LK+D+ KAYDR+ W F++  L  +GF
Sbjct  586   IRKKTKIFEMGLKLDMSKAYDRIEWDFVQAVLLKMGF  622


 Score =   227 bits (579),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 139/428 (32%), Positives = 221/428 (52%), Gaps = 13/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R ++ C++S     + NG++  +  P +GLRQGDP+SP LF++ ++ LS M++ +V  
Sbjct  626   WVRWVLRCLSSVEFAVIVNGKVGSYFKPTRGLRQGDPLSPYLFLIVSDVLSSMINQAVTH  685

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+K  R  P +SHLFFADD + F +A       + + LD +C+ SGQ +N +KS++
Sbjct  686   GFIQGMKFGRGGPVLSHLFFADDSLMFLKATENNCRVIVRILDAYCTASGQLVNFEKSNM  745

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS NT L  +  + A L +    D GK+LGLP+I GR KK +   + ++I  ++ G   
Sbjct  746   FFSPNTPLEVKDRLRAILNVTISEDPGKYLGLPTIWGRSKKMALAFVKDKILGKIQGWKH  805

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS AG  V+++SV  A+P Y M   L P+G    I+ ++  F WG  +  NK H + W
Sbjct  806   GLLSQAGREVLIKSVAQAVPSYPMSVFLFPNGFCQEIDSILANFWWGQSQQSNKIHWISW  865

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G ++LK  N+A LAK  WR+  +    W  L K+KY F    +     
Sbjct  866   KDLGMPKNEGGMGFRNLKDFNVALLAKQGWRMVTEPQAFWAQLLKSKY-FPNCDFLRAGK  924

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                SS AW  +L   +I  NG +W V +G     W D W+   P   E +  + PS L+ 
Sbjct  925   GAKSSWAWSSLLVGRNIIMNGARWQVLDGSRVHLWTDKWI---PGCTEHA--LQPSHLSQ  979

Query  195   LVANYWIS------NEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
             +     +       +  W+ + +  +   +    +    L  D    DRL+W     G +
Sbjct  980   VDLEAKVETIIDCHSREWNLEAIGGMFSPNAAKIIKAMPLG-DGWEKDRLIWPLNQTGSY  1038

Query  33    SVSSAYEL  10
             +V S Y +
Sbjct  1039  TVKSGYNM  1046



>gb|EEC79647.1| hypothetical protein OsI_20882 [Oryza sativa Indica Group]
Length=1784

 Score =   278 bits (711),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/613 (31%), Positives = 305/613 (50%), Gaps = 29/613 (5%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  + +  R L    R     L+ L E + S  +   + S LG   ++     G S
Sbjct  6     WNCRGIGNAATVRDLCALSREAGSQLVFLCETRQSVERMRRLRSRLGLRGFVGENCNGMS  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ LF   S+ +EI   + ++I   V  +V+ P W ++ VYG   +  R  +++ L+  
Sbjct  66    GGLALFWDESVFVEIKGINERYIDAYVRLSVNDPIWHVTFVYGEPRVEHRHRMWSMLNSI  125

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +    WL +GDFN    Q E  +K+  S  +   F D +   EL DLGF G  YT+  
Sbjct  126   KQSSNLPWLVLGDFNETLWQFEHFSKKKRSEVQMQAFRDVLQTYELHDLGFKGLPYTYDN  185

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-F  2355
               +  +    RLDR +++      F  ++V HL    S+H P+++       Q    +  
Sbjct  186   KREGINNVRVRLDRVVADDGWRDMFRSSQVEHLISPCSNHCPVVLKFCVDTNQPARRKCL  245

Query  2354  KFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGN----IPQ  2205
              + + W         +   W     +SDL D+S   S ++  L  WSR    N    I +
Sbjct  246   HYEIFWEREAELVEVIDESWAALGDKSDLADISRALSQVMAKLHSWSRRKCKNVGREIEK  305

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
              ++RL   +E    S S+   SD +             LY+EE++W QRSR  W+K GDR
Sbjct  306   GRKRLAELIESGADSRSIRSASDNLHEL----------LYREEMLWLQRSRVNWLKEGDR  355

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNR---TN  1854
             NTRF+      +  ++R++KL D +G +      L     +YF  +F+ +  +++   T 
Sbjct  356   NTRFFHSKAVWRAKKNRITKLKDREGTVHSTTAKLEDMATEYFKEVFSADPLLDQSKVTR  415

Query  1853  FCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSL  1674
                    P + E   ++ + F  E+I  A+F + P KA GPDGF   F+ + W  +   +
Sbjct  416   LIQRKVSPAMNE---TLCSEFKEEEISNAMFQIGPLKAPGPDGFPARFYQRHWGFMKNDI  472

Query  1673  FSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKD  1494
                V  FF+ G++P G NDT + LIPK++ P  +  FRPI LCNV+YK+++K ++ RL+ 
Sbjct  473   VRAVKLFFDTGVMPEGVNDTAIVLIPKIEQPMELRDFRPISLCNVIYKVVSKCLVNRLRP  532

Query  1493  MVRKLVGPHQSSFVHGRQITDNT-LAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWC  1317
             ++ +LV P QS+FV GR ITDN  LA++   +  + +K      A K+DL KAYDR+ W 
Sbjct  533   ILDELVSPCQSAFVLGRMITDNAILAFECFHSIQKNRKPESAACAYKLDLSKAYDRVDWG  592

Query  1316  FIEDTLRDIGFNH  1278
             F+E +L  +GF H
Sbjct  593   FLEQSLYKLGFAH  605


 Score =   215 bits (548),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 186/331 (56%), Gaps = 1/331 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM C+T+ R    +NG L    +P +GLRQGDP+SP LF+  A+ LS +++  V  
Sbjct  607   WVRWIMVCITTVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQ  666

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    VK+ R AP +SHL FADD + F +A+++QA  +K+ +  + S +GQ IN  K S+
Sbjct  667   GALSPVKICRQAPGISHLLFADDTLLFFKADNVQAQAVKEVISDYASATGQLINPAKCSI  726

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +++   T+  I  TL I +     ++LG P+  GR+ K  F ++ ERI  RL     
Sbjct  727   MFGESSPPQTRDAIRVTLQIANSGFEDRYLGFPTPEGRMCKGKFQSLQERIWKRLIIWGE  786

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V+++SV+ AIP Y M    +P  V + + +L R F WG  +GK K H   W
Sbjct  787   NLLSSGGKEVLIKSVIQAIPVYVMGIFKLPESVCEELTKLTRNFWWGVEKGKRKTHWKSW  846

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+NGGLG +  +  N A LA+ AWRL  + + L   + KAKY  + S+  +   
Sbjct  847   ECLTRPKSNGGLGFRDFRLFNQALLARQAWRLIVNPDSLCARVLKAKYFPNGSLVDT-SF  905

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRA  283
               N+S  WK I   L + + GI W + NG++
Sbjct  906   GGNASPVWKAIEYGLSLLKEGIIWRIGNGKS  936


 Score =   241 bits (614),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 152/430 (35%), Positives = 229/430 (53%), Gaps = 18/430 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM C+T+ R    +NG L    +P +GLRQGDP+SP LF+  A+ LS +++  V  
Sbjct  1305  WVRWIMVCITTVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFIADGLSLLLEDKVAQ  1364

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    VK+ R AP +SHL FADD + F +A+++QA  +K+ +  + S +GQ IN  K S+
Sbjct  1365  GALSPVKICRQAPGISHLLFADDTLLFFKADNVQAQAVKEVISDYASATGQLINPAKCSI  1424

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +++   T+  I  TL I +     ++LG P+  GR+ K  F ++ ERI  RL     
Sbjct  1425  MFGESSPPQTRDAIRVTLQIANSSFEDRYLGFPTPEGRMCKGKFQSLQERIWKRLIIWGE  1484

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V+++SV+ AIP Y M    +P  V + + +L R F WG  +GK K H   W
Sbjct  1485  NLLSSGGKEVLIKSVIQAIPVYVMGIFKLPESVCEELTKLTRNFWWGVEKGKRKTHWKSW  1544

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+NGGLG +  +  N A LA+ AWRL  + + L   + KAKY  + S+  +   
Sbjct  1545  ECLTRPKSNGGLGFRDFRLFNQALLARQAWRLIVNPDSLCARVLKAKYFPNGSLVDT-SF  1603

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL----LDRPLFEEASAPIAPS  208
               N+S  WK I   L + + GI W + NG++ R W D WL      RP+  + +  +   
Sbjct  1604  GGNASPVWKAIEYGLSLLKEGIIWRIGNGKSVRIWRDPWLPRDFSRRPITRKGNCRL---  1660

Query  207   SLNNLVANYWISNEGWDWDMLDRV-LP--EHILNKLSTFVLQEDTLLGDRLVWYKEPNGL  37
                  V++    N  WD   +++V LP     +  +     QED    D + W+ + +G 
Sbjct  1661  ---KWVSDLLSENGAWDETRVNQVFLPVDAETICSIRVSSRQED----DFVAWHPDKHGK  1713

Query  36    FSVSSAYELA  7
             FSV SAY LA
Sbjct  1714  FSVRSAYGLA  1723


 Score =   213 bits (541),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 125/372 (34%), Positives = 196/372 (53%), Gaps = 27/372 (7%)
 Frame = -1

Query  2351  FNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGN----IPQK  2202
             + + W         +   W     +SDL D+S   S ++  L  WSR    N    I + 
Sbjct  945   YEIFWEREAELVEVIDESWAASGDKSDLADISRALSQVMAKLHSWSRRKCKNVGREIEKG  1004

Query  2201  KRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRN  2022
             ++RL   +E    S S+   SD +             LY+EE++W QRSR  W+K GDRN
Sbjct  1005  RKRLAELIESGADSTSIRSASDNLHEL----------LYREEMLWLQRSRVNWLKEGDRN  1054

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNR---TNF  1851
             TRF+      +  ++R++KL D +G +      L     +YF  +F+ +  +++   T  
Sbjct  1055  TRFFHSKAVWRAKKNRITKLKDREGTVHSTTAKLEDMATEYFKEVFSADPLLDQSKVTRL  1114

Query  1850  CYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLF  1671
                   P + E   ++ + F  E+I  A+F + P KA GPDGF   F+ + W  +   + 
Sbjct  1115  IQRKVSPAMNE---TLCSEFKEEEISNAMFQIGPLKALGPDGFPARFYQRHWGFMKNDIV  1171

Query  1670  SFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDM  1491
               V  FF+ G++P G NDT + LIPK++ P  +  FRPI LCNV+YK+++K ++ RL+ +
Sbjct  1172  RAVKLFFDTGVMPEGVNDTAIVLIPKIEQPMELRDFRPISLCNVIYKVVSKCLVNRLRPI  1231

Query  1490  VRKLVGPHQSSFVHGRQITDNT-LAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCF  1314
             + +LV P QS+FV GR ITDN  LA++   +  + +K      A K+DL KAYDR+ W F
Sbjct  1232  LDELVSPCQSAFVLGRMITDNAILAFECFHSIQKNRKPESAACAYKLDLSKAYDRVDWGF  1291

Query  1313  IEDTLRDIGFNH  1278
             +E +L  +GF H
Sbjct  1292  LEQSLYKLGFAH  1303



>gb|ABA96650.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1100

 Score =   265 bits (676),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 170/554 (31%), Positives = 282/554 (51%), Gaps = 14/554 (3%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEIL-YTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHL  2733
             V+ VG  GG+ LF   S ++++L YT+         D  +  W  + VYG      R ++
Sbjct  170   VDGVGSGGGLALFWDESFHLDLLSYTNRHIDVLVKEDRSAMQWRCTFVYGEPKAHERHNM  229

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             +  L     N    W  MGDFN    Q E  ++      +  DF + +   ++ DLGF G
Sbjct  230   WTLLRRIKPNSTAPWCLMGDFNEAMWQFEHFSEHKRKEKQMLDFREILSHCDVFDLGFIG  289

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQ  2373
             + +T+            RLDRA+++   S+ +P A+V HL    SDH P+L+  T    +
Sbjct  290   TPWTYDNKRKGGYNVRVRLDRAVASQSWSVLYPQAQVRHLVSSRSDHCPILVQCTPDEDK  349

Query  2372  FCSSR-FKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKSAMV-EALSVWSRDSFGN  2214
                SR  ++ + W    S    +++ W      +DL   ++K  +V  AL  WSR+ FG+
Sbjct  350   DKPSRCMRYEILWEREESLSEEIRTAWEQHHAATDLGSVSSKLKLVMGALQHWSREKFGS  409

Query  2213  IPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKS  2034
             + ++   L  ++E +Q    +G R    +  +   + +EE LY+EE++W QRSR  W++ 
Sbjct  410   VNKELGALRKKMEELQ----LGGRHTHDQEYQSCSRRMEEILYREEMMWLQRSRVAWLRE  465

Query  2033  GDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTN  1854
             GDRNT F++ A    R ++++SKL   DG        +     ++F  L+T +  V    
Sbjct  466   GDRNTSFHRKAAWRHR-KNKISKLFLPDGSWTDQRKEMETMATNFFKDLYTKDPLVTPQP  524

Query  1853  FCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSL  1674
                     + E+    +   F+ ++I  ALF + P KA GPDGF   FF + W  +   +
Sbjct  525   LLDLIMLKVTEQMNEDLCKAFSDKEISDALFQIGPIKAPGPDGFPARFFQRNWEVLKNDV  584

Query  1673  FSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKD  1494
                V  FF+  ++P G N T + LIPK +  + +  FRPI LCNV+YK++ K ++  L+ 
Sbjct  585   CKAVKLFFDQKVMPEGVNTTAIVLIPKKKESKELKDFRPISLCNVIYKVVAKCLVNHLRP  644

Query  1493  MVRKLVGPHQSSFVHGRQITDNTL-AYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWC  1317
             ++  ++   QS+F+ GR ITDN L A++   N  ++K+    + A K+DL KAYDR+ W 
Sbjct  645   ILESIISQEQSAFIPGRMITDNALIAFECFHNIAQSKRESQEFCAYKLDLAKAYDRVDWQ  704

Query  1316  FIEDTLRDIGFNHT  1275
             ++E  L  +GF++T
Sbjct  705   YLEGVLDRMGFSNT  718


 Score =   228 bits (580),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 130/344 (38%), Positives = 192/344 (56%), Gaps = 9/344 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ +M CVTS R    +NG +     P +GLRQGDP+SP LF+  A+ LS ++ S+VR+
Sbjct  719   WIQWMMACVTSVRYAVRFNGSMLKSFQPSRGLRQGDPLSPYLFLFVADGLSTILSSAVRT  778

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+   +KV R AP +SHL FADD + F +AN  QA  +K+ L+L+  C+ Q ++  K S+
Sbjct  779   GDLVPLKVCRQAPGISHLLFADDSLLFFKANVEQATVVKEALNLYERCTSQLLSPAKCSM  838

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K+ +  TQ  I + L +       K+LGLP+  GR+K D F +I ER   RL   + 
Sbjct  839   LFGKHCSDQTQPGIKSLLDVQQNSFEDKYLGLPTPEGRMKADRFQSIKERFFKRLIDWAE  898

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + L + G  V+++SV+ A+P Y M    +P    +   +L+R F WG    + K H   W
Sbjct  899   KHLPMGGKEVLIKSVIQALPTYMMSVFKLPPSFCEEYMQLVRKFWWGEDRSQRKVHWASW  958

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY----DFDPSVWS  388
               +   K+ GG+G K +K  N A LA+ AWRL Q  + L   + KAKY    D   + +S
Sbjct  959   QQLIKPKSMGGMGFKDMKIFNQALLARQAWRLVQFPDSLCARVLKAKYYPNGDLLDTAFS  1018

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL  256
             S      SS++WKGI+  L + + G+ W +  GR    W D WL
Sbjct  1019  S-----VSSDSWKGIVHGLELLKKGVIWRIGTGRKVHIWRDDWL  1057



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score =   277 bits (708),  Expect(2) = 7e-129, Method: Compositional matrix adjust.
 Identities = 177/592 (30%), Positives = 288/592 (49%), Gaps = 11/592 (2%)
 Frame = -1

Query  3032  RTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSIN  2853
             + LK  +   KP L+ L E K      + +   L F +   +  VG  GG+ L    +++
Sbjct  337   QALKALVAKDKPDLVFLMETKNFEPVLSSLQRRLHFQQLFVINPVGLKGGLALLWQDNLS  396

Query  2852  IEILYTHPQFIAFQVYD-NVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMG  2676
             I+I++    +I     + NV+    ++ ++      +R+ L+ ++     +    W+  G
Sbjct  397   IDIIHASEDYIDMLCSEVNVARTMRITCLHAPYSYHMRQLLWQEIRLISISNTWPWICTG  456

Query  2675  DFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARL  2496
             DFN +    E   + + +  R + F+ +I    L+++   G  +TW            RL
Sbjct  457   DFNDILYPWEKVGRRSVAPFRLSSFHSFINDCSLMEVESKGCRFTWTNKRVGDDLIKERL  516

Query  2495  DRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQ  2316
             DR L      + +P A V  LP +GSDHSPLL+     P +    +F +   W      Q
Sbjct  517   DRVLCTSNWRVLYPTAVVFALPAVGSDHSPLLLDTIGTPAK-NRRQFVYEAYWNRDPECQ  575

Query  2315  ACVQSVWRSDLDLST----NKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMG  2148
               VQ  W S     +        +  AL  WSR+ F N  Q+   L  +L  +  + S+ 
Sbjct  576   HIVQRHWNSSRHHQSMFDHKIQVVTRALQAWSREKFQNGHQRINALYQQLTDLNNTPSL-  634

Query  2147  IRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVS  1968
               S+      ++R E+     QEEL W  RSR  W++SGD+N++F+  +T  +R ++R+ 
Sbjct  635   -HSNDTEDASQIRDEIRNLWQQEELFWAMRSRINWLRSGDKNSKFFHASTIQRRQRNRII  693

Query  1967  KLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWAS-VNAPF  1791
              L D +   + D   L +   D+F  L+T+E   N       C P ++  D  + + A  
Sbjct  694   MLQDGNEEWVRDPQALREMTTDFFSQLYTSERARNYNPVLDQC-PSVVTLDMNNQLTASV  752

Query  1790  TPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTI  1611
             T E+++ A F +   KA GPDG    F+   W  +   L   V  FF  G LP   N TI
Sbjct  753   TMEEVQKATFQLGISKAPGPDGLNGLFYQNHWEIIKYDLLRLVEDFFNSGSLPRQLNKTI  812

Query  1610  LSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITD  1431
             ++LIPK  +P+ + Q+RPI LCN  YK+I+KV+  RLK  +  L+   Q++FV GR I D
Sbjct  813   IALIPKTNHPQSLEQYRPISLCNYAYKIISKVLANRLKPWLPNLIAKEQAAFVSGRHIQD  872

Query  1430  NTLAYQEILNAFRTKK-GRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             N L  QE+++ F+ +K  R   + +K D+ KAYDR+ W F++D L  +GF+H
Sbjct  873   NVLILQEVMHQFKARKWKRRHKILVKTDMHKAYDRVEWDFLKDYLLKLGFHH  924


 Score =   215 bits (547),  Expect(2) = 7e-129, Method: Compositional matrix adjust.
 Identities = 138/424 (33%), Positives = 216/424 (51%), Gaps = 12/424 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CVT+  L   +NG    +I P +GLRQGDP+SP LFVL A  LS ++  +V S
Sbjct  926   WVLWVMQCVTTTSLGLRFNGATLPYIQPTRGLRQGDPLSPYLFVLVANVLSTLITQAVSS  985

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  KG+K  R  P +SHLFFADD VFF +    +   M   L+ +C  +GQ IN  KS +
Sbjct  986   GYLKGIKFARSCPTLSHLFFADDSVFFLDGTITECQNMSNILNQYCIATGQTINRNKSGM  1045

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               SK   +  Q+++A    +P +   GK+LG+PS  GR K+D F  I+ R+ +++ G   
Sbjct  1046  ICSKYCPISLQEHLAREFRVPVLQRFGKYLGIPSDWGRSKRDMFSWIVARVSSKMEGWKE  1105

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V++++V+ AIP Y+M    +P  +  ++E+ I  F W +   +   H   W
Sbjct  1106  SLLSKGGKEVLLKAVVQAIPQYAMSVFQLPQSICKTLEQRIAQFWWRNDVSRRGVHWHPW  1165

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK +GGLG + L   N A L K AW+L Q    LW+ LFK  Y F    +   + 
Sbjct  1166  NALKISKHSGGLGFRDLMVFNKALLGKQAWKLVQSPLSLWSQLFKGLY-FPNGSFLRAEI  1224

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIA---PSS  205
                 S  W+ +L         ++W V +G+      D WL   P+      P+A   P  
Sbjct  1225  GYRPSWGWRSLLAGREAILPNLRWSVGDGKRISIRQDQWL---PI-GSIPGPLARDEPQI  1280

Query  204   LNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
             + +L+       + W+  +L R   + I+ ++    ++      D+L+W    +G++SV 
Sbjct  1281  VADLIDPLL---QTWNLPLLQRHYDDCIVREVIKIPIRP-LFTSDQLIWAASKDGIYSVK  1336

Query  24    SAYE  13
             S Y+
Sbjct  1337  SNYQ  1340


 Score = 62.0 bits (149),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 75/174 (43%), Gaps = 6/174 (3%)
 Frame = -3

Query  4320  MWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKM  4141
             +WK E    +    +  +IAKF+   +   V  GGPW+     ++ ++W P         
Sbjct  4     VWKTER-VHISQRDNGLYIAKFQLEKEKQRVADGGPWLFSGHLVIFKQWLPQTPLHWYDF  62

Query  4140  DKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPL  3961
                  W+    LP+E+  +  L++  + IG  V +D T    S  +  RV +++ +  PL
Sbjct  63    TCCAFWVHVYGLPLEWSTEQLLRRAVQQIGSVVAVDSTISAGSTIRHCRVRIEIALANPL  122

Query  3960  LSNFVIN---GTEWPK-EYEGIHQICFKCSIYGHRMETCGLSVPIPAASVDGTA  3811
              +  +I     T W   +YE +   C+ C   GH    C    P  AA ++G +
Sbjct  123   KTGKLIRIAGKTFWLDFKYERLPNFCYSCGRIGHYAMYCP-EYPYDAALLEGNS  175



>ref|XP_010513742.1| PREDICTED: uncharacterized protein LOC104789794 [Camelina sativa]
Length=1787

 Score =   261 bits (668),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/585 (32%), Positives = 289/585 (49%), Gaps = 8/585 (1%)
 Frame = -1

Query  3026  LKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIE  2847
             L+   RLH P  + L E K SR    ++  SLG++    V+ VG SGG+ LF   S  +E
Sbjct  437   LREMRRLHFPDFLFLLETKNSRDYVVKLQRSLGYEYSHIVDPVGLSGGLALFWKPSYEVE  496

Query  2846  ILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFN  2667
             ++    + I  +     S  + +S VYG    +LR+ ++  L     +    WL +GD N
Sbjct  497   VISADHRIIDVKAKLG-SLSFYVSCVYGDPVSSLRQGVWDSLVDIGVSRDAPWLVIGDLN  555

Query  2666  SVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRA  2487
              +   +E       + S    F + I    L ++   G+  +W  G     +    LDRA
Sbjct  556   EMVSNTEKLGGPARAESSFFPFRNMILDCRLREVSSIGNRLSWA-GKRNNMWIQCCLDRA  614

Query  2486  LSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACV  2307
             L N      FP  +  ++  IGSDH  LL+ +        S RF FN  W +   F A V
Sbjct  615   LGNEAWFQLFPRVQGEYMERIGSDHRALLLRLAN-DNVSRSGRFIFNKRWISKPDFAAVV  673

Query  2306  QSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SL-SMGIRSDlv  2130
             QS W  +  ++T +++++  ++   R   G    +      R++ V+  L + G +    
Sbjct  674   QSGW--NKGVTTGQTSVMSRIAECRRTISGWKRSQNLNSKVRIQQVREQLDAEGTKIHPN  731

Query  2129  rlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDA  1953
                 R  +      Y+ EEL W +RSRE+W++ GDRNT+F+  +   +R Q+++  L D 
Sbjct  732   FQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQNKILSLFDE  791

Query  1952  DGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIK  1773
             +G     +G   +    YF  +FT+           G  P + +   A +  P +  +IK
Sbjct  792   NGVEQFSEGSKGEVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDSMNAELIRPVSALEIK  851

Query  1772  TALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPK  1593
              A+F +   K  G DG +  FF + W  VG  +   V +FF  G LP   N T + LIPK
Sbjct  852   NAVFSIKGEKTPGADGMSSQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQICLIPK  911

Query  1592  VQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQ  1413
             VQNP R+T  RPI LC+V+YK ++KV+  RLK  + K+V   Q +FV GR ITDN L   
Sbjct  912   VQNPTRMTNLRPISLCSVLYKTVSKVLCQRLKRFLPKIVSDTQGAFVSGRLITDNILLAH  971

Query  1412  EILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             E+++A +TK G    ++A+K D+ KAYDR+ W F+E+ L  +GF+
Sbjct  972   ELVHALQTKAGCNEEFLAIKTDMSKAYDRVEWNFLEELLIRLGFD  1016


 Score =   228 bits (582),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 152/425 (36%), Positives = 220/425 (52%), Gaps = 14/425 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV S     L NG+   +I P +G+RQGDP+SP LF+LCAE L H+++ + + 
Sbjct  1019  WVNWIMSCVRSVTFSVLINGKEHGFIKPERGIRQGDPLSPFLFILCAEALVHVMNKAEQE  1078

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+T   P++ HL FADD +F   A+ ++   + +CL L+   SGQ+INLQKSS+
Sbjct  1079  GRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKSSI  1138

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K  +   ++ I    GI      GK+LGLP      KKD    I +R+ +RL G   
Sbjct  1139  TFGKKLDPYMRRVIGLFTGIEQEGGAGKYLGLPECFSGSKKDMLAYITDRLTSRLRGWFE  1198

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLSL G  V++++V  A+P Y+M    +       I  ++  F W + E K K H V W
Sbjct  1199  KTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSVMANFWWNAVEEKQKMHWVSW  1258

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + +   N A LAK AWRL    + L   ++KA+Y F    +     
Sbjct  1259  EKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARY-FPSISFMEANL  1317

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPLFEEASAPIAPS  208
                 S AW+ IL    +   G+   + +G  T  WLD W+ D    RP  +E    +   
Sbjct  1318  GPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFDELPRRPCNKEQMINL---  1374

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
                NL  +  I+N+G W+   L  + P   + K+ +F    DT L DRLVW    NG +S
Sbjct  1375  ---NLRVSELITNQGDWNLQALQELFPPCDVIKIRSF--PPDTRLQDRLVWAYTNNGHYS  1429

Query  30    VSSAY  16
             V S Y
Sbjct  1430  VKSGY  1434


 Score = 58.2 bits (139),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 69/171 (40%), Gaps = 7/171 (4%)
 Frame = -3

Query  4347  SFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRP  4168
             S L+  +  +W++      IAL +D F   F++  D   V   G W   D  L  + W  
Sbjct  51    SSLIHEMPRVWRVYNRVRGIALPNDKFQFIFDSEADLSLVLQSGAWTFNDWSLTLERWVE  110

Query  4167  NFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVC  3988
             N  P  + +  L  W+R   +P+ Y   D +K+I   IGR   I           + RV 
Sbjct  111   N--PPSDFLKVLPIWVRIRHIPVNYLTVDTIKEIAGHIGRVTDIAFDPLKPLSRGYVRVR  168

Query  3987  VQLDITKPLLSNFVI-----NGTEWPKEYEGIHQICFKCSIYGHRMETCGL  3850
             V  DI KPL +   +        E   EYE I + C+ C    H    C L
Sbjct  169   VLFDINKPLKNRKELKIPSGEVVEIGFEYERIRKRCYHCLRLTHDKLRCPL  219



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   262 bits (670),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/575 (32%), Positives = 279/575 (49%), Gaps = 22/575 (4%)
 Frame = -1

Query  2957  QANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLM  2778
             QA  +  SLGF     V   G SGG+ LF + +  + +   +  FI   V      PW +
Sbjct  5     QARNLMWSLGFSGSFAVSCEGLSGGLALFWTTAYTVSLRGFNSHFIDVLVSTEELPPWRI  64

Query  2777  SVVYGCLDMALRRHLFADLS*YFFNP-QGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDF  2601
             S VYG     LR H F +L     +  +G WL  GDFN V C  E       S      F
Sbjct  65    SFVYGEPKRELR-HFFWNLLRRLHDQWRGPWLCCGDFNEVLCLDEHLGMRERSEPHMQHF  123

Query  2600  NDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIG  2421
                +    LIDLGF G  +TW    D  S    RLDRA++N E S  F D  V ++    
Sbjct  124   RSCLDDCGLIDLGFVGPKFTWSNKQDANSNSKVRLDRAVANGEFSRYFEDCLVENVITTS  183

Query  2420  SDHSPLLISITTCPQQFCSSR------FKFNMAWTTHYSFQACVQSVWRSD----LDLST  2271
             SDH    ISI    +     R      F+F  AW     ++  V++ WR      + L  
Sbjct  184   SDH--YAISIDLSRRNHGQRRIPIQQGFRFEAAWLRAEDYREVVENSWRISSAGCVGLRG  241

Query  2270  NKSAMVE---ALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkel  2100
               S + +   +L  WS+ SFG++    RR + ++E    SL     +D+V  E +L ++ 
Sbjct  242   VWSVLQQVAVSLKDWSKASFGSV----RRKILKMERKLKSLRQSPVNDVVIQEEKLIEQQ  297

Query  2099  eETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGL  1923
                L++ EE++  QRSR +W++ GDRNT F+    + +R  +R+ +LV  DG        
Sbjct  298   LCELFEKEEIMARQRSRVDWLREGDRNTAFFHARASARRRTNRIKELVRDDGSRCISQEG  357

Query  1922  LLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCK  1743
             + +    ++  LF++E   +           + +     +   +T E+IKTALF M   K
Sbjct  358   IKRMAEVFYENLFSSEPCDSMEEVLDAIPNKVGDFINGELGKQYTNEEIKTALFQMGSTK  417

Query  1742  ASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQF  1563
             A GPDGF   F+   W  +   + + V  F     +P G  D+++ LIPKV N   +++F
Sbjct  418   APGPDGFPALFYQTHWGILEEHICNAVRGFLLGEEIPEGLCDSVVVLIPKVNNASHLSKF  477

Query  1562  RPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKK  1383
             RPI LCNV+YK+ +KV+  RLK  +  +V   QS+FV GR ITD+ L   E L+  R + 
Sbjct  478   RPISLCNVLYKIASKVLANRLKPFLPDIVSEFQSAFVPGRLITDSALVAYECLHTIRKQH  537

Query  1382  GRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              +  + ALK+D+ KAYDR+ W ++   L  +GF+ 
Sbjct  538   NKNPFFALKIDMMKAYDRVEWAYLSGCLSKLGFSQ  572


 Score =   227 bits (578),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 142/424 (33%), Positives = 219/424 (52%), Gaps = 5/424 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CV+S R     NG+LT  + P +G+RQGDPISP LF+LC E LS ++     +
Sbjct  574   WINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLHKKEVA  633

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+K  R  P +SHL FADD +FF +A+S     +K  L  +CS SGQKINL KSS+
Sbjct  634   GELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSI  693

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF K      + ++ + L + + +    +LG+P+  G    + F  + ERI  R++G + 
Sbjct  694   FFGKRCPDAVKISVKSCLQVDNEVLQDSYLGMPTEIGLATTNFFKFLPERIWKRVNGWTD  753

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M+++V  AIP Y M    IP  + + ++  I    WG  +GK K H   W
Sbjct  754   RPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKKKMHWKSW  813

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++  K  GG+G +     N A L +  WRL  D + L + + K +Y  + S W + QP
Sbjct  814   SWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWEAAQP  873

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAPSSLN  199
             K + S  W+ +L    +   G++W V +G+  + + D+W+   RP      +P    +  
Sbjct  874   K-SPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGFRPQLVTTLSPFPTDATV  932

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             + + N       WD D++  + P  I  ++    +       D   W  +  GL+SV SA
Sbjct  933   SCLMNE--DARCWDGDLIRSLFPVDIAKEILQIPISRHG-DADFASWPHDKLGLYSVRSA  989

Query  18    YELA  7
             Y LA
Sbjct  990   YNLA  993



>ref|XP_009118883.1| PREDICTED: uncharacterized protein LOC103843855 [Brassica rapa]
Length=1293

 Score =   274 bits (700),  Expect(2) = 7e-128, Method: Compositional matrix adjust.
 Identities = 172/541 (32%), Positives = 273/541 (50%), Gaps = 11/541 (2%)
 Frame = -1

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ L     +N+++L + P +I   V     A +  + VYG  ++  R+ ++  LS   
Sbjct  15    GGLALLWRSDVNLQVLTSTPHYIDTSVSFK-GAAFFSTFVYGAPEIQHRQGVWNLLSDIS  73

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              N  G W   GDFN +T  SE S       S  + F  ++   +L D+  TG+  +W RG
Sbjct  74    LNRNGAWYLTGDFNEITDNSEKSGGRERPESSFSAFRTFLSSCDLFDIKHTGNFLSW-RG  132

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKF  2349
               +      RLDRA++N   S  FP+ +  +L   GSDH P+L S     ++  S  F++
Sbjct  133   RRSTHLVHCRLDRAMANSAWSDMFPNGRSHYLQFEGSDHRPVL-STFDSKKKKTSRLFRY  191

Query  2348  NMAWTTHYSFQACVQSVWRSDLDLSTNK--SAMVEALSVWSRDSFGNIPQKKRRLLARLE  2175
             +     +   +  V + W S   L+  +  S    A++ WS+ S+ N    ++R++   E
Sbjct  192   DRRLRDNPEIKLLVDATWTSGAHLTVAERISRCRHAIATWSKKSYVN---SQKRIVELKE  248

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
              +  +++  I  D                  EE  W QRSR+ W+  GDRNT F+  AT 
Sbjct  249   SLDQAMTATIVDDSYISLINRDLLQAYK--AEEEFWKQRSRQLWLSLGDRNTGFFHAATK  306

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
              +R ++R+S + D  G+ I ++  + K + +YF  +FT+              P +  E 
Sbjct  307   GRRARNRISVIEDTSGNPIFEEDEIGKVIAEYFRKIFTSSDPAAVDIVNKAITPCITLET  366

Query  1814  WASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
               S+    +  +I+ A+F + P KA GPDGF+  FF   W  VG ++   +  FF  G L
Sbjct  367   NESLTTTPSALEIREAMFAIHPDKAPGPDGFSASFFQSNWDVVGPAITKEIQGFFISGAL  426

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
             P   N T + LIPK+Q+P++++ +RPI LCNV YK I+K++ IRLK ++  +V  +QS+F
Sbjct  427   PYSINSTHIRLIPKIQSPKQVSDYRPIALCNVYYKTISKILSIRLKPVLHDIVSANQSAF  486

Query  1454  VHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             V  R I DN L   E+L+  +     +   MA+K D+ KAYDRL W FI   L  +GFN 
Sbjct  487   VPDRAIQDNVLITHEMLHYLKASGATIHCSMAVKTDISKAYDRLEWSFIRAVLERLGFND  546

Query  1277  T  1275
             T
Sbjct  547   T  547


 Score =   214 bits (546),  Expect(2) = 7e-128, Method: Compositional matrix adjust.
 Identities = 136/423 (32%), Positives = 227/423 (54%), Gaps = 17/423 (4%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             +M C+++     L N ++   + P++G+RQGDP+SP +F++CAE LS +  ++  +G   
Sbjct  552   MMECISTVSYSFLLNNEVVGEVHPQRGIRQGDPLSPYIFIICAEVLSGLCRTAQENGTLP  611

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             GV+V+R  P ++HL FADD + F + + +    + + L  +   SGQ IN QKSS+ FS 
Sbjct  612   GVRVSRYGPKVNHLLFADDTMIFTKTDPLSCTTLVEILQSYEKASGQMINAQKSSISFSS  671

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
              T    +  +   LGI     +GK+LGLP   GR KKD F +I++ ++ + +  S++ LS
Sbjct  672   KTPAEIRSRVKEKLGIDKEGGVGKYLGLPEHFGRRKKDLFASIVDSMRQKAASWSTQFLS  731

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG   M+QSVLSA P ++M S L+P  +   I+ ++  F W  ++G+ K     W  +T
Sbjct  732   TAGKATMIQSVLSAKPNFAMSSFLLPVSLCKQIQTILTRFWWDDKDGEKKICWKSWESLT  791

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
             + K+ GGLG + ++  N A LAK+AWR+    + L   +  +KY +  + ++        
Sbjct  792   HPKSLGGLGFRDVQAFNEALLAKIAWRILTKPDSLLAKVLLSKYCYK-TTFTKVIAGSAI  850

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN--NLV  190
             S+ W+GIL    +    +   + NG  T  W DSW+   P+      PI P  L   +L+
Sbjct  851   SHGWRGILTGRDLLLRHLGRAIGNGETTNLWADSWI--DPI--SNLRPIGPVPLQEKDLM  906

Query  189   ANYWISNEGWDWDM--LDRVLPE---HILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
                 ++ E  +W+   + ++LPE   HILN +   VL      GD  +W  +  G ++V 
Sbjct  907   VADILTRETKEWNTGRIRQLLPELEDHILN-IKPSVLGT----GDSYIWPLQKTGEYTVK  961

Query  24    SAY  16
             + Y
Sbjct  962   TGY  964



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score =   273 bits (697),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/587 (33%), Positives = 281/587 (48%), Gaps = 19/587 (3%)
 Frame = -1

Query  3011  RLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTH  2832
             RL+ P ++ L E K +  +   +   LG      +E  G +GG+ +F     ++ ++   
Sbjct  416   RLYSPEVVALLETKNNSRRYXFLKHRLGMSCMHAIEPRGIAGGLCVFWRDXXDVVLIKYG  475

Query  2831  PQFIAFQVYDNVS-APWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTC  2655
               FI   + D V    W + VVY C D   R   F  L       +  +L MGDF  +  
Sbjct  476   DFFIXVLIEDXVRHLKWRLVVVYACXDERKRAQQFEVLLSXIRGFEXPYLIMGDFXDLLL  535

Query  2654  QSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNV  2475
              SE       S++    F +++    L+DL F G  Y W R      F   RLD  L+  
Sbjct  536   ASEKDGGXAXSVASMRVFRNFVVHASLLDLXFEGYPYXW-RNRREEXFIQERLDXVLATH  594

Query  2474  E*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW  2295
             E    +  A V H+   GSDH+ L++S T   Q     RF ++  W+        V++ W
Sbjct  595   EWVHNYQXAVVKHVVXXGSDHAMLVLS-TEVDQPRRKKRFMYDPRWSXDPKCDEVVRACW  653

Query  2294  -----RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKK--RRLLARLEGVQ*SLSMGIRSD  2136
                  R           MV+   +  + + G   QK+  R   A  E  Q  +  G    
Sbjct  654   GGLHGRPHAYXIMQNLRMVKHGLITXQKNEGRNEQKEICRLKXALREAYQQPVYDG----  709

Query  2135  lvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVD  1956
                  RRL +EL   L +EE+ W  +SR +W+K GD+NTRF+   T  +   +    L  
Sbjct  710   --NXIRRLEEELTXALXREEIFWRTKSRVQWLKEGDKNTRFFHAQTLKRXRXNMJXGLEA  767

Query  1955  ADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE-DWASVNAPFTPED  1779
              DG    D   +     DYF  LFT +  +        C P  + E D A + AP T  +
Sbjct  768   GDGTWCTDATQINSIAVDYFTSLFTMDRPLQFGEXLQ-CVPTRVGEVDNAMLVAPVTDGE  826

Query  1778  IKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLI  1599
             I+ A++ M P K+ GPDGF  GF+H  W TVG  +   V  FF  G +  G N T + LI
Sbjct  827   IEAAIYQMHPTKSPGPDGFNAGFYHHHWETVGAVVLGMVKSFFVSGRMLEGVNHTNIVLI  886

Query  1598  PKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLA  1419
             PKV NP  +  FRPI LCNVVYK+I+KV+  RLK ++ K++ P+QS+FV GRQI+DN L 
Sbjct  887   PKVXNPRNMGHFRPISLCNVVYKIISKVLTNRLKRVLPKVISPNQSAFVAGRQISDNILV  946

Query  1418  YQEILNAFR-TKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
               ++L+  +  K+  V +M +K+D+ KAYDR+ W F+   L  +GF+
Sbjct  947   VHZLLHXMQHGKEDGVDYMXMKLDMAKAYDRVEWAFLNAMLLQLGFD  993


 Score =   214 bits (546),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 139/428 (32%), Positives = 219/428 (51%), Gaps = 19/428 (4%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             +M CV +     + NG+ T +I PR+G++QGD +SP LF++CAE  + ++ +    G  +
Sbjct  1000  VMACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSPFLFLICAEGFTSLLHNXEEMGRLR  1059

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+ VT  A  +SH+FFADD V F  A   +A  +K  L  +   SGQ INL KSS+ FS 
Sbjct  1060  GMSVTEXADPLSHVFFADDXVLFCRATXGEAHTIKGLLQQYAVGSGQFINLDKSSVHFSM  1119

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
               +   ++ ++  LGI      GK+LG+    G  KK  F+ +  R+  R++G + + LS
Sbjct  1120  GCSKALKEQLSQILGIKHQEGFGKYLGIQXDFGASKKKVFEEVRNRLDERINGWAEQFLS  1179

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             +AG  V+++SV +A+P Y+M    +P  +   IE++I  F W  +  K   H + W  V 
Sbjct  1180  MAGKEVLIKSVAAALPXYTMSCFQLPIHLAKEIEQVIARFWWRDQRTKKGIHWMTWNKVA  1239

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K  GGLG + +   NLA LAK+ WRL  +       + +AKY +  S +        +
Sbjct  1240  XKKVYGGLGFREIIDFNLAMLAKVGWRLISNXGSJLARVLQAKY-YPSSSFLDAPVGXGT  1298

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL----LDRPLFEEASAPIAPSSLNN  196
             S  WKGILQ   I + G++W V +    +   D WL      RP       PI  + L +
Sbjct  1299  SWGWKGILQGRKILKAGVRWRVGDXTCIQIGKDPWLPIPRTFRPTSRHEEMPIFVADLVD  1358

Query  195   LVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSVS  25
             +        EG W  ++++    E   ++  T +    +  G  DR+VW+   NG++SV 
Sbjct  1359  M--------EGMWKREVIELCFSE---DEAKTILSMPISRFGCPDRVVWHYTRNGVYSVK  1407

Query  24    SAYELALE  1
             S Y +A E
Sbjct  1408  SGYIVAQE  1415



>ref|XP_010495131.1| PREDICTED: uncharacterized protein LOC104772187 [Camelina sativa]
Length=1814

 Score =   261 bits (668),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/585 (32%), Positives = 289/585 (49%), Gaps = 8/585 (1%)
 Frame = -1

Query  3026  LKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIE  2847
             L+   RLH P  + L E K SR    ++  SLG++    V+ VG SGG+ LF   S  +E
Sbjct  464   LREMRRLHFPDFLFLLETKNSRDYVVKLQRSLGYEYSHIVDPVGLSGGLALFWKPSYEVE  523

Query  2846  ILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFN  2667
             ++    + I  +     S  + +S VYG    +LR+ ++  L     +    WL +GD N
Sbjct  524   VISADHRIIDVKAKLG-SLSFYVSCVYGDPVSSLRQGVWDSLVDIGVSRDAPWLVIGDLN  582

Query  2666  SVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRA  2487
              +   +E       + S    F + I    L ++   G+  +W  G     +    LDRA
Sbjct  583   EMVSNTEKLGGPARAESSFFPFRNMILDCRLREVSSIGNRLSWA-GKRNNMWIQCCLDRA  641

Query  2486  LSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACV  2307
             L N      FP  +  ++  IGSDH  LL+ +        S RF FN  W +   F A V
Sbjct  642   LGNEAWFQLFPRVQGEYMERIGSDHRALLLRLAN-DNVSRSGRFIFNKRWISKPDFAAVV  700

Query  2306  QSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SL-SMGIRSDlv  2130
             QS W  +  ++T +++++  ++   R   G    +      R++ V+  L + G +    
Sbjct  701   QSGW--NKGVTTGQTSVMSRIAECRRTISGWKRSQNLNSKVRIQQVREQLDAEGTKIHPN  758

Query  2129  rlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDA  1953
                 R  +      Y+ EEL W +RSRE+W++ GDRNT+F+  +   +R Q+++  L D 
Sbjct  759   FQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQNKILSLFDE  818

Query  1952  DGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIK  1773
             +G     +G   +    YF  +FT+           G  P + +   A +  P +  +IK
Sbjct  819   NGVEQFSEGSKGEVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDSMNAELIRPVSALEIK  878

Query  1772  TALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPK  1593
              A+F +   K  G DG +  FF + W  VG  +   V +FF  G LP   N T + LIPK
Sbjct  879   NAVFSIKGEKTPGADGMSSQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQICLIPK  938

Query  1592  VQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQ  1413
             VQNP R+T  RPI LC+V+YK ++KV+  RLK  + K+V   Q +FV GR ITDN L   
Sbjct  939   VQNPTRMTNLRPISLCSVLYKTVSKVLCQRLKRFLPKIVSDTQGAFVSGRLITDNILLAH  998

Query  1412  EILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             E+++A +TK G    ++A+K D+ KAYDR+ W F+E+ L  +GF+
Sbjct  999   ELVHALQTKAGCNEEFLAIKTDMSKAYDRVEWNFLEELLIRLGFD  1043


 Score =   226 bits (575),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 151/425 (36%), Positives = 219/425 (52%), Gaps = 14/425 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV S     L NG+   +I P +G+RQGDP+SP LF+LCAE L H+++ + + 
Sbjct  1046  WVNWIMSCVRSVTFSVLINGKEHGFIKPERGIRQGDPLSPFLFILCAEALVHVMNKAEQE  1105

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+T   P++ HL FADD +F   A+ ++   + +CL L+   SGQ+INLQKSS+
Sbjct  1106  GRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKSSI  1165

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K  +   ++ I    GI      GK+LGLP      KKD    I +R+ +RL G   
Sbjct  1166  TFGKKLDPYMRRVIGLFTGIEQEGGAGKYLGLPECFSGSKKDMLAYITDRLTSRLRGWFE  1225

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLSL G  V++++V  A+P Y+M    +       I   +  F W + E K K H V W
Sbjct  1226  KTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWWNAVEEKQKMHWVSW  1285

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + +   N A LAK AW L    + L   ++KA+Y F  + +     
Sbjct  1286  EKMCKSKDQGGLGFRDIGRFNQALLAKQAWCLLDGPSSLLARVYKARY-FPSTSFMEANL  1344

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPLFEEASAPIAPS  208
                 S AW+ IL    +   G+   + +G  T  WLD W+ D    RP  +E    +   
Sbjct  1345  GPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFDELPRRPCNKEQMINL---  1401

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
                NL  +  I+N+G W+   L  + P   + K+ +F    DT L DRLVW    NG +S
Sbjct  1402  ---NLRVSELITNQGDWNLQALQELFPPCDVIKIRSF--PPDTRLQDRLVWAYTNNGHYS  1456

Query  30    VSSAY  16
             V S Y
Sbjct  1457  VKSGY  1461


 Score = 57.8 bits (138),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 69/171 (40%), Gaps = 7/171 (4%)
 Frame = -3

Query  4347  SFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRP  4168
             S L+  +  +W++      IAL +D F   F++  D   V   G W   D  L  + W  
Sbjct  51    SSLIHEMPRVWRVYNRVRGIALPNDKFQFIFDSEADLSLVLQSGAWTFNDWSLTLERWVE  110

Query  4167  NFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVC  3988
             N  P  + +  L  W+R   +P+ Y   D +K+I   IGR   I           + RV 
Sbjct  111   N--PPSDFLKVLPIWVRIRHIPVNYLTVDTIKEIAGHIGRVTDIAFDPLKPLSRGYVRVR  168

Query  3987  VQLDITKPLLSNFVI-----NGTEWPKEYEGIHQICFKCSIYGHRMETCGL  3850
             V  DI KPL +   +        E   EYE I + C+ C    H    C L
Sbjct  169   VLFDINKPLKNRKEMKIPSGEVVEIGFEYERIRKRCYHCLRLTHDKLRCPL  219



>ref|XP_008340956.1| PREDICTED: uncharacterized protein LOC103403885 [Malus domestica]
Length=1256

 Score =   271 bits (692),  Expect(2) = 8e-127, Method: Compositional matrix adjust.
 Identities = 176/553 (32%), Positives = 272/553 (49%), Gaps = 19/553 (3%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVY-DNVSAPWLMSVVYGCLDMALRRHL  2733
             VE  G  GG+ +F     NI  +     +I   V  D + + W +  VY   D   R+  
Sbjct  7     VEPTGIGGGLCVFWKDEANISSIVWSRFYIELGVGCDPLHSDWSLLAVYASTDAKRRKRQ  66

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             + +L        G  + +GDFN +    E       SM+   DF +++   EL+DLGF G
Sbjct  67    WNELGKRISGMTGKCVVIGDFNDIVDDVENDGGNYRSMASTRDFREFLAANELLDLGFEG  126

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQ  2373
               +TW    D    +  RLDR ++       FP AK+ H+ + GSDHS L++S +    Q
Sbjct  127   YPFTWRNKRDEGLIQ-QRLDRGVATAGWVTLFPHAKILHVELEGSDHSMLVLS-SEGKFQ  184

Query  2372  FCSSRFKFNMAWTTHYSFQACVQSVWRSDL------DLSTNKSAMVEALSVWSRDSFGNI  2211
                 RF ++  W      +  ++  WR  +       +S         L  W R +    
Sbjct  185   RVPRRFMYDSRWGKTPECREIIKDAWRVSVVGSVAFKVSEKLKGTRRQLGEWKRVT---K  241

Query  2210  PQKKRRLLARLEGVQ*SL-SMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKS  2034
             P  +RR++   E ++  L    +R D +R + +        L +EEL W  +SR  W++ 
Sbjct  242   PNSQRRIVELREEIRKGLMDENVRHDYLRGKEKALAV---ALKEEELYWKVKSRNTWLRE  298

Query  2033  GDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTN  1854
             GD+NT+F+   T  +R  +++  L D  G    D   + + V  YF  LF +        
Sbjct  299   GDKNTKFFHAQTVQRRRNNQIVGLEDIHGVWHKDPTCVQQIVLHYFNTLFHSG-GSRLEG  357

Query  1853  FCYGCFPPLLE-EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTS  1677
                GC    ++    A +   F+ E+I+ A F +   K+ GPDGFT GFF   W  VG  
Sbjct  358   EVAGCVEIKVDGRQNAELIRLFSAEEIRDAAFQIPATKSPGPDGFTAGFFQDHWEVVGED  417

Query  1676  LFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLK  1497
             +   V  F   G L    N T + LIPKV+NP+R+T+ RPI LCNVVYK+I KV+  RL 
Sbjct  418   IIRMVQAFHHSGRLLKKVNHTHIVLIPKVKNPKRMTELRPIALCNVVYKIIAKVLSRRLT  477

Query  1496  DMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSW  1320
             +++ +++  +QS+FV GRQI DN L   EIL++ +   +G  G MA+K+D+ KAYDR+ W
Sbjct  478   NVMDRIISGNQSAFVPGRQIHDNILIVHEILHSLKQGVEGENGRMAVKLDMAKAYDRVEW  537

Query  1319  CFIEDTLRDIGFN  1281
              F+ D +R++ F+
Sbjct  538   HFLLDVMRNMXFH  550


 Score =   214 bits (546),  Expect(2) = 8e-127, Method: Compositional matrix adjust.
 Identities = 140/426 (33%), Positives = 229/426 (54%), Gaps = 10/426 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR    C++S     L NG  + +  P++GLRQGDP+SP LF++CAE LS  + ++ R+
Sbjct  556   WIRE---CISSVSYSVLINGVPSGFFRPQRGLRQGDPLSPFLFLICAEALSAYIRANERA  612

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   GV+V   A  +SHLFFADD V F +A+  +   + + L+ +   SGQ INL KSS+
Sbjct  613   GLISGVRVAPGAHAISHLFFADDSVVFCKADENEVGTVIRILENYGRESGQIINLAKSSI  672

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF K     T++ I + + I +    GK+LG+ +  G  KK  F+++   +++R+ G + 
Sbjct  673   FFGKWCYKKTKKRIVSRMNIQARDGFGKYLGIQADFGHSKKAVFESVRRGMESRIDGWAE  732

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V+++SV  A+  + M    +P  +   +ER+I  F W ++     C+ V W
Sbjct  733   QFLSPAGKEVLIKSVXMAMXNHVMACFKLPVTLCKEMERVIAXFFWRNQPNTRGCYWVAW  792

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T SK  GGLG + L   NLA LAK+ WR+      + + + + KY F  S +   + 
Sbjct  793   DKLTESKKMGGLGFRDLVGFNLAMLAKIGWRVMDKPESMLSMVLRDKY-FPHSSFXEARQ  851

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
             ++NSS  WKGIL    I   G++W V NG   R   D W+     F+     + P++   
Sbjct  852   QKNSSXGWKGILLGRQIMLRGLRWRVGNGETVRV-ADPWVPKPHSFKPVLXSLDPNT--R  908

Query  195   LVANYWISNEGWDWDMLDR-VLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             +     +  +GW+ + L+R V PE ++  L   +        D+ +W+    G+++V S 
Sbjct  909   VCELMTVDRQGWNLEALERGVAPEDMV--LIRAIPFSRYGCADKRIWHYTKTGVYTVRSG  966

Query  18    YELALE  1
             Y +A++
Sbjct  967   YHVAMD  972



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   253 bits (646),  Expect(2) = 7e-126, Method: Compositional matrix adjust.
 Identities = 151/478 (32%), Positives = 247/478 (52%), Gaps = 15/478 (3%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL +GDFN  T   E   ++     R + F + +    LID+   G +YTW+        
Sbjct  266   WLCVGDFNEATYHWEKVGRKLADFHRMSSFREVLHDCSLIDMESKGCAYTWMSNRQGEDI  325

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
                RLDR L  ++  + FP+A+V     +GSDHSPLL++ T  PQ      F F   W  
Sbjct  326   IKERLDRCLCTLDWRIAFPNAEVCAFLAVGSDHSPLLLN-TDAPQTRRRQPFTFEAFWLQ  384

Query  2330  HYSFQACVQSVWRSDLDLSTNKSAMVE----ALSVWSRDSFGNIPQKKRRLLARLEGVQ*  2163
             H   +  +  VW+    ++ N   +++    AL++WSR +F N  ++   L   L+ +  
Sbjct  385   HPDCKKIISDVWKQASTVAHNLPYLLKKVSLALTLWSRRTFSNAKERITELQYELQQI--  442

Query  2162  SLSMGIRSDl---vrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
                   RSD+         ++ E+++   QEE  W  +SR  W+  GD+NT+F+   T  
Sbjct  443   ----ANRSDIPYDRETATTIKSEIQQLWQQEEQFWAMKSRISWLNWGDKNTKFFHATTIQ  498

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++R++ L+D +   + D  +L      +F  L+ +    +       C   +  E  
Sbjct  499   RRQRNRITMLLDEEQGWVRDAAILKVKTQTFFSNLYKSVGSRDFAPILDQCPCLVTPEIN  558

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
              ++ A  T ++I+ A F +   KASGPDG    F+   W T+   +F  VH+FF  G++P
Sbjct  559   TALTAMVTKDEIQAATFQLGANKASGPDGLNGLFYQSNWDTLQEEVFFSVHQFFTSGLMP  618

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
                N T + L+PK+  P+ +  +RPI LCN  YK+I++V++ RLK ++ +L+   QS+ V
Sbjct  619   LDLNKTDVVLVPKIPLPQSLDHYRPISLCNFGYKIISRVLVNRLKPILPQLISTEQSASV  678

Query  1451  HGRQITDNTLAYQEILNAFRTKKGRVGWMA-LKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              GRQI DN L  QEI++  +  K R  + A LK+D++KAYDR+ W F+   L  +GF+
Sbjct  679   SGRQIQDNILVTQEIIHQIKISKRRRNFPAILKMDMQKAYDRVEWDFLTAYLLKLGFH  736


 Score =   229 bits (583),  Expect(2) = 7e-126, Method: Compositional matrix adjust.
 Identities = 143/424 (34%), Positives = 222/424 (52%), Gaps = 8/424 (2%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W++ I  C++S  +   +NGQ  D+ +P +GLRQGDP+SP LF+L    LS ++  ++
Sbjct  737   PRWVQWIYQCISSASISIKFNGQQMDYFNPTRGLRQGDPLSPYLFILVTNLLSSLIHQAI  796

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G+ +G KV+R +P +SHLFFADD +FF  A + +   +   L  +C  +GQ IN  KS
Sbjct  797   DIGHLQGFKVSRYSPTLSHLFFADDAIFFLTATTTECQNLASILSQYCLATGQSINRNKS  856

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
              +F  K      ++N+A+ L IP +  MGK+LG+PS  G  K + F  IL R+ +++ G 
Sbjct  857   GIFLGKYCPRCLKENLASELRIPVLDRMGKYLGIPSDWGSSKGEMFSWILGRVNSKMEGW  916

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
                 +S  G  V++++V+ AIP Y M    IP  +  SIE+ I  F W +   K   H  
Sbjct  917   KENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEKKIARFWWQNDCRKAGIHWK  976

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
             +W ++  +KA GGLG + L   N A L K AWRL Q  + LW+ LFKA Y F    +   
Sbjct  977   QWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSLWSKLFKAIY-FPAQDFRYA  1035

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
                   S  W+ +L +  +    ++W V +G+      D W L R +    +    PS  
Sbjct  1036  HKGVRPSWGWQSLLSSREVILPNLQWSVGDGKNINIREDRW-LPRGIVGGPANREEPS--  1092

Query  201   NNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
               LVA   + N   W+   L+    E    ++    ++ + L  D+LVW +  NG +++ 
Sbjct  1093  --LVAELLVQNSNHWNLATLNNFYDEQTTAEILRIPVRRN-LTQDKLVWTETTNGQYTIR  1149

Query  24    SAYE  13
             SAY 
Sbjct  1150  SAYH  1153



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score =   251 bits (642),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 165/569 (29%), Positives = 274/569 (48%), Gaps = 12/569 (2%)
 Frame = -1

Query  2966  SRAQANEICSS-LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSA  2790
              +A   ++C    GF+  + + +VG SGG+ ++ +    I   ++   F+     +N + 
Sbjct  245   KQAGVGKLCGEKCGFENGLCIGSVGLSGGMGIWWNDVNAIIRSFSAHHFVVDICDENDAL  304

Query  2789  PWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRC  2610
              W    +YG  + + + + +  +           +  GDFN +   +E          + 
Sbjct  305   VWRAVGIYGWPEASNKHYTWELMRQICVGNHTPTVVFGDFNEIVSLTEKFGGAVRGERQM  364

Query  2609  TDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLP  2430
               F   I    L+DLG+ GS YTW RG+   +    RLDR L+N E    FP  +V H P
Sbjct  365   DAFRTTIDDCRLLDLGYKGSIYTWQRGISMDTLVKERLDRYLANNEWCTMFPYREVLHYP  424

Query  2429  MIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRSDL--DLSTNKSA  2259
             +  SDH+P+L+       ++   + F+F   W +    +  V   W++ +  D+      
Sbjct  425   IFKSDHAPILLKFGKDKTRYAKGKLFRFESLWLSKVECEQVVSRAWKAQVTEDIMARVEH  484

Query  2258  MVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-  2082
             +  +L+ W++ +FG++ ++ +    RL  +Q     G     +  + R      + LY  
Sbjct  485   VAGSLATWAKTTFGDVQKRIKDAERRLHNLQAKPPDGF----ILQQCRAIASELDELYNL  540

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             +E  W  R+R   ++ GDRNT ++    + +R ++ +  L D DG        L   +  
Sbjct  541   KESYWHARARANELRDGDRNTSYFHHKASQRRKRNSIKGLFDRDGVWRTSKEELEGIITQ  600

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
             YF  LF             G  P +    +   +N P   E+IK ALF+M P KA G DG
Sbjct  601   YFDELFAAGNPCEMEAAVAGIEPKVTSRMNQDLLNEP-NGEEIKAALFEMHPNKAPGVDG  659

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
                 FF K W  VG  + +FV +++   +   G N T + LIPK  NP+ +T+FRPI LC
Sbjct  660   MHALFFQKFWHVVGIDVINFVQKWWRGELELAGVNQTCIVLIPKCANPKYMTEFRPISLC  719

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGW  1368
             NV+YK+++K M  +LK  +  L+  +QS+FV  R ITDN L   EI +  + K +G+ G 
Sbjct  720   NVIYKIVSKTMANKLKKCLESLISINQSAFVPKRLITDNALIAFEIFHYMKRKGEGKDGT  779

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             +ALK+D+ KAYDR+ W F+E  +   GF+
Sbjct  780   VALKLDMSKAYDRVEWSFLEKVMLKFGFD  808


 Score =   229 bits (585),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 223/427 (52%), Gaps = 16/427 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM C+ S       N  +   + P +GLRQGDPISP LF+LCA+  S ++D + R 
Sbjct  811   WIQKIMWCLQSVSFSFKLNNTVCGHVVPGRGLRQGDPISPYLFLLCADAFSMLLDKAARE  870

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 GV++ R AP +SHLFFADD + F  AN  +  ++   + L+   SGQK+NL K+ +
Sbjct  871   RAIHGVRICRGAPRISHLFFADDSILFARANLRECSQIADIIKLYERASGQKVNLSKTDV  930

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK  ++  ++ I  TLG+  V    K+LGLP+I GR KK  F  + ERI  +L+G   
Sbjct  931   AFSKKVSVARREEIVDTLGVREVDRHEKYLGLPTIIGRSKKAVFACLKERIWKKLTGWKE  990

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V++++V  AIP Y M    +P G+ID I  L   F WGS + + K H   W
Sbjct  991   KLLSRPGKEVLIKAVAQAIPTYMMSIFRLPDGLIDEIHALFAKFWWGSNDVEKKMHWHNW  1050

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GG+G + LK  N A LAK  WRL ++ + L   +FKA+Y F    + +   
Sbjct  1051  ESLCLPKAMGGMGFRDLKCFNQAMLAKQCWRLFENPHSLLYKVFKARY-FKHDEFLTAHR  1109

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S +W+ I  A  +   G++W V NG + + W ++WL D     +   P A +  + 
Sbjct  1110  GFDPSYSWRSIWGAKSLLLEGLRWRVGNGVSIKVWDEAWLADDDA-NKVPTPTAAAEPHI  1168

Query  195   LVANYWISNEGWDW------DMLDRVLPEHILN-KLSTFVLQEDTLLGDRLVWYKEPNGL  37
             LV+       GW W      + +     + +LN  LS F  ++D        W+    G+
Sbjct  1169  LVSELIDHELGW-WNEAKVREQMVEADADRVLNIPLSKFWPRDDKF------WWPSKTGV  1221

Query  36    FSVSSAY  16
             + V S Y
Sbjct  1222  YEVKSGY  1228



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   247 bits (630),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/531 (32%), Positives = 262/531 (49%), Gaps = 10/531 (2%)
 Frame = -1

Query  2858  INIEILYTHPQFIAFQVYD-NVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLA  2682
             +N+++L      I  +V D N++  W    VYG  + A +   ++ L     N +   L 
Sbjct  38    LNVKLLTFSAHHIHVEVLDDNLNPMWQAMGVYGWPETANKHLTWSLLRQVKQNNEMPLLF  97

Query  2681  MGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGA  2502
              GDFN + C  E       S      F + I   E+ DLG+ G  +TW RG    +    
Sbjct  98    FGDFNEIVCLGEKEGGVPRSERLMDAFREAIDDCEMKDLGYKGCPFTWQRGNSPTTLIRE  157

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR--FKFNMAWTTH  2328
             RLDR L+N E    FP  ++ HLP   SDH+PLL+  T     FC  +  FKF   W + 
Sbjct  158   RLDRMLANEEWCNLFPSWEMLHLPRYRSDHAPLLLK-TGVNDAFCRGQKLFKFEALWLSK  216

Query  2327  YSFQACVQSVWR--SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLS  2154
                   V+  W      D+ +    +   LS W+  +FGN+ ++K+  L  L  +Q    
Sbjct  217   EECGKIVEDAWGDGEGEDMGSRLEFVSRRLSDWAVATFGNLKKRKKEALHLLNRLQ---Q  273

Query  2153  MGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSR  1974
                 +  +   R +  +L+E    EE  W  R+R   ++ GD+NT+++    + +++++ 
Sbjct  274   RAPDATTLEHCRVVSTDLDEIHKLEESYWHARARTNELRDGDKNTKYFHHKASQRKSRNT  333

Query  1973  VSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAP  1794
             +  L+D +G        + + V +YF  LF++   V+      G    + +     + AP
Sbjct  334   IKGLLDENGVWKKGKDEIGEIVSNYFQQLFSSGNPVDMETALEGMQCCVTDSMNVELMAP  393

Query  1793  FTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDT  1614
              T EDI+ ALF M P KA G DGF   FF K W  VG  + SFV R++   +     N T
Sbjct  394   PTGEDIRLALFSMHPNKAPGVDGFHALFFQKFWHIVGRDIISFVLRWWNGDVDLSSINRT  453

Query  1613  ILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQIT  1434
              + LIPK   P  +  FRPI LC V+YK+++K +  +LK  +  ++ P+QS+FV  R IT
Sbjct  454   CVVLIPKCATPLSMKDFRPISLCTVLYKILSKTLANKLKKFLPTIISPNQSAFVPRRLIT  513

Query  1433  DNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             DN L   EI +A + K G   G  ALK+D+ KAYDR+ WCF+E  +  +GF
Sbjct  514   DNALVAFEIFHAMKRKDGTNSGVCALKLDMSKAYDRVEWCFLEKVMEKMGF  564


 Score =   234 bits (596),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 150/423 (35%), Positives = 218/423 (52%), Gaps = 2/423 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CV+S       NG +   + P +GLRQGDPISP LF+LCA+  S ++  +   
Sbjct  568   WIVRVMACVSSVAFTFKINGVVQGSLVPSRGLRQGDPISPYLFLLCADAFSTLITKAANE  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G ++ R AP +SHLFFADD + F  A+  +   +   +  +   SGQ++NL K+ +
Sbjct  628   KKIHGAQICRGAPRISHLFFADDSILFTNASVHECSVVADIISKYERASGQQVNLSKTEV  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+N   G +  I   LG+  V    K+LGLP+I GR KK +F  I ERI  +L G   
Sbjct  688   VFSRNVGRGVRNEIVNVLGVNEVEKQEKYLGLPTIIGRSKKVTFACIKERIWKKLQGWKE  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V++++V+ AIP Y M    +PSG+ID I  LI  F WGS+EG+ K H  KW
Sbjct  748   KLLSRPGKEVLIKAVVQAIPTYMMSVFCLPSGLIDEIHSLIARFWWGSKEGERKMHWHKW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K+ GGLG + L   N A LAK AWRL  +   L + L KA+Y +    +   + 
Sbjct  808   EALCMPKSMGGLGFRDLHCFNQALLAKQAWRLCNNSYSLLSLLLKARY-YKKVEFIDARR  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N S  W+ I  +  +   G+KW V +GR+ R W D+WL+        +  +       
Sbjct  867   GYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWDDAWLMGEGAHLTPTPRLDSDMELR  926

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
             + A       GW+ +++ +   E   + +    L       D L W+   NG FSV S Y
Sbjct  927   VSALLDYEGGGWNVELVRQTFVEEEWDMILKIPLSR-FWPDDHLYWWPTQNGYFSVKSCY  985

Query  15    ELA  7
              LA
Sbjct  986   WLA  988



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score =   266 bits (679),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/604 (30%), Positives = 289/604 (48%), Gaps = 16/604 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG  +P   R LK   + H P ++ L E K S+    ++   LG+D    VE  G S
Sbjct  5     WNCQGLRNPWTIRYLKEMKKDHFPDILFLMETKNSQDFVYKVFCWLGYDFIHTVEPEGRS  64

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ +F    + IE LY     +  QV  + +  W +S VYG     +R  L+  L+   
Sbjct  65    GGLAIFWKSHLEIEFLYADKNLMDLQV-SSRNKVWFISCVYGLPVTHMRPKLWEHLNSIG  123

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
                   W  +GDFN +    E       S S    F   +    + +LG TG+S+TW  G
Sbjct  124   LKRAEAWCLIGDFNDIRSNDEKLGGPRRSPSSFQCFEHMLLNCSMHELGSTGNSFTW-GG  182

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKF  2349
                  +   +LDR   N      FP+A    L   GSDH P+L+  T   + F   +F++
Sbjct  183   NRNDQWVQCKLDRCFGNPAWFSIFPNAHQWFLEKFGSDHRPVLVKFTNDNELF-RGQFRY  241

Query  2348  NMAWTTHYSFQACVQSVWRSDLDLSTNKS--AMVE---ALSVWSRDSFGNIPQKKRRLLA  2184
             +            +   W S +   T+ S  +++E   A+SVW   S  N   + +RL  
Sbjct  242   DKRLDDDPYCIEVIHRSWNSAMSQGTHSSFFSLIECRRAISVWKHSSDTNAQSRIKRLRK  301

Query  2183  RLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQV  2004
              L+  +      I+         ++ +L      EEL W Q+SR++W+  GD+NT F+  
Sbjct  302   DLDAEK-----SIQIPCWPRIEYIKDQLSLAYGDEELFWRQKSRQKWLAGGDKNTGFFHA  356

Query  2003  ATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLL  1824
                 +R ++ +S L+D +      +    K    +F  LFT+   +   N   G    + 
Sbjct  357   TVHSERLKNELSFLLDENDQEFTRNSDKGKIASSFFENLFTSTYILTHNNHLEGLQAKVT  416

Query  1823  EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFED  1644
              E   ++    T  ++  A+F +    A GPDGFT  FF + W  V   + + +  FFE 
Sbjct  417   SEMNHNLIQEVTELEVYNAVFSINKESAPGPDGFTALFFQQHWDLVKHQILTEIFGFFET  476

Query  1643  GILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQ  1464
             G+LP   N T + LIPK+ +P+R++  RPI LC+V+YK+I+K++  RLK  +  +V   Q
Sbjct  477   GVLPQDWNHTHICLIPKITSPQRMSDLRPISLCSVLYKIISKILTQRLKKHLPAIVSTTQ  536

Query  1463  SSFVHGRQITDNTLAYQEILNAFRTKKGRVG--WMALKVDLEKAYDRLSWCFIEDTLRDI  1290
             S+FV  R I+DN L   E++++ RT   R+    MA K D+ KAYDR+ W F+E  +  +
Sbjct  537   SAFVPQRLISDNILVAHEMIHSLRTND-RISKEHMAFKTDMSKAYDRVEWPFLETMMTAL  595

Query  1289  GFNH  1278
             GFN+
Sbjct  596   GFNN  599


 Score =   214 bits (545),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 149/438 (34%), Positives = 222/438 (51%), Gaps = 35/438 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CVTS     L NGQ    I P +G+RQGDP+SP LFVLC E L H+++ + ++
Sbjct  601   WISWIMNCVTSVSYSVLINGQPYGHIIPTRGIRQGDPLSPALFVLCTEALIHILNKAEQA  660

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++      +++HL FADD +   +A   +  E+ +CL  +   SGQ INL KS++
Sbjct  661   GKITGIQFQDKKVSVNHLLFADDTLLMCKATKQECEELMQCLSQYGQLSGQMINLNKSAI  720

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F KN ++  +  I +  GI      GK+LGLP      K+D F  I E++++RL+G  +
Sbjct  721   TFGKNVDIQIKDWIKSRSGISLEGGTGKYLGLPECLSGSKRDLFGFIKEKLQSRLTGWYA  780

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLS  G  V+++S+  A+P Y M    +P  +   +  ++  F W S + K K H + W
Sbjct  781   KTLSQGGKEVLLKSIALALPVYVMSCFKLPKNLCQKLTTVMMDFWWNSMQQKRKIHWLSW  840

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K  GG G K L+  N A LAK AWR+ Q+   L++ +F+++Y F  S + S   
Sbjct  841   QRLTLPKDQGGFGFKDLQCFNQALLAKQAWRVLQEKGSLFSRVFQSRY-FSNSDFLSATR  899

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPLFE--------E  232
                 S AW+ IL    +   G++  + NG+ T  W D WL D    RPL          +
Sbjct  900   GSRPSYAWRSILFGRELLMQGLRTVIGNGQKTFVWTDKWLHDGSNRRPLNRRRFINVDLK  959

Query  231   ASAPIAPSSLNNLVANYWISNEGWDWDMLDRVLP----EHILNKLSTFVLQEDTLLGDRL  64
              S  I P+S N            W+ +ML  + P    E IL +   F  +      D  
Sbjct  960   VSQLIDPTSRN------------WNLNMLRDLFPWKDVEIILKQRPLFFKE------DSF  1001

Query  63    VWYKEPNGLFSVSSAYEL  10
              W    NGL+SV + YE 
Sbjct  1002  CWLHSHNGLYSVKTGYEF  1019



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   281 bits (718),  Expect(2) = 9e-125, Method: Compositional matrix adjust.
 Identities = 193/604 (32%), Positives = 300/604 (50%), Gaps = 20/604 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG  +    R L+    L+ P +I L E K  R     +   LGF +   VE +G S
Sbjct  6     WNCQGVGNTPTVRHLREIRGLYFPEVIFLCETKKRRNYLENVVGHLGFFDLHTVEPIGKS  65

Query  2888  GGIWLFCSVSINIEILYTHPQFI-AFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ L    S+ I++L +  + I A  ++ +    + ++ +YG    A R  L+  L+  
Sbjct  66    GGLALMWKDSVQIKVLQSDKRLIDALLIWQD--KEFYLTCIYGEPVQAERGELWERLTRL  123

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +  G W+  GDFN +   SE         S C +F   +    L ++  +G  ++W  
Sbjct  124   GLSRSGPWMLTGDFNELVDPSEKIGGPARKESSCLEFRQMLNSCGLWEVNHSGYQFSWY-  182

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
             G         RLDR ++N      FP AK T+L  I SDHSPL+ ++     +  +  FK
Sbjct  183   GNRNDELVQCRLDRTVANQAWMELFPQAKATYLQKICSDHSPLINNLVGDNWRKWAG-FK  241

Query  2351  FNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVE------ALSVWSRDSFGNIPQKKRRL  2190
             ++  W     F+  + + W S     TN   M +       +S W R S  +   + + L
Sbjct  242   YDKRWVQREGFKDLLCNFW-SQQSTKTNALMMEKIASCRREISKWKRVSKPSSAVRIQEL  300

Query  2189  LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY  2010
               +L+     +    R        RL+KEL +    EE  W ++SR  W+++GDRNT+++
Sbjct  301   QFKLDAATKQIPFDRRE-----LARLKKELSQEYNNEEQFWQEKSRIMWMRNGDRNTKYF  355

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPP  1830
               AT  +R Q+R+ KL+D +G     D  L +    YF  LF +E DV  T        P
Sbjct  356   HAATKNRRAQNRIQKLIDEEGREWTSDEDLGRVAEAYFKKLFASE-DVGYTVEELENLTP  414

Query  1829  LLEEDWAS-VNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRF  1653
             L+ +   + + AP T E+++ A F + P K  GPDG     + + W T+G  +   V  F
Sbjct  415   LVSDQMNNNLLAPITKEEVQRATFSINPHKCPGPDGMNGFLYQQFWETMGDQITEMVQAF  474

Query  1652  FEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVG  1473
             F  G +  G N T + LIPK+   E++T FRPI LCNV+YK+I K+M  RLK ++  L+ 
Sbjct  475   FRSGSIEEGMNKTNICLIPKILKAEKMTDFRPISLCNVIYKVIGKLMANRLKKILPSLIS  534

Query  1472  PHQSSFVHGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAYDRLSWCFIEDTLR  1296
               Q++FV GR I+DN L   E+L+A  +  K    ++A+K D+ KAYDR+ W F+E  +R
Sbjct  535   ETQAAFVKGRLISDNILIAHELLHALSSNNKCSEEFIAIKTDISKAYDRVEWPFLEKAMR  594

Query  1295  DIGF  1284
              +GF
Sbjct  595   GLGF  598


 Score =   197 bits (501),  Expect(2) = 9e-125, Method: Compositional matrix adjust.
 Identities = 135/431 (31%), Positives = 216/431 (50%), Gaps = 15/431 (3%)
 Frame = -3

Query  1278  YWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVR  1099
             +WIR IM CV S R   L NG     I P +GLRQGDP+SP LFV+C E L  M+ S+ +
Sbjct  601   HWIRLIMECVKSVRYQVLINGTPHGEIIPSRGLRQGDPLSPYLFVICTEMLVKMLQSAEQ  660

Query  1098  SGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
                  G+KV R AP +SHL FADD +F+ + N     ++ + ++ +   SGQ++N  KSS
Sbjct  661   KNQITGLKVARGAPPISHLLFADDSMFYCKVNDEALGQIIRIIEEYSLASGQRVNYLKSS  720

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
             ++F K+ +   +  +   LGI      G +LGLP      K  +   + +R+  ++ G  
Sbjct  721   IYFGKHISEERRCLVKRKLGIEREGGEGVYLGLPESFQGSKVATLSYLKDRLGKKVLGWQ  780

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             S  LS  G  +++++V  A+P Y+M    IP  +   IE ++  F W +++     H   
Sbjct  781   SNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMAEFWWKNKKEGRGLHWKA  840

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  ++  KA GGLG K ++  N+A L K  WR+  + + L   +FK++Y F  S   +  
Sbjct  841   WCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMITEKDSLMAKVFKSRY-FSKSDPLNAP  899

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
                  S AWK I +A  + + GI+  + NG     W D W+  +P   +A+  +  S L 
Sbjct  900   LGSRPSFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWIGAKP--AKAAQAVKRSHLV  957

Query  198   NLVANYWI---------SNEGWDWDMLDRVLPEHIL-NKLSTFVLQEDTLLGDRLVWYKE  49
             +  A   I             W+W+++  + P++   N L+     ++T   DR  W   
Sbjct  958   SQYAANSIHVVKDLLLPDGRDWNWNLVSLLFPDNTQENILALRPGGKETR--DRFTWEYS  1015

Query  48    PNGLFSVSSAY  16
              +G +SV S Y
Sbjct  1016  RSGHYSVKSGY  1026



>emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1389

 Score =   274 bits (701),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/610 (28%), Positives = 301/610 (49%), Gaps = 15/610 (2%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WN +G    +       F + +   ++ L E K     +    S+ GF     + A+GYS
Sbjct  6     WNVRGGCRKNVMEECSDFCKNNNIKILMLCETKSQSPPSQLAVSAAGFLHHDSIPAMGYS  65

Query  2888  GGIWLF---CSVS-INIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
             GG+WLF   C ++  ++ ++Y   +FIA  +   N +  ++   +Y       +   + +
Sbjct  66    GGLWLFWRDCILNPFSLVVIYKSVRFIACSINLLNQNLQFVAIFIYAPAQKEFKSSFWDE  125

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             L  Y  +    ++ +GDFN +   S+      FS SR     +     +  ++ FTG  +
Sbjct  126   LIAYVSSLSFPFIILGDFNEINSPSDKLGGAPFSSSRAYYMQNLFSQVDCTEISFTGQIF  185

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW +  D P+    RLDR +++    + FP A + H     SDH  + +       +  +
Sbjct  186   TWRKKKDGPNNIHERLDRGVASTSWLMLFPHAFLKHHIFTSSDHCQISLEYLA-NNKSKA  244

Query  2363  SRFKFNMAWTTHYSFQACVQSVWRSDLDLS-----TNKSAMVEALSV-WSRDSFGNIPQK  2202
               F+F   W T   + + V+  W +    S       K  +V+  S  W++  FGNI ++
Sbjct  245   PPFRFEKMWCTRKDYDSLVKRTWCTKFYGSHMFNFVQKCKLVKINSKEWNKTQFGNIFRQ  304

Query  2201  KRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDR  2025
              R++  RLE +Q +L +   +  ++ ++ L       L +     W Q+ + +++  GD 
Sbjct  305   LRQVDERLEEIQRNLLIDHNNTSLKTQQELFLAKRNKLLEYNTTYWKQKCKSDFMVLGDT  364

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVN-RTNFC  1848
             N++FY    ++++ ++++ + +  +   I    L+ K +   F   F +        N  
Sbjct  365   NSKFYHTHASIRKYRNQIKEFIPDNAQPITQPDLIEKEITLAFKKRFISNPACKFNQNVD  424

Query  1847  YGCFPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLF  1671
             +    P++ E D A + +  +PE+IK A+FD+ P K+ GPDGF P FF K W  +G S+ 
Sbjct  425   FNLLSPIVSEADNAYLTSAVSPEEIKNAVFDLAPDKSPGPDGFPPYFFQKYWTLIGKSVC  484

Query  1670  SFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDM  1491
               V  FF  G +    N T L+LIPKV  P     FRPI LC+ +YK+I+K++  RLK  
Sbjct  485   RAVQAFFHSGYMLKEVNHTFLALIPKVDKPVNANHFRPISLCSTIYKVISKIITNRLKIT  544

Query  1490  VRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFI  1311
             + K++ P Q +F+  R I DN L   E+ ++F+ K GR GW+A+K+D+EKAYDRL W +I
Sbjct  545   LGKIIHPLQGAFIPERLIQDNILIAHEVFHSFKNKTGRGGWIAIKLDMEKAYDRLEWKYI  604

Query  1310  EDTLRDIGFN  1281
               T+  +GF+
Sbjct  605   YTTMDKMGFS  614


 Score =   204 bits (518),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 127/428 (30%), Positives = 213/428 (50%), Gaps = 5/428 (1%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  I  C++S     L NG   +   P +G+RQGDP+SP LF+LCAE L+     + 
Sbjct  615   PIWIEWIRSCISSASFSVLVNGIPGERFFPSRGIRQGDPLSPYLFILCAELLAREFSKAC  674

Query  1101  RS-GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQK  925
                G   GV + R    +  L FADD + F +A      ++++ LD +C  SGQ +N  K
Sbjct  675   HEPGKLIGVPIGRTRTRIPFLTFADDTMIFAKATEASCHKIRQILDKYCLMSGQLVNYHK  734

Query  924   SSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg  745
             S+   S N     + N A+ LG+    ++G +LG P I+ R+ K++F  ++ +   +L  
Sbjct  735   SAFQCSPNVRDIDKVNFASILGMQESSELGDYLGCPIINSRVTKETFAGVISKTVQQLPK  794

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL  565
               + +LS AG  V++QS L++   + M+S  +P  V+ +++   R F W         + 
Sbjct  795   WKANSLSQAGRTVLIQSNLASKASFQMQSFTLPKKVLTTLDTTYRNFFWNKDPAAKSANF  854

Query  564   VKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS  385
             + W  +   K+ GG+G +  +  N+A   KL W++    + +W  L   KY  + ++   
Sbjct  855   IGWNKICQPKSVGGVGFRKAEVTNIALQMKLLWKIMVSKDNIWVKLVTQKYLKEQNLLVC  914

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSS  205
               P  N+S  WK +L+  + F  G++W + +G+   FW D+W+   PL  +    +   S
Sbjct  915   KIPS-NASWQWKNLLRHRNFFSKGLRWLIGDGQDISFWTDNWIFQYPLNSKYVPTVG--S  971

Query  204   LNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
              N  VA  +    GWD   L  ++P +I+  +S+  +   +   DRL+W   P G +SV 
Sbjct  972   ENIKVAECFNGLGGWDIPKLLTLVPPNIVKAISSVFIPSSS-QQDRLLWGLTPTGQYSVK  1030

Query  24    SAYELALE  1
             S   L  E
Sbjct  1031  SGASLIRE  1038



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score =   263 bits (671),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/555 (31%), Positives = 276/555 (50%), Gaps = 23/555 (4%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHL  2733
             V + G SGG+ L+   S+++++   + ++I   V  +   P W ++ VYG   +  R  +
Sbjct  788   VSSEGMSGGLALYWDESVSVDVKDINKRYIDAYVQLSPEEPQWHVTFVYGEPRVENRHRM  847

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             ++ L     +    W  +GDFN    Q E  ++      +  DF D +   EL DLGF G
Sbjct  848   WSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDFRDVLQDCELHDLGFKG  907

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS-ITTCPQ  2376
               +T+    +       RLDR +++ +    +  A+V HL    SDH P+L++ +   P 
Sbjct  908   VPHTYDNKREGWRNVKVRLDRVVADDKWRDIYSTAQVVHLVSPCSDHCPILLNLVVKDPH  967

Query  2375  QFCSSRFKFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGN  2214
             Q       + + W         ++  W     ++DL D++   + ++ AL  WSR    N
Sbjct  968   QLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKALAKVMTALRSWSRAKVKN  1027

Query  2213  IP---QKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETL-YQEELIWFQRSREE  2046
             +    +K R+ LA L          I S+  R   R   +    L Y+EE++W QRSR  
Sbjct  1028  VGRELEKARKKLAEL----------IESNADRTVIRNATDHMNELLYREEMLWLQRSRVN  1077

Query  2045  WIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDV  1866
             W+K  DRNT+F+      +  ++++SKL DA+  +      L     +YF  ++T + ++
Sbjct  1078  WLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMATEYFQDVYTADPNL  1137

Query  1865  NRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTV  1686
             N           + +     +   FT ++I  A+F + P K+ GPDGF   F+ + W T+
Sbjct  1138  NPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDGFPARFYQRNWGTI  1197

Query  1685  GTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMI  1506
                +   V RFF+ G++P G NDT + LIPK + P  +  FRPI LCNVVYK+++K ++ 
Sbjct  1198  KADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLCNVVYKVVSKCLVN  1257

Query  1505  RLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDR  1329
             RL+ ++  LV   QS+FV GR ITDN L   E  +A  + KK      A K+DL KAYDR
Sbjct  1258  RLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAACAYKLDLSKAYDR  1317

Query  1328  LSWCFIEDTLRDIGF  1284
             + W F+E  +  +GF
Sbjct  1318  VDWRFLEMAMNKLGF  1332


 Score =   214 bits (544),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 213/431 (49%), Gaps = 16/431 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CVTS R +  +NG L    +P +GLRQGDP+ P LF+  A+ LS ++   V  
Sbjct  1336  WVNWIMKCVTSVRYMVKFNGTLLQSFAPTRGLRQGDPLLPFLFLFVADGLSLLLKEKVAQ  1395

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +    KV R AP +SHL FADD + F +A+  +A  +K+ L  +   +GQ IN  K S+
Sbjct  1396  NSLTPFKVCRAAPGISHLLFADDTLLFFKAHQREAEVVKEVLSSYAMGTGQLINPAKCSI  1455

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                  +     + I+  L +       ++LG P+  GR+ K  F ++  +I  R+     
Sbjct  1456  LMGGASTPAVSEAISEILQVERDRFEDRYLGFPTPEGRMHKGRFQSLQAKIWKRVIQWGE  1515

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V++++V+ AIP Y M    +P  VID + +L + F W S  G+ K H   W
Sbjct  1516  NHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQRKTHWKAW  1575

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+ GGLG +  +  N A LA+ AWRL    + L   + KAKY F          
Sbjct  1576  DSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKY-FPHGSLIDTSF  1634

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               NSS AW+ I   L + + GI W V NG + R W DSWL      + +  PI   +   
Sbjct  1635  GSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPR----DHSRRPITGKANCR  1690

Query  195   L--VANYWISNEGWDWDMLDRVL----PEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
             L  V++    +  WD   + +       E ILN   +   +ED      + W+ + NG+F
Sbjct  1691  LKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDF-----IAWHPDKNGMF  1745

Query  33    SVSSAYELALE  1
             SV SAY LA +
Sbjct  1746  SVRSAYRLAAQ  1756


 Score = 74.3 bits (181),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 75/174 (43%), Gaps = 8/174 (5%)
 Frame = -3

Query  4353  SYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEW  4174
             + S L + ++  W+L A     +L  + FI  F    DY+ V  G PW+   D L+  E+
Sbjct  369   NQSALFEDMRRAWRLRAEMSYKSLKDNLFIVSFNAEGDYNFVLQGDPWLHRGDALLVAEF  428

Query  4173  RPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFAR  3994
                 +P +  +D +  W+R   LP+   +    +  G  +G+  ++D+     +K  F R
Sbjct  429   NGLLNPSMVNLDTVPIWVRIYDLPLVMMNRARGELYGSKMGKVREVDVQEDGCNKHDFFR  488

Query  3993  VCVQLDITKPLLSNFVINGTEWPKE--------YEGIHQICFKCSIYGHRMETC  3856
             + V L + +PL     I      KE        YE +   CF C   GH  + C
Sbjct  489   IRVDLPVNRPLRRMLAIKIKVQGKEETRRFHLRYERVPHFCFFCGFIGHSDKEC  542



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score =   263 bits (671),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/555 (31%), Positives = 276/555 (50%), Gaps = 23/555 (4%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHL  2733
             V + G SGG+ L+   S+++++   + ++I   V  +   P W ++ VYG   +  R  +
Sbjct  185   VSSEGMSGGLALYWDESVSVDVKDINKRYIDAYVQLSPEEPQWHVTFVYGEPRVENRHRM  244

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             ++ L     +    W  +GDFN    Q E  ++      +  DF D +   EL DLGF G
Sbjct  245   WSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDFRDVLQDCELHDLGFKG  304

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS-ITTCPQ  2376
               +T+    +       RLDR +++ +    +  A+V HL    SDH P+L++ +   P 
Sbjct  305   VPHTYDNKREGWRNVKVRLDRVVADDKWRDIYSTAQVVHLVSPCSDHCPILLNLVVKDPH  364

Query  2375  QFCSSRFKFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGN  2214
             Q       + + W         ++  W     ++DL D++   + ++ AL  WSR    N
Sbjct  365   QLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKALAKVMTALRSWSRAKVKN  424

Query  2213  IP---QKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETL-YQEELIWFQRSREE  2046
             +    +K R+ LA L          I S+  R   R   +    L Y+EE++W QRSR  
Sbjct  425   VGRELEKARKKLAEL----------IESNADRTVIRNATDHMNELLYREEMLWLQRSRVN  474

Query  2045  WIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDV  1866
             W+K  DRNT+F+      +  ++++SKL DA+  +      L     +YF  ++T + ++
Sbjct  475   WLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMATEYFQDVYTADPNL  534

Query  1865  NRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTV  1686
             N           + +     +   FT ++I  A+F + P K+ GPDGF   F+ + W T+
Sbjct  535   NPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDGFPARFYQRNWGTI  594

Query  1685  GTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMI  1506
                +   V RFF+ G++P G NDT + LIPK + P  +  FRPI LCNVVYK+++K ++ 
Sbjct  595   KADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLCNVVYKVVSKCLVN  654

Query  1505  RLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDR  1329
             RL+ ++  LV   QS+FV GR ITDN L   E  +A  + KK      A K+DL KAYDR
Sbjct  655   RLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAACAYKLDLSKAYDR  714

Query  1328  LSWCFIEDTLRDIGF  1284
             + W F+E  +  +GF
Sbjct  715   VDWRFLEMAMNKLGF  729


 Score =   214 bits (544),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 213/431 (49%), Gaps = 16/431 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CVTS R +  +NG L    +P +GLRQGDP+ P LF+  A+ LS ++   V  
Sbjct  733   WVNWIMKCVTSVRYMVKFNGTLLQSFAPTRGLRQGDPLLPFLFLFVADGLSLLLKEKVAQ  792

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +    KV R AP +SHL FADD + F +A+  +A  +K+ L  +   +GQ IN  K S+
Sbjct  793   NSLTPFKVCRAAPGISHLLFADDTLLFFKAHQREAEVVKEVLSSYAMGTGQLINPAKCSI  852

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                  +     + I+  L +       ++LG P+  GR+ K  F ++  +I  R+     
Sbjct  853   LMGGASTPAVSEAISEILQVERDRFEDRYLGFPTPEGRMHKGRFQSLQAKIWKRVIQWGE  912

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V++++V+ AIP Y M    +P  VID + +L + F W S  G+ K H   W
Sbjct  913   NHLSTGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQRKTHWKAW  972

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+ GGLG +  +  N A LA+ AWRL    + L   + KAKY F          
Sbjct  973   DSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKY-FPHGSLIDTSF  1031

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               NSS AW+ I   L + + GI W V NG + R W DSWL      + +  PI   +   
Sbjct  1032  GSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPR----DHSRRPITGKANCR  1087

Query  195   L--VANYWISNEGWDWDMLDRVL----PEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
             L  V++    +  WD   + +       E ILN   +   +ED      + W+ + NG+F
Sbjct  1088  LKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDF-----IAWHPDKNGMF  1142

Query  33    SVSSAYELALE  1
             SV SAY LA +
Sbjct  1143  SVRSAYRLAAQ  1153



>gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea]
Length=1469

 Score =   280 bits (716),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/616 (31%), Positives = 297/616 (48%), Gaps = 22/616 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S S  R L+  +    PS+I L E K   +    +   L +   + V A G S
Sbjct  374   WNCRGLRSASTVRRLRDVISSDAPSMIFLSETKCLASHVEWLKECLSYFG-VAVSATGLS  432

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ LF    + + +L     +I   V    + P W  +  YG   + LR   +  L   
Sbjct  433   GGLALFWRKDVCVSLLSFCSSYIDVLVRLTPTLPEWRFTGFYGNPAVQLRPRSWDLLRQI  492

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +    WL  GDFN V  Q+EV +  +   S+   F D +   +L D+GFTG  +TW  
Sbjct  493   RHHSICPWLVAGDFNEVVMQNEVESLNSRPASQMRAFRDALLDCQLQDIGFTGFPFTWCN  552

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI-TTCPQQFCSS--  2361
                 P    ARLDRA++    +  FP A V HLP   SDH PLLI +    P     +  
Sbjct  553   KRKAPDTVRARLDRAVATTTWNNLFPRAIVKHLPYGSSDHLPLLIFLDPAAPTSIRPNKR  612

Query  2360  RFKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
             RFKF   WTT       +   W      ++ +    K+ M  +L  W +   G I  + +
Sbjct  613   RFKFEAFWTTIPGCADVIHQSWAPNSQPTNFNYRIQKTRM--SLLKWYQSKVGPIKSRLQ  670

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             ++   L+ +       I  D+   E  L++E      QEE+ W QR +  W++ GDRNT 
Sbjct  671   KIATELDLLA---RQSITDDIKHCESALKEEQASLWKQEEMYWKQRGKIHWLRCGDRNTA  727

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV-DVNRTNFCYGC  1839
             F+  + + KR Q+R++ + +A G  I     ++  +  Y+  LFT+   D          
Sbjct  728   FFHASASEKRTQNRIAGIKNAHGLWITRGPEVITTMLSYYQDLFTSSPPDPIEMERALSI  787

Query  1838  FPPLLEEDW-ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
              P  + +D  A +  P+   ++  A+  M P  + GPDGF P F+ K WPTVG +    V
Sbjct  788   IPRTITDDMRAILERPYNAAEVWPAVRRMKPLSSPGPDGFPPVFYQKYWPTVGQATVEAV  847

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
              +   +G++ P  N + + LIPK  NP+    +RPI L NV YK+ +K++  RLK ++ +
Sbjct  848   LKLLNNGVMEPQLNHSHIVLIPKKSNPQEPAHYRPISLSNVAYKIASKMVANRLKPIMER  907

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAF---RTKKGRVGWMALKVDLEKAYDRLSWCFI  1311
             +V   Q++F+ GR ITDN L   E+ ++    R +  R G  ALK+D+ KA+DRL W F+
Sbjct  908   IVSKEQAAFLSGRSITDNILLAYELNHSIKLARRQSKRYG--ALKLDVSKAFDRLEWPFL  965

Query  1310  EDTLRDIGFNHTGSGT  1263
             E  LR  GF  + + T
Sbjct  966   EQVLRRHGFPASTTDT  981


 Score =   196 bits (497),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 216/424 (51%), Gaps = 17/424 (4%)
 Frame = -3

Query  1266  NIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNW  1087
              IM  V+S     L NG     I P +G+RQGDP+SP LF+LC++ LS ++         
Sbjct  981   TIMRLVSSATYSILINGSPEGHIVPTRGIRQGDPMSPYLFILCSDTLSRLLHEEGAHNPD  1040

Query  1086  KGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFS  907
              G++++   P +SHL FADD + F  A       ++  L  + + SGQ INL+KS+L   
Sbjct  1041  LGIQLSPTVPKISHLLFADDTLIFSAATLTAMEGIRSVLTRYAAISGQLINLEKSALSVP  1100

Query  906   KNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtl  727
                +   +Q ++  +G+P    +GK+LGLPS+ G  KK +F ++ +RI+ R+    ++ L
Sbjct  1101  SEADPHYRQLLSTAVGVPLTDSLGKYLGLPSMIGISKKAAFRSLKDRIQGRILHWHTKFL  1160

Query  726   slag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIV  547
             S AG  V+++SVL +IP Y+M+   IP+ +I  +  L   F W  R G +K HL+ W  +
Sbjct  1161  SKAGKMVLIKSVLQSIPSYTMQCFKIPTTLIRELNSLFSQFWWSDR-GHSKMHLLAWDKL  1219

Query  546   TNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRN  367
               +   GGLG ++L   N A LAK  WR+    + L + + + KY  + S   + +  RN
Sbjct  1220  CEAPVQGGLGFRNLTTFNQALLAKQCWRIFTKDDLLLSRVLQGKYYKNTSFLEA-RLGRN  1278

Query  366   SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPLFEEASAPIAPSSLN  199
              S  W+ +L A ++  +G++W   +G     W   WL      +P+F        P+   
Sbjct  1279  PSFTWRSLLTAKNLLLSGLRWRPGDGVHINVWNSPWLPRAGSFKPMFRN------PALSP  1332

Query  198   NLVANYWISNEGWDWD---MLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             +L  +  IS +  DW+   +    LP      LS  +    +   DR++W+    G ++V
Sbjct  1333  HLRVSDLISPDTCDWNRSYIQQVFLPADAATILS--IPLGSSGHHDRMIWHYSREGTYTV  1390

Query  27    SSAY  16
              S Y
Sbjct  1391  KSGY  1394



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score =   243 bits (621),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 156/542 (29%), Positives = 264/542 (49%), Gaps = 14/542 (3%)
 Frame = -1

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ L     I++ +L T   FI  ++     + +L + +YG  D   R  ++ +L+   
Sbjct  33    GGLILSWKKDIDLTVLSTTDNFIETRISSKGKS-FLTTFLYGEPDHTKRNAVWNELTTLH  91

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              N +  W   GDFN +   SE       +      F  ++   +L DL  +G+ ++W RG
Sbjct  92    ANLKEPWFLTGDFNELQDNSEKKGGPERAEGTFGAFRTFLSENDLFDLKHSGNPFSW-RG  150

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKF  2349
                      RLDRA+SN E    FP  +  +L   GSDH P+L  + T  ++   + F++
Sbjct  151   KRGAHLVRCRLDRAMSNPEWMELFPSCRCQYLKFEGSDHRPILSYLDTTRKK-GHNLFRY  209

Query  2348  NMAWTTHYSFQACVQSVWRSDLDLSTNKSAMV--EALSVWSRDSFGNIPQKKRRLLARLE  2175
             +         +  V  +W++   L      ++   A+  W +    N  Q    L   L+
Sbjct  210   DRRLKDQKEIKELVAEIWQNCTYLGVEARLVLVRRAICKWCKLFQENSKQTIENLRVELD  269

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVAT  1998
                       + D      +   +L    Y  EE  W QRSR  W+  GD N+ ++   T
Sbjct  270   ------DQMTKDDPDEDRIQDINKLILKAYNSEEAYWKQRSRLLWLTLGDSNSGYFHAVT  323

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
               ++ ++R++ + + DG  + ++  +   V  Y+  LFT       ++       P + +
Sbjct  324   KTRKARNRLTVMENKDGIPVYEEDQISALVCSYYDNLFTANQRGEISSTISQALKPCVTQ  383

Query  1817  DWASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDG  1641
             +W  +     +P +IK ALF +   KA GPDGF+  FFH  W T+G S+ + +  FF  G
Sbjct  384   EWNELLTRDPSPAEIKEALFAIHADKAPGPDGFSASFFHSNWETIGQSIITEIQEFFSTG  443

Query  1640  ILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQS  1461
             +L P  N T + LIPK    +R+ ++RPI LCNV YK+I+K++ +RLK ++  ++  +QS
Sbjct  444   VLSPTLNVTHVRLIPKTLGAKRVDEYRPIALCNVYYKVISKLLSLRLKPILCSIISENQS  503

Query  1460  SFVHGRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +F+ GR ITDN L   E+L   +T + +    MA+K+D+ KAYDR+ W FI   ++ +GF
Sbjct  504   AFIPGRAITDNVLITHEVLQFLKTSQAKKQCAMAVKMDMSKAYDRVEWEFIAQVMKRLGF  563

Query  1283  NH  1278
             + 
Sbjct  564   HE  565


 Score =   231 bits (589),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 146/421 (35%), Positives = 219/421 (52%), Gaps = 6/421 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C+TS     L N  +   + P +G+RQGDPISP LF+LC E LS +   +   
Sbjct  567   WINWIMQCITSVSYSYLINDSVYGLVKPHRGIRQGDPISPYLFILCGEVLSGLCRKAELE  626

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +GV+V R  P ++HL FADD + F  + S   L + + L  + S SGQK+N+ KS++
Sbjct  627   GSMRGVRVARGCPRVNHLLFADDTMIFCNSTSESCLALLRILRDYESVSGQKVNIAKSAI  686

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    +Q     LGI     MGK+LGLP   GR KKD F +I++RI+ R +  S+
Sbjct  687   NFSSKTPPEVKQAAKDLLGIQKEGGMGKYLGLPEHFGRKKKDLFTSIVDRIRQRAANWST  746

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M+++VL+AIP Y+M   ++P  + + I+  +  F W     K     V W
Sbjct  747   RFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWWDKSPDKKNMCWVAW  806

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
             G +T  K  GGLG++ ++  N A LAK+AWR+    +CL   +   KY    S      P
Sbjct  807   GKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVLTGKYCHKKSFLDVQTP  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
                 S+ W+ IL    + +  +   + NG+ TR W D W+ L  PL  +   P+  + L+
Sbjct  867   AV-CSHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWISLQAPL--KPYGPVQEAGLD  923

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V++    +  W+ D +D+ LP+    K    +        D  VW    +G++S  S 
Sbjct  924   LRVSDLLTDDLQWNKDKIDKFLPD--FTKQIQCLKPSKEGAEDIYVWLPLESGVYSTKSG  981

Query  18    Y  16
             Y
Sbjct  982   Y  982



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score =   270 bits (689),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 281/588 (48%), Gaps = 44/588 (7%)
 Frame = -1

Query  3005  HKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQ  2826
             H+P  + L E K  R     I + LGFD    VE +G SGG+ LF      + +L+++ +
Sbjct  5     HRPGFVFLSETKNRRPLLQNIQADLGFDHLFTVEPLGLSGGLALFFMDEYRVNVLFSNNR  64

Query  2825  FIAFQ-VYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQS  2649
              I  + V D +     M+ VYG   +  R  ++  L+ +     G W  +GDFN +TC +
Sbjct  65    MIDIEAVIDGIKV--YMTFVYGDPVLERRDQVWERLTRFSTTRNGPWFMIGDFNEITCHN  122

Query  2648  EVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*  2469
             E         S    F   +    +++  FTG   +W+      S    RLDRA+ N + 
Sbjct  123   EKEGGRQRPDSSFLPFKQMLNDCGMLEFLFTGDMLSWVGKRAGGSTVRCRLDRAVGNSDW  182

Query  2468  SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRS  2289
               +FP + V ++ + GSDH P+L  I   P +  S +FKF+  W  +   +  +   W+S
Sbjct  183   HEKFPHSTVKYMRLWGSDHRPILADILIKPTRR-SRKFKFDKRWLDNEELRQIILEGWKS  241

Query  2288  DLDLSTNKSAMV------EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvr  2127
               DL  + + M       +ALS W R    N  +    L  ++EG+         +    
Sbjct  242   P-DLPPHATIMEHISSCRKALSDWRRQHNVNSAKLVEELKEKVEGL-----YADDNATTE  295

Query  2126  lerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADG  1947
                   KEL + L  EEL W Q+SR  W++ GD+NT+F+   T  +R ++++++L+D +G
Sbjct  296   QIAAALKELSDALKAEELFWKQKSRVFWLREGDKNTKFFHALTKQRRARNKITQLLDENG  355

Query  1946  HLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTA  1767
             + + D+  L+     YF  +F +    +  +        +      ++ AP +  +IK A
Sbjct  356   NAVEDEEGLVAIATSYFRQIFESSNPEDIEDALSQVSTSITGAMNDNLTAPVSEWEIKLA  415

Query  1766  LFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQ  1587
             LF M P KA GPDG T  F+ K W  V   L   V++F  +G +  G NDT + LIPK  
Sbjct  416   LFAMHPEKAPGPDGMTALFYQKFWDIVKEDLTRMVNQFLFEGTVTSGLNDTNICLIPKTT  475

Query  1586  NPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEI  1407
              P  + QFRPI LCNV YK+I+K                       GR+I       QE+
Sbjct  476   RPNEMAQFRPISLCNVSYKIISK-----------------------GRKIRQP----QEL  508

Query  1406  LNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHTGSG  1266
              +A RTK  GR   MA+K D+ KAYDR+ W FIE  LR +GF+ T  G
Sbjct  509   FHALRTKPSGRNNRMAIKTDMSKAYDRMEWSFIEAVLRKMGFSETWIG  556


 Score =   205 bits (521),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 210/426 (49%), Gaps = 8/426 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M C+TS +   L NG+    I P +GLRQGDP SP +F+LC E L  +++ +   
Sbjct  554   WIGWVMRCITSVKYKVLMNGEPRGNIIPGRGLRQGDPXSPFIFILCTEALVSLLNHAEIQ  613

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++VTR  P++SHL FADD +FF +A   +  E+ K +  +   SGQ IN  KSSL
Sbjct  614   GKITGMRVTRACPSVSHLLFADDSLFFCKAEPRECEEVMKVVRKYGKASGQCINFDKSSL  673

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K  N+  +Q +   LGI +   MG +LG+P      K   F  + E++  R++G + 
Sbjct  674   LFGKRINVAMRQELKDVLGIQNEGGMGTYLGIPEDISGSKCKLFAFLKEKLMHRVNGWTG  733

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  V+++S+L A+P Y M + L+P  + +++   I  F W S   K   H  KW
Sbjct  734   RWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIAQFWWSSNPPKRGIHWAKW  793

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               V   +  GG+G + +   NLA LAK  WRL Q  + L   + + +Y +  S       
Sbjct  794   EKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFPDSLVARVLRGRY-YRLSSPLRVNT  852

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S  W  I  A  +   GI+  + +G   + W D W+   P     + PIAP    N
Sbjct  853   VTSPSYVWTSISAARKLLLLGIRQKIHSGHEVKVWEDPWVPTTP--ARPAIPIAPVMHPN  910

Query  195   LVANYWISNEGWDWD---MLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
             +  +  I     +WD   + + V PE I   L   +    T   D   W    NG ++V 
Sbjct  911   MRVSDLIDQASKEWDIGLLENYVSPEDI--PLIRSLAISSTHRRDTFCWNYTKNGQYTVK  968

Query  24    SAYELA  7
             S Y LA
Sbjct  969   SGYWLA  974


 Score = 79.7 bits (195),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 105/242 (43%), Gaps = 18/242 (7%)
 Frame = -3

Query  711   HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKA  532
              ++++SV  A+P ++M    +P  V   +   +  F W S   + K   V W  +   K 
Sbjct  1286  EILLKSVGLALPIFAMSCFKLPKDVCAKLTSAMIDFWWSSGNNRKKISWVAWQKLCKDKE  1345

Query  531   NGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAW  352
              GGLG K L+  N + LAK AWR+      L   + + +Y  +     S    R  S AW
Sbjct  1346  AGGLGFKELEKFNQSLLAKQAWRIWDKPESLVARILRHRYFRNSGFLDSGVGSR-PSYAW  1404

Query  351   KGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVANY---  181
             + IL    + + G+   V +G  T+ W D+WL+       A  P +P      V +    
Sbjct  1405  RSILHGRDLLKRGLVRVVGDGNDTKVWTDNWLI-------APLPRSPRYRQGAVVDLTLR  1457

Query  180   ---WISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSVSSAY  16
                 +S++   WD+    L E I ++    +LQ  T  G  D L W    NG++   S Y
Sbjct  1458  VGDLLSDDSNVWDISK--LREVIDDEDIPLILQIKTQRGKNDMLRWGFSRNGVYDSKSGY  1515

Query  15    EL  10
             +L
Sbjct  1516  KL  1517



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   249 bits (637),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/606 (30%), Positives = 291/606 (48%), Gaps = 21/606 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG A+P     L       +P+++ + E  +      +I    GF   + + + G S
Sbjct  6     WNCQGLANPWTVNALHSLCWRDRPNIVFVMETMVDSQVLEKIRKRCGFMNGLCLSSNGNS  65

Query  2888  GGIWLFCS-VSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ L+ + + + +E    H    A  + +N +  W    +YG  + + +   ++ L   
Sbjct  66    GGMGLWWNEMDVTVESFSAH-HIHAVVLDENKNPIWNAMGIYGWPETSNKHLTWSLLRRL  124

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                     L  GDFN +T   E              F + I    + DLG+ G+ +TW R
Sbjct  125   KQQCSLPVLFFGDFNEITSIEEKEGGAPRCERVMDAFREVIDDCAVKDLGYVGNRFTWQR  184

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQF--CSSR  2358
             G    +    RLDR L+N E    FP  +V HLP   SDH+PLL+  T     F   +  
Sbjct  185   GNSPSTLIRERLDRMLANDEWCDNFPSWEVVHLPRYRSDHAPLLLK-TGVNDSFRRGNKL  243

Query  2357  FKFNMAWTTHYSFQACVQSVWRSDL--DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLA  2184
             FKF   W +       V+  W      D++     +  +LS W+  +FGN+ ++K+  L 
Sbjct  244   FKFEAMWLSKEECGKIVEEAWNGSAGEDITNRLDEVSRSLSTWATKTFGNLKKRKKEALT  303

Query  2183  RLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ----EELIWFQRSREEWIKSGDRNTR  2016
              L G+Q       + D         + +   L +    EE  W  R+R   I+ GD+NT+
Sbjct  304   LLNGLQ-------QRDPDASTLEQCRIVSGDLDEIHRLEESYWHARARANEIRDGDKNTK  356

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             ++    + ++ ++ +++L+D +G        +   V  YF GLF T+  VN      G  
Sbjct  357   YFHHKASQRKRRNTINELLDENGVWKKGREEICGVVQHYFEGLFATDSPVNMELALEGLS  416

Query  1835  PPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHR  1656
               +  +   ++    + +++K ALF M P KA G DG    FF K W  +G+ + SFV  
Sbjct  417   HCVSTDMNTALLMLPSGDEVKEALFAMHPNKAPGIDGLHALFFQKFWHILGSDVISFVQS  476

Query  1655  FFEDGILPPGC-NDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
             ++  G+   G  N T + LIPK  +P+ +  FRPI LC V+YK+++K +  RLK ++  +
Sbjct  477   WWR-GMGDLGVVNKTCIVLIPKCDHPQSMKDFRPISLCTVLYKILSKTLANRLKVILPAI  535

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDT  1302
             + P+QS+FV  R ITDN L   EI +A + K   + G  ALK+D+ KAYDR+ WCF+E  
Sbjct  536   ISPNQSAFVPRRLITDNALVAFEIFHAMKRKDANKNGVCALKLDMSKAYDRVEWCFLERV  595

Query  1301  LRDIGF  1284
             ++ +GF
Sbjct  596   MKKMGF  601


 Score =   222 bits (565),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 145/421 (34%), Positives = 214/421 (51%), Gaps = 4/421 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M C++S       NG +   +SP +GLRQGDPISP LF+LCA+  S ++  +   
Sbjct  605   WIDRVMACISSVSFTFNVNGVVEGSLSPSRGLRQGDPISPYLFLLCADAFSTLLSKAASE  664

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G ++ R AP +SHLFFADD + F +A+  +   +   +  +   SGQ++NL K+ +
Sbjct  665   KKIHGAQICRGAPVVSHLFFADDSILFTKASVQECSMVADIISKYERASGQQVNLSKTEV  724

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS++ +   +  I   LG+  V    K+LGLP+I GR KK +F  I ERI  +L G   
Sbjct  725   VFSRSVDRERRSAIVNVLGVKEVDRQEKYLGLPTIIGRSKKVTFACIKERIWKKLQGWKE  784

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V+++SV  AIP Y M    +PSG+ID I  L+  F WGS +   K H   W
Sbjct  785   KLLSRPGKEVLIKSVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGSSDTNRKMHWHSW  844

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K+ GGLG + L   N + LAK AWRL      L   L +A+Y F  S     + 
Sbjct  845   DTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQARY-FKSSELLEARR  903

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N S  W+ I  +  +   G+KW V +G   R W D+W+L          P A S+L+ 
Sbjct  904   GYNPSFTWRSIWGSKSLLLEGLKWCVGSGERIRVWEDAWILGEGA-HMVPTPQADSNLDL  962

Query  195   LVANYW-ISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              V +   ++   W+ + + +   E     + +  L    L  D   W+   NG+FSV S 
Sbjct  963   KVCDLIDVARGAWNIESVQQTFVEEEWELVLSIPLSR-FLPDDHRYWWPSRNGIFSVRSC  1021

Query  18    Y  16
             Y
Sbjct  1022  Y  1022



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score =   240 bits (613),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/540 (31%), Positives = 251/540 (46%), Gaps = 26/540 (5%)
 Frame = -1

Query  2858  INIEILYTHPQFIAFQVYDNVSAP-WLMSVVYG---------CLDMALRRHLFADLS*YF  2709
             IN+EI       +   V +N   P W    +YG           D+  R H    L    
Sbjct  38    INLEISSYSEHHVEAFVKNNEGLPVWRAVGIYGWPEAENKYKTWDLMRRLHGEGSLPTVM  97

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
             F         GDFN +   +E          +   F + I    + DLGF GS +TW RG
Sbjct  98    F---------GDFNEIVSMAEKEGGAIRGERQMDAFREAIDDCAMSDLGFHGSCFTWKRG  148

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FK  2352
               + +    RLDR +        FP   V HLP+  SDH+P+L+       +    R FK
Sbjct  149   NSSATLIRERLDRFMGCARWREVFPWWHVIHLPIYKSDHAPILLKAGLRDPRISGGRSFK  208

Query  2351  FNMAWTTHYSFQACVQSVWRSDL--DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             F   W +    +  V   WR  L  D+    +++   LS W+  +FGNI +K +   ++L
Sbjct  209   FESLWLSRDDCEQVVAESWRGGLGEDIERRIASVATDLSKWAASTFGNIKKKIKVTESQL  268

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
             +  Q +L      D  +       EL      EE  WF R+R   ++ GD+NT ++    
Sbjct  269   KAAQNNLPDAAMFDRCKELSAKLDELHR---MEESYWFARARANELRDGDKNTSYFHHKA  325

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
             + +R ++R+S L DA+     DD  + + ++ YF  LFT        +   G    +   
Sbjct  326   SQRRKRNRISGLWDANNTWQTDDDSIKEIIHAYFDDLFTGGSPTGFADATAGLRSCVTSN  385

Query  1817  DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
                 ++A    E+I+ ALF M P KA GPDG    FF K W  +G  + SFV  ++E   
Sbjct  386   MNQVLDAVPNGEEIRLALFQMHPNKAPGPDGMHALFFQKFWHVIGQDVISFVQNWWEGNR  445

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
                  N T + LIPK   P+ +  FRPI LCNV+YK+++KVM  +LK  +  ++   QS+
Sbjct  446   DLSEINKTCIVLIPKCAEPKCMGDFRPISLCNVLYKIVSKVMANKLKQFLGDIISLQQSA  505

Query  1457  FVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             FV  R ITDN L   EI +A  R  +G  G +ALK+D+ KAYDR+ W F+   +  +GF+
Sbjct  506   FVPKRLITDNALVAFEIFHAMKRRTEGAEGSIALKLDMSKAYDRVEWDFLVCVMSKLGFS  565


 Score =   230 bits (587),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 212/424 (50%), Gaps = 4/424 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I   + S       NG++  ++ P++GLRQGDPISP LF+LCA+  S ++D + R 
Sbjct  568   WIHRIRMLLESTSFTFKINGRVDGFLVPKRGLRQGDPISPYLFLLCADAFSMLIDKAARE  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 GV V R AP +SHLFFADD + F +A   +   +   +  +   SGQK+NL K+ +
Sbjct  628   RAIHGVMVCRGAPRVSHLFFADDSILFAKATLQECSRVADIISTYERASGQKVNLSKTEV  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS N     +++I  TLG+  V    K+LGLP+I GR KK  F  + ERI  +L G   
Sbjct  688   AFSTNVPAERRKDIVETLGVREVDRHEKYLGLPTIIGRSKKAVFACLKERIWKKLQGWKE  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  +M+++V  AIP Y M    IP G+ID I  L   F WGS     K H  KW
Sbjct  748   KLLSRPGKEIMIKAVAQAIPTYMMSIFKIPDGLIDEIHSLFARFWWGSTGSHRKLHWHKW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GGLG + LK  N A LAK  WRL      L   + KA+Y F    +     
Sbjct  808   EDLCLPKAMGGLGFRDLKSFNAALLAKQGWRLIHGTGTLLHKILKARY-FKNCSFLEAPC  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N S +W+ +     +   G KW V NG   R W D+WL           P+A S+ + 
Sbjct  867   GFNPSYSWRSLWGVKDLLMEGTKWRVGNGTQIRVWEDAWLPGHGS-HLVPTPMAHSTADL  925

Query  195   LVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             LV+N      G W+ + L+     H    +    L +     D + W+   +G+FSV S 
Sbjct  926   LVSNLICFESGKWNVEKLNVTFGAHDRRLIRDIPLSQ-PWSSDVMYWWPNKDGVFSVRSG  984

Query  18    YELA  7
             Y LA
Sbjct  985   YWLA  988



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score =   243 bits (621),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/604 (29%), Positives = 298/604 (49%), Gaps = 35/604 (6%)
 Frame = -1

Query  3044  PSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICS---SLGFDEWIRVEAVGYSGGIWL  2874
             P  +  L    R++   ++ L E   +  Q +++C     LGF   I     G SGG+ L
Sbjct  395   PLTQSRLFRLFRMYNYDILFLVE---TLNQCDKVCKLAYDLGFPNVITQPPNGRSGGLAL  451

Query  2873  FCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQG  2694
                 ++++ ++    + I   V  N +  + +S VYG    + R  L+  L     N   
Sbjct  452   MWKNNVSLSLISQDERLIDSHVTFN-NKSFYLSCVYGHPTQSERHQLWQTLEHISDNRNA  510

Query  2693  TWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPS  2514
              WL +GDFN +   +E             +F + +   ++ D+   G  ++W+    T +
Sbjct  511   EWLLVGDFNEILSNAEKIGGPMREEWTFRNFRNMVSHCDIEDMRSKGDRFSWVGERHTHT  570

Query  2513  FKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTC-PQQFCSSRFKFNMAW  2337
              K   LDR   N   +  FP A++  L   GSDH P+L+      P++  S  F+F+   
Sbjct  571   VKCC-LDRVFINSAWTATFPYAEIEFLDFTGSDHKPVLVHFNESFPRR--SKLFRFDNRL  627

Query  2336  TTHYSFQACVQSVWRSDLD-----LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
                 +F+  VQ+ WR++ +     ++   S+  +A++     S  N  Q+ ++L + L  
Sbjct  628   IDIPTFKRIVQTSWRTNRNSRSTPITERISSCRQAMARLKHASNLNSEQRIKKLQSSLNR  687

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
                S     R    +L  +L++ L +    EE+ W Q+SR +W+K GD+NT ++   T  
Sbjct  688   AMES----TRRVDRQLIPQLQESLAKAFSDEEIYWKQKSRNQWMKEGDQNTGYFHACTKT  743

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFPPLLEED  1815
             + +Q+RV+ ++D  G +   D  +  H  D+F  +F+T  + V+  +F    F   +   
Sbjct  744   RYSQNRVNTIMDDQGRMFTGDKEIGNHAQDFFTNIFSTNGIKVSPIDF--ADFKSTVTN-  800

Query  1814  WASVNAPFTPEDIKTALFDMVPC-----KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
               +VN   T E   T ++D + C     KA GPDG T  F+   W  VG  +   V +FF
Sbjct  801   --TVNLDLTKEFSDTEIYDAI-CQIGDDKAPGPDGLTARFYKNCWDIVGYDVILEVKKFF  857

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
             E   + P  N T + +IPK+ NP  ++ +RPI LCNV+YK+I+K ++ RLK  +  +V  
Sbjct  858   ETSFMKPSINHTNICMIPKITNPTTLSDYRPIALCNVLYKVISKCLVNRLKSHLNSIVSD  917

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRVG--WMALKVDLEKAYDRLSWCFIEDTLR  1296
              Q++F+ GR I DN +   E++++ + +K RV   +MA+K D+ KAYDR+ W F+E T+R
Sbjct  918   SQAAFIPGRIINDNVMIAHEVMHSLKVRK-RVSKTYMAVKTDVSKAYDRVEWDFLETTMR  976

Query  1295  DIGF  1284
               GF
Sbjct  977   LFGF  980


 Score =   226 bits (575),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 227/436 (52%), Gaps = 34/436 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM  V S     L NG    +I+P +G+RQGDP+SP LF+LC + LSH+++    S
Sbjct  984   WIGWIMAAVKSVHYSVLINGSPHGYITPTRGIRQGDPLSPYLFILCGDILSHLINGRASS  1043

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +GV++   AP ++HL FADD +FF +AN      +K   D++   SGQKIN+QKS +
Sbjct  1044  GDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYEYYSGQKINVQKSMI  1103

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       TQ  +   L IP+    GK+LGLP   GR KK+ F+ I++R+K R S  S+
Sbjct  1104  TFGSRVYGSTQSRLKQILEIPNQGGGGKYLGLPEQFGRKKKEMFEYIIDRVKKRTSTWSA  1163

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  +M++SV  A+P Y+M    +P G++  IE L+  F W     +     V W
Sbjct  1164  RFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWEKASNQRGIPWVAW  1223

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + L   N A LAK AWRL Q  N L+  + KA+Y  D S+  + + 
Sbjct  1224  KRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYFKDVSILDA-KV  1282

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPL-FEEASAPIAP  211
             ++  S  W  +L  + + + G +  + +G+  R  LD+ ++D    RPL  EE    +  
Sbjct  1283  RKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN-IVDSHPPRPLNTEETYKEMTI  1341

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQED-----------TLLGDRL  64
             ++L     +Y+       WD           +K+S FV Q D           +   D++
Sbjct  1342  NNLFERKGSYYF------WDD----------SKISQFVDQSDHGFIHRIYLAKSKKPDKI  1385

Query  63    VWYKEPNGLFSVSSAY  16
             +W     G ++V S Y
Sbjct  1386  IWNYNTTGEYTVRSGY  1401



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   245 bits (625),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 179/607 (29%), Positives = 283/607 (47%), Gaps = 23/607 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG         L    RLH P ++ L E K        +  SLG D W  VE  G  
Sbjct  6     WNCQGIGGDLTVDNLLEQNRLHTPDMVILLETKNKSXNFIHLKRSLGMDHWFIVEPRGIX  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYD-NVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GGI +F      + +  +    +  +++D  ++  W +  VY   D   RR  + +LS  
Sbjct  66    GGICVFWRDDTPVVLXKSEDFXVELKLWDEKMNCNWRLFGVYASTDEKKRREQWQELSKR  125

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                 +   L +GDFN   C  E             DF ++   EEL+DLG+ G  +TW  
Sbjct  126   IGQERDRCLLIGDFNDXLCNXEXEGGNYRPAVSLRDFRNFXAREELMDLGYEGYPFTWRN  185

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
               ++   +  RLDR ++ +     +P+ K+ H+ + GSDH  LL+S T         +F 
Sbjct  186   NRESMPIQ-QRLDRGMATMGWYEMYPNTKIKHVLLEGSDHXLLLLS-TEKELNRKGRQFS  243

Query  2351  FNMAWTTHYSFQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRL  2190
             F+  W+     +  V   WR  +  S           +   L VW +   G      + +
Sbjct  244   FDGRWSKSEECRTLVGEEWRDKIKGSHAFRFCDKLKHLRRRLKVWYK---GRGXNSAKMI  300

Query  2189  LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY-QEELIWFQRSREEWIKSGDRNTRF  2013
             L   E ++ +    I ++    E + +++     + Q E  W  +SR +W++ GD+NT+F
Sbjct  301   LQLKEEIRVAY---ISNEFASKEVKQKEKEXIAAHXQXETYWKVKSRNQWLREGDKNTKF  357

Query  2012  YQVATTVKRNQSRVSKLVDADGHLICDDGL--LLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
             +  A T+KR +    + ++ DG  I  + L  +     +YF  LF +    N       C
Sbjct  358   FH-AQTLKRRRFNTIRGIE-DGRGIWQZSLKGIGDTAIEYFSDLFQS-CKPNLVEEIQSC  414

Query  1838  FPPLLE-EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
                 L  ED   + A  T  +I  A + +   +A GPDGF+  F+   W TVG  +   V
Sbjct  415   IESRLSIEDNXGLTAMVTXCEIMEAAYQIPXXRAPGPDGFSGCFYQDHWDTVGPDVIKIV  474

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               F+  G L    N T L LI K++ P+ ++Q+ PI LCNV+YK+I KV+  RLK ++ K
Sbjct  475   KAFWHSGTLLRKLNHTNLVLIXKMKCPKNMSQYXPIALCNVIYKIIAKVLXNRLKRVMPK  534

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIED  1305
             ++G +QS+FV  +QI DN L   E L++    K G    MA+K+D+ KAYDR+ W F+  
Sbjct  535   VIGENQSAFVAXKQIQDNILVVHEALHSLIHQKSGDHPGMAIKLDMAKAYDRIEWXFLLG  594

Query  1304  TLRDIGF  1284
              +  +GF
Sbjct  595   MMCSLGF  601


 Score =   223 bits (569),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 232/441 (53%), Gaps = 20/441 (5%)
 Frame = -3

Query  1308  GYSPRYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAER  1129
             G++P +     WI+    C++S     L NG  T    P +GLRQGD +SP LF+LC E 
Sbjct  600   GFAPLF---XKWIKE---CISSVSFSVLINGSPTGXFRPNRGLRQGDXLSPFLFLLCTEG  653

Query  1128  LSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCS  949
             L  ++   +  G   G K++     ++HLFFADD V FG A+  +A  + + L  +   S
Sbjct  654   LXMLIRRGLERGVLHGFKISXAGAPLTHLFFADDSVVFGNASVEEAESIVEVLKTYARGS  713

Query  948   GQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILE  769
             GQ+INL K S+FF  NT+   + NI  +L I S    GK+LGL +  G  KK  F  I +
Sbjct  714   GQEINLTKXSVFFGANTSKKMRANIVDSLMIQSKXGFGKYLGLQADFGHSKKAVFXEIRD  773

Query  768   RIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSR  589
             +I+A +SG + + LS AG  ++V++V  A+P Y+M    +P GV   +ER IR + W   
Sbjct  774   KIEAXMSGWAEQFLSQAGKEILVKTVAMALPNYAMSCFKLPIGVCRDVERAIRNYWWRGN  833

Query  588   EGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYD  409
             E +   H +    +   K  GGLG K ++ +NLAFLAK+ WR++ +   L  ++ + KY 
Sbjct  834   EQRKGIHWISXDRLMKQKKAGGLGFKDIQCVNLAFLAKIGWRITLNPMSLLASVLRDKY-  892

Query  408   FDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEA  229
             F    +      +N+S  WKG+ +A  +   G++W V NG++     D W   +P    A
Sbjct  893   FPGKSFGEXPKGKNTSXGWKGLFEARKVLNLGLRWRVGNGKSINIREDPW-FPKP----A  947

Query  228   SAPIAPSSLNNLVANY---WISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRL  64
             +  + P   NNLV       I ++   W   D +      + +ST ++   +  G  DRL
Sbjct  948   TFKVRPR--NNLVETMVSDLIDSDTKIWRT-DLIANGFHRDDVSTILIIPLSHAGSNDRL  1004

Query  63    VWYKEPNGLFSVSSAYELALE  1
             VW+   NG++SV S Y +AL+
Sbjct  1005  VWHYATNGIYSVKSGYSMALK  1025



>ref|XP_010676027.1| PREDICTED: uncharacterized protein LOC104891937 [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score =   241 bits (616),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 148/482 (31%), Positives = 246/482 (51%), Gaps = 18/482 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             ++ +GDFN ++  S+        M+R  +  +       I++ F+GS YTW +       
Sbjct  8     YIILGDFNEISNSSDKLGGSPPVMARFLNMQNLFNSLPCIEIPFSGSIYTWRKKKGGADN  67

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCP-QQFCSSRFKFNMAWT  2334
                RLDR +++++    FP AK++H     SDH    I++   P Q+  +  FKF   W 
Sbjct  68    IHERLDRGVASIDWLSLFPQAKISHNIFTSSDHCQ--ITLNYIPFQKAKAPPFKFEKMWC  125

Query  2333  THYSFQACVQSVWRSD------LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
             +   +   V+  W +         L+     + E   +W++  FGNI ++ R++  +L+ 
Sbjct  126   SRRDYDTLVKKTWCTHFIGSHMFRLTQKCKLLKEKSKIWNQSQFGNIFRQLRKVDEKLQS  185

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEEL-IWFQRSREEWIKSGDRNTRFYQVATT  1995
             +Q  L     + L+  ++    +    L       W Q+ + +++  GD N+ FY    +
Sbjct  186   LQLLLITEPLNHLLLSKQDTFLQKRSNLLSFSYEYWKQKCKVDYLLLGDTNSSFYHAHAS  245

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLE--  1821
             ++RN++ + +L  AD   I +  ++ + +   F+  FT++   +RT F       LLE  
Sbjct  246   IRRNRNAIKELSKADNDTISNPDIISQELTRAFMERFTSD---SRTCFNSANDFSLLEAI  302

Query  1820  ---EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
                +D   + +  T ++IK+A F + P K+ GPDGF P FF K W  VG S+   V  FF
Sbjct  303   ISVDDNTYLTSLVTCDEIKSATFSLAPDKSPGPDGFPPFFFQKYWTLVGNSVIRAVQAFF  362

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
                 +    N T L+LIPK+ NP     FRPI LC+ +YK+I+K+M  RLK ++  ++ P
Sbjct  363   HSSRILKEINHTFLALIPKIDNPTSANHFRPISLCSTIYKIISKIMTSRLKIVMGHIIHP  422

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
              Q +FV  R I DN L   E+  +F+ K G  GW+A+K+D+EKAYDRL W +I  TL  +
Sbjct  423   LQGAFVPDRLIQDNILIAHEVFQSFKNKSGASGWIAIKLDMEKAYDRLEWNYIFTTLEKL  482

Query  1289  GF  1284
             GF
Sbjct  483   GF  484


 Score =   227 bits (579),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 231/425 (54%), Gaps = 7/425 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +  C+TS     L NG   +  SP +G+RQGDP+SP LF+LCAE L+ ++ SS  S
Sbjct  488   WVNWVKACITSTSFSVLVNGIPGEKFSPSRGIRQGDPLSPFLFILCAELLARLL-SSAAS  546

Query  1095  GNWK--GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
             G  K  GV + R    +  L FADD + F +A +   L +++ LD +C+ SGQ +N  KS
Sbjct  547   GPTKPIGVPIGRSGVKVPFLTFADDTMIFAKATNYSCLVIRQILDKYCAMSGQLVNYHKS  606

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S   + N +   + N A+ L +    D+G++LG P IH ++ K++F +++ +   +L   
Sbjct  607   SFQCTANISEDDKANFASILQMSETFDLGEYLGCPIIHSKVTKETFSSVINKTVGQLPKW  666

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
              +  LS AG  ++++S L++   Y M+S L+P+ ++ S+++  R F W         +L+
Sbjct  667   KANALSQAGRSILIKSNLASKASYQMQSFLLPNSILSSLDKTYRNFFWNKDPNAKSPNLI  726

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K  GGLG +  +  N A   KL WR+ ++   LW NL + +Y  + S++ + 
Sbjct  727   GWDKICKPKVAGGLGFRKAEVNNQALQMKLLWRIVKNDTNLWVNLVRKRYLKNRSLF-TI  785

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             +  +++S  W+ +L    +F+ G++W + +G   RFW D+W    PL  ++     P ++
Sbjct  786   KVSKSASWQWRNLLSLRDLFKKGLRWQIGDGSCVRFWSDNWAFQYPL--DSIITPTPETI  843

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
             N LV +   +N  W+  +L  ++P +I++ +S+  L       D L+W    +G +SV S
Sbjct  844   NFLVKDCLTANGNWNTQLLLSLVPPNIVSHISSIYLPSSP-QQDTLIWGLTSDGEYSVKS  902

Query  21    AYELA  7
                LA
Sbjct  903   GALLA  907



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score =   243 bits (619),  Expect(2) = 8e-122, Method: Compositional matrix adjust.
 Identities = 169/575 (29%), Positives = 286/575 (50%), Gaps = 32/575 (6%)
 Frame = -1

Query  2957  QANEICS---SLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP  2787
             Q +++C     LGF   I     G SGG+ L    ++++ ++    + I   V  N +  
Sbjct  195   QCDKVCKLAYDLGFPNVITQPPNGRSGGLALMWKNNVSLSLISQDERLIDSHVTFN-NKS  253

Query  2786  WLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCT  2607
             + +S VYG    + R  L+  L     N    WL +GDFN +   +E             
Sbjct  254   FYLSCVYGHPTQSERHQLWQTLEHISDNRNAEWLLVGDFNEILSNAEKIGGPMREEWTFR  313

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
             +F + +   ++ D+   G  ++W+    T + K   LDR   N   +  FP A+   L  
Sbjct  314   NFRNMVSHCDIEDMRSKGDRFSWVGERHTHTVKCC-LDRVFINSAWTATFPYAETEFLDF  372

Query  2426  IGSDHSPLLISITTC-PQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLD-----LSTNK  2265
              GSDH P+L+      P++  S  F+F+       +F+  VQ+ WR++ +     ++   
Sbjct  373   TGSDHKPVLVHFNESFPRR--SKLFRFDNRLIDIPTFKRIVQTSWRTNRNSRSTPITERI  430

Query  2264  SAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY  2085
             S+  +A++     S  N  Q+ ++L + L     S     R    +L  +L++ L +   
Sbjct  431   SSCRQAMARLKHASNLNSEQRIKKLQSSLNRAMES----TRRVDRQLIPQLQESLAKAFS  486

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
              EE+ W Q+SR +W+K GD+NT ++   T  + +Q+RV+ ++D  G +   D  +  H  
Sbjct  487   DEEIYWKQKSRNQWMKEGDQNTGYFHACTKTRYSQNRVNTIMDDQGRMFTGDKEIGNHAQ  546

Query  1904  DYFLGLFTTE-VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPC-----K  1743
             D+F  +F+T  + V+  +F    F   +     +VN   T E   T ++D + C     K
Sbjct  547   DFFTNIFSTNGIKVSPIDF--ADFKSTVTN---TVNLDLTKEFSDTEIYDAI-CQIGDDK  600

Query  1742  ASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQF  1563
             A GPDG T  F+   W  VG  +   V +FFE   + P  N T + +IPK+ NP  ++ +
Sbjct  601   APGPDGLTARFYKNCWDIVGYDVILEVKKFFETSFMKPSINHTNICMIPKITNPTTLSDY  660

Query  1562  RPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKK  1383
             RPI LCNV+YK+I+K ++ RLK  +  +V   Q++F+ GR I DN +   E++++ + +K
Sbjct  661   RPIALCNVLYKVISKCLVNRLKSHLNSIVSDSQAAFIPGRIINDNVMIAHEVMHSLKVRK  720

Query  1382  GRVG--WMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              RV   +MA+K D+ KAYDR+ W F+E T+R  GF
Sbjct  721   -RVSKTYMAVKTDVSKAYDRVEWDFLETTMRLFGF  754


 Score =   226 bits (575),  Expect(2) = 8e-122, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 227/436 (52%), Gaps = 34/436 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM  V S     L NG    +I+P +G+RQGDP+SP LF+LC + LSH+++    S
Sbjct  758   WIGWIMAAVKSVHYSVLINGSPHGYITPTRGIRQGDPLSPYLFILCGDILSHLINGRASS  817

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +GV++   AP ++HL FADD +FF +AN      +K   D++   SGQKIN+QKS +
Sbjct  818   GDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYEYYSGQKINVQKSMI  877

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       TQ  +   L IP+    GK+LGLP   GR KK+ F+ I++R+K R S  S+
Sbjct  878   TFGSRVYGSTQSKLKQILEIPNQGGGGKYLGLPEQFGRKKKEMFEYIIDRVKKRTSTWSA  937

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  +M++SV  A+P Y+M    +P G++  IE L+  F W     +     V W
Sbjct  938   RFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWEKASNQRGIPWVAW  997

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + L   N A LAK AWRL Q  N L+  + KA+Y  D S+  + + 
Sbjct  998   KRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYFKDVSILDA-KV  1056

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPL-FEEASAPIAP  211
             ++  S  W  +L  + + + G +  + +G+  R  LD+ ++D    RPL  EE    +  
Sbjct  1057  RKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN-IVDSHPPRPLNTEETYKEMTI  1115

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQED-----------TLLGDRL  64
             ++L     +Y+       WD           +K+S FV Q D           +   D++
Sbjct  1116  NNLFERKGSYYF------WDD----------SKISQFVDQSDHGFIHRIYLAKSKKPDKI  1159

Query  63    VWYKEPNGLFSVSSAY  16
             +W     G ++V S Y
Sbjct  1160  IWNYNTTGEYTVRSGY  1175



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   243 bits (620),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 158/486 (33%), Positives = 241/486 (50%), Gaps = 14/486 (3%)
 Frame = -1

Query  2705  NPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI-RG  2529
             NP   WL  GDFN +    E       + S   +F   +    L DLGF G ++TW    
Sbjct  373   NPTTPWLMAGDFNEILFSHEKQGGRMKAQSAMDEFRHALTDCGLDDLGFEGDAFTWRNHS  432

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQ----QFCSS  2361
                  +   RLDRA++N E    FP A+V +     SDH P++I +    +    +   +
Sbjct  433   HSQEGYIRERLDRAVANPEWRAMFPAARVINGDPRHSDHRPVIIELEGKNKGVRGRNGHN  492

Query  2360  RFKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
              F+F  AW     F+  V+  W        L +  + + +   LS WS +  G++ ++ +
Sbjct  493   DFRFEAAWLEEEKFKEVVKEAWDVSAGLQGLPVHASLAGVAAGLSSWSSNVLGDLEKRVK  552

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
             ++   LE  +      I  D V  E  LR  LE+   Q ++ W QR+   W+  GDRNT 
Sbjct  553   KVKKELETCR---RQPISRDQVVREEVLRYRLEKLEQQVDIYWKQRAHTNWLNKGDRNTS  609

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             F+  + + +R ++R++KL   DG  +  +      + ++F  LFT+    N         
Sbjct  610   FFHASCSERRRRNRINKLRREDGSWVEREEDKRAMIIEFFKQLFTSNGGQNSQKLLDVVD  669

Query  1835  PPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHR  1656
               +      S+ A FT E++K AL  +   KA GPDG   GF+   W  VG  +   V  
Sbjct  670   RKVSGAMNESLRAEFTREEVKEALDAIGDLKAPGPDGMPAGFYKACWDVVGEKVTDEVLE  729

Query  1655  FFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLV  1476
                 G +P G ND  + LIPKV+ PE I   RPI LCNV YKL++KV+  RLK ++  ++
Sbjct  730   VLRGGAIPEGWNDITIVLIPKVKKPELIKDLRPISLCNVCYKLVSKVLANRLKKILPDVI  789

Query  1475  GPHQSSFVHGRQITDNTLAYQEILNAFRTKK-GRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
              P QS+FV GR I+DN L   E+ +  R K+ G+VG+ A K+D+ KAYDR+ W F+ D +
Sbjct  790   SPAQSAFVPGRLISDNILIADEMTHYMRNKRSGQVGYAAFKLDMSKAYDRVEWSFLHDMI  849

Query  1298  RDIGFN  1281
               +GF+
Sbjct  850   LKLGFH  855


 Score =   225 bits (573),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 139/431 (32%), Positives = 231/431 (54%), Gaps = 16/431 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV++       NG+L++  SP +GLRQGDP+SP LF+LCAE  S ++  +   
Sbjct  858   WVNLIMKCVSTVTYRIRVNGELSESFSPGRGLRQGDPLSPYLFLLCAEGFSALLSKTEEE  917

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+++ + AP++SHL FADD +    AN  +A +++  L ++  CSGQ IN  KS++
Sbjct  918   GRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKSAV  977

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS NT+   ++ + A L +       ++LGLP   GR +   F  + ERI  R+ G   
Sbjct  978   MFSPNTSSLEKRAVMAALNMQRETTNERYLGLPVFVGRSRTKIFSYLKERIWQRIQGWKE  1037

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  +++++V  AIP ++M    +   + D I ++I  + W ++E  NK H + W
Sbjct  1038  KLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQEKDNKMHWLSW  1097

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K  GGLG + +   NLA LAK  WRL QD + L + + +AKY     +   ++P
Sbjct  1098  NKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYF---PLGDCFRP  1154

Query  375   KRNS--SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL----LDRPLFEEASAPIA  214
             K+ S  S  W+ I + L + +NG+ W V +G     W D W+      +P+    +  + 
Sbjct  1155  KQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRGANLV-  1213

Query  213   PSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
              + +  L+  Y  +   WD D+L +   E  +  + +  +  +  + D L W+ +  G F
Sbjct  1214  -TKVEELIDPYTGT---WDEDLLSQTFWEEDVAAIKSIPVHVE--MEDVLAWHFDARGCF  1267

Query  33    SVSSAYELALE  1
             +V SAY++  E
Sbjct  1268  TVKSAYKVQRE  1278



>ref|XP_009140393.1| PREDICTED: uncharacterized protein LOC103864388 [Brassica rapa]
Length=1377

 Score =   262 bits (669),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/610 (31%), Positives = 287/610 (47%), Gaps = 20/610 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S    R L+   R H P  + L E K S     ++ SSLGFD    V+ VG S
Sbjct  6     WNCRGLRSNLTVRRLEEMCREHLPDFLFLLETKNSSDHVIKLWSSLGFDHCYLVDPVGLS  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ LF      ++IL    + I  +V    +  + MS VYG      R  ++ +L    
Sbjct  66    GGLALFWKKKHEVKILSASARIIDTEVKLG-AVVFYMSFVYGDPVRQRRIAVWNELKVIA  124

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW--I  2535
              N  G W   GDFN +   SE         S   DF        L ++  +G+  +W  +
Sbjct  125   LNRTGGWFLAGDFNELMNNSEKVGGPPRQESSFFDFRAMARDCRLKEIPSSGNRLSWGGV  184

Query  2534  R-----GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQF  2370
             R     G+    +   RLDRA  N E    FP +   +L   GSDH P+  S+    Q+ 
Sbjct  185   REIMENGVKEKVWVQCRLDRAFGNAEWFRIFPQSHTVYLEKTGSDHRPIFTSLANIGQRR  244

Query  2369  CSSRFKFNMAWTTHYSFQACVQSVWRSDL-----DLSTNKSAMVEALSVWSRDSFGNIPQ  2205
              + RF F+  W         ++  W S+       +S    +  + L  W R +  N   
Sbjct  245   -TGRFMFDKRWCQKPEITEVIRRGWCSNFISGQGSVSERIKSCRQELCKWKRHANVNSSV  303

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
               RRL   LE     +    R   + +   LR +LE+   +EE  W Q+ +  W++ GD+
Sbjct  304   TIRRLRRELE-----VEESKRWPNLLILPSLRLDLEKAYDEEEAFWKQKCKNSWLQVGDK  358

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             NT+ +      +R ++++  L+D  G     +  + K   +YF  LF +    + +    
Sbjct  359   NTKVFHGWVESRRMKNKIHSLIDNAGIEQFSEDEMGKVAVEYFQELFHSTGSADVSELLD  418

Query  1844  GCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSF  1665
             G  P + E     +  P +  +I+ A+ ++      G DG T  FF K W  VG  +   
Sbjct  419   GMAPRVTESMNIGLIKPISDAEIRRAVKEIKSDSTPGVDGMTGQFFQKFWNIVGPQVTHE  478

Query  1664  VHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVR  1485
             V RFF+DG+LP   N T L L+PKVQNP ++   RPI LC+VVYK+++KV+  RLK ++ 
Sbjct  479   VRRFFDDGLLPVDWNYTELCLLPKVQNPNQMKDLRPISLCSVVYKIVSKVLCDRLKVVLP  538

Query  1484  KLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIE  1308
              +V P Q +FV GR I+DN L   E+++  RT    +  ++A+K D+ KAYDR+ W F+E
Sbjct  539   HIVSPAQGAFVAGRLISDNLLIAHEMVHGLRTNPACKSDFIAIKTDMSKAYDRVEWDFLE  598

Query  1307  DTLRDIGFNH  1278
                  +GF+ 
Sbjct  599   ALFLKLGFHQ  608


 Score =   206 bits (524),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 138/428 (32%), Positives = 212/428 (50%), Gaps = 11/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV S     + NGQ     +P +G+RQGDP+SP LF+LCAE L H +  + + 
Sbjct  610   WVSWIMLCVRSVSYSVILNGQSYGHFTPERGIRQGDPLSPFLFILCAEALVHTMSKAEQE  669

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+    P + HL FADD  F   A+  +  E  + L L+   SGQ IN QKS++
Sbjct  670   GVLTGMKLAPSCPAVQHLLFADDSFFLCRASLAECTEFLRRLKLYGDSSGQMINFQKSAI  729

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +   ++ +A  L I      GK+LGLP      K+     I E++  RL G  +
Sbjct  730   TFGAGIDPIMRRVLAELLNIEKEGGDGKYLGLPECFSGSKQQLLAFIGEKMSKRLKGWFA  789

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V+++S+  A+P Y+M    +   +   I   +  F W   + K K H + W
Sbjct  790   KKLSFGGKEVLLKSIAMALPVYAMSCFRLTKHLCQKIMSAMASFWWDENDEKKKIHWISW  849

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK NGGLG + ++  N A LAK AWRL  D   L   ++K +Y       +S + 
Sbjct  850   KKLCISKENGGLGFRDIEDFNQALLAKQAWRLLNDPTSLIARIYKGRYFASSDFMNSGKG  909

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPI--APSSL  202
              R  S AW+ IL    +   G+   + NG +T  W  +W+LD    E    PI   P   
Sbjct  910   YR-PSYAWRSILFGRELLNKGLMKSIGNGNSTFVWSHNWILD----ETPRRPINKQPEID  964

Query  201   NNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
              NL  +  I ++G WD + L    P++ + ++    + +   + DR +W   PNG ++V 
Sbjct  965   INLRVSSLIGDDGQWDVNKLQCRFPQNEVTRIRQLPVGD---VPDRDIWAYSPNGSYTVK  1021

Query  24    SAYELALE  1
             S Y++A +
Sbjct  1022  SGYKVATQ  1029



>ref|XP_009108843.1| PREDICTED: uncharacterized protein LOC103834526 [Brassica rapa]
Length=1084

 Score =   254 bits (649),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/609 (28%), Positives = 290/609 (48%), Gaps = 21/609 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G       R L+   R++ P L+ L E K       ++  SLG+D    V   G S
Sbjct  6     WNCRGLGQRLTVRRLRELQRVYSPDLLFLVETKQGNDYVRDVGVSLGYDSMELVPPRGLS  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ +     +++  + +  + +   V Y N S  + +S +YG      R HL+  L   
Sbjct  66    GGLAVLWKSYVSVSCISSDERLVDLFVDYKNFS--FYLSCIYGNPVPKFRSHLWEKLQRI  123

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               N  G W+  GD N ++  +E       S S   DF   + + ++ DL   G++++W+ 
Sbjct  124   AVNRVGPWMLCGDMNEISDPAEKKGGRIRSESSVKDFKTMLEICDMKDLQAKGNNFSWV-  182

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
             G          LDR   N      FP ++  +L +  SDH P++IS+     Q     F+
Sbjct  183   GRRRNEVIECCLDRVFVNSVWLNNFPFSENEYLELAESDHRPMIISVRYNQDQ-KRGLFR  241

Query  2351  FNMAWTTHYSFQACVQSVWRS---DLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLAR  2181
             ++        F + V   W     DL+LS       + ++ W R    N  ++   +  +
Sbjct  242   YDKRLYKQEGFCSIVTQKWEQNLGDLNLSQQLVQCRKTMAHWKRVHRFNAAEEIHNIRLQ  301

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVA  2001
             ++      ++ I +        L+++L +    EE  W  +SR  W+K G+RNT+FY   
Sbjct  302   IDRATRDHTVPITT-----IHVLQRQLNQAYSDEEEFWRLKSRNRWLKLGERNTKFYHNI  356

Query  2000  TTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT---TEVDVNRTNFCYGCFPP  1830
             T  +R+ +++  + D  G +   D  +      YF  LFT   TE D +   F       
Sbjct  357   TRSRRSTNKIKSVTDDQGIIHTKDEAIASVAEKYFSELFTAGGTEWDSD--TFIPTNQVS  414

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             +    W  +  P T  +I+ A F++   +A G DGF+  F+ + W  + + +   VH FF
Sbjct  415   MDMNTW--LIRPVTESEIREAAFNIGQDRAPGHDGFSGAFYQQFWDVISSDVSKMVHAFF  472

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
             ++G++ P  N T L LIPK  +   I  +RPI LC V YK+I+ ++M R+KD +  L+  
Sbjct  473   DNGVMDPSVNHTQLCLIPKSTDASMIKDYRPISLCTVGYKVISNILMARMKDCLHGLISE  532

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRV-GWMALKVDLEKAYDRLSWCFIEDTLRD  1293
              Q++FV GR I DN +   E+++A ++KK    G+M +K D+ KAYDR+ W F+E  ++ 
Sbjct  533   SQAAFVPGRHIQDNVMVAHELMHALKSKKDIAEGYMGIKTDISKAYDRVEWNFLEKVMKK  592

Query  1292  IGFNHTGSG  1266
             +GF+   +G
Sbjct  593   LGFHDIWTG  601


 Score =   212 bits (539),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 138/429 (32%), Positives = 208/429 (48%), Gaps = 12/429 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M CV +     L NG     + P +GLRQGDPISP LF+LCAE LS +   + R 
Sbjct  599   WTGWVMNCVKTVTYSILINGADYGRVQPTRGLRQGDPISPYLFLLCAEVLSQLFQKAERE  658

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               +KG+K+ R  P++SHL FADD +FF  A      ++   L  +   SGQ++NL+KSS+
Sbjct  659   NRFKGLKIARSCPSVSHLLFADDSLFFCRATVSDCQQVASLLKEYEEYSGQRVNLEKSSI  718

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +   +  +   LGI      GK+LGLP   GR KK+ F  +++  K  +   S+
Sbjct  719   TFGMKIDDSQRALLKNILGIQRTGGGGKYLGLPEQFGRNKKELFAYLVDNTKNNVECWSN  778

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  VM+++V    P YSM   LIP    D I  L+ GF WG   G+ K   + W
Sbjct  779   QYLSQGGKEVMIKTVSMGKPVYSMSCFLIPKTTCDEINGLLSGFWWGKDNGRRKISWIAW  838

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY----DFDPSVWS  388
               ++  K  GG+G + L   N+A LAK AW++  +   L   +++ +Y     F  S  S
Sbjct  839   KRLSTPKKEGGMGFRDLHQFNMALLAKQAWKIQNNPTSLLARIYRGRYHNKLTFLQSTCS  898

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
             S     N S  W+ I     +   G++  + NGR T  W D W+   P  +    P    
Sbjct  899   S-----NPSYGWRSIQAGKELLLKGLRVQIGNGRTTDVWRDKWIPTIPPRQINRNPQFLG  953

Query  207   SL-NNLVANYWISNE-GWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
              L   LV++  + N   WD + ++ +        + T  L       D+++W    +  +
Sbjct  954   PLETTLVSDLLLQNTLSWDQEKIETMFTPEDAALVQTIRLSR-YASHDKIIWPYTRDCSY  1012

Query  33    SVSSAYELA  7
             SV S Y +A
Sbjct  1013  SVKSGYWVA  1021



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score =   249 bits (637),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/590 (30%), Positives = 285/590 (48%), Gaps = 26/590 (4%)
 Frame = -1

Query  3011  RLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTH  2832
             + H P ++ L E    +    +I   LG++    V+ VG  GG+ LF   S++I + Y  
Sbjct  491   KKHFPEVMFLMETMNCKDVIVDIQVWLGYENVYTVDPVGTCGGLALFWKKSVDISVYYED  550

Query  2831  PQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQ  2652
                +   V       + ++ VYG  +   R  ++  L+ +  + +G W  +GDFN +   
Sbjct  551   KNLLDLAVQFG-EYSFFLTCVYGNTNFCYRHQVWERLTRFGLSRKGNWCMIGDFNEI---  606

Query  2651  SEVSNKETFSMSRCTDFNDWIFMEELIDLGFT-----GSSYTWIRGLDTPSFKGARLDRA  2487
               ++N+E     R +D +   F   L D G +     G+ +TW  G     +  ++LDR 
Sbjct  607   --LNNEEKLGGPRRSDNSFLPFSTMLKDCGMSELPSSGNGFTW-GGRRGTHWIQSKLDRC  663

Query  2486  LSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACV  2307
              +N +    FP A    LP  GSDH P+L+S+ +  Q      F+F+         +  +
Sbjct  664   FANKDWVSCFPAANQAFLPKRGSDHRPILVSLVSS-QDLYRGSFRFDKRLLHKPGVKEAI  722

Query  2306  QSVWR-----SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIR  2142
               VWR     +   +S         LS W +++  N   K   +   LE VQ S      
Sbjct  723   SMVWRQSAISAPAPVSQRIRDCRRVLSKWKKENEMNSKVKIIAIQNELELVQSS------  776

Query  2141  SDlvrlerrlrkeleETL-YQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSK  1965
             SD      R  K        +EE  W Q+SR++W+  GDRNT+F+  +    R+++ + K
Sbjct  777   SDPSASRLRSLKNKLVEANKEEESHWQQKSRDKWMLEGDRNTKFFHASVKNLRSKNGLDK  836

Query  1964  LVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTP  1785
             L D +G +   +    +    YF  LF+T   V+      G  P + +    S+ A  + 
Sbjct  837   LQDPNGIVHRSEASKGEVAASYFQNLFSTSSPVDIQAMLEGVTPRVTDVMNQSLLAKVSK  896

Query  1784  EDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILS  1605
             E++K A+F + P KA G DG T  FF + W  VG  + S V  FF+ GI P   N T L 
Sbjct  897   EEVKNAVFSINPSKAPGADGMTGMFFQQYWDIVGHQVTSEVLAFFDSGIFPKEWNFTQLC  956

Query  1604  LIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNT  1425
             LIPK  N   ++  RPI LC+V+YK++ K++M RL+ ++ ++V P+QS+F+  R I+DN 
Sbjct  957   LIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIVSPNQSAFIPERLISDNI  1016

Query  1424  LAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             L   E ++  RT K     +MA+K D+ KAYDR+ W ++E  +  +GF+ 
Sbjct  1017  LIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALMLGLGFHQ  1066


 Score =   216 bits (551),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 220/424 (52%), Gaps = 11/424 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ +M CVTS     L NGQ    I+P++GLRQGDP+SP LFVLCAE L+H+++ +   
Sbjct  1068  WVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHLLNKAESE  1127

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++ +   P + HL FADD +F  +A+  Q   ++K L  +   +GQ INL+KSS+
Sbjct  1128  GKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSSI  1187

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F        +  IA  LGI      G +LGLP      K +    I +R+K R+SG  +
Sbjct  1188  TFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMSGWFA  1247

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             RTLS  G  ++++SV  A+P ++M    +P    +++   +  F W S E K K H + W
Sbjct  1248  RTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKKKMHWISW  1307

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG K ++  N A L+K AWR+ QD +CL+   FK++Y  D    S+   
Sbjct  1308  EKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFLSATLG  1367

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN-  199
              R  S AW+ IL    + + G++  + +G +T  W   W+LD  +     AP+  + L  
Sbjct  1368  YR-PSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIM----RAPLMKNILFD  1422

Query  198   -NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSV  28
              +L+    +      WD+    L  H   +    +L+   ++   D L+W    +G +SV
Sbjct  1423  LDLMVKDLLDTTTQSWDLAK--LQYHFYPRDVELILKIKPVMSSEDYLIWEHTKSGAYSV  1480

Query  27    SSAY  16
              S Y
Sbjct  1481  KSGY  1484


 Score = 58.5 bits (140),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (45%), Gaps = 8/183 (4%)
 Frame = -3

Query  4386  SLILRVLG-RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPW  4210
             SLI R+L  +  S S ++  +   W+       IAL+ + F   F+   D + V   G  
Sbjct  34    SLIGRILNPKCQSVSGVVFDMPRKWQKGDRIRGIALSKERFQFIFQNEHDLEDVLNKGFQ  93

Query  4209  MVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDL  4030
                D  L+ + W  +  P  + +     W++  ++PI ++    +  IG++ G+ + +  
Sbjct  94    TYNDWGLIMERWTEH--PAADSLQFTTLWVQIRNIPINHYTAPAITAIGELAGQVLHVAF  151

Query  4029  TTGMASKGKFARVCVQLDITKPLLSNFVI-----NGTEWPKEYEGIHQICFKCSIYGHRM  3865
                 A   ++ RV ++ D++KPL  + VI        E    YE + + CFKC    H +
Sbjct  152   DPSRAQGKEYVRVQIRFDVSKPLRKSKVIGLPNNKSVEIFFNYEKVQKRCFKCQRLSHEV  211

Query  3864  ETC  3856
             + C
Sbjct  212   DFC  214



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score =   249 bits (636),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/590 (30%), Positives = 286/590 (48%), Gaps = 26/590 (4%)
 Frame = -1

Query  3011  RLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTH  2832
             + H P ++ L E    +    +I   LG++    V+ VG  GG+ LF   S++I + Y  
Sbjct  491   KKHFPEIMFLMETMNCKDVIVDIQVWLGYENVYAVDPVGTCGGLALFWKKSVDISVYYED  550

Query  2831  PQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQ  2652
                +   V     + +L + VYG  +   R  ++  L+ +  + +G W  +GDFN +   
Sbjct  551   KNLLDLAVQFGEYSSFL-TCVYGNPNFCYRYQVWERLTRFGLSRKGNWCMIGDFNEI---  606

Query  2651  SEVSNKETFSMSRCTDFNDWIFMEELIDLGFT-----GSSYTWIRGLDTPSFKGARLDRA  2487
               ++N+E     R +D +   F   L D G +     G+ +TW  G     +  ++LDR 
Sbjct  607   --LNNEEKLGGPRRSDNSFLPFSTMLKDCGMSELPSSGNGFTW-GGRRGTHWIQSKLDRC  663

Query  2486  LSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACV  2307
              +N +    FP A    LP  GSDH P+L+S+ +  Q      F+F+         +  +
Sbjct  664   FANKDWVSCFPAANQAFLPKRGSDHRPILVSLVSS-QDLYRGSFRFDKRLLHKPGVKEAI  722

Query  2306  QSVWR-----SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIR  2142
               VWR     +   +S         LS W +++  N   K   +   LE VQ S      
Sbjct  723   SMVWRQSAISAPAPVSQRIRDCRRVLSKWKKENEMNSKVKIIAIQNELELVQSS------  776

Query  2141  SDlvrlerrlrkeleETL-YQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSK  1965
             SD      R  K        +EE  W Q+SR++W+  GDRNT+F+  +    R+++ + K
Sbjct  777   SDPSASRLRSLKNKLVEANKEEESHWQQKSRDKWMLEGDRNTKFFHASVKNLRSKNGLDK  836

Query  1964  LVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTP  1785
             L D +G +   +    +    YF  LF+T   V+      G  P + +    S+ A  + 
Sbjct  837   LQDPNGIVHRSEASKGEVAASYFQNLFSTSSPVDIQAMLEGVTPRVTDVMNQSLLAKVSK  896

Query  1784  EDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILS  1605
             E++K A+F + P KA G DG T  FF + W  VG  + S V  FF+ GI P   N T L 
Sbjct  897   EEVKNAVFSINPSKAPGADGMTGMFFQQYWDIVGHQVTSEVLAFFDSGIFPKEWNFTQLC  956

Query  1604  LIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNT  1425
             LIPK  N   ++  RPI LC+V+YK++ K++M RL+ ++ ++V P+QS+F+  R I+DN 
Sbjct  957   LIPKKVNSSLMSDLRPISLCSVLYKVVAKIIMSRLQPLLSEIVSPNQSAFIPERLISDNI  1016

Query  1424  LAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             L   E ++  RT K     +MA+K D+ KAYDR+ W ++E  +  +GF+ 
Sbjct  1017  LIAHEAIHGLRTDKVIAKEFMAVKTDMSKAYDRMEWSYLEALMLGLGFHQ  1066


 Score =   216 bits (551),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 220/424 (52%), Gaps = 11/424 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ +M CVTS     L NGQ    I+P++GLRQGDP+SP LFVLCAE L+H+++ +   
Sbjct  1068  WVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHLLNKAESE  1127

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++ +   P + HL FADD +F  +A+  Q   ++K L  +   +GQ INL+KSS+
Sbjct  1128  GKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSSI  1187

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F        +  IA  LGI      G +LGLP      K +    I +R+K R+SG  +
Sbjct  1188  TFGAQVEQSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMSGWFA  1247

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             RTLS  G  ++++SV  A+P ++M    +P    +++   +  F W S E K K H + W
Sbjct  1248  RTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKKKMHWISW  1307

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG K ++  N A L+K AWR+ QD +CL+   FK++Y  D    S+   
Sbjct  1308  EKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFLSATLG  1367

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN-  199
              R  S AW+ IL    + + G++  + +G +T  W   W+LD  +     AP+  + L  
Sbjct  1368  YR-PSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIM----RAPLMKNILFD  1422

Query  198   -NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSV  28
              +L+    +      WD+    L  H   +    +L+   ++   D L+W    +G +SV
Sbjct  1423  LDLMVKDLLDTTTQSWDLAK--LQYHFYPRDVELILKIKPVMSSEDYLIWEHTKSGAYSV  1480

Query  27    SSAY  16
              S Y
Sbjct  1481  KSGY  1484


 Score = 58.5 bits (140),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (45%), Gaps = 8/183 (4%)
 Frame = -3

Query  4386  SLILRVLG-RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPW  4210
             SLI R+L  +  S S ++  +   W+       IAL+ + F   F+   D + V   G  
Sbjct  34    SLIGRILNPKCQSVSGVVFDMPRKWQKGDRIRGIALSKERFQFIFQNEHDLEDVLNKGFQ  93

Query  4209  MVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDL  4030
                D  L+ + W  +  P  + +     W++  ++PI ++    +  IG++ G+ + +  
Sbjct  94    TYNDWGLIMERWTEH--PAADSLQFTTLWVQIRNIPINHYTAPAITAIGELAGQVLHVAF  151

Query  4029  TTGMASKGKFARVCVQLDITKPLLSNFVI-----NGTEWPKEYEGIHQICFKCSIYGHRM  3865
                 A   ++ RV ++ D++KPL  + VI        E    YE + + CFKC    H +
Sbjct  152   DPSRAQGKEYVRVQIRFDVSKPLRKSKVIGLPNNKSVEIFFNYEKVQKRCFKCQRLSHEV  211

Query  3864  ETC  3856
             + C
Sbjct  212   DFC  214



>ref|XP_009118875.1| PREDICTED: uncharacterized protein LOC103843847 [Brassica rapa]
Length=1319

 Score =   243 bits (619),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 176/583 (30%), Positives = 279/583 (48%), Gaps = 24/583 (4%)
 Frame = -1

Query  2999  PSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGY-SGGIWLFCSVSINIEILYTHPQF  2823
             P ++ L E K   +   +   SL ++  + +   G+ +GG+ LF    I I+IL +    
Sbjct  7     PDILFLMETKNPDSFVKKKTDSLQYENSLLISPTGHGAGGLALFWKEEIKIQILSSSANC  66

Query  2822  IAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEV  2643
             I   + +     +  S +Y    +  RR L+A L          W   GDFN +   +E 
Sbjct  67    IDTSI-EFEGKQFFASFIYADTVIPKRRALWASLIEQSTRRDAPWFLTGDFNDLLNNAEK  125

Query  2642  SNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SL  2463
                   +    TD   +    +L DL  +G   +W RG         RLDRA +N   + 
Sbjct  126   VGGPARTEGSFTDMRTFYSEGDLYDLRHSGDCLSW-RGTRGDYLVRCRLDRAAANSYWAE  184

Query  2462  RFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDL  2283
              FP+A+  +L   GSDH P+L S     ++     F+++     +   +  ++  W S  
Sbjct  185   LFPNARSQYLTYEGSDHKPIL-SFFEPDKKKRRGLFRYDRRLKNNPEAKVLIKQAWDSAP  243

Query  2282  DLSTNK--SAMVEALSVWSRDSFGN----IPQKKRRLLARLEGVQ*SLSMGIRSDlvrle  2121
               S N     +  AL  WS+  + N    I QK+  L A L            ++   L 
Sbjct  244   YSSVNDRIKEVRTALIQWSKQQYKNSREQIEQKRFELEAALTDP---------TNDTELI  294

Query  2120  rrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHL  1941
              R+  EL +    EE  W QRSR  W+  GDRNT F+      ++  +  + + DA+G++
Sbjct  295   SRVSNELNDAYNSEEEYWRQRSRLLWLSLGDRNTGFFHATAKNRKRANAFTVIEDAEGNM  354

Query  1940  ICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLL--EEDWASVNAPFTPEDIKTA  1767
             +  +  + + + +YF  LF T +D NR         P++  E +   +  P   E IK A
Sbjct  355   VYQEDQIGRVIVEYFHELFKT-IDGNREETVMHALSPMVSAETNEQLIAVPAAVE-IKEA  412

Query  1766  LFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQ  1587
             LF +   KA GPDGF+  F+H  W TVG  +   +  FF    LP   N+T + LIPKV 
Sbjct  413   LFSIHADKAPGPDGFSASFYHTNWDTVGPEIVREIQDFFITDRLPERINETHIRLIPKVP  472

Query  1586  NPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEI  1407
             +P+++T++RPI LCNV YK+I+K++  RL+ ++  +V  +QS+FV GR I+DN L   E+
Sbjct  473   SPQQVTEYRPIALCNVYYKIISKILTKRLQPLLSNIVSENQSAFVPGRMISDNVLITHEV  532

Query  1406  LNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             L+  +     +   MA+K D+ KAYDRL W FI    + +GF+
Sbjct  533   LHYLKNSDAEKRCAMAVKTDMSKAYDRLEWEFIRLVFQRLGFH  575


 Score =   223 bits (567),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 222/430 (52%), Gaps = 11/430 (3%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  I+ CV++     L NG     ++P +G+RQGDP+SP +F+LC+E LS +   + 
Sbjct  576   PKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCSKAQ  635

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G+ KG+KV+R  P ++HL FADD +FF  A+   A  + K L L+   SGQ IN  KS
Sbjct  636   EEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTKVLKLYEEASGQSINANKS  695

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ FS+ T    +  +  TL I     +GK+LGLP   GR K D F +I++RIK +  G 
Sbjct  696   SITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKKCDLFSSIIDRIKQKAKGW  755

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             S+R LS AG   M++SVLS +P ++M    +P  +   I+  +  F W    G+ K   +
Sbjct  756   SNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWWDDSMGRKKMSWI  815

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K  GGL  + ++  N A+LAKLAWR+  + + L   +   KY  +    +  
Sbjct  816   AWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRILLGKYCHNEPFLAV-  874

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
               K   S+ W+G+L    I  +   W V NG +   W   WL      E   +P+ P+ L
Sbjct  875   DVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWL----SCEVQESPMGPAPL  930

Query  201   NNL---VANYWISN-EGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
               L   V+++++ N   W+ DM+  VLP      L+  +    T   D+L W    +G +
Sbjct  931   QYLNLTVSDFFLPNSREWNVDMIRLVLPMEEQKILA--IKPSVTGAPDKLSWLGAKSGSY  988

Query  33    SVSSAYELAL  4
             +  S Y  AL
Sbjct  989   TTKSGYATAL  998



>ref|XP_009103763.1| PREDICTED: uncharacterized protein LOC103829818 [Brassica rapa]
Length=1304

 Score =   243 bits (619),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/583 (30%), Positives = 279/583 (48%), Gaps = 24/583 (4%)
 Frame = -1

Query  2999  PSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGY-SGGIWLFCSVSINIEILYTHPQF  2823
             P ++ L E K   +   +   SL ++  + +   G+ +GG+ LF    I I+IL +    
Sbjct  7     PDILFLMETKNPDSFVKKKTDSLQYENSLLISPTGHGAGGLALFWKQEIKIQILSSSANC  66

Query  2822  IAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEV  2643
             I   + +     +  S +Y    +  RR L+A L          W   GDFN +   +E 
Sbjct  67    IDTSI-EFEGKQFFASFIYADTVIPKRRALWASLIEQSTRRDAPWFLTGDFNDLLNNAEK  125

Query  2642  SNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SL  2463
                   +    TD   +    +L DL  +G   +W RG         RLDRA +N   + 
Sbjct  126   VGGPARTEGSFTDMRTFYSEGDLYDLRHSGDCLSW-RGTRGDYLVRCRLDRAAANSYWAE  184

Query  2462  RFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDL  2283
              FP+A+  +L   GSDH P+L S     ++     F+++     +   +  ++  W S  
Sbjct  185   LFPNARSQYLTYEGSDHKPIL-SFFEPDKKKRRGLFRYDRRLKNNPEAKVLIKQAWDSAP  243

Query  2282  DLSTNK--SAMVEALSVWSRDSFGN----IPQKKRRLLARLEGVQ*SLSMGIRSDlvrle  2121
               S N     +  AL  WS+  + N    I QK+  L A L            ++   L 
Sbjct  244   YSSVNDRIKEVRTALIQWSKQQYKNSREQIEQKRFELEAALTDP---------TNDTELI  294

Query  2120  rrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHL  1941
              R+  EL +    EE  W QRSR  W+  GDRNT F+      ++  +  + + DA+G++
Sbjct  295   SRVSNELNDAYNSEEEYWRQRSRLLWLSLGDRNTGFFHATAKNRKRANAFTVIEDAEGNM  354

Query  1940  ICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLL--EEDWASVNAPFTPEDIKTA  1767
             +  +  + + + +YF  LF T +D NR         P++  E +   +  P   E IK A
Sbjct  355   VYQEDQIGRVIVEYFHELFKT-IDGNREETVMHALSPMVSAETNEQLIAVPAAVE-IKEA  412

Query  1766  LFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQ  1587
             LF +   KA GPDGF+  F+H  W TVG  +   +  FF    LP   N+T + LIPKV 
Sbjct  413   LFSIHADKAPGPDGFSASFYHTNWDTVGPEIVREIQDFFITDRLPERINETHIRLIPKVP  472

Query  1586  NPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEI  1407
             +P+++T++RPI LCNV YK+I+K++  RL+ ++  +V  +QS+FV GR I+DN L   E+
Sbjct  473   SPQQVTEYRPIALCNVYYKIISKILTKRLQPLLSNIVSENQSAFVPGRMISDNVLITHEV  532

Query  1406  LNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             L+  +     +   MA+K D+ KAYDRL W FI    + +GF+
Sbjct  533   LHYLKNSDAEKRCAMAVKTDMSKAYDRLEWEFIRLVFQRLGFH  575


 Score =   222 bits (566),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 222/430 (52%), Gaps = 11/430 (3%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  I+ CV++     L NG     ++P +G+RQGDP+SP +F+LC+E LS +   + 
Sbjct  576   PKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCSKAQ  635

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G+ KG+KV+R  P ++HL FADD +FF  A+   A  + K L L+   SGQ IN  KS
Sbjct  636   EEGSLKGIKVSRGTPRINHLLFADDTMFFLRASKDSAEALTKVLKLYEEASGQSINADKS  695

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ FS+ T    +  +  TL I     +GK+LGLP   GR K D F +I++RIK +  G 
Sbjct  696   SITFSRKTPAALKTVVHDTLSIQKEGGVGKYLGLPEHFGRKKCDLFSSIIDRIKQKAKGW  755

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             S+R LS AG   M++SVLS +P ++M    +P  +   I+  +  F W    G+ K   +
Sbjct  756   SNRFLSTAGKMTMLKSVLSLVPSHAMSCFQLPVSLCKRIQSTLTRFWWDDSMGRKKMSWI  815

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K  GGL  + ++  N A+LAKLAWR+  + + L   +   KY  +    +  
Sbjct  816   AWNKLIRPKDQGGLDFRDIQSFNEAYLAKLAWRIINNPDKLIGRILLGKYCHNEPFLAV-  874

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
               K   S+ W+G+L    I  +   W V NG +   W   WL      E   +P+ P+ L
Sbjct  875   DVKVEISHGWRGVLIGRDIVMSNASWEVGNGESINIWTKPWL----SCEVQESPMGPAPL  930

Query  201   NNL---VANYWISN-EGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
               L   V+++++ N   W+ DM+  VLP      L+  +    T   D+L W    +G +
Sbjct  931   QYLNLTVSDFFLPNSREWNVDMIRLVLPMEEQKILA--IKPSVTGAPDKLSWLGAKSGSY  988

Query  33    SVSSAYELAL  4
             +  S Y  AL
Sbjct  989   TTKSGYATAL  998



>emb|CAE04866.2| OSJNBa0086O06.14 [Oryza sativa Japonica Group]
Length=1205

 Score =   239 bits (609),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 154/479 (32%), Positives = 233/479 (49%), Gaps = 54/479 (11%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL +GDFN    Q E  ++   S  +  DF + +   +L D+GF    +T+     +P+ 
Sbjct  156   WLMIGDFNDAMWQIEHRSRVKHSERQMRDFREVLVECDLQDIGFQCVPWTYDNNQASPNN  215

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK-FNMAWT  2334
                RLDRA+++      F  A + HL    SDH PLL+      QQ   S+   F   W 
Sbjct  216   VKVRLDRAVASPVWRAMFDQANIMHLTTACSDHVPLLLEKGGNMQQRRRSKINCFEAVWE  275

Query  2333  THYSFQACVQSVW------RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
                SF +     W      ++  D+ T  +  +E L  WSRD  GNI +   R    LE 
Sbjct  276   RVKSFNSIEHESWDDGGLAKNLGDVRTKLAYTMENLKRWSRDKIGNIKKSIERCRRELE-  334

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
                 + M  R D      RL+  L+E L++EE+ W QRSR  W+K GDRNTR++ +  + 
Sbjct  335   ---EMRMRGREDSEPDVHRLKIFLQELLHREEIWWKQRSRITWLKEGDRNTRYFHLKASW  391

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +  ++ + KL  +D  +   +G+L K                                  
Sbjct  392   RARKNLIKKLRRSDDEM---NGMLTK----------------------------------  414

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
                  PFT E+I  ALF + P KA GPDGF   FF + W  +   +   V  FFE G   
Sbjct  415   -----PFTDEEISDALFQIGPLKAPGPDGFPARFFQRNWGVLKRDVIEGVREFFETGEWK  469

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
              G NDT++ +IPK   P  +  FRP+ LCNV+YK++ K ++ RL+ ++++++   QS+FV
Sbjct  470   EGMNDTVIVMIPKTNAPVEMKDFRPVSLCNVIYKVVAKCLVNRLRPLLQEIISETQSAFV  529

Query  1451  HGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              GR ITDN L   E  ++  +  +    + ALK+DL KAYDR+ W F++  L+ +GF +
Sbjct  530   PGRMITDNALVAFECFHSIHKCTRESQDFCALKLDLSKAYDRVDWGFLDGALQKLGFGN  588


 Score =   224 bits (571),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 145/427 (34%), Positives = 225/427 (53%), Gaps = 11/427 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + IM CVTS R     NG + +   P +GLR+GDP++P LF+  A+ LS+++      
Sbjct  590   WRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFLFIADGLSNILQRRRDE  649

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                + +KV R AP +SHL FADD + F +A  IQA  +K+ LDL+  C+GQ IN ++ SL
Sbjct  650   RQIQPLKVCRSAPGVSHLLFADDSLLFFKAEVIQATRIKEALDLYERCTGQLINPKECSL  709

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS       Q  I A L +       K LGLP+  GR+K + F  I ER + RL+  S 
Sbjct  710   LFSALCPQERQDGIKAVLQVERTCFDDKCLGLPTPDGRMKAEQFQPIKERFEKRLTDWSE  769

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LSLAG   +++SV  A+P Y+M    +P    +  E+L+R F WG  +G+ K H + W
Sbjct  770   RFLSLAGKEALIKSVAQALPTYTMGVFKMPERFCEEYEQLVRNFWWGHEKGEKKVHWIAW  829

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T+ K  GGLG + ++  N A LA+ AWRL +  + L   + KAKY  + ++  +  P
Sbjct  830   EKLTSPKLLGGLGFRDIRCFNQALLARQAWRLIESPDSLCARVLKAKYYPNGTITDTAFP  889

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                SS  WKGI+  L + + G+ W + +G  T+ W + W+       E    +   + N 
Sbjct  890   S-VSSPTWKGIVHGLELLKKGLIWRIGDGSKTKIWRNHWV----AHGENLKILEKKTWNR  944

Query  195   LVANYWI---SNEGWDWDMLDRVLPEHILNK-LSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             ++    +     + W+  ++  ++ E   ++ L   + Q +    D   W+ E  G+FSV
Sbjct  945   VIYVRELIVTDTKTWNEPLIRHIIREEDADEILKIRIPQREE--EDFPAWHYEKTGIFSV  1002

Query  27    SSAYELA  7
              S Y LA
Sbjct  1003  RSVYRLA  1009



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score =   239 bits (610),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 160/554 (29%), Positives = 258/554 (47%), Gaps = 11/554 (2%)
 Frame = -1

Query  2915  IRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRH  2736
             + V  VG  GG+ LF      + +L      I   + ++  + + ++  YG  D   R H
Sbjct  5     VTVARVGLGGGLALFWRSGWGVRLLSYSVGHIHVLITESNDSQFYLTGFYGHPDTQQRNH  64

Query  2735  LFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFT  2556
              +  L    +  QG W+ +GDFN +    +          +  +F   +    L    FT
Sbjct  65    SWELLRRLSYTVQGAWVVVGDFNEILFSKDKRGGRERPQGQMNNFKMALEDCRLSSTRFT  124

Query  2555  GSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI-SITTCP  2379
             G  +TW R     S    RLDR ++N     R+     +HL  +GSDH P+L+ +    P
Sbjct  125   GYPFTWARRYPDGSVVEERLDRCVANGVFFGRYSHLTTSHLVAVGSDHYPILVEACVDDP  184

Query  2378  QQFC--SSRFKFNMAWTTHYSFQACVQSVWRSD---LDLSTNKSAMVEALSVWSRDSFGN  2214
             +     S RF F   WT    F   ++  W+       +S + S   + L  W+   FGN
Sbjct  185   EAGAKRSRRFHFEEMWTKEPEFNKVIEEAWKVTDGVESVSNSLSLCAKELKTWNHIHFGN  244

Query  2213  IPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKS  2034
             + ++       L  +Q  L+    +D   L+ ++ + + + L ++E++W QRSR  W+K 
Sbjct  245   VRKQLTHAYKELTALQGRLT----TDQHVLKAKVEETISDLLEKQEIMWRQRSRVVWLKE  300

Query  2033  GDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTN  1854
             GD+NT F+    + +  ++RV  + DA+     ++  +     DYF  LF++        
Sbjct  301   GDKNTHFFHGRASSRSKRNRVCGIFDANQAWQTEEQRIGDLFCDYFKTLFSSSGGQQMER  360

Query  1853  FCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSL  1674
                   P +       +   FT E+++  LF M P KA G DG    FF K W  VG  +
Sbjct  361   ILNEVRPVITSAMNDRLLQAFTREELEHTLFQMFPTKAPGHDGMPALFFQKYWHIVGDKV  420

Query  1673  FSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKD  1494
                  +           N T+++LIPKV+ P  +++FRPI LC  VYK+I K +  RLK 
Sbjct  421   AKKCLQILNGEGSVREFNHTLIALIPKVKMPTTVSEFRPISLCTTVYKMIAKTIANRLKT  480

Query  1493  MVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFR-TKKGRVGWMALKVDLEKAYDRLSWC  1317
             ++  ++   QS+FV  R I DN +A  EI+N  +  KK R   MALK+D+ KAYDR+ W 
Sbjct  481   VLPHVITETQSAFVPNRMILDNVMAAFEIMNTIKGVKKRRDVQMALKLDMAKAYDRVEWV  540

Query  1316  FIEDTLRDIGFNHT  1275
             F+   +  +GF+ T
Sbjct  541   FLRAMMLKLGFSAT  554


 Score =   222 bits (565),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 223/425 (52%), Gaps = 8/425 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M C+++     LW G     I P++GLRQG P+SP LF++C E  S ++  + R 
Sbjct  555   WVSKVMDCISTTTFSVLWKGTPVGHIMPQRGLRQGCPLSPYLFLICTEGFSCLLHGAERR  614

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+  GV+V R AP+++HL FADD + F +A +   + ++     +   +GQ+IN  KS+L
Sbjct  615   GDLVGVQVARGAPSVTHLLFADDSILFMKATNKACMALETLFQTYEEVTGQQINYSKSAL  674

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               S N        I   L +P V     +LGLP+I G+ +K  F ++ +++   +SG   
Sbjct  675   SLSPNATRADFDMIEGGLNVPVVRCHENYLGLPTIAGKGRKQLFQHLKDKLWKHISGWKE  734

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  +++++VL AIP YSM    IP G+   +  ++  F W   + K   H VKW
Sbjct  735   KLLSRAGKEILIKAVLQAIPTYSMSCFQIPKGLCKELNGIMARFWWAKAKDKRGIHWVKW  794

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSV-WSSWQ  379
              ++  SK  GGLG + L+  N A LAK  WR+ +    L   +F+A+Y   PSV +   +
Sbjct  795   ELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRARY--HPSVPFLEAE  852

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
                N S  W  +     +   G++W V +G + + + D WL     F+  S P  P  L+
Sbjct  853   VGTNPSFIWGSLQWGKELLNKGVRWRVGSGVSIQVYTDKWLPAPSCFKIMSPPQLP--LS  910

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG-DRLVWYKEPNGLFSVSS  22
               V + + S+  W+  +L  +  +  ++ +    L   +L G D L+W+ E NG++SV S
Sbjct  911   TRVCDLFTSSGQWNVPLLKDIFWDQEVDAILQIPLA--SLAGHDCLIWHYERNGMYSVKS  968

Query  21    AYELA  7
              Y LA
Sbjct  969   GYRLA  973



>gb|EEC84753.1| hypothetical protein OsI_31756 [Oryza sativa Indica Group]
Length=1350

 Score =   231 bits (589),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 154/482 (32%), Positives = 239/482 (50%), Gaps = 66/482 (14%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL MGDFN V  Q E  +K   + S+   F D +   EL DLGF G  +T+    +  + 
Sbjct  373   WLVMGDFNEVLWQYEHFSKRPRNESQMRAFRDALHSCELHDLGFRGLPHTYDNKREGWNN  432

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISIT----TCPQQFCSSRFKFNM  2343
                RLDRA+++      F +A+++HL    SDH P+++ ++    T  ++ C    ++ +
Sbjct  433   VKVRLDRAVADGNWRDVFSNAQLSHLVSPCSDHCPIVLQLSGDSRTQGRKKC---LQYEI  489

Query  2342  AWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLAR  2181
              W    +    +   W     + DL +++     ++ AL  WSR    N+ ++  R   R
Sbjct  490   FWEREAAISEVIGEAWSEYGTKEDLGEINKALGKVMIALHSWSRTKCKNVGRELERARKR  549

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVA  2001
             L  +  + + G         R++   + + LY+EE++W QRSR  W+K GDRNT+F+   
Sbjct  550   LSNLLEANADG------ATVRQVTDNMNDLLYREEMLWLQRSRVSWLKEGDRNTKFFH--  601

Query  2000  TTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLE  1821
                    SRVSK+                        LF T+V     +         L 
Sbjct  602   -------SRVSKITR----------------------LFQTKVSAKMND--------KLC  624

Query  1820  EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDG  1641
             ED       FT E++  A+F + P KA GPDGF   F+ + W  + + +   V  FF  G
Sbjct  625   ED-------FTEEEVAIAMFQIGPIKAPGPDGFPAHFYQRNWGGLKSDIVRAVKEFFRSG  677

Query  1640  ILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQS  1461
             I+P G NDT + LIPK+  P  +   RPIGLCNV+YK+++K ++ RLK ++ +L+  +QS
Sbjct  678   IMPVGVNDTAIVLIPKIDQPTELKDLRPIGLCNVIYKVVSKCLVNRLKPLLDELISVNQS  737

Query  1460  SFVHGRQITDNT-LAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +FV GR ITDN  LA++      + K       A K+DL KAYDR+ W F+E  +  +GF
Sbjct  738   AFVPGRMITDNALLAFEYFHYIQKNKNPNKAASAYKLDLSKAYDRVDWGFLEQAMYKLGF  797

Query  1283  NH  1278
              H
Sbjct  798   AH  799


 Score =   229 bits (584),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 222/427 (52%), Gaps = 10/427 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM C+T+ R    +NG L D  +P +GL QGDP+SP LF+  A+ LS ++D  V+ 
Sbjct  801   WVRWIMECITTVRYSVKFNGTLLDSFAPSRGLCQGDPLSPFLFLFLADGLSLLLDEKVQQ  860

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    + +   AP +SHL FADD + F +A   QA  +++ L+ + + +GQ+IN  K S+
Sbjct  861   GVLSPIHICHSAPGISHLLFADDTLLFLKAVPEQAEVIREVLNDYATATGQQINPSKCSI  920

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F  +++   Q+ I  TL I + +   K+LG P+  GRLKK  F +I ERI  RL     
Sbjct  921   MFGDSSSELVQEAIRDTLQIANNVFEDKYLGFPTPDGRLKKGKFQSIQERIWKRLIQWGE  980

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  +++++++ AIP Y M    +P  V D + R+ RGF WG  +G  K H   W
Sbjct  981   NYLSSGGKEILIKALIQAIPVYVMGIFKLPESVCDELTRITRGFWWGGEKGARKTHWKAW  1040

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K  GGLG +  +  N A LA+ AWRL    + L   + KAKY  + ++ +    
Sbjct  1041  DTLTKPKNCGGLGFRDFRLFNQALLARQAWRLIDSPDSLCAMVLKAKYFLNGNL-TDTSF  1099

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSS--L  202
               N+S  W+ I   L + + GI W + NGR+ R W D W+      + +  PI   S   
Sbjct  1100  GGNASPGWRAIEFGLELLKKGIIWRIGNGRSVRIWRDPWIPR----DHSRRPITKKSNYK  1155

Query  201   NNLVANYWISNEGWDWDMLDRVL-PEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
                V +       WD + + ++  P      L   V  +D  + D + W+ +  G FSV 
Sbjct  1156  TKWVTDLLTDAGEWDVNRVRQIFWPIDAEVILKIRVPSQD--VSDFVAWHPDRLGRFSVR  1213

Query  24    SAYELAL  4
             SAY LA+
Sbjct  1214  SAYSLAV  1220



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score =   232 bits (592),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/606 (29%), Positives = 277/606 (46%), Gaps = 52/606 (9%)
 Frame = -1

Query  3065  NCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSG  2886
             N +  +  +  R L   ++     ++ L E +    +   + S LG   ++   + G SG
Sbjct  608   NSEATSHGAAVRDLIALVKEANSQVVFLSETRQKIERIRRLRSRLGLKGFVGCNSDGLSG  667

Query  2885  GIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWL-MSVVYGCLDMALRRHLFADLS*YF  2709
             G+ LF   SI +++   + +++   +  +   P   ++ VYG   +  R  L++ L    
Sbjct  668   GLALFWHESIFMDVKSVNERYVDAYMRLSPEDPLCHVTFVYGEPRVENRHRLWSRLLDLK  727

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              +    W+ +GDFN    Q E  +      ++   F D + + EL+DLGF+G  YT+   
Sbjct  728   QSSPLPWMIIGDFNETLWQFEHFSVSKRGEAQMRAFRDVLQICELVDLGFSGVPYTYDNR  787

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FK  2352
              +  S    RLDRAL++      + +++V HL    SDH P+L+      +Q    + F 
Sbjct  788   REGRSNVKVRLDRALADNSWRDIYSNSQVVHLTSSCSDHCPILLKFAADSRQSNRKKCFH  847

Query  2351  FNMAWTTHYSFQACVQSVW------RSDLDLSTNKSAMVEALSVWSRDSFGNIP---QKK  2199
             + + W    +    +   W      R+  D++     ++ AL  WS+  F N+    +K 
Sbjct  848   YEICWEREPASTEVISLAWAEVGEKRTLGDINFTLGKVMGALQGWSKVKFKNVSRAIEKA  907

Query  2198  RRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNT  2019
             R+ LA L       S   RS  V  E          LY+EE++W QRSR  W+K      
Sbjct  908   RKDLATLVSHNADYSEIRRSSDVLNEL---------LYREEMLWLQRSRISWLKEVKSTH  958

Query  2018  RFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
                ++ T                               DYF  +FT +  ++++      
Sbjct  959   EMEKIET-------------------------------DYFKDMFTADPCIDQSRVSRLF  987

Query  1838  FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
                +  E    +   FT ++I  ALF + P KA G DGF   FF + W  +   + S V 
Sbjct  988   QEKVSPEMNVDLCKDFTEQEIADALFQIGPIKAPGLDGFPARFFQRNWDAIKKDVVSAVK  1047

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
              FFE  I+P G NDT + LIPKV  P  +  FRPI LCNV+YK+++K ++ RL+ ++ +L
Sbjct  1048  SFFETSIMPEGVNDTAIVLIPKVDQPMELKDFRPISLCNVIYKIVSKCLVNRLRPILDEL  1107

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDT  1302
             V  +QS+FV GR ITDN L   E  +   R K       A K+DL KAYDR+ W F+E T
Sbjct  1108  VSQNQSAFVPGRMITDNALLAFECFHFIQRNKNANKAACAYKLDLSKAYDRVDWVFLEQT  1167

Query  1301  LRDIGF  1284
             +  +GF
Sbjct  1168  MCKLGF  1173


 Score =   227 bits (578),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 227/441 (51%), Gaps = 22/441 (5%)
 Frame = -3

Query  1308  GYSPRYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAER  1129
             G++PR      WI+ IM C++S R    +NG L D  +P +GLRQGDP+SP LF+  A+ 
Sbjct  1172  GFAPR------WIKWIMTCLSSVRYSIKFNGTLLDTFAPSRGLRQGDPLSPFLFLFVADG  1225

Query  1128  LSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCS  949
              S +++  V +G+   VK+ R A  +SHL F DD + F +A+  QA  +K  L+ +   +
Sbjct  1226  FSRLMEERVAAGDITPVKICRGALGISHLLFVDDTLLFFKADCEQARLIKGVLNEYALGT  1285

Query  948   GQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILE  769
             GQ +N  K S+ F   ++  TQ  I   L I       K+LG P+  GRL K  F ++ E
Sbjct  1286  GQLVNPNKCSILFDDTSHAETQDAIKNLLQIVCHNFEDKYLGFPTPEGRLNKGKFQSLQE  1345

Query  768   RIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSR  589
             ++  R+       LS  G  +M++ V+ AIP Y M    +P  V + + +L R F WG+ 
Sbjct  1346  KMWKRIILWGENYLSSGGKEIMLKVVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWGAD  1405

Query  588   EGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYD  409
             +GK K H   W  +T  K NGGL  +  +  N A LA+ AWRL    + L   + KAKY 
Sbjct  1406  KGKRKTHWRAWSCLTKPKHNGGLAFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKYY  1465

Query  408   FDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEA  229
              + S+  +     N+S  W+ I   L + + GI W + NGR+ R W D W+      + +
Sbjct  1466  PNGSLVDT-AFGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWIPR----DHS  1520

Query  228   SAPIAPSSLNNL--VANYWISNEGWDWDMLDRV-LP---EHILNKLSTFVLQEDTLLGDR  67
               PI       +  V++    +  WD   + RV LP   + IL   ++  L+ED      
Sbjct  1521  CRPITTKRNCRVKWVSDLLGQDGSWDVQKVSRVFLPIDADEILKIRTSVRLEEDF-----  1575

Query  66    LVWYKEPNGLFSVSSAYELAL  4
             L W+ +  G FSV SAY+LA+
Sbjct  1576  LSWHPDRLGQFSVRSAYKLAI  1596


 Score = 65.1 bits (157),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 77/187 (41%), Gaps = 11/187 (6%)
 Frame = -3

Query  4362  RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVT  4183
             +S + + L + ++  W+L +     +L  + FI  F    DY  V  GGPW+   D L+ 
Sbjct  206   KSPNLAALFEDMRRAWRLRSDMTYKSLRDNLFIISFGAEGDYRFVIQGGPWIHRGDALLV  265

Query  4182  QEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGK  4003
              E+     P    +D +  W+R   LP+        +  G  +GR  ++D+     +K  
Sbjct  266   AEFDGITCPSKVTLDVIPVWVRIYDLPLVLMTKARGEIYGSKLGRVREVDVGDDGRNKHD  325

Query  4002  FARVCVQLDITKPLLSNFVINGTEWPK--------EYEGIHQICFKCSIYGHRMETC---  3856
             F R+   L + +PL     I  +   +         YE +   CF C   GH  + C   
Sbjct  326   FFRIRADLSVKRPLKDKLTIKISAQGRVETRSFALRYERVPHFCFICGFMGHADKDCDKR  385

Query  3855  GLSVPIP  3835
             G +V  P
Sbjct  386   GANVENP  392



>ref|XP_010513002.1| PREDICTED: uncharacterized protein LOC104788940 [Camelina sativa]
Length=1347

 Score =   238 bits (607),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/606 (29%), Positives = 275/606 (45%), Gaps = 45/606 (7%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G       R LK     + P+++ L   K       ++ + LG++    V  +G  
Sbjct  6     WNCRGLKGSLVVRRLKGIKATYSPNILFLIGTKNPDDVIRDVAAQLGYEGVKCVSPLGIG  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ +    ++++     + + I  ++ +N    +  S VYG     LR HL+  L    
Sbjct  66    GGLAMLWMKTVSVCFYDVNKRIIDCKI-NNKDVSFYFSCVYGHPIRKLRHHLWERLQRIS  124

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              N  G WL  GDFN +   SE            TDF + + + ++ DL F GS+ TW  G
Sbjct  125   INRNGPWLMCGDFNEILHNSEKRGGRVRENWSFTDFRNMVNICKVSDLPFKGSNMTW-SG  183

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKF  2349
                       LDRAL+N +    F  ++V +L M+ SDH P +I I     +     F+F
Sbjct  184   KRRKHRVHCWLDRALANDQWKATFLASEVEYLEMVESDHRPAIIKIKRTTDRGMKP-FQF  242

Query  2348  NMAWTTHYSFQACVQSVWR----SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLAR  2181
             +        FQ  VQ  W     +D+ L        + +S W R+   N   + + L   
Sbjct  243   DTRLCKIQEFQDVVQQSWNGADSTDMSLYERIRHCRKDISAWKRNHNTNSAIQIKELTQE  302

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY---  2010
             ++    + S+            L++ L     +EE  W  +SR +W+  GD  TR Y   
Sbjct  303   IDAAHSNPSIS-----TDQIHELQRRLSAAYREEERYWQLKSRNQWLHHGDHGTRIYGHR  357

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPP  1830
             Q+AT   R                            YF  LFT+    + +       P 
Sbjct  358   QIATEATR----------------------------YFSNLFTSTPTTDISKTIQNIKPI  389

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             +  E    + +  T E+I++ALF +   +A GPDGF   F+   W  VG ++ S V  FF
Sbjct  390   VTAEMNKLLVSDVTDEEIRSALFSIGATRAPGPDGFNAAFYQHYWDVVGPAIISEVKNFF  449

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
               G +    N T L LIPK  +P+ +  FRPI LCNV YK+I+K++  RLK ++ ++V  
Sbjct  450   TTGEMQQEWNHTNLCLIPK-NDPKTMKDFRPIALCNVTYKIISKILTKRLKQVLSEVVSE  508

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRV-GWMALKVDLEKAYDRLSWCFIEDTLRD  1293
              Q++F+ GR ITDN L   E+L++ + ++     +MA+K D+ KAYDR+ W F+E  L  
Sbjct  509   TQAAFIPGRFITDNVLIAHEVLHSLKVRQRCANSYMAVKTDISKAYDRVEWRFLEAVLIK  568

Query  1292  IGFNHT  1275
              GF+ T
Sbjct  569   KGFHPT  574


 Score =   219 bits (559),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 224/435 (51%), Gaps = 21/435 (5%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI+ IM CV +     L NG    +  P +G+RQGDP+SP LF+LCA+ LS ++  + 
Sbjct  573   PTWIKWIMGCVETVSFSVLINGSTYGYFRPSRGIRQGDPLSPSLFILCADVLSSLLSQAT  632

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
             R G  +G++++   P +SHL FADD +FF +AN   ++ + +    +   SGQ IN +KS
Sbjct  633   REGRIQGIQISNGGPRVSHLLFADDSLFFLKANYRNSVNLLQIFKDYGDASGQIINFEKS  692

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ F       T+  I   L IP+V   GK+LGLP   GR KK+    I   +K +  G 
Sbjct  693   SITFGSRVYQQTRDRIKHILSIPNVGGGGKYLGLPKQFGRRKKEMLQYIHTHVKQKTDGW  752

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
              +R L+ AG   +++SV  A+P YSM    +P  +   ++ LI  F WGS + K K   V
Sbjct  753   QTRFLNTAGKETLIKSVAFAMPVYSMNCFELPKKLCSELDSLIARFWWGSTQEKKKISWV  812

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS-S  385
              W  +  SK  GGLG +     N A LA  AW++ Q  + L   L KA+Y  D S +S S
Sbjct  813   AWKKLVTSKNEGGLGFRDFHLFNQALLANQAWKILQRPDNLIYRLLKARYFRDTSFFSAS  872

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRP-----LFEEASAP  220
             W  K   S +W  +     + ++GI++ + +GR T+  +D WL   P     L     A 
Sbjct  873   WGTK--PSYSWNSLRFGRELLKSGIQYSIGDGRLTKLGVDPWLPTNPPRPPLLIRAEDAE  930

Query  219   IAPSSLNNLVANYWISNEGWDWDMLDRVL---PEHILNKLSTFVLQEDTLLGDRLVWYKE  49
             +  S++ + V+ +      WD   + R +     H++ K  T++ Q   L  D  +W   
Sbjct  931   MPVSTIIDPVSFH------WDELQVQRFIDPRDHHLIYK--TYLPQIPAL--DSYIWSGT  980

Query  48    PNGLFSVSSAYELAL  4
              +G+++V S Y  AL
Sbjct  981   KHGMYTVKSGYWKAL  995



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   229 bits (583),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 231/437 (53%), Gaps = 9/437 (2%)
 Frame = -1

Query  2579  ELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL  2400
             +L DLGF GS +TW RG D  +    RLDR L++ +    F  + V H P+  SDH+PLL
Sbjct  18    DLRDLGFRGSPFTWQRGNDPATVIRERLDRFLASEDWCTLFSISSVCHFPIYKSDHAPLL  77

Query  2399  ISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRSDLD--LSTNKSAMVEALSVWSR  2229
             +S     ++    + F F   W +       V+S W S     + +  +A    L  W+ 
Sbjct  78    LSADVRGRRRVHKKLFYFEALWLSRPECFDVVRSAWGSHAGEGIESRVAACAVQLGSWAA  137

Query  2228  DSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSR  2052
              +FG++ ++ +R  A LE  Q      +    +  + R+     + L++ EE  W  R+R
Sbjct  138   ATFGDLKKRVKRKEAELEEWQ----SRVPDAAMLSQCRVLVGELDELHRLEESYWHARAR  193

Query  2051  EEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV  1872
                ++ GD+NT ++    + ++ ++ + +L D  G L  ++  +     DYF  +F++ +
Sbjct  194   VNELRDGDKNTSYFHHKASYRKRRNSILQLQDEHGVLKMEEEEIGDINSDYFTNMFSSSL  253

Query  1871  DVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWP  1692
                      G    +++E   ++ A  T E+I +AL  M P KA G DG    F+ K W 
Sbjct  254   PSGFDEALAGISSKVVDESNHALVAMPTREEIHSALLQMHPNKAPGVDGMHALFYQKFWS  313

Query  1691  TVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVM  1512
              VG  +  FV ++++  +     N T ++LIPK QNP ++  FRPI LCNV+YK+I+KVM
Sbjct  314   VVGDDVIDFVQQWWDSRVDLQSLNATCITLIPKCQNPIQMGDFRPISLCNVLYKVISKVM  373

Query  1511  MIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAY  1335
               RL+ ++  L+ P+QS+FV GR ITDN +   EI +   R+   + G MA K+D+ KAY
Sbjct  374   ANRLEVILPDLISPYQSAFVPGRLITDNAMIAYEIFHYMKRSGDSKTGSMAFKLDMSKAY  433

Query  1334  DRLSWCFIEDTLRDIGF  1284
             DR+ W F+E  +R +GF
Sbjct  434   DRVEWSFLEQVMRKMGF  450


 Score =   228 bits (580),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 148/420 (35%), Positives = 213/420 (51%), Gaps = 3/420 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM C++S       NG++T  I P +GLRQGDP+SP LF+LCAE  S ++  +   
Sbjct  454   WVRRIMVCLSSVSYAFKLNGKVTGNIIPSRGLRQGDPLSPYLFLLCAEAFSTLLAKASDD  513

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G +V R AP +SHLFFADD + F  A   +   +   + ++   SGQKIN  KS +
Sbjct  514   GRIHGARVCRSAPRISHLFFADDSILFTRATLQECSVVADIISVYERASGQKINFNKSEV  573

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSKN +   +  I + LG+  V+   K+LGLP++ GR KK  F  + ER+  +L G   
Sbjct  574   SFSKNVDDSRRVEIRSMLGVREVVKHDKYLGLPTLIGRSKKAVFAVLKERVWKKLQGWKE  633

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ AIP Y M    IP G+++ I  +   F W +     K H + W
Sbjct  634   KLLSKAGKEVLIKAVIQAIPTYMMSLFAIPDGILEDINSMCARFWWRATGMARKMHWISW  693

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
                   K+ GG+G + LK  N A LAK  WRL  D   L   + +A+Y F    +   + 
Sbjct  694   EKFCLPKSYGGMGFRDLKTFNQALLAKQGWRLMCDDGSLAHQIMRARY-FKNVPFLDARR  752

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S  W+ I  A  +   G+KW V NG + R W  +WL       +   P   S  + 
Sbjct  753   GYDPSFVWRSIWGAKSLLMEGLKWRVGNGASIRVWDMAWLPGDS-SSKVPTPNVESREDL  811

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
             +VA+    N GWD   L   L E          L E   + D L W+   +G+FS  SAY
Sbjct  812   MVADLLSVNGGWDVAALAHHLTEEDAMLAREIPLSERYPI-DVLYWWPAKDGIFSTKSAY  870



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score =   239 bits (611),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 146/461 (32%), Positives = 235/461 (51%), Gaps = 24/461 (5%)
 Frame = -1

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
             +F + I    L+D+GF G  +TW       ++   RLDR L + +    F +     L  
Sbjct  239   EFKESIRACNLMDMGFKGHKFTWSNRRFGVNYIEERLDRVLCSKDWGSTFQNLPAISLAN  298

Query  2426  IGSDHSPLLISITTCPQQFCSSRFKF-----NMAWTTHYSFQACVQSVWRSDLDLSTNKS  2262
               SDH P++  +  C ++    +  F        W+++ +    V+S W S  D ++ +S
Sbjct  299   WVSDHCPIMFEVKVCCKKLHYKKNSFPRDYYEDMWSSYEACSNIVRSEWES-FDGNSWES  357

Query  2261  AM----------VEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrl  2112
              +          +  L +WS++ F    +K+  L+ RL+  +      I  + +R     
Sbjct  358   PVQKFQRVAKRSLAHLKIWSKEEFEGRKKKQNELIDRLKMTKQEPLQAIDGEEIRKLEDQ  417

Query  2111  rkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICD  1932
                    L  EE+ W QRSR +W+K GD+NT+F+    + +R ++++  + D  G+ + D
Sbjct  418   ISN---MLVDEEVYWKQRSRADWLKEGDKNTKFFHSKASARRRKNKIWGVEDDQGNWVDD  474

Query  1931  DGLLLKHVYDYFLGLFTTE--VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFD  1758
                +      +F  LFT+        +    G  P + +E    +  PFTPEDI  AL +
Sbjct  475   PEGIEGEFCGFFQQLFTSSNPSQTQISEALKGLLPKVSQEMNTHLEEPFTPEDITRALSE  534

Query  1757  MVPCKASGPDGFTPGFFHKTWPTVGTSLF-SFVHRFFEDGILPPGCNDTILSLIPKVQNP  1581
             M P KA GPDG    FF K W  VG  L  + +H   E G L    N T ++LIPKV+ P
Sbjct  535   MCPTKAPGPDGLPAAFFQKHWQIVGEGLTKTCLHILNEQGTLD-SLNHTFIALIPKVEKP  593

Query  1580  ERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILN  1401
              ++ +FRPI LCNVVY+++ K +  RLK ++  ++ P+QS+F+  R ITDN +   E L+
Sbjct  594   RKVMEFRPISLCNVVYRIVAKAIANRLKPILNHIISPNQSAFIPNRLITDNVIIGYECLH  653

Query  1400  AFRTKKGRV-GWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
               R  KGR  G +ALK+D+ KAYDR+ W F+E T+ ++GF+
Sbjct  654   KIRLSKGRRNGLVALKLDISKAYDRVEWNFLEQTMSNLGFS  694


 Score =   217 bits (552),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 220/426 (52%), Gaps = 9/426 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C+T+     L NG     I P +GLRQG P+SP LF+LCAE  S++++ + R 
Sbjct  697   WISLIMSCITTTCFSVLINGNPVGLIKPERGLRQGCPLSPYLFILCAEAFSNLLNQAERE  756

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                +G+K  +    ++HL FADD + F +A+      +K   D +   SGQ  N +KSS+
Sbjct  757   QKIRGLKFAQDI-TITHLLFADDSLVFSKASVADCKYLKGIFDCYAKASGQIFNFEKSSM  815

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS   +      I +   +  V    K+LGLP + GR K   F  +  ++ +++S    
Sbjct  816   FFSGKASSEQISAIKSIFQLKVVPKYEKYLGLPPMLGRNKMSFFKEVKLKVTSKISSWHH  875

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +  S  G  +++++V  A+P Y+M    +P G+ + I++ I  F WG+++ K+  H  +W
Sbjct  876   KLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWWGTKKDKHGIHWARW  935

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++ +K  GGLG + L   N A +AK  WRL +  N L   + KA+Y  + + W++ + 
Sbjct  936   DSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKARYYKNSTFWNA-KV  994

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL--  202
               N S  W+ IL    + + G++W + +G+    + D W+     F+    PI+P +L  
Sbjct  995   GSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIPRPATFQ----PISPKTLPH  1050

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
               +VA+   S   W  D L++   +  +  +   +L       D ++W+ +  G +SV S
Sbjct  1051  ETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLPSGK-EEDEVLWHFDKKGEYSVKS  1109

Query  21    AYELAL  4
              Y+LAL
Sbjct  1110  GYQLAL  1115


 Score = 69.7 bits (169),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 89/221 (40%), Gaps = 8/221 (4%)
 Frame = -1

Query  2957  QANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLM  2778
             Q +    S  F+    V+ +G  GG+ LF S  +++ I       I   V +     W  
Sbjct  5     QVDATYGSFNFENRFVVDRIGMGGGLALFWSSDVDVTIKSFSSHHIDAIVQNQSGKIWRC  64

Query  2777  SVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFN  2598
             + +YG  + + + H +A L          W  +GDFN +    E       S +  ++F 
Sbjct  65    TGIYGHAEASQKHHTWALLKMLAELYSYNWCCLGDFNEILYSHEKLGANDHSSNMMSEFR  124

Query  2597  DWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGS  2418
             + I    L+D+G+    YTW       +F    LDR   + + S  F +   T L    S
Sbjct  125   ESIRACNLMDMGYKEHKYTWSNRRYEDNFIEETLDRVFCSKDWSSTFQNLPATSLVNWVS  184

Query  2417  DHSPLLISITTCPQQFCSSRFKFNMAWTTHY-----SFQAC  2310
             DH P++  +  C ++     +K N     HY     S++ C
Sbjct  185   DHCPIMFEVKDCCKKL---NYKKNFFPRDHYEDMWSSYEVC  222



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score =   234 bits (596),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/608 (29%), Positives = 279/608 (46%), Gaps = 52/608 (9%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S    R L+  +R H+PS+I L E K+   + + I   +G+     V  +G +
Sbjct  6     WNCRGLGSDPVVRALRGLIRKHRPSMIFLSETKMKDHRIDGIRRHMGYSFGFXVSPIGRA  65

Query  2888  GGIWLFCSVSINIEILY--THPQFIAFQVYDNVSAPWL-MSVVYGCLDMALRRHLFADLS  2718
             GG+ L+   S+N+ IL+  TH   + F + D  S  W+  + VYG      +   +  ++
Sbjct  66    GGLXLWWHESMNVNILFSSTHIIDVCFCMEDCRS--WVRCTFVYGTPYRREKMDFWNWMT  123

Query  2717  *YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW  2538
              YF      WL  GDFN      E S       +R    N+++    L+DLGF G  +TW
Sbjct  124   NYFGPTDIPWLCGGDFNEFVWDHEKSGGARVLYNRXGYLNNFLNAANLMDLGFIGPKFTW  183

Query  2537  IRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR  2358
                                           +V H  +IGSD  P+++   + P      R
Sbjct  184   ------------------------------RVLHETVIGSDXCPIVVQ--SQPSARKGKR  211

Query  2357  -FKFNMAWTTHYSFQACVQSVWRSD-----LDLSTNKSAMVEA-LSVWSRDSFGNIPQKK  2199
              F+F   W      +  V   W S      LD    K ++ ++ L  WSR+ F     KK
Sbjct  212   IFRFEAFWAKEEDCRDLVTKCWSSLGKGRWLDTWHQKLSICKSHLITWSRNKF-----KK  266

Query  2198  RRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNT  2019
             R L          L      D V   + +   +++   QEEL W  R R  W++ GD NT
Sbjct  267   RGLEIEELVHHLDLLQLHXEDNVEEIQVVFNRIDQLREQEELYWLXRFRVNWLRDGDANT  326

Query  2018  RFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
              F+   T  +R  + + +L D DG  + D   +   V D+F  L+T+    +  N    C
Sbjct  327   AFFHRTTLQRRRVNSIVRLKDVDGQXVDDGRRVFTLVDDHFQSLYTSXGSRDWGNI-LNC  385

Query  1838  FPPLLEEDW-ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
               P++ E   A +  P + E+IK A+  M   KA GPDGF   F+H     +   +   V
Sbjct  386   LEPMVSELMNADLIKPVSEEEIKAAVHQMGGLKAPGPDGFQGIFYHSFXDIIVAEVNGLV  445

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               F +        N T L LIPKV  PE ++Q+RPI LCN  +K+++KV+  RL+ ++  
Sbjct  446   MDFMQGVGNSRSINSTYLVLIPKVPTPELVSQYRPISLCNFSFKILSKVLANRLQPLLPL  505

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIED  1305
             L+ P Q+ F+  RQI +N     E+ +  + +K +  + M +K+D++KAYDR+ W F+E 
Sbjct  506   LISPMQNXFIADRQIQENLGLAHELFHFLKLRKTKQKFEMCVKLDMQKAYDRVEWDFLEA  565

Query  1304  TLRDIGFN  1281
              L  +GF+
Sbjct  566   VLLKLGFS  573


 Score =   222 bits (565),  Expect(2) = 5e-118, Method: Compositional matrix adjust.
 Identities = 137/422 (32%), Positives = 202/422 (48%), Gaps = 3/422 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M CV + +   L NG    W SP  G+RQGDP+SP LF++ ++ LS M+   V  
Sbjct  576   WTNLVMNCVRTVKFAILLNGXPGKWFSPSXGIRQGDPLSPYLFLMVSDVLSRMIQRGVDD  635

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+ +    P +SHLFF DD +   +A       +   L+ +C  SGQ +N QK S+
Sbjct  636   XRLNGIHMNPRGPCISHLFFXDDTLICLQATQRNGENIMHILNQYCLASGQMMNXQKXSV  695

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             +F +NT    +  + + LG+PSV D G +LGLP+I GR K+ S   +   +  ++ G   
Sbjct  696   YFGRNTPAQVRSQLGSLLGMPSVSDPGVYLGLPAIXGRSKRSSLAFVKXXVXGKIQGWKQ  755

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS AG  V++++V+ AIP Y M     P  V   ++ +  GFLWG   G    H V W
Sbjct  756   SALSFAGKEVLLKAVVQAIPTYXMNLFKFPVAVCKDLDSMSAGFLWGDCGGHRXIHWVNW  815

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG ++ +  N A L K  W L  + N LW    KA+Y F  S +   + 
Sbjct  816   DTLGRPKYEGGLGFRNFQDFNDALLVKQCWXLILNPNSLWAQTLKARY-FXHSSFLDAKL  874

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                +  AW  +     I +NG  W + NG  TR W+D WL   PL     +     +LN 
Sbjct  875   GSRAXWAWASLPVGRDILKNGAHWQILNGXDTRLWVDRWLPSXPLGHPIPSSPTSVTLNT  934

Query  195   LVANYWI-SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              V++    S + WD + L   + E     +    L  +    DRL+W     G + V S 
Sbjct  935   KVSSLICPSTKSWDIEFLRPFISEVEJKXIYDIPLG-NCSRRDRLIWTSSXXGNYXVRSG  993

Query  18    YE  13
             Y 
Sbjct  994   YH  995



>gb|EEC68887.1| hypothetical protein OsI_37529 [Oryza sativa Indica Group]
Length=1765

 Score =   262 bits (669),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/555 (31%), Positives = 276/555 (50%), Gaps = 23/555 (4%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHL  2733
             V + G SGG+ L+   S+++++   + ++I   V  +   P W ++ VYG   +  R  +
Sbjct  529   VSSEGMSGGLALYWDESVSVDVKDINKRYIDAYVQLSPEEPQWHVTFVYGEPRVENRHRM  588

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             ++ L     +    W  +GDFN    Q E  ++      +  DF D +   EL DLGF G
Sbjct  589   WSLLRTIHQSSSLPWAVIGDFNETMWQFEHFSRTPRGEPQMQDFRDVLQDCELHDLGFKG  648

Query  2552  SSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS-ITTCPQ  2376
               +T+    +       RLDR +++ +    +  A+V HL    SDH P+L++ +   P 
Sbjct  649   VPHTYDNKREGWRNVKVRLDRVVADDKWRDIYSTAQVVHLVSPCSDHCPILLNLVVKDPH  708

Query  2375  QFCSSRFKFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGN  2214
             Q       + + W         ++  W     ++DL D++   + ++ AL  WSR    N
Sbjct  709   QLRQKCLHYEIVWEREPEATQVIEEAWVVAGEKADLGDINKALAKVMTALRSWSRAKVKN  768

Query  2213  IP---QKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETL-YQEELIWFQRSREE  2046
             +    +K R+ LA L          I S+  R   R   +    L Y+EE++W QRSR  
Sbjct  769   VGRELEKARKKLAEL----------IESNADRTVIRNATDHMNELLYREEMLWLQRSRVN  818

Query  2045  WIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDV  1866
             W+K  DRNT+F+      +  ++++SKL DA+  +      L     +YF  ++T + ++
Sbjct  819   WLKDEDRNTKFFHSRAVWRAKKNKISKLRDANETVHSSTMKLESMATEYFQDVYTADPNL  878

Query  1865  NRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTV  1686
             N           + +     +   FT ++I  A+F + P K+ GPDGF   F+ + W T+
Sbjct  879   NPETVTRLIQEKVTDIMNEKLCEDFTEDEISQAIFQIGPLKSPGPDGFPARFYQRNWGTI  938

Query  1685  GTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMI  1506
                +   V RFF+ G++P G NDT + LIPK + P  +  FRPI LCNVVYK+++K ++ 
Sbjct  939   KADIIGAVRRFFQTGLMPEGVNDTAIVLIPKKEQPVDLRDFRPISLCNVVYKVVSKCLVN  998

Query  1505  RLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDR  1329
             RL+ ++  LV   QS+FV GR ITDN L   E  +A  + KK      A K+DL KAYDR
Sbjct  999   RLRPILDDLVSVEQSAFVQGRMITDNALLAFECFHAMQKNKKANHAACAYKLDLSKAYDR  1058

Query  1328  LSWCFIEDTLRDIGF  1284
             + W F+E  +  +GF
Sbjct  1059  VDWRFLEMAMNKLGF  1073


 Score =   192 bits (488),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 138/434 (32%), Positives = 204/434 (47%), Gaps = 40/434 (9%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CVTS R +  +NG L    +P +GLRQGDP+ P LF+  A+ LS ++   V  
Sbjct  1077  WVNWIMKCVTSVRYMVKFNGTLLQSFAPTRGLRQGDPLLPFLFLFVADGLSLLLKEKVAQ  1136

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +    KV R AP +SHL FADD + F +A+  +A  +K+ L  +   +GQ IN  K S+
Sbjct  1137  NSLTPFKVCRAAPGISHLLFADDTLLFFKAHQREAEVVKEVLSSYAMGTGQLINPAKCSI  1196

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF---DNILERIKarlsg  745
                    +G     A +  I  +  + +     S+  ++ K      +N L         
Sbjct  1197  L------MGGASTPAVSEAISEIFPVERDRTFQSLQAKIWKRVIQWGENHLS--------  1242

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL  565
                      G  V++++V+ AIP Y M    +P  VID + +L + F W S  G+ K H 
Sbjct  1243  -------TGGKEVLIKAVIQAIPVYVMGIFKLPESVIDDLTKLTKNFWWDSMNGQRKTHW  1295

Query  564   VKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS  385
               W  +T  K+ GGLG +  +  N A LA+ AWRL    + L   + KAKY F       
Sbjct  1296  KAWDSLTKPKSLGGLGFRDYRLFNQALLARQAWRLITYPDSLCARVLKAKY-FPHGSLID  1354

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSS  205
                  NSS AW+ I   L + + GI W V NG + R W DSWL      + +  PI   +
Sbjct  1355  TSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLPR----DHSRRPITGKA  1410

Query  204   LNNL--VANYWISNEGWDWDMLDRVL----PEHILNKLSTFVLQEDTLLGDRLVWYKEPN  43
                L  V++    +  WD   + +       E ILN   +   +ED      + W+ + N
Sbjct  1411  NCRLKWVSDLITEDGSWDVPKIHQYFHNLDAEVILNICISSRSEEDF-----IAWHPDKN  1465

Query  42    GLFSVSSAYELALE  1
             G+FSV SAY LA +
Sbjct  1466  GMFSVRSAYRLAAQ  1479



>ref|XP_007203701.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
 gb|EMJ04900.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
Length=1367

 Score =   247 bits (631),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/497 (34%), Positives = 241/497 (48%), Gaps = 24/497 (5%)
 Frame = -1

Query  2798  VSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSM  2619
             V   W  + +YGC   A R   +  L          WL  GDFN +    E         
Sbjct  378   VRGKWRFTGIYGCPVTAERHRSWDLLRRLGATNYLPWLCCGDFNEILRADEKLGGRRRRE  437

Query  2618  SRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVT  2439
              +   F   I      DLG+TG  YTW R  + P     RLDRAL+  +   RF   KV 
Sbjct  438   GQMLGFRQAIDTCGFKDLGYTGPKYTWWR--NNPMEIRIRLDRALATADWCSRFLGTKVI  495

Query  2438  HLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW----RSDLDLST  2271
             HL    SDH PL               F+F   W  H +    +Q  W    R     +T
Sbjct  496   HLNPTKSDHLPL------------KKLFRFEEMWAEHVNCMQTIQDGWQRTSRGSAPFTT  543

Query  2270  NKS--AMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkele  2097
              +        L  WS+ +FG++P + +    +L  +   L        V L   L K+L+
Sbjct  544   TEKLKCTCHQLLGWSKCNFGHLPNQIKITQEKLGEL---LDAPPSHHTVELRNVLTKQLD  600

Query  2096  ETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLL  1917
               + + E+ W QRSR  W+K+GDRN++F+    + +R ++ +S L D  GH    +  L 
Sbjct  601   SLMAKNEVYWRQRSRATWLKAGDRNSKFFHYKASSRRRRNTISALEDEHGHWQTTEQGLT  660

Query  1916  KHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKAS  1737
             + V +YF  LF++      T    G    + EE   ++ A FTPE+IK ALF M P KA 
Sbjct  661   QTVVNYFQHLFSSTGSSEYTGVVDGVRGRVTEEMNQTLLAEFTPEEIKIALFQMHPSKAP  720

Query  1736  GPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRP  1557
             GPDGF+P F+ K W  VG  + + V  FF+ G L    N T ++LIPKV  P+ + Q R 
Sbjct  721   GPDGFSPFFYQKYWQIVGEDVVAAVLHFFKTGKLLKKINFTHVALIPKVHEPKNMMQLRL  780

Query  1556  IGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKK-G  1380
             I L NV+YK+  KV+  RLK ++  L+   QS+FV GR I+DN++   E+L+    K  G
Sbjct  781   ISLFNVLYKIGAKVLATRLKAILPTLISDTQSAFVPGRAISDNSIVAFELLHMMHKKNHG  840

Query  1379  RVGWMALKVDLEKAYDR  1329
             R G++ALK+D+ KAYDR
Sbjct  841   RQGYLALKIDMSKAYDR  857


 Score =   206 bits (524),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 213/416 (51%), Gaps = 17/416 (4%)
 Frame = -3

Query  1254  CVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVK  1075
             CVT      + NG    ++ P++GLRQGDP+SP LF+LCAE LS ++  + R     GV 
Sbjct  858   CVTRVSYSFMLNGNPVGYVIPQRGLRQGDPLSPYLFLLCAEALSSLILQAERRNLLHGVN  917

Query  1074  VTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTN  895
             + R AP++SHLFF DD   F  AN     ++      +    GQKI+L+KS + FS N +
Sbjct  918   LCRGAPSVSHLFFTDDRFLFLRANQQDCEQLSIIFQKYEMVLGQKIHLEKSCVSFSNNMD  977

Query  894   LGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtlslag  715
                Q N+AA L +  V     +LGLP+  GR ++  F+++ ERI  ++ G  ++ LS AG
Sbjct  978   RTDQDNLAAVLEVKRVDQHDVYLGLPTHVGRSRRQCFNSLKERIWKKIQGWKAKLLSFAG  1037

Query  714   *HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSK  535
               ++++ V   +P Y M   LIP  + D I++++  + WG ++G+ K H + W  +   K
Sbjct  1038  KEILLKVVAQVVPIYMMNCFLIPKCLCDEIQQVMARYWWGEQDGQRKIHWLSWNKLCLPK  1097

Query  534   ANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNA  355
               GGLG ++L   N+A LAK  WRL Q  N L   + KA+Y  + S+  + Q   + S  
Sbjct  1098  QEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVARILKARYFKNCSILEA-QIGHSPSYI  1156

Query  354   WKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVANYWI  175
             W+ + +A  +     +W + NG + R W DS  L+   F      +      +L+   W 
Sbjct  1157  WQSLCKARVLIEKESQWRIGNGHSVRIWGDSLTLNLSKFPHHKQRVTMQWKEDLL-QAWF  1215

Query  174   SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYELA  7
             S E  +           I N   +F    D      L+W+ E +G ++V S +E+A
Sbjct  1216  STEEVNC----------IRNIPLSFRHPPDI-----LIWHFERDGQYTVRSGHEVA  1256



>ref|XP_010412448.1| PREDICTED: uncharacterized protein LOC104698743 [Camelina sativa]
Length=1329

 Score =   263 bits (673),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/577 (32%), Positives = 272/577 (47%), Gaps = 19/577 (3%)
 Frame = -1

Query  2981  FEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCS-VSINIEILYTHPQFIAFQVY  2805
              E K  R    +     G+ +   VE +G SGG+ LF S    N+ IL+   + I  +  
Sbjct  1     METKQPRVVLEKYIGHFGYTDLTTVEPIGSSGGLALFYSQADFNVTILFESNRLIDIEAV  60

Query  2804  DNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETF  2625
                   +L + VYG      R  ++  L     +    W  +GDFN +T   E    +  
Sbjct  61    YKGRVIYL-TFVYGDPVPKNRDMVWERLLRIGVSRSSPWFTVGDFNELTGNHEKRGGKLR  119

Query  2624  SMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAK  2445
               S    FN  I     ++  F G   +W RG         RLDRAL N +    FPD  
Sbjct  120   HPSSFLPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTV  178

Query  2444  VTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW-----RSDLD  2280
             + +LPMI SDH P++++I    +     RF F+  W         +++ W     +S  +
Sbjct  179   LEYLPMIASDHKPVVVNIGA-KRPRGKRRFMFDPRWIGKEGLMEAIEAGWVGGTPQSSPN  237

Query  2279  LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkel  2100
                       A+S W +D   ++P  +  +    E ++  LS+    D   L        
Sbjct  238   FLDKIVICRRAISRWRKD---HVPFGRETI----EDLKCQLSVAQADDATPLSVIADLNA  290

Query  2099  e--ETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDG  1926
                E    EE+ W+ +SR +W++ GD+N++++   T  +R ++R+  L D +     +D 
Sbjct  291   RLWEAYKDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQRRARNRIIGLYDKNEIWSTEDE  350

Query  1925  LLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPC  1746
              +      YF  LFTT    N         P +  E  A + A  T  +++ ALF M P 
Sbjct  351   DICNIAVSYFADLFTTLHPTNFDEVLREVHPVITAEANAQLTARVTESEVRAALFMMHPD  410

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             KA GPDG T  F+ K W  V   L S V+ FFE+G+   G N T + LIPKV  P R+T+
Sbjct  411   KAPGPDGMTALFYQKAWQIVKGDLVSLVNGFFEEGVFDRGLNTTHICLIPKVAKPTRMTE  470

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK  1386
              RPI LCNV YK+I+K+M  RLK ++  L+   QS+FV GR I+DN L  QE+ +  RT 
Sbjct  471   LRPISLCNVGYKIISKIMCQRLKKLLPDLISETQSAFVPGRLISDNILIAQEMFHGLRTN  530

Query  1385  KGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
                 G +MA+K D+ KAYDR+ W FI+  L  +GF+ 
Sbjct  531   PSCKGKFMAIKTDMSKAYDRVEWEFIDKLLHKMGFDE  567


 Score =   190 bits (482),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 139/435 (32%), Positives = 207/435 (48%), Gaps = 26/435 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR IM CV+S     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  +   
Sbjct  569   WIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKAEAE  628

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +    Q   + + L  + + SGQ+IN  KSS+
Sbjct  629   KLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSI  688

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       T+  I   LGI +   MG +LGLP   G  K   F  + ER++ R +G S+
Sbjct  689   QFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFSFVRERLQGRTTGWSA  748

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  VM++S+ +A+P + M    +P  +   +   +  F W S       H + W
Sbjct  749   RLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSDGRTGGMHWLAW  808

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY--DFDPSVWSSW  382
               +  SK  GGLG +++   N A LAK  WRL +  + L+  + K +Y  + DP      
Sbjct  809   EKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSDP-----M  863

Query  381   QPKR--NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAP  211
             +P R  + S  W+ I+ A  + + G+   V +G +   W D W+    P    +  P   
Sbjct  864   EPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPFKD  923

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEH-------ILNKLSTFVLQEDTLLGDRLVWYK  52
              SL     ++ I +    W M   VL +H       ++  L      +D  LG    W+ 
Sbjct  924   PSLK---ISHLIDSRTRSWRM--DVLSDHFDPGDVALIGALPLGSCPKDDTLG----WHF  974

Query  51    EPNGLFSVSSAYELA  7
               NG ++V S Y +A
Sbjct  975   TKNGRYTVKSGYHVA  989



>ref|XP_009112590.1| PREDICTED: uncharacterized protein LOC103837948 [Brassica rapa]
Length=1415

 Score =   232 bits (592),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/510 (31%), Positives = 247/510 (48%), Gaps = 23/510 (5%)
 Frame = -1

Query  2777  SVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFN  2598
             S V+G  D   R HL+  L       +  W   GDFN++ C  E    +       TD  
Sbjct  172   SFVHGSTDKNQRNHLWDVLVTKATIREDAWFITGDFNNLLCSEEKEGGQERPEGSFTDMR  231

Query  2597  DWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM-IG  2421
              +    +L DL  +G   +W RG         RLDRA +N   + RFP A+  +L   + 
Sbjct  232   TFFSEGDLFDLQHSGDPLSW-RGQRGDHLVRCRLDRAAANTLWAERFPTARCQYLEADLT  290

Query  2420  SDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNK--SAMVEA  2247
             SDH PLL S      +     F+++     +   +  + + WR     S     ++   A
Sbjct  291   SDHKPLL-SFFDKGGRRRRGNFRYDRRLCKNEEARKMISNAWRGAGQASVRDKLASTRSA  349

Query  2246  LSVWSRDSFGN----IPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQE  2079
             +S W++    N    I Q+K  L A L      + +          + +  +L      E
Sbjct  350   ISAWNKTQHRNSQEVIQQQKTALNAALSSPVNDIDL---------IQVIAAKLNAAYSAE  400

Query  2078  ELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDY  1899
             E  W QRSR  W+K GDRNT ++   T  ++  +  S +   DG ++  +  +++ + DY
Sbjct  401   EEYWRQRSRALWLKLGDRNTGYFHATTKNRKRINGFSVIEREDGQMVHKEEEIVQVIGDY  460

Query  1898  FLGLFTTEVDVNRTNFCYGCFPPLL--EEDWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
             F  +F++ +   R +       PLL  EE+ + +  P T  +I+ A F +   KA GPDG
Sbjct  461   FQKMFSS-LPGEREDIVNRALQPLLTGEENDSLIAVP-TSGEIRDAAFSINAEKAPGPDG  518

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
             F+ GFFH  W  VG  +   V  FF    LP   N+T + LIPK+ NP++++ +RPI LC
Sbjct  519   FSAGFFHTHWEDVGPDIVKEVQGFFRGEPLPELINETNIRLIPKIPNPQKVSDYRPIALC  578

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGW  1368
             NV YK+ +K++  RL+ ++ KL+  +QS+FV GR I DN L   E+L+   T +  +   
Sbjct  579   NVYYKIFSKLLTRRLQPLLSKLISVNQSAFVPGRAIGDNILITHEVLHYLNTSQAEQRCA  638

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             MA+K D+ KAYDRL W FI   +  +GF+ 
Sbjct  639   MAVKTDMSKAYDRLEWEFISLVMVRLGFHQ  668


 Score =   220 bits (560),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 142/429 (33%), Positives = 223/429 (52%), Gaps = 11/429 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             +++ +M C++S     L NG     + P +G+RQGDP+SP +F++C+E LS + + +   
Sbjct  670   FVKCVMQCISSVTYSFLINGLPRGKVVPSRGIRQGDPLSPYIFIMCSEVLSGLCNQAKED  729

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +G++V R  P ++HL FADD +FF E        +   L  + S SGQ I+ +KS++
Sbjct  730   GSLQGIRVARGCPRINHLLFADDTMFFLETTQGNCSALTDILTKYESASGQTISKEKSAI  789

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+ T    ++ +   L I      GK+LGLP   GR K D F +I++RIK +  G S+
Sbjct  790   TFSRRTPAAIKEMVKEELQIQKEGGTGKYLGLPEQFGRRKHDIFSSIVDRIKQKARGWSN  849

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  VM+QSVLSA P YSM    +P  +   I+  +  F W + E   K   V W
Sbjct  850   KFLSSAGKMVMLQSVLSAAPSYSMSHFALPVSLCKRIQSTVTRFWWDNNEHTRKMAWVSW  909

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GGLG +  +  N+A LAKL+WRL Q+ +CL   +   KY  + +V ++  P
Sbjct  910   DSMAKPKALGGLGFRDFQVYNVALLAKLSWRLVQNPDCLLGQVLLGKYCTESNVLTATGP  969

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP---SS  205
               N S+ W+ +L    +    + W V NG+  + W D WL     F +   P+ P   S+
Sbjct  970   S-NMSHGWRSVLVGRDLLIKNLGWVVGNGQDIKVWDDPWL----SFSKQVRPMGPPQEST  1024

Query  204   LNNLVANYWISNE-GWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             +   V++        WD   +   LP +          Q   L  DR++W    +G++SV
Sbjct  1025  VELRVSDLMCPGTCEWDATKIHSWLPMYEETIRCIKPSQSGAL--DRIIWLGTKSGVYSV  1082

Query  27    SSAYELALE  1
              S Y  A++
Sbjct  1083  KSGYYSAVD  1091



>gb|AAP54692.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1585

 Score =   252 bits (644),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/600 (29%), Positives = 287/600 (48%), Gaps = 53/600 (9%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  + +  + L   ++      + L E +    +   + + LG   +  V + G S
Sbjct  467   WNCRGIGNATTVQELCALVKEASSQFVFLCETRQPVDKIKRLRNRLGLRGFAGVSSDGMS  526

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ LF   S+++EIL  + +FI   +  + + P W  + VYG   +  R  +++ L+  
Sbjct  527   GGLALFWHESVHVEILNKNERFIDAYIRLSPNDPLWHATFVYGEPRVENRHKMWSLLNSI  586

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +   +WL +GDFN    Q E  +++  S ++   F D +   EL DLG +G  +T+  
Sbjct  587   KQSSNLSWLVIGDFNEALWQFEHFSRKPRSDAQMQAFRDVLDTCELHDLGISGLPHTYDN  646

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI-TTCPQQFCSSRF  2355
                  +    RLDRAL++ E    F   +V HL    S+H P+++ +  + P Q      
Sbjct  647   RRGGWNNVKVRLDRALADDEWRDLFSQYQVQHLVSPCSNHCPIVLKLHGSVPDQ------  700

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLE  2175
                                                    WS+  + NI ++  +   +L 
Sbjct  701   --------------------------------------SWSKKKYKNIGRELEKTRKKLS  722

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
              +   L  G         R+    + E LY+EE++W QRSR  W+K GDRNT+F+     
Sbjct  723   NL---LEAGT---DKAAIRQTSDYMNELLYREEMLWLQRSRVNWLKEGDRNTKFFHNRVA  776

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
              +  +++++KL DA G       ++ +    YF  +FT + +++ +       P + EE 
Sbjct  777   WRAKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSPVTRLIQPKVTEEM  836

Query  1814  WASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
                + + F+ ++I  ALF + P KA G DGF   F+ + W  +   +   V  FF  GI+
Sbjct  837   NNRLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWGCIKNDIVRAVKEFFHSGIM  896

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
               G NDT + LIPK++ P  +  FRPI LCNV+YK+++K ++ RL+  + +L+  +QS+F
Sbjct  897   LEGVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKCLVNRLRPFLDELISKNQSAF  956

Query  1454  VHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             V  R ITDN L   E  +   R K  R    A K+DL KAYDR+ W F+E ++   GF+H
Sbjct  957   VPRRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKAYDRVDWRFLEQSMYKWGFSH  1016


 Score =   199 bits (507),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 133/395 (34%), Positives = 206/395 (52%), Gaps = 14/395 (4%)
 Frame = -3

Query  1176  QGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSI  997
             +G    P LF+  A+ LS +++  V  G    ++V   AP +SHL FADD + F +A+  
Sbjct  1032  KGTRCDPFLFLFVADGLSLLLEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLS  1091

Query  996   QALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLP  817
             Q+  +K+    + + +GQ IN  K S+ F  +  + ++  I   L I S     K+LGLP
Sbjct  1092  QSQAIKEVFGSYATSTGQLINPTKCSILFGNSLPIASRDAITNCLQIASTEFEDKYLGLP  1151

Query  816   SIHGRLKKDSFDNILERIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGV  637
             +  GR+ K  F ++ ERI  ++       LS  G  V++++V+ AIP Y M    +P  V
Sbjct  1152  TPGGRMHKGRFQSLRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESV  1211

Query  636   IDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLS  457
              + +  L R F WG+ +GK K H   W  +T SK+ GGLG K ++  N A LA+ AWRL 
Sbjct  1212  CEDLTSLTRNFWWGAEKGKRKTHWKAWKSLTKSKSLGGLGFKDIRLFNQALLARQAWRLI  1271

Query  456   QDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATR  277
              + + L   + KAKY  + S+  +     N+S  W+ I   L + + GI W + NGR+ R
Sbjct  1272  DNPDSLCARVLKAKYYPNGSIVDT-SFGGNASPGWQAIEHGLELVKKGIIWRIGNGRSVR  1330

Query  276   FWLDSWLLDRPLFEEASAPIAPSSLNNL--VANYWISNEGWDWDMLDRV-LP--EHILNK  112
              W D W L R L   +  PI P +   +  VA+  + N  WD + ++++ LP    I+ K
Sbjct  1331  VWQDPW-LPRDL---SRRPITPKNNCRIKWVADLMLDNGMWDANKINQIFLPVDVEIILK  1386

Query  111   LSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYELA  7
             L T    E+    D + W+ +  G FSV +AY LA
Sbjct  1387  LRTSSRDEE----DFIAWHPDKLGNFSVRTAYRLA  1417


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 0/140 (0%)
 Frame = -3

Query  4362  RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVT  4183
             ++ + + L   ++  W+L A     +L  + FI  F +  DY  VK GGPW+   D L+ 
Sbjct  178   KTPNQNALFDDMRRAWRLRADMNYKSLRDNLFIVSFSSEGDYKFVKDGGPWLHRGDALLV  237

Query  4182  QEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGK  4003
              E+     P    ++ +  W+R   LP+     D     G  +G   ++D+     +K  
Sbjct  238   AEFDGLTSPSQVPLEVVPIWVRIYDLPLVLMTKDRGILYGSKLGHVREVDVEADGRNKHD  297

Query  4002  FARVCVQLDITKPLLSNFVI  3943
             F R+ V L + + L ++  I
Sbjct  298   FFRIRVDLPVNRALKTHIAI  317



>gb|AAO00713.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1557

 Score =   252 bits (643),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/600 (29%), Positives = 287/600 (48%), Gaps = 53/600 (9%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  + +  + L   ++      + L E +    +   + + LG   +  V + G S
Sbjct  439   WNCRGIGNATTVQELCALVKEASSQFVFLCETRQPVDKIKRLRNRLGLRGFAGVSSDGMS  498

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ LF   S+++EIL  + +FI   +  + + P W  + VYG   +  R  +++ L+  
Sbjct  499   GGLALFWHESVHVEILNKNERFIDAYIRLSPNDPLWHATFVYGEPRVENRHKMWSLLNSI  558

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               +   +WL +GDFN    Q E  +++  S ++   F D +   EL DLG +G  +T+  
Sbjct  559   KQSSNLSWLVIGDFNEALWQFEHFSRKPRSDAQMQAFRDVLDTCELHDLGISGLPHTYDN  618

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI-TTCPQQFCSSRF  2355
                  +    RLDRAL++ E    F   +V HL    S+H P+++ +  + P Q      
Sbjct  619   RRGGWNNVKVRLDRALADDEWRDLFSQYQVQHLVSPCSNHCPIVLKLHGSVPDQ------  672

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLE  2175
                                                    WS+  + NI ++  +   +L 
Sbjct  673   --------------------------------------SWSKKKYKNIGRELEKTRKKLS  694

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
              +   L  G         R+    + E LY+EE++W QRSR  W+K GDRNT+F+     
Sbjct  695   NL---LEAGT---DKAAIRQTSDYMNELLYREEMLWLQRSRVNWLKEGDRNTKFFHNRVA  748

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
              +  +++++KL DA G       ++ +    YF  +FT + +++ +       P + EE 
Sbjct  749   WRAKKNKITKLRDAAGTFHRSKMVMEQMATQYFKDMFTADPNLDHSPVTRLIQPKVTEEM  808

Query  1814  WASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
                + + F+ ++I  ALF + P KA G DGF   F+ + W  +   +   V  FF  GI+
Sbjct  809   NNRLCSEFSEDEIANALFQIGPLKAPGTDGFLARFYQRNWGCIKNDIVRAVKEFFHSGIM  868

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
               G NDT + LIPK++ P  +  FRPI LCNV+YK+++K ++ RL+  + +L+  +QS+F
Sbjct  869   LEGVNDTAIVLIPKIEQPRDLRDFRPISLCNVIYKVLSKCLVNRLRPFLDELISKNQSAF  928

Query  1454  VHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             V  R ITDN L   E  +   R K  R    A K+DL KAYDR+ W F+E ++   GF+H
Sbjct  929   VPRRMITDNALLAFECFHFIQRNKNPRSAACAYKLDLSKAYDRVDWRFLEQSMYKWGFSH  988


 Score =   199 bits (506),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 133/395 (34%), Positives = 206/395 (52%), Gaps = 14/395 (4%)
 Frame = -3

Query  1176  QGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSI  997
             +G    P LF+  A+ LS +++  V  G    ++V   AP +SHL FADD + F +A+  
Sbjct  1004  KGTRCDPFLFLFVADGLSLLLEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLS  1063

Query  996   QALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLP  817
             Q+  +K+    + + +GQ IN  K S+ F  +  + ++  I   L I S     K+LGLP
Sbjct  1064  QSQAIKEVFGSYATSTGQLINPTKCSILFGNSLPIASRDAITNCLQIASTEFEDKYLGLP  1123

Query  816   SIHGRLKKDSFDNILERIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGV  637
             +  GR+ K  F ++ ERI  ++       LS  G  V++++V+ AIP Y M    +P  V
Sbjct  1124  TPGGRMHKGRFQSLRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESV  1183

Query  636   IDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLS  457
              + +  L R F WG+ +GK K H   W  +T SK+ GGLG K ++  N A LA+ AWRL 
Sbjct  1184  CEDLTSLTRNFWWGAEKGKRKTHWKAWKSLTKSKSLGGLGFKDIRLFNQALLARQAWRLI  1243

Query  456   QDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATR  277
              + + L   + KAKY  + S+  +     N+S  W+ I   L + + GI W + NGR+ R
Sbjct  1244  DNPDSLCARVLKAKYYPNGSIVDT-SFGGNASPGWQAIEHGLELVKKGIIWRIGNGRSVR  1302

Query  276   FWLDSWLLDRPLFEEASAPIAPSSLNNL--VANYWISNEGWDWDMLDRV-LP--EHILNK  112
              W D W L R L   +  PI P +   +  VA+  + N  WD + ++++ LP    I+ K
Sbjct  1303  VWQDPW-LPRDL---SRRPITPKNNCRIKWVADLMLDNGMWDANKINQIFLPVDVEIILK  1358

Query  111   LSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYELA  7
             L T    E+    D + W+ +  G FSV +AY LA
Sbjct  1359  LRTSSRDEE----DFIAWHPDKLGNFSVRTAYRLA  1389


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 0/140 (0%)
 Frame = -3

Query  4362  RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVT  4183
             ++ + + L   ++  W+L A     +L  + FI  F +  DY  VK GGPW+   D L+ 
Sbjct  178   KTPNQNALFDDMRRAWRLRADMNYKSLRDNLFIVSFSSEGDYKFVKDGGPWLHRGDALLV  237

Query  4182  QEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGK  4003
              E+     P    ++ +  W+R   LP+     D     G  +G   ++D+     +K  
Sbjct  238   AEFDGLTSPSQVPLEVVPIWVRIYDLPLVLMTKDRGILYGSKLGHVREVDVEADGRNKHD  297

Query  4002  FARVCVQLDITKPLLSNFVI  3943
             F R+ V L + + L ++  I
Sbjct  298   FFRIRVDLPVNRALKTHIAI  317



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score =   246 bits (628),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/481 (33%), Positives = 244/481 (51%), Gaps = 18/481 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W+  GDFN V  QSEV +      ++   F   +   EL DLG+ G  +TW      P  
Sbjct  20    WIVAGDFNEVMIQSEVDSSHLRPQAQMQSFRLTLSDCELHDLGYDGFPFTWCNNRKAPDT  79

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-----FKFN  2346
               ARLDRA++    S  +P A V HL    SDH P+LI +   P    SSR     F+F 
Sbjct  80    VRARLDRAIATQPWSQLYPKAVVKHLSHGSSDHLPILIVLD--PNTLPSSRPLRKRFRFE  137

Query  2345  MAWTTHYSFQACVQSVWRSDLDLST-NKSAMVEALSV--WSRDSFGNIPQKKRRLLARLE  2175
               W +    +  ++  W       T N+      +S+  W +D  G I  + RRL   L+
Sbjct  138   AFWASIPGCEEVIKQTWPLPHTPDTLNRRIQNTRISLLKWYQDKVGPIKTRLRRLAQELD  197

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLY-QEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
              +   LS+   +D  +   R  K+ +E+L+ QEEL W QR +  W++ GDRNT F+  + 
Sbjct  198   ALS-KLSI---TDATQASERHLKDEQESLWKQEELYWKQRGKAHWLRCGDRNTAFFHASA  253

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV-DVNRTNFCYGCFPPLLE  1821
             T KR Q+R+  + +  GH +     +      YF  LF + + D  + +      P  + 
Sbjct  254   TEKRTQNRIKGIKNLHGHWVTLVSDVRSTFLSYFQHLFASSLPDPIQIDRTLAVIPRTVT  313

Query  1820  EDWASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFED  1644
             +   SV   P+T  ++  A+ +M P  + GPDG  P F+ K W TVG +    V      
Sbjct  314   DSMRSVLERPYTAAEVWPAIRNMKPLSSPGPDGLPPLFYQKYWSTVGPATVRAVLHLLNH  373

Query  1643  GILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQ  1464
             G +    N + + LIPKV +P+    +RPI L NVVYK+ +K++  R+K ++ K++   Q
Sbjct  374   GSMESRMNHSFIVLIPKVSDPQEPAHYRPISLSNVVYKIASKMVATRIKPIMEKIISKEQ  433

Query  1463  SSFVHGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIG  1287
             ++F+ GR ITDN L   E+ ++ +T ++G   + ALK+D+ KA+DR+ W F+E  LR  G
Sbjct  434   AAFLSGRSITDNILMAYELNHSIKTSRRGEPRYGALKLDVSKAFDRIEWTFLEKVLRCHG  493

Query  1286  F  1284
             F
Sbjct  494   F  494


 Score =   205 bits (521),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 138/430 (32%), Positives = 219/430 (51%), Gaps = 19/430 (4%)
 Frame = -3

Query  1272  IRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSG  1093
             IR IM CVT+     + NG     I P +G+RQGDP+SP LF+LC++ LS ++ +     
Sbjct  499   IRTIMLCVTTVTYSVMINGVPEGNIIPTRGIRQGDPLSPYLFILCSDTLSRLLHAECDRN  558

Query  1092  NWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLF  913
             +  G +++   P +SHL FADD + F  A       +   L  + + SGQ INL+KS L 
Sbjct  559   SEIGFQLSPTTPKISHLLFADDTLIFSSATLAAMRGIDGVLSSYAAVSGQMINLEKSVLV  618

Query  912   FSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssr  733
                  +      ++  +G+P    +G++LGLPS+ G  KK +F N+ +RI +R+    ++
Sbjct  619   IPSEPDAQYTHLLSEAVGVPLTETLGRYLGLPSMVGLSKKAAFRNLKDRIHSRILHWHTK  678

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWG  553
              LS AG  V+++SVL AIP YSM+   +P+ +I  +  L+  F W  R GK K HL+ W 
Sbjct  679   FLSKAGKMVLIKSVLQAIPAYSMQCFKLPASLIAELNGLLSSFWWDDR-GKPKMHLLAWD  737

Query  552   IVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK  373
              +  +  +GGLG ++L   N A LAK  WR+    + L   L K KY  + S   +    
Sbjct  738   KLCRATVHGGLGFRNLAIFNKALLAKQCWRILMKPDSLLAQLLKGKYYRNTSFLCA-SLG  796

Query  372   RNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL----LDRPLFEEASAPIAPSS  205
             R+ S  W+ +L A  +  +G++W   +G     W   WL      +P+++    P     
Sbjct  797   RSPSFTWRSLLTARELLVSGLRWCPGDGSQINIWSSPWLPRMGFFKPIYKRPELP-----  851

Query  204   LNNLVANYWISNEGWDWDMLDRVLPEHILNKL-STFVLQEDTLLG---DRLVWYKEPNGL  37
                L  +  I+    DW   +R L  H+   + ++ +L      G   DRL+W+   +G 
Sbjct  852   -PTLRVSDLINPGTRDW---NRSLIRHLFLPIDASSILSIPLGTGRHPDRLIWHFSKDGA  907

Query  36    FSVSSAYELA  7
             +SV S Y+ A
Sbjct  908   YSVKSGYKRA  917



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score =   251 bits (642),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/579 (29%), Positives = 275/579 (47%), Gaps = 28/579 (5%)
 Frame = -1

Query  2957  QANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLM  2778
             Q N       F+    V+  G  GG+ LF + ++ +EI       I   V       W  
Sbjct  5     QVNFENKHFNFENHFAVDRNGLGGGLALFWTSNVEVEIKSYSLHHIDALVKTGNGKVWRC  64

Query  2777  SVVYGCLDMALRRH---LFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCT  2607
             + VYG  +   + +   L   L+  F  P   W   GDFN +    E S     ++    
Sbjct  65    TGVYGHPETNQKHNTWTLLKRLAGIFSYP---WCCFGDFNEILNLQEKSGGNEKNIDMVV  121

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
              F + +    L+D+G+ G  +TW        F   RLDR L + + S  F D   T+L  
Sbjct  122   QFREAVQACNLVDVGYRGHPFTWSNRRYGQHFIEERLDRFLCSNDWSENFHDMAATNLVN  181

Query  2426  IGSDHSPLLISITTCPQQFCSS-----RFKFNMAWTTHYSFQACVQSVWRS------DLD  2280
               SDH P+L+ +    +          R  +   W+++ + +  V++ W S      +  
Sbjct  182   WVSDHCPILMEVRERSKDRSHGKKSIHREHYEDMWSSYEACKNIVRNEWASMGRGARENP  241

Query  2279  LSTNKSAMVEALS---VWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlr  2109
             +   + A   +L+   +WS+  F +  +K+ +L+ +L   +   +  +  D +R      
Sbjct  242   VKHFQQAAKNSLANLKIWSKSEFADRKKKQDQLINQLIHAKHGSAQRMNGDQIRRIENQI  301

Query  2108  keleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDD  1929
                   L  EE+ W QRSR EW+K GDRNT+++    + +R ++++  + ++ G    D 
Sbjct  302   NG---MLMDEEIYWRQRSRAEWLKEGDRNTKYFHSKASARRRKNKIWGIENSHGQWTEDQ  358

Query  1928  GLLLKHVYDYFLGLFTTEVDVNRTNF---CYGCFPPLLEEDWASVNAPFTPEDIKTALFD  1758
               + K   +YF  LFTT    N++       G  P +       +  PFT E+I  AL  
Sbjct  359   REVEKEFCEYFQNLFTTS-SPNQSQIQDALDGISPKVTTNMNHQLEEPFTEEEIVEALHQ  417

Query  1757  MVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPE  1578
             M P KA GPDG    FF K W TV +S+         +G      N T ++LIPK   P+
Sbjct  418   MSPTKAPGPDGLPAAFFQKHWQTVRSSVIGTCMHILNEGGNLSALNHTFIALIPKTTKPK  477

Query  1577  RITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNA  1398
             ++T+FRPI LCNV+Y+++ K +  RLK ++ +++ P QS+F+  R I+DN +   E L+ 
Sbjct  478   KVTEFRPISLCNVIYRIVAKTIANRLKPILSQIISPTQSAFIPNRLISDNVIIGYECLHK  537

Query  1397  FRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              R  +G + G +ALK+D+ KAYDR+ W F++ T++ +GF
Sbjct  538   IRHSQGKKKGLVALKLDISKAYDRVEWTFLKQTMKKLGF  576


 Score =   199 bits (507),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 122/428 (29%), Positives = 209/428 (49%), Gaps = 11/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM C+TS     + NG    +  P +GLRQG P+SP LF++C E  S ++  +   
Sbjct  580   WLELIMGCITSVSFSVIINGTPKGFFHPERGLRQGCPLSPYLFIICTEVFSSLLLQAETK  639

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G++       +SHL FADD + F  A+  +   +K   D +   SGQ  N +KSS+
Sbjct  640   KRISGLRFAEDV-TISHLLFADDSLVFSTASVAECKHLKGIFDRYAKASGQIFNFEKSSM  698

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF        +  I     +  V    K+LGLPS+ GR K   F  +  R+ ++++    
Sbjct  699   FFGGKIPEEQKAAIRNIFNLNVVSKYEKYLGLPSMIGRKKTSFFREVKLRVLSKINNWQH  758

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +  S  G  +++++V  A+P Y+M    +P G+ + I+  I  F WGS++ K   H  +W
Sbjct  759   KMFSSGGKEILIKAVAQAVPAYAMSVFKLPKGLCEEIQSEIAKFWWGSKKDKRGIHWARW  818

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++ +K+ GGLG +     N A +AK  WRL Q  N L + + +A+Y F    +   +P
Sbjct  819   DKLSCAKSRGGLGFRDFISFNQAMVAKQGWRLIQFPNSLVSKVLRARY-FKSCSFLDAKP  877

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N S  W+ IL    + + G +W + NG     + D+W+     F+  S P  P  ++ 
Sbjct  878   GSNPSFIWRSILWGRQVIQKGARWRIGNGSNILVYKDNWIPRPDTFKPISPPTLP--IDT  935

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQ---EDTLLGDRLVWYKEPNGLFSVS  25
              V         W+   L+    +H + + +  +L+     +   D ++W+ + +G +SV 
Sbjct  936   TVGELMDDENNWNVAKLN----QHFMQEDTEAILKIPLPRSQKVDEMMWHYDKHGEYSVK  991

Query  24    SAYELALE  1
             S Y++AL+
Sbjct  992   SGYQIALK  999



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   237 bits (605),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/600 (29%), Positives = 288/600 (48%), Gaps = 37/600 (6%)
 Frame = -1

Query  3050  ASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLF  2871
              +P   +TL+ +    +P+++ L E  I   +   +    GF + + + + G SGGI  F
Sbjct  2     GNPWTVKTLQTWCWRERPNVVFLMETMIDSKKLQIVKEKCGFTDGLCLSSEGLSGGI-GF  60

Query  2870  CSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGC-------LDMALRRHLFADLS*  2715
                 +N+ ++      +A +V +    P W+   +YG        L  AL R L   +S 
Sbjct  61    WWRDVNVRVISFSKHHVAVEVCNEEDVPVWVAVGIYGWPKATNKHLTWALMRELKDTISL  120

Query  2714  --YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
                FF         GDFN +   SE       S      F + + + ++ DLG+ G ++T
Sbjct  121   PVIFF---------GDFNEILHASEKEGGAVRSERLIDAFRESVELCKVHDLGYRGGTFT  171

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSS  2361
             W RG D  S    RLDR L++      FP A+V + P+  SDH+P+L+      Q+  + 
Sbjct  172   WRRGNDASSMIRERLDRFLASDGWDELFPHARVRNFPIYRSDHAPILLETEEEGQRRRNG  231

Query  2360  RFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLAR  2181
             R          + F+A    +W S+ D+S       +AL  W+  +FG+I   K+R+ ++
Sbjct  232   R---------RFHFEA----LWLSNPDVSNVGGVCADALRGWAAGAFGDI---KKRIKSK  275

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVA  2001
              E +Q   S      ++   + + KEL+E     E  W  R+R   ++ GDRNT  +   
Sbjct  276   EEELQVWHSQAPDGRMLEKCKEIVKELDELNRLHESYWHARARANEMRDGDRNTAHFHHK  335

Query  2000  TTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLE  1821
              + ++ ++ + KL D  G     +  + + + DYF  +F++ +  +      G    + +
Sbjct  336   ASQRKKRNMIRKLKDDTGEWKEKEEDVSRIITDYFSNIFSSSLPRDFDAALAGLTAKVTD  395

Query  1820  EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDG  1641
             E   ++ A    E+++ ALF M P KA G DG    F+ K W  VG  +  FV  ++   
Sbjct  396   EANEALVASPNSEEVRGALFQMHPNKAPGVDGMHALFYQKFWHIVGDDIVKFVQEWWRGE  455

Query  1640  ILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQS  1461
                   N T + LIPK   P ++  FRPI LC V+YK+I+K+M  RLK  +  L+  HQS
Sbjct  456   TQIETLNKTCIVLIPKCPAPCKMGDFRPISLCTVIYKIISKMMANRLKIYLSDLISAHQS  515

Query  1460  SFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +FV GR ITDN +   EI +  + K  G+ G MA K+D+ KAYD + W F+E  +  +GF
Sbjct  516   AFVPGRLITDNAMIAFEIFHHMKRKGDGKNGLMAFKLDMSKAYDCVEWSFLERVMLKLGF  575


 Score =   213 bits (543),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 140/426 (33%), Positives = 215/426 (50%), Gaps = 15/426 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R +M C++S       NG++   I P +GLRQGDP+SP LF+LCAE  S ++  +   
Sbjct  579   WVRRVMECLSSVTYAFKLNGRVEGHIIPSRGLRQGDPLSPYLFLLCAEAFSALLSKAADD  638

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G +V R  P +SHLFFADD + F  A   +   + + L  +   SGQKIN  KS +
Sbjct  639   GRIHGARVCRSGPRISHLFFADDSILFSRATLQECSVVAEILSTYERASGQKINFDKSEV  698

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK+ +   +  I +  G+  V    K+LGLP++ GR KK  F  + ER+  +L G   
Sbjct  699   SFSKHVDTNRRVAIRSLFGVREVEKHEKYLGLPTVIGRSKKVIFSVLKERVWKKLQGWKE  758

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++++ +IP Y M    +P  +++ I  +   F WG+R  + K H V W
Sbjct  759   KLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILNEINAMCSRFWWGARGTERKMHWVSW  818

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K+ GG+G + LK  N A LAK  WRL  D N L   + KA+Y F  ++++S + 
Sbjct  819   EKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCDTNSLAHLVMKARY-FPRTLFTSARR  877

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S  W+ I  A  +   G+KW V +G +   W DSWL         S  + P+    
Sbjct  878   GFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWEDSWL------PGDSCSVVPTPNIE  931

Query  195   LVANYWIS---NEGWDWDMLDRVLPEHILNKLSTFVLQ---EDTLLGDRLVWYKEPNGLF  34
               A+  +S   + G  W+ L   L  H  +  +  +        +  D   W+   NG +
Sbjct  932   SPADLQVSDLIDRGGTWNEL--ALSTHFTSNDAALIRTIHISRRMPEDIQYWWPASNGEY  989

Query  33    SVSSAY  16
             S  S Y
Sbjct  990   STKSGY  995



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score =   236 bits (601),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/594 (29%), Positives = 278/594 (47%), Gaps = 15/594 (3%)
 Frame = -1

Query  3032  RTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRV----EAVGYSGGIWLFCS  2865
             R LK FL +HKP LI L E K++ AQ  ++ + L  D  + V    +  G  GG+ LF +
Sbjct  297   RDLKDFLFVHKPDLIFLIETKMTEAQMGKLKARLRMDGVLCVGRNEDNGGARGGMCLFWN  356

Query  2864  VSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNP-QGTW  2688
               + ++ + +   FI   V          +  YG  + + +RHL  DL           W
Sbjct  357   NKVVVDYISSSFYFINAMVTWEDKKKCRFTGFYGHPETS-QRHLSWDLLRSLRRVCSEPW  415

Query  2687  LAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFK  2508
             L  GDFN +   +E +     S  +   F   +    L +  FTG  YTW       +  
Sbjct  416   LCCGDFNEILDFNEKTGAVQRSQRQIDGFRHAVEDCGLYEFAFTGFQYTWDNRRKGDANV  475

Query  2507  GARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS----ITTCPQQFCSSRFKFNMA  2340
               RLDR   N+    ++      HL  + SDH PLL      ++         RF F   
Sbjct  476   KERLDRGFGNLALIQQWGGISCHHLVSMSSDHCPLLFENDPPMSRGGNWRRKRRFLFEDM  535

Query  2339  WTTHYSFQACVQSVWRSDLDLSTNKSAMVEA-LSVWSRDSFGNIPQKKRRLLARLEGVQ*  2163
             W TH   +  V+  W   ++    K   V   L  W++++FG++ +K   L   L+ +Q 
Sbjct  536   WLTHEGCRGVVERQWLFGVNSVVGKLEQVAGGLKRWNQETFGSVKKKVASLREELDVLQ-  594

Query  2162  SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRN  1983
                    S+++     +   L+  L +EEL+W QR+R  W K GDRNT+F+      +  
Sbjct  595   --RQPPTSNIICKRNEVECLLDGVLEREELLWKQRARVSWFKCGDRNTQFFHQTAKQRGR  652

Query  1982  QSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASV  1803
              +R+  ++  D     D   +      YF  LFT                 +      S+
Sbjct  653   SNRICGILGEDNRWRSDVTDIGCVFVSYFRNLFTAGGGSMDETIFEAVTSRVDATSKKSL  712

Query  1802  NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGC  1623
             +  +  E+I+ AL DM P K+ G DG    FF K W  +G  +     RF          
Sbjct  713   DQVYRREEIELALKDMNPSKSPGSDGMPARFFQKFWNIIGNDVVDVCLRFLNGDGSIADF  772

Query  1622  NDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGR  1443
             N ++++LIPKVQNP+++T++RPI LCNVVYKL++KV+  RLK ++ +++  +QS+F+  R
Sbjct  773   NHSLIALIPKVQNPKKVTEYRPISLCNVVYKLVSKVLANRLKSVLPEVIAENQSAFMSQR  832

Query  1442  QITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              I DN +A  EI++  + + K     +ALK+D+ KAYDR+ W F++  +  +GF
Sbjct  833   IIHDNIIAAFEIIHCLKRRGKDSRQKIALKLDMTKAYDRVEWGFLQRMMEVMGF  886


 Score =   215 bits (547),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 218/425 (51%), Gaps = 13/425 (3%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CV S     L  G     I P +GLRQGDPISP LF++ AE LS ++  + R     
Sbjct  894   IMDCVKSVTYSVLLQGAPFGKIKPSRGLRQGDPISPYLFLIVAEGLSALIRKAEREQQIH  953

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             GV + R AP++SHLF+ADD + F +A     + +K     + + SGQKIN  KS++ FS 
Sbjct  954   GVAIARGAPSVSHLFYADDSLLFCDATVTDCMALKNIFSTYEAASGQKINKDKSAICFSP  1013

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
              +    ++  +A L +P V    ++LGLP++ G+ KK  F ++ +R+  R+ G   + LS
Sbjct  1014  KSPAAIKEACSAILDMPVVPCHERYLGLPTVSGKDKKKLFQSLPDRVWNRVHGWEGKLLS  1073

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG  V++++V  AIP Y+M    +P+G  D+I + +  F WG +EG    H  +W  + 
Sbjct  1074  KAGKEVLIKTVAQAIPNYTMSVFQLPAGTSDAINKCVARFWWG-KEGGKGIHWRRWSDLC  1132

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY----DFDPSVWSSWQP  376
              SK +GGLG + L   N A L K  WRL    + L   + KAKY    DF  +   S   
Sbjct  1133  FSKKDGGLGFRDLSLFNQALLGKQGWRLMMYPDSLVARMLKAKYFPWDDFMEAELGS---  1189

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S  W+  L    + R G++W + +G+  R ++D W+   P F       AP  L  
Sbjct  1190  --SPSYLWRSFLWGRELLRKGVRWRIGDGKEVRVFIDPWVPGLPSFRPILRQGAPLFLR-  1246

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
              V++   +N GW+ + L+    +     +S+  +   T   D  +W    NG ++V S Y
Sbjct  1247  -VSDLLHNNGGWNMEALNYWFTDDECEAISSITVGA-TRRPDVYMWNYCKNGRYTVKSGY  1304

Query  15    ELALE  1
              LA E
Sbjct  1305  WLACE  1309



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   229 bits (584),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 220/424 (52%), Gaps = 14/424 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ ++ C+++     + NG    ++ P +GL QGDP+SP LF+LCAE L+ ++    R 
Sbjct  505   WIQLMLTCISTVSYSFVINGTPHGFLHPSRGLHQGDPLSPYLFLLCAEGLTELIAQKERE  564

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  KGV + R AP +SHLFFADD V F  AN      M  C+      SGQ++N QKS++
Sbjct  565   GFLKGVSICRGAPAISHLFFADDSVLFARAN------MADCM----RASGQQVNFQKSAV  614

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSKN + G Q  +A  +GIP V    ++LGLP +  + K  SF+++ ER+  +L     
Sbjct  615   CFSKNVHRGDQLMLAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKERLWKKLQTWKG  674

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  ++++ V  AIP Y+M   L+P  V + + +L+  F W S     K H + W
Sbjct  675   KLLSGAGKEILIKVVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWWNSSTENKKIHWMAW  734

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG ++L   NLA LAK  WRL Q+ + L T + KAKY F    +     
Sbjct  735   DRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLITKVLKAKY-FPTRSFLETAV  793

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               ++S  WK + +A  +   G +W V +G     W D WL     F         S++  
Sbjct  794   SLHASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIFFPKPEHSAITK  853

Query  195   LVANYWISNEGWDWDMLDRV-LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             +       +  W+  +L  V  PE ++  L   +     L  D LVW+ +  G+F+V SA
Sbjct  854   VSDLIHGDSREWNVPLLQNVFFPEEVM--LIRSIPLSLRLTPDMLVWHYDKKGMFTVKSA  911

Query  18    YELA  7
             Y +A
Sbjct  912   YHVA  915


 Score =   220 bits (561),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/576 (29%), Positives = 264/576 (46%), Gaps = 82/576 (14%)
 Frame = -1

Query  2993  LICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAF  2814
             ++ L E +  +   N I   LGFD    V+A+G SGG+ LF    +N+ I  +    I  
Sbjct  2     VVFLCETRCKQRNFNSIKEQLGFDYCFVVDAIGLSGGLCLFWKSELNLAIRSSSTHHIDA  61

Query  2813  QVYD-NVSAPWLMSVVYG---CLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSE  2646
             +V     S  W ++  YG     D  L  +L  DL+      +  W+ MGDFN +   +E
Sbjct  62    EVGGIGDSLHWRLTGFYGYPATEDTHLSWNLLRDLA---SESRLPWVCMGDFNELLYANE  118

Query  2645  VSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*S  2466
                     + +   F D I    L D+GF G+++TW    +       RLDR L+N E  
Sbjct  119   KEGGLIRPVRQMLAFRDAISDCHLDDMGFEGATFTWFSTRNGGI--KERLDRVLANCEWR  176

Query  2465  LRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS-SRFKFNMAWTTHYSFQACVQSVWRS  2289
               FP A V HL    SDH P+L+  +   + +   S F+F   WT H   ++ + + W +
Sbjct  177   SLFPQATVHHLEPCSSDHLPILLEASPTMKPWRRRSFFRFESMWTQHEDCESIIANAWNT  236

Query  2288  DLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlr  2109
                       ++  +S +              L+++L+ +                    
Sbjct  237   SF-----TGTLMYQVSTY------------HLLMSQLDSL--------------------  259

Query  2108  keleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDD  1929
                   L +EE  W QRS+  W+K GDRNTRF+    + ++ ++ V  L D  G    D+
Sbjct  260   ------LSREEAFWKQRSKVSWLKEGDRNTRFFHQRASNRKQRNYVKGLRDNTGRWREDE  313

Query  1928  GLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVP  1749
               L   V DYF  LFT+    +           +  +    +   +   +I  A+F M P
Sbjct  314   QGLQYVVLDYFTHLFTSSASGSEGESIDAVESRVTPDMNNLLLTDYCDAEIHEAVFQMYP  373

Query  1748  CKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERIT  1569
              KA GPDG  P FF K W  VG+                             V++P+ ++
Sbjct  374   TKAPGPDGMPPIFFQKYWHIVGSD----------------------------VKHPKDMS  405

Query  1568  QFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-R  1392
             Q RPI LCNV++K+ TKV+  RLK ++ K++ P QS+F+ GR I+DNT+   EI++   R
Sbjct  406   QLRPISLCNVLFKIATKVLANRLKLILHKIISPSQSAFISGRLISDNTILAAEIIHYLRR  465

Query  1391  TKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              ++G+ G+M LK+D+ KAYDR+ W F+E  +R +GF
Sbjct  466   RRRGKKGFMVLKMDMSKAYDRIEWSFLEAIMRKLGF  501



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   230 bits (587),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 158/556 (28%), Positives = 273/556 (49%), Gaps = 44/556 (8%)
 Frame = -1

Query  2933  LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCL  2757
             +G+ +   V  +G +GG+ L+   S+ + I +T    I   + + +      ++ VYG  
Sbjct  1     MGYQKGFNVSPIGRAGGLSLWWDDSVEVTIDFTSKHIIDANITFVDSDRRARVTWVYGTA  60

Query  2756  DMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEE  2577
               + +   +  +   F      WL  GDFN +    E S   + + +R     +++   E
Sbjct  61    YRSEKLDFWRGMKERFRPTNILWLCGGDFNEILWDFEKSGGASLNYNRPRYLEEFLNGTE  120

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             L+DL F G  +TW RG+        RLDR L+N +    +P+  V H   IGSDH P++I
Sbjct  121   LMDLDFNGPCFTW-RGMRNGQLVEERLDRGLANRQWQDCWPNTMVIHETAIGSDHIPIII  179

Query  2396  SITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRS-DLDLSTNKSAMVEALSVWSRDS  2223
                  P+   + + F+F   W      +  V+   R  +LD   N+  +++  + W ++ 
Sbjct  180   Q--GHPRAVKTKKLFRFEAYWAKEERCKDTVEFKARGRELDGLINRLGVLQ--NNWRKNW  235

Query  2222  FGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEW  2043
                  ++ +R+ AR++ +                             EE  W QRSR +W
Sbjct  236   -----EEIKRVSARIDRLG--------------------------EIEEQFWQQRSRVKW  264

Query  2042  IKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE--VD  1869
             +K GD NT F+  +T  +R ++++ K+ D +G  I +   + K++ D+F  LF+T    +
Sbjct  265   LKEGDANTAFFHQSTLQRRRRNKLVKIKDGNGDWIDNPSEVQKYIEDHFKNLFSTSGSRE  324

Query  1868  VNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPT  1689
               RT  C    P + +E  + +  P + E+I+TA   M   KA GPDGF   F+H  W +
Sbjct  325   WGRTLDCLQ--PKVSDEMNSGLIKPVSLEEIQTAALQMGGLKAPGPDGFQGIFYHSFWNS  382

Query  1688  VGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMM  1509
             +   +   V  +      P   N T + L+PK+ NP+ + QFRPI LCN  YK+++K++ 
Sbjct  383   LMDDVNGIVQDYMLGVSDPQRLNSTHIVLVPKISNPDSVGQFRPISLCNYSYKIVSKILA  442

Query  1508  IRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYD  1332
              RLK ++ +++ P QS+FV GRQI DN     E+ +  + +K +  + M +K+D+ KAYD
Sbjct  443   NRLKPLLSEIISPTQSAFVMGRQIQDNIGIAHEMFHFLKLRKAKSKFEMGVKLDMHKAYD  502

Query  1331  RLSWCFIEDTLRDIGF  1284
             R+ W F+E  +  +GF
Sbjct  503   RVEWDFLEAVMEKLGF  518


 Score =   219 bits (557),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 147/426 (35%), Positives = 204/426 (48%), Gaps = 11/426 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M  V +     + NGQ      P +G+RQGDP+SP LF+L  E L  ++  +V  
Sbjct  522   WRNLVMGYVKTVEFAIILNGQPGKQFIPTRGIRQGDPLSPYLFILVGEVLDKLIQQAVER  581

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G++     P +SHLFFADD + F  A+      +KK L  +CS SGQ +N QKS L
Sbjct  582   RMLMGIQPNYGCPIISHLFFADDTLIFMRADKKNCNSLKKILADYCSASGQLVNYQKSCL  641

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF  N        +   +GIP   + GK+LGLPS  GR KK     + ERI A++ G   
Sbjct  642   FFGANVPRCLSIELGHFVGIPLAEEPGKYLGLPSFWGRSKKQGLAFVKERILAKVQGWKQ  701

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              TLS AG  +M+++V+ AIP Y M     P+ +    + LI  F WG   G+   H V  
Sbjct  702   YTLSQAGKEIMIKAVIQAIPAYPMHLFKFPTTLCSDFDALIAEFWWGKSGGQKGIHWVSR  761

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
             GI+   K   G+G ++ +  N A LAK  WRL  D N LW  L KA+Y    S       
Sbjct  762   GILGYPKQEEGMGFRNFQAFNDALLAKQCWRLIHDPNSLWAQLLKARYFPHCSFLDDSLG  821

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL--  202
              R +S  W  +L    I   G  W + NGR+ R W D W+   P    A  P A   +  
Sbjct  822   GR-ASWGWSSLLVGREILLRGAHWQIMNGRSIRLWHDRWVPSIP----AGKPTAVGGVRV  876

Query  201   -NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQE--DTLLGDRLVWYKEPNGLFS  31
               N+  N  I++    W+ ++ + P   L      +     D L  DRL+W    NG++S
Sbjct  877   SRNMRVNTLINDVSGTWN-IEAIRPFISLEDFEAILDTSIGDGLRDDRLIWPATRNGVYS  935

Query  30    VSSAYE  13
             V S Y 
Sbjct  936   VKSGYH  941



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   242 bits (617),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/576 (30%), Positives = 275/576 (48%), Gaps = 27/576 (5%)
 Frame = -1

Query  2969  ISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSA  2790
             I   +   +    GF E + + +VG SGGI  + +  +NI ++      +A +V D+   
Sbjct  2     IDAKRLQSVKEKCGFSEGLCLSSVGLSGGIGFWWN-DLNITLISYSTHHVAVEVRDDDDV  60

Query  2789  P-WLMSVVYGC-------LDMALRRHLFADLS*--YFFNPQGTWLAMGDFNSVTCQSEVS  2640
             P W    +YG        L  AL + +   LS    FF         GDFN +   SE  
Sbjct  61    PLWAAVGIYGWPEASNKHLTWALMKEIRGVLSLPIVFF---------GDFNEILHASEKE  111

Query  2639  NKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLR  2460
                        +F + + + EL DLG++G ++TW RGL+  +    RLDR L+       
Sbjct  112   GGAVRGERHIDEFRETVELCELGDLGYSGGAFTWQRGLEERTIIRERLDRFLACDRWGTL  171

Query  2459  FPDAKVTHLPMIGSDHSPLLISITTCPQQF-CSSRFKFNMAWTTHYSFQACVQSVWRSDL  2283
             FP A V + P+  SDH+P+L+S  +  Q+     RF F   W ++   Q  V+  W +  
Sbjct  172   FPHAWVKNFPIYKSDHAPILLSTDSGQQERRKGKRFHFEALWLSNSDCQTVVKQAWATSG  231

Query  2282  DLSTNK--SAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlr  2109
                 ++  +     L  W+  +FG++ ++ ++    L+  Q     G R      E    
Sbjct  232   GSQIDERIAGCASELQRWAAVTFGDVKKRIKKKEEELQVWQNKAPDG-RMLGKCKELVRE  290

Query  2108  keleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDD  1929
              +    L+  E  W  R+R   +K GD+NT ++    + ++ ++ + KL D+ G    D+
Sbjct  291   LDELNRLH--ESYWHARARANEMKDGDKNTSYFHHKASQRKKRNAIHKLRDSAGVWKTDE  348

Query  1928  GLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVP  1749
               +   + DYF  +F +    N  +   G  P +       + A  T ++++ ALF M P
Sbjct  349   KDVSAIISDYFTNIFASSSPANFDDALAGLSPKVPHTANEVLMAEPTVDEVRDALFQMHP  408

Query  1748  CKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERIT  1569
              KA G DG    F+ K W  VG  +  F+  ++   +     N T + LIPK  NP+++ 
Sbjct  409   NKAPGVDGMHALFYQKFWHIVGDDIVLFIRDWWNGRVQIGSLNRTCIVLIPKCSNPQQMG  468

Query  1568  QFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-R  1392
              FRPI LC V+YK+++K+M  RLK  +  L+  HQS+FV GR ITDN +   EI ++  R
Sbjct  469   DFRPISLCTVLYKILSKMMANRLKVFLSDLISLHQSAFVPGRLITDNAMTAFEIFHSMKR  528

Query  1391  TKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
                G+ G MA K+D+ KAYDR+ W F+E  +  +GF
Sbjct  529   GGDGKKGVMAFKLDMSKAYDRVEWSFLERVMGRLGF  564


 Score =   207 bits (526),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 144/427 (34%), Positives = 214/427 (50%), Gaps = 17/427 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM C++S       NG +   I P +GLRQGDP+SP LF+LCAE  S ++  +   
Sbjct  568   WVRRIMECLSSVSYSFKLNGSVEGNIIPSRGLRQGDPLSPYLFLLCAEAFSALLSKAAGD  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G +V R AP +SHLFFADD + F  A   +   +   L  +   SGQKIN  KS +
Sbjct  628   GLIHGARVCRSAPRISHLFFADDSILFTRAALQECSVVADILSTYERASGQKINFDKSEV  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSKN +   + +I +  G+  V    K+LGLP++ GR KK  F  + ER+  +L G   
Sbjct  688   SFSKNVDDSRKNDIRSLFGVREVERHEKYLGLPTVIGRSKKMVFTVLKERVWKKLQGWKE  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ +IP Y M    IP  ++  I  +   F WGSR  + + H + W
Sbjct  748   KLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSEINAMCARFWWGSRGTERRMHWLSW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GG+G + LK  N A LAK  WRL      +   +F A+Y +  S + + + 
Sbjct  808   EKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHNGSMAHAVFNARY-YPRSNFLNARR  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S  W+ I  A  +   G+KW V +G +   W +SWL         SA + P+    
Sbjct  867   GFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWL------PGESAAVVPTPNME  920

Query  195   LVANYWIS---NEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG----DRLVWYKEPNGL  37
               A+  +S   +    WD L  VL  H   +    +++E  L      D   W+   +G 
Sbjct  921   SPADLRVSDLLDASGRWDEL--VLRNHFTEE-DILLIREIPLSSRKPPDLQYWWPSTDGF  977

Query  36    FSVSSAY  16
             F+  SAY
Sbjct  978   FTTKSAY  984



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score =   229 bits (583),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 147/429 (34%), Positives = 227/429 (53%), Gaps = 11/429 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV++     L NG     + P +G+RQGDP+SP +F+LC+E LS + + +   
Sbjct  807   WIKMIMQCVSTVTYSFLINGSPRGRVQPSRGIRQGDPLSPYIFILCSEVLSGLCNRASEE  866

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ KG++V R  P ++HL FADD +FF  AN      + K L  +   SGQ IN  KSS+
Sbjct  867   GSLKGIRVARACPRVNHLLFADDTMFFIRANKESTQCLSKILKQYEEASGQSINTNKSSI  926

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+   L  +  I   L I     +GK+LGLP   GR KKD F +I++RI  +    S+
Sbjct  927   SFSRKAPLELRAKIKEELNIQREGGVGKYLGLPEHFGRRKKDLFTSIVDRIIQKGRSWSN  986

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M++SVLS IP ++M    +P  +   I+  +  F W  +EG  K   V W
Sbjct  987   RFLSKAGKLTMIKSVLSPIPSHAMTCFKLPLSLCKRIQAAVTRFWWDDKEGTKKMAWVSW  1046

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T SK  GGLG++  +  N AFL KL+WR+  +   L + +   KY    S     + 
Sbjct  1047  DKMTQSKEVGGLGVRDFQAFNDAFLGKLSWRILNNPEILLSRVLLGKYSSTESFLEVTE-  1105

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
             K   S+ W+G+L    + ++ + W V NG +   W + WL L + L    + P    + N
Sbjct  1106  KSAISHGWRGVLIGRDLLKDNMGWSVGNGISISIWNEPWLSLSQQL--SPTGPATEETSN  1163

Query  198   NLVANYWISNE-GWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSV  28
               V++ +  +E  W+   + RVLP+   N ++     + +L G  D+ +W    NG+++ 
Sbjct  1164  FTVSDLFNEHERTWNVTTIKRVLPQWEQNIINI----KPSLSGAPDKRIWLGTNNGIYTT  1219

Query  27    SSAYELALE  1
              S Y +AL+
Sbjct  1220  KSGYHIALK  1228


 Score =   219 bits (558),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/605 (27%), Positives = 280/605 (46%), Gaps = 42/605 (7%)
 Frame = -1

Query  3056  GAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGY-SGGI  2880
             G  +P   R LK   +   P ++ L E K       +   +LG++    +   G+ +GG+
Sbjct  233   GLGNPQTVRRLKEMNKSISPDILFLMESKNPDQFVIDKTKALGYEHHHLIPPTGHGAGGL  292

Query  2879  WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNP  2700
              +     + + +L ++  FI   + +     +  + V+G  D   RR  +  +       
Sbjct  293   AILWKQEVKLHVLSSNANFIDTCI-EFEGKTFFAAFVHGDTDFIKRRLFWNQMVSLMNGR  351

Query  2699  QGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDT  2520
                W   GDFN +    E            +D   +    +L DL  +G   +W RG   
Sbjct  352   DAPWFITGDFNDILSNDEKDGGPVRVEGSFSDLRSFYSEGDLYDLPHSGDLLSW-RGQRG  410

Query  2519  PSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMA  2340
                   RLDRA +    +  FP A+  +L    SDH PL+  + T  ++     F+++  
Sbjct  411   NHLVRCRLDRAAATSSWAELFPSARSQYLAFEASDHRPLVTVLETGIKKR-RGMFRYDRR  469

Query  2339  WTTHYSFQACVQSVWRSDLD------LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
                +   +  VQ+VW +  +      +S  +SA+VE     +R+S   I  KK+ L   L
Sbjct  470   LKDNIEVKELVQTVWTNAGECSIREKISLTRSAIVEWSKQQNRNSRLTIELKKQELEEAL  529

Query  2177  EGVQ*SLSM--GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQV  2004
                   L++   I SDL               + EE  W QRSR  W++ GDRNT F+  
Sbjct  530   SSPVNDLTLIHQINSDLND-----------AYHAEEEHWRQRSRLLWLRLGDRNTGFFHA  578

Query  2003  ATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLL  1824
              +  ++  +  S + D +G+++  +  + + +  Y+  LFT+ V+ N+T         L+
Sbjct  579   VSRNRKRANAFSVIEDVNGNVVYKEDDIARAIVQYYEALFTS-VEGNKTETVNAALRRLV  637

Query  1823  -EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFE  1647
              +ED   +    + ++I+ A+F +   KA                 VG  +   V +FF+
Sbjct  638   SDEDNIELIRRPSGQEIRNAVFSIHADKAP----------------VGPDMIKEVQKFFD  681

Query  1646  DGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPH  1467
              G+ PP  N+T + LIPK+ NP+ +  +RPI LCNV YK ++K++  R++ ++  ++   
Sbjct  682   SGVFPPRTNETNVRLIPKILNPQVVADYRPIALCNVFYKTVSKLLSRRMQPLLANIISET  741

Query  1466  QSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
             QS+FV GR I+DN L   E+L+  +T +  +   MA+K D+ KAYDRL W FIE  L+ +
Sbjct  742   QSAFVPGRAISDNVLITHEVLHFLKTSRAEKRCSMAVKTDMSKAYDRLEWEFIELVLQRL  801

Query  1289  GFNHT  1275
             GF+ T
Sbjct  802   GFHET  806



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score =   280 bits (717),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/607 (31%), Positives = 303/607 (50%), Gaps = 36/607 (6%)
 Frame = -1

Query  3053  AASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWL  2874
             + S   +R +K    +H+  ++ + EP +  ++A      +GF++ I    V  S  IWL
Sbjct  860   SKSRVIQRRIKKLQLMHRLKILAILEPMVDTSKAEYFRRKMGFEKVI----VNNSQKIWL  915

Query  2873  FCSVSINIEILYTHPQFIAFQVYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*YF  2709
             F SV    E+L  HPQ +  +V    + PWL      + VY     + R  L+  L    
Sbjct  916   FHSVEFICEVLLDHPQCLHVRV----TIPWLDLPIFTTFVYAKCTRSERTPLWNCLRNLA  971

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              + +G W+  GDFN +  + E             DF   +    L+D GF G+ +TW   
Sbjct  972   ADMEGPWIVGGDFNIILKREERLYGADPHEGSIEDFASVLLDCGLLDGGFEGNPFTW---  1028

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKF  2349
               T +    RLDR + N +   +FP  ++ HL   GSDH PLL+S +   ++  SS F+F
Sbjct  1029  --TNNRMFQRLDRMVYNQQWINKFPITRIQHLNRDGSDHCPLLLSCSNSSEKAPSS-FRF  1085

Query  2348  NMAWTTHYSFQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRLL  2187
               AW  H++F A V+  W   ++ S      + +  + + L  W++  FG+I    +   
Sbjct  1086  LHAWALHHNFNASVEGNWNLPINGSGLMAFWSKQKRLKQHLKWWNKTVFGDIFSNIKEAE  1145

Query  2186  ARLEGV----Q*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNT  2019
              R+E      Q   ++G R        +   +L + L  EE+ W Q+S  +W+  G+RNT
Sbjct  1146  KRVEECEILHQQEQTIGSR----IQLNKSYAQLNKQLSMEEIFWKQKSGVKWVVEGERNT  1201

Query  2018  RFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
             +F+ +    KR +S + K+ + DG+ I D   L +   D+F  L   E   + T F    
Sbjct  1202  KFFHMRMQKKRIRSHIFKIQEQDGNWIEDPEQLQQSAIDFFSSLLKAE-SCDDTRFQSSL  1260

Query  1838  FPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
              P ++ + D   + A  T +++K A+F + P  A+GPDGF+  F+ + W  +   LF  V
Sbjct  1261  CPSIISDTDNGFLCAEPTLQEVKEAVFGIDPESAAGPDGFSSHFYQQCWDIIAHDLFEAV  1320

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               FF    +P G   T L LIPK  +  + ++FRPI LC V+ K+ITK++  RL  ++  
Sbjct  1321  KEFFHGADIPQGMTSTTLVLIPKTTSASKWSEFRPISLCTVMNKIITKILANRLAKILPS  1380

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDT  1302
             ++  +QS FV GR I+DN L  QE++     +K R G +ALK+D+ KAYDRL W F+   
Sbjct  1381  IITENQSGFVGGRLISDNILLAQELIGKL-DQKNRGGNVALKLDMMKAYDRLDWSFLFKV  1439

Query  1301  LRDIGFN  1281
             L+ +GFN
Sbjct  1440  LQHLGFN  1446


 Score =   167 bits (423),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 212/423 (50%), Gaps = 12/423 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C+++     L NG+   +    +GLRQGD ISP LF+L AE L+  +++    
Sbjct  1449  WIGMIQKCISNCWFSLLLNGRTVGYFKSERGLRQGDSISPQLFILAAEYLARGLNALY--  1506

Query  1095  GNWKGVKVTR-IAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
               +  +  +   + ++SHL FADD++ F   +     ++   L  +   SGQ+IN QKS 
Sbjct  1507  DQYPSLHYSSGCSLSVSHLAFADDVIIFANGSKSALQKIMAFLQEYEKLSGQRINPQKSC  1566

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
             +    N     +Q I    G         +LG P   G  K   F++++ +I+ R++G  
Sbjct  1567  VVTHTNMASSRRQIILQATGFSHRPLPITYLGAPLYKGHKKVMLFNDLVAKIEERITGWE  1626

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             ++TLS  G   +++S LS++P Y ++    P  V++ I RL+  FLWG      + H   
Sbjct  1627  NKTLSPGGRITLLRSTLSSLPIYLLQVLKPPVIVLERINRLLNNFLWGGSTASKRIHWAS  1686

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             WG +    A GGL I++++ +  AF  KL WR  +  N LWT   +AKY     + +  Q
Sbjct  1687  WGKIALPIAEGGLDIRNVEDVCEAFSMKLWWRF-RTTNSLWTQFMRAKY-CGGQLPTDVQ  1744

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             PK + S  WK ++    I    I+W + +G    FW D W+ + PL     A    SS+ 
Sbjct  1745  PKLHDSQTWKRMVTISSITEQNIRWRIGHGELF-FWHDCWMGEEPLVNRNQA--FASSMA  1801

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V++++++N  W+ + L  VL + ++ ++    +  DT   D+  W   PNG FS  SA
Sbjct  1802  Q-VSDFFLNN-SWNVEKLKTVLQQEVVEEIVKIPI--DTSSNDKAYWTTTPNGDFSTKSA  1857

Query  18    YEL  10
             ++L
Sbjct  1858  WQL  1860


 Score = 62.0 bits (149),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 65/163 (40%), Gaps = 12/163 (7%)
 Frame = -3

Query  4311  LEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKL  4132
             L   +E+  L +   +       D++ +     W +    +   +W P F+P   +   +
Sbjct  16    LTGAYEVRWLDYKHVLIHLSNEQDFNRIWTKQNWFIATQKMRVFKWTPEFEPE-KESAVV  74

Query  4131  LAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSN  3952
               W+ FP+L    F+   L  I K +G+P+ +D  T   S+   ARVCV+ D  K  +  
Sbjct  75    PVWISFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCVEYDCRKSPVDQ  134

Query  3951  F-----------VINGTEWPKEYEGIHQICFKCSIYGHRMETC  3856
                         V+NG     E+  +   C  C   GH+   C
Sbjct  135   VWIVVQNRKTGEVMNGYSQRVEFAQMPAYCDHCCHVGHKETDC  177



>ref|XP_010480950.1| PREDICTED: uncharacterized protein LOC104759762 [Camelina sativa]
Length=1598

 Score =   230 bits (586),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 249/512 (49%), Gaps = 14/512 (3%)
 Frame = -1

Query  2795  SAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMS  2616
             S  W +S VYG     LR  ++  ++ +  +    W  +GDFNS+    +        +S
Sbjct  314   SKVWFISCVYGNPVTGLRSAVWDKITDFGLSRSEAWCMIGDFNSILSNKDKLGGPLRDLS  373

Query  2615  RCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTH  2436
                 F + +   ++ +LG +G+ +TW  G+    +   +LDR   N      FP ++   
Sbjct  374   SFFPFQELLANCDMAELGSSGNGFTW-GGVRDKQWIQCKLDRCFGNPAWFSLFPSSRQCF  432

Query  2435  LPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAM  2256
             L  +GSDH P+L++ + C ++   S+F F+  W    SF   ++  W     +  N S M
Sbjct  433   LEKLGSDHKPVLVNFS-CHKELHKSQFWFDKRWAEDPSFMEVIKKAWNEKKTMDNNSSVM  491

Query  2255  V------EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleE  2094
             V      +A+  W +  + +   + +RL   L     SL              +++EL  
Sbjct  492   VRFENCRKAIGSWKKRVWTSSEIRIKRLRKELATQDASLH-----PCFTRINAIKRELAI  546

Query  2093  TLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLK  1914
                +EE+ W Q+S E+W+  GDRNT+F+Q +    R ++ +  LVD  G     +    +
Sbjct  547   AFREEEVYWRQKSTEKWLLHGDRNTKFFQASVKAARIKNSLPFLVDDKGTEHFSELEKGE  606

Query  1913  HVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASG  1734
                 YF  LF +      +       P +       ++   T  +IK A F +    A G
Sbjct  607   VAIKYFTDLFKSSGPSPISELLINFQPRVSNHMNQDLSRNITIAEIKQAAFSISNESAPG  666

Query  1733  PDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPI  1554
              DG T  FF   W  +   + + V RFF+ GI+P G N T L L+PK+Q P+R+T  RPI
Sbjct  667   HDGLTGFFFKTYWHLIKDQVNTEVLRFFDTGIIPEGWNHTHLCLLPKIQTPKRMTDLRPI  726

Query  1553  GLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-R  1377
              LC+V+YK+++K+++ RLK  +  +V P Q++FV  R I+DN L   EI ++  +     
Sbjct  727   SLCSVIYKIVSKILVHRLKKHLPTIVSPTQAAFVSERLISDNILIAHEIAHSLHSNPTVS  786

Query  1376  VGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
               +M +K D+ KAYDR+ W F++D L+ +GF+
Sbjct  787   QEFMMVKKDMSKAYDRVEWIFLKDMLQALGFH  818


 Score =   218 bits (555),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 145/430 (34%), Positives = 225/430 (52%), Gaps = 13/430 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI   M CV+S     + NG+    I P +G+RQGDP+SP LFVLC E L H+ D +  +
Sbjct  821   WIFWTMGCVSSVSYSVIMNGEPFGLIKPERGIRQGDPLSPFLFVLCTEALIHLFDQATMA  880

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+  G++     P ++HL FADD +FF +AN  +  EM +CL  +   SGQ IN +KS++
Sbjct  881   GHITGIQFHHSGPQINHLLFADDSLFFCKANRTECAEMMRCLQKYEWMSGQVINKEKSAI  940

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F   +N    + I    GI      GK+LGLP      K+     I +R+ +RL+G  +
Sbjct  941   TFGSKSNNLDWEWIKEKSGICLEGGAGKYLGLPECLSGSKQQLLGFIKDRLHSRLTGWYA  1000

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V+++S+  A+P Y+M    +P G+I  +  ++  + W + + K K H + +
Sbjct  1001  KNLSQGGKEVLLKSIALALPVYAMSCYKLPKGIIKKMISVMMDYWWSNTQDKKKIHWLSY  1060

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+ GG G K L+  N A LAK AWRL  D +CL++  FK++Y +    + +   
Sbjct  1061  EKMTLPKSAGGFGFKDLEIFNQALLAKQAWRLLHDTDCLFSRFFKSRY-YATDDFLNAAK  1119

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              RN S  W+ I+    +   G+K  + NG+ T  W+D+WL D      A  PI   SL N
Sbjct  1120  GRNPSYGWRSIIFGRQLLSKGLKRVIGNGKNTLVWIDNWLFD----NRAIRPIGLHSLMN  1175

Query  195   L----VANYWISNEGWDWDMLDRVLPEHILNKLSTF-VLQEDTLLGDRLVWYKEPNGLFS  31
             +    V  +      W+ D L R L  H  ++++T   ++      D   W +  NG++S
Sbjct  1176  INLRVVDLFNHRTRIWN-DFLLRSLFHH--SEINTIKAIKPRIGFDDSFCWGETRNGIYS  1232

Query  30    VSSAYELALE  1
             VSS Y L  +
Sbjct  1233  VSSGYALMFK  1242


 Score = 65.1 bits (157),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/208 (27%), Positives = 94/208 (45%), Gaps = 16/208 (8%)
 Frame = -3

Query  4389  RSLILRVLGRSVS-YSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGP  4213
             RSLI R L       S  +  +  +W+L      +AL+ D F   F+   D + +   G 
Sbjct  27    RSLIGRFLNPDYQRMSNWILEMPRIWRLYNRVRGVALSRDRFQFIFKYDEDINEILKTGV  86

Query  4212  WMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKID  4033
             W   D  +V + W    DP  N +  L  W+R  +LP+ ++  D + +I   +G+ +++ 
Sbjct  87    WTQDDWGVVMERWVA--DPPANYLMFLPVWIRLRNLPVNHYTKDTIGEIAGCVGQVLELP  144

Query  4032  LTTGMASKGKFARVCVQLDITKPLLSNF----VINGT--EWPKEYEGIHQICFKCSIYGH  3871
                  A    + RV + LD++K  L NF    + NG+  +   +YE + + CF+C    H
Sbjct  145   FDEKEAQSKDYVRVRILLDVSKG-LKNFKELQLPNGSLVKIGIDYERVRKRCFQCQRLTH  203

Query  3870  RMETCGLSVPIPAASVDGTAGTSSTTGI  3787
                 C      P A +D TA   S+T +
Sbjct  204   DKSRC------PFAQLDITARDCSSTNL  225



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   238 bits (607),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/566 (30%), Positives = 270/566 (48%), Gaps = 25/566 (4%)
 Frame = -1

Query  2933  LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWL-MSVVYGCL  2757
             +GF     V  VG +GG+ L+   ++++EIL++    I  ++ +  +  W+ ++ VYG  
Sbjct  1     MGFLNGFNVTPVGRAGGLSLWWDXTLDVEILFSSKHIIDARMMEIGAHRWVRVTGVYGTP  60

Query  2756  DMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEE  2577
                 +   +  +S YF      WL   DFN     SE +       +R      ++   E
Sbjct  61    YRCDKVEFWNWMSNYFSPSDMPWLCAXDFNEFLWDSEKAGGSQVXYNRPRYLESFLSTSE  120

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             L+DL F G ++TW RG+   S    RLD+ L N      +P+  VTH   +GSDH P++I
Sbjct  121   LLDLDFNGPAFTW-RGMRNGSLVEERLDKGLCNRIWQDVWPNTTVTHGTXLGSDHCPIII  179

Query  2396  SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSV-------  2238
               T    +     F+F   W      +  V+  W    D      A V  L         
Sbjct  180   Q-TEPDARRGRKLFRFEAXWAKEVDCKEVVRKSW----DCREEGGAQVRWLKKINDCRSQ  234

Query  2237  ---WSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY-QEELI  2070
                WSR+ F     +   LL +L  +Q +          R E   +  L +TL+ QEE  
Sbjct  235   LIRWSRNKFKMRSYQIDYLLEQLGELQKNWG------PHRXEILEKSRLIDTLWAQEESF  288

Query  2069  WFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLG  1890
             W QRSR +W+K GD NT+F+   T   R +++V K+ ++ G  + +   +   V ++FL 
Sbjct  289   WHQRSRVKWLKEGDANTKFFHQTTLQXRRRNKVLKIRNSTGDWVDNPNQVRXLVDEHFLT  348

Query  1889  LFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGF  1710
              F +E D N         P +  E  A++  P   E+IK A  +M   KA GPDGF   F
Sbjct  349   SFRSEGDRNWGTTLDCLTPMVTGEMNAALMXPVLEEEIKXAALNMGGLKAPGPDGFQGVF  408

Query  1709  FHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYK  1530
             +H     +   +   V         P   N T + LIPKVQNPE ++Q R I LCN  YK
Sbjct  409   YHTFXENIVGDVNDLVRSMIMGQDXPRKLNSTHIVLIPKVQNPEMVSQXRXISLCNYSYK  468

Query  1529  LITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKV  1353
             +++KV+  RLK ++ +++ P Q++FV GRQI DN     E+ +  +  K +  + + +K+
Sbjct  469   ILSKVLANRLKPILTEIISPMQNAFVAGRQIQDNIGIAHEVFHFLKIXKAKRRFEVGIKL  528

Query  1352  DLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             D++KAYDR+ W F++  +  +GF  +
Sbjct  529   DMQKAYDRVEWDFLDAVMEXMGFGSS  554


 Score =   209 bits (531),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 142/426 (33%), Positives = 212/426 (50%), Gaps = 13/426 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + IM CV+S     L NGQ  +  +P +GLRQGDP+SP LF+L  E LS M+  +V  
Sbjct  555   WRKLIMGCVSSVNFAVLLNGQPGEKFAPSRGLRQGDPLSPYLFLLVGEVLSKMIQGAVXX  614

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 GVK+    P +SH+FFADD + F +A+      +   L  +C+ SGQ IN+QKSS+
Sbjct  615   RQLDGVKLNGAGPVISHIFFADDTLIFLKADRKNCNNLVVLLQDYCNASGQAINMQKSSV  674

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF  N      + +   LG+  V + G +LG+P+I G+LKK     +  RI  +L G   
Sbjct  675   FFGNNVQSFLSEELGNILGMTVVDNPGSYLGVPTIWGQLKKLGLAYVKGRILGKLQGWKQ  734

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS AG  V++++V+ AIP Y M     P+ +   ++ LI  F W     + K H V  
Sbjct  735   XMLSRAGKEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSGVRRKIHWVSM  794

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G ++ +  N A LAK  WRL  + + LW  + KA+Y  + S   + + 
Sbjct  795   ETLGLPKHLGGMGFRNFQEFNDALLAKQCWRLIAEPDSLWAQVMKARYFPNCSFLDASKG  854

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN-  199
              R +S AW  +L    +   G  W +  G   R W+D WL    L     +P+   ++  
Sbjct  855   GR-ASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWL--PALXSGHPSPLGEVAVTR  911

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG-----DRLVWYKEPNGLF  34
             N   +  I      WD L+ +LP     + +      DT +G     DRL+W    NG++
Sbjct  912   NTRVSXIICPSSRTWD-LEFLLPFLSAGECAAIC---DTPIGNPRRKDRLIWASTRNGIY  967

Query  33    SVSSAY  16
             SV   Y
Sbjct  968   SVKXGY  973



>gb|AAG03119.1|AC004133_13 F5A9.24 [Arabidopsis thaliana]
Length=1254

 Score =   253 bits (645),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/568 (31%), Positives = 285/568 (50%), Gaps = 14/568 (2%)
 Frame = -1

Query  2966  SRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP  2787
             SR    +I S L +D+   VE VG  GG+ L    S+ +++ +     +  QV    +  
Sbjct  6     SRDDLVDIQSWLEYDQVYTVEPVGKCGGLALLWKSSVQVDLKFVDKNLMDAQVQFG-AVN  64

Query  2786  WLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCT  2607
             + +S VYG  D + R   +  +S      +  W   GDFN +    E +     S   C 
Sbjct  65    FCVSCVYGDPDRSKRSQAWERISRIGVGRRDKWCMFGDFNDILHNGEKNGGPRRSDLDCK  124

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
              FN+ I   +L+++   G+ +TW  G     +   RLDRA  N E    FP +  T L  
Sbjct  125   AFNEMIKGCDLVEMPAHGNGFTWA-GRRGDHWIQCRLDRAFGNKEWFCFFPVSNQTFLDF  183

Query  2426  IGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKS  2262
              GSDH P+LI + +    +   +F+F+  +      +  +   W      +++ ++    
Sbjct  184   RGSDHRPVLIKLMSSQDSY-RGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVADRLR  242

Query  2261  AMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ  2082
             A  ++LS W + +  N   K  +L A LE  Q SL   I     +    L+K+L +   +
Sbjct  243   ACRKSLSSWKKQNNLNSLDKINQLEAALEKEQ-SLVWPI----FQRVSVLKKDLAKAYRE  297

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W Q+SR++W++SG+RN++++  A    R + R+ KL D +G++   +    +    
Sbjct  298   EEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKGEVAAA  357

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  LF +      T++  G  P + E    S+    + ++IK A+F + P  A GPDG 
Sbjct  358   YFGNLFKSSNPSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAPGPDGM  417

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  FF   W TVG  + S V +FF DGI+P   N T L LIPK Q+P  +   RPI LC+
Sbjct  418   SALFFQHYWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPISLCS  477

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWM  1365
             V+YK+I+K+M  RL+  + ++V   QS+FV  R ITDN L   E++++ +   +    +M
Sbjct  478   VLYKIISKIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRISSEFM  537

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             A+K D+ KAYDR+ W ++   L  +GF+
Sbjct  538   AVKSDMSKAYDRVEWSYLRSLLLSLGFH  565


 Score =   194 bits (493),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 141/435 (32%), Positives = 219/435 (50%), Gaps = 23/435 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV+S     L N      I  ++GLRQGDP+SP LFVLC E L+H+++ +   
Sbjct  568   WVNWIMVCVSSVTYSVLINDCPFGLIILQRGLRQGDPLSPFLFVLCTEGLTHLLNKAQWE  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G++ +   P + HL FADD +F  +A+  Q+L ++K L ++ + +GQ INL KSS+
Sbjct  628   GALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLVLQKILKVYGNATGQTINLNKSSI  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +  +   +  I   LGI +    G +LGLP      K D    + +R+K +L    +
Sbjct  688   TFGEKVDEQLKGTIRTCLGIFTEGGAGTYLGLPECFSGSKVDMLHYLKDRLKEKLDVWFT  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  V+++SV  A+P ++M    +P    +++E  +  F W S +   K H   W
Sbjct  748   RCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENLESAMASFWWDSCDHSRKIHWQSW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K +GGLG + ++  N A LAK AWRL    +CL + L K++Y FD + +     
Sbjct  808   ERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPDCLLSRLLKSRY-FDATDFLDAAL  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              +  S  W+ IL    +   G++  V +G +   W+D W+ D        AP       N
Sbjct  867   SQRPSFGWRSILFGRELLSKGLQKRVGDGASLFVWIDPWIDDNGF----RAPWR----KN  918

Query  195   LVANYWISNEG--------WDWDML-DRVLPEHILN-KLSTFVLQEDTLLGDRLVWYKEP  46
             L+ +  +  +         WD ++L D  LPE IL  K    V+ +     D  VW    
Sbjct  919   LIYDVTLKVKALLNPRTGFWDEEVLHDLFLPEDILRIKAIKPVISQ----ADFFVWKLNK  974

Query  45    NGLFSVSSAYELALE  1
             +G FSV SAY LA +
Sbjct  975   SGDFSVKSAYWLAYQ  989



>gb|AAF97969.1|AC000103_19 F21J9.30 [Arabidopsis thaliana]
Length=1270

 Score =   253 bits (647),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/568 (31%), Positives = 285/568 (50%), Gaps = 14/568 (2%)
 Frame = -1

Query  2966  SRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP  2787
             SR    +I S L +D+   VE VG  GG+ L    S+ +++ +     +  QV    +  
Sbjct  3     SRDDLVDIQSWLEYDQVYTVEPVGKCGGLALLWKSSVQVDLKFVDKNLMDAQVQFG-AVN  61

Query  2786  WLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCT  2607
             + +S VYG  D + R   +  +S      +  W   GDFN +    E +     S   C 
Sbjct  62    FCVSCVYGDPDRSKRSQAWERISRIGVGRRDKWCMFGDFNDILHNGEKNGGPRRSDLDCK  121

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
              FN+ I   +L+++   G+ +TW  G     +   RLDRA  N E    FP +  T L  
Sbjct  122   AFNEMIKGCDLVEMPAHGNGFTWA-GRRGDHWIQCRLDRAFGNKEWFCFFPVSNQTFLDF  180

Query  2426  IGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKS  2262
              GSDH P+LI + +    +   +F+F+  +      +  +   W      +++ ++    
Sbjct  181   RGSDHRPVLIKLMSSQDSY-RGQFRFDKRFLFKEDVKEAIIRTWSRGKHGTNISVADRLR  239

Query  2261  AMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ  2082
             A  ++LS W + +  N   K  +L A LE  Q SL   I     +    L+K+L +   +
Sbjct  240   ACRKSLSSWKKQNNLNSLDKINQLEAALEKEQ-SLVWPI----FQRVSVLKKDLAKAYRE  294

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W Q+SR++W++SG+RN++++  A    R + R+ KL D +G++   +    +    
Sbjct  295   EEAYWKQKSRQKWLRSGNRNSKYFHAAVKQNRQRKRIEKLKDVNGNMQTSEAAKGEVAAA  354

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  LF +      T++  G  P + E    S+    + ++IK A+F + P  A GPDG 
Sbjct  355   YFGNLFKSSNPSGFTDWFSGLVPRVSEVMNESLVGEVSAQEIKEAVFSIKPASAPGPDGM  414

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  FF   W TVG  + S V +FF DGI+P   N T L LIPK Q+P  +   RPI LC+
Sbjct  415   SALFFQHYWSTVGNQVTSEVKKFFADGIMPAEWNYTHLCLIPKTQHPTEMVDLRPISLCS  474

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWM  1365
             V+YK+I+K+M  RL+  + ++V   QS+FV  R ITDN L   E++++ +   +    +M
Sbjct  475   VLYKIISKIMAKRLQPWLPEIVSDTQSAFVSERLITDNILVAHELVHSLKVHPRISSEFM  534

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             A+K D+ KAYDR+ W ++   L  +GF+
Sbjct  535   AVKSDMSKAYDRVEWSYLRSLLLSLGFH  562


 Score =   193 bits (491),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 141/435 (32%), Positives = 219/435 (50%), Gaps = 23/435 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV+S     L N      I  ++GLRQGDP+SP LFVLC E L+H+++ +   
Sbjct  565   WVNWIMVCVSSVTYSVLINDCPFGLIILQRGLRQGDPLSPFLFVLCTEGLTHLLNKAQWE  624

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G++ +   P + HL FADD +F  +A+  Q+L ++K L ++ + +GQ INL KSS+
Sbjct  625   GALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLVLQKILKVYGNATGQTINLNKSSI  684

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +  +   +  I   LGI +    G +LGLP      K D    + +R+K +L    +
Sbjct  685   TFGEKVDEQLKGTIRTCLGIFTEGGAGTYLGLPECFSGSKVDMLHYLKDRLKEKLDVWFT  744

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  V+++SV  A+P ++M    +P    +++E  +  F W S +   K H   W
Sbjct  745   RCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENLESAMASFWWDSCDHSRKIHWQSW  804

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K +GGLG + ++  N A LAK AWRL    +CL + L K++Y FD + +     
Sbjct  805   ERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPDCLLSRLLKSRY-FDATDFLDAAL  863

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              +  S  W+ IL    +   G++  V +G +   W+D W+ D        AP       N
Sbjct  864   SQRPSFGWRSILFGRELLSKGLQKRVGDGASLFVWIDPWIDDNGF----RAPWR----KN  915

Query  195   LVANYWISNEG--------WDWDML-DRVLPEHILN-KLSTFVLQEDTLLGDRLVWYKEP  46
             L+ +  +  +         WD ++L D  LPE IL  K    V+ +     D  VW    
Sbjct  916   LIYDVTLKVKALLNPRTGFWDEEVLHDLFLPEDILRIKAIKPVISQ----ADFFVWKLNK  971

Query  45    NGLFSVSSAYELALE  1
             +G FSV SAY LA +
Sbjct  972   SGDFSVKSAYWLAYQ  986



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   225 bits (573),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 238/502 (47%), Gaps = 11/502 (2%)
 Frame = -1

Query  2768  YGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWI  2589
             YG  D   R H +  L        G WL  GDFN V   +E S       ++  DF   I
Sbjct  501   YGHPDQTQRHHSWELLRRLGRVDLGPWLCCGDFNEVMECNEKSGSRLRRDAQMEDFKMAI  560

Query  2588  FMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHS  2409
                 L    FTG  +TW       +   ARLDR   N+     + +    HL    SDH 
Sbjct  561   TDCCLFQFEFTGYPFTWSNKRKDTAHVEARLDRGFGNLALLQHWGNFTSHHLVAFSSDHH  620

Query  2408  PLLISITTCPQQFCSS------RFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEA  2247
             P+LI+ +  P    +       RF+F   WT     +  V+  W++ +   +N       
Sbjct  621   PILIA-SDGPHGDKARGPRGRRRFQFEEVWTKEVDCEEVVRHSWQNAVSPLSNIDNCASN  679

Query  2246  LSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIW  2067
             LS WS +  G +P+K + L  RL  +Q   S    +        +  EL+  L QEE+ W
Sbjct  680   LSRWSAEKGGQVPKKVKELRLRLASLQ---SDEPSTQTFHNRSLIETELDTCLEQEEIYW  736

Query  2066  FQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGL  1887
              QRSR  W++ GDRNT F+    T +R ++ +  ++D +     +   +     ++F  L
Sbjct  737   HQRSRVHWLQHGDRNTSFFHKQATSRRKKNALVGILDENDRWQREYDKIGGVFVEFFTNL  796

Query  1886  FTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFF  1707
             FT+++ V            +    + ++  P++ ++I+ AL  + P KA GPDG    F+
Sbjct  797   FTSDMGVADVEVFSAVQARVSSRSYHNLLLPYSRDEIEVALNSIGPTKAPGPDGMPALFY  856

Query  1706  HKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKL  1527
              K W  VG  +     R           N T+++LIPKV +P R++++RPI LCNV+YK+
Sbjct  857   QKYWSIVGPEVSDLCLRVLNGSDGVNDFNHTLVALIPKVHSPTRVSEYRPISLCNVLYKI  916

Query  1526  ITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVD  1350
             I+K +  RLK ++ +++   QS+F+  R I DN LA  E ++   R  K     + LK+D
Sbjct  917   ISKTLANRLKKVLPEVISEFQSAFIPNRMILDNVLAAFETVHCLKRRGKTGKKKLILKLD  976

Query  1349  LEKAYDRLSWCFIEDTLRDIGF  1284
             + KAYDR+ W F+E  LR +GF
Sbjct  977   MAKAYDRVEWQFLEQMLRTMGF  998


 Score =   219 bits (559),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 222/425 (52%), Gaps = 6/425 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             +I+ IM CVT+     L  G+    I P +GLRQGDPISP LF++ AE  S ++  + R 
Sbjct  1002  FIQLIMGCVTTVSYSLLIQGRPFGRIIPSRGLRQGDPISPYLFLIVAEAFSALLQQAERD  1061

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 GV +   AP+++HLFFADD + F  A + +ALE+K+   ++   SGQK+NL KS+L
Sbjct  1062  SRLHGVSIAPSAPSINHLFFADDSLLFCNAGTTEALELKRIFGVYELASGQKVNLGKSAL  1121

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS +T    Q +I   L +  V    ++LGLP+I G+ KK  F  + +R+  +++G   
Sbjct  1122  CFSPSTPRVLQDDIRQLLNVTLVPCHERYLGLPTIVGKDKKKLFRTVKDRVWNKVNGWQG  1181

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V+++SV  AIP YSM    +P G+   IE +I  F W   +G+   H  KW
Sbjct  1182  KLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKNDGRG-IHWKKW  1240

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K++GGLG + L   N A L K  WRL +  + L   + KA+Y F  S + +   
Sbjct  1241  SFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKARY-FPNSDFLAASS  1299

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                 S  W+ +L    + R G++W + +GR    + D W+     F   S P  P++  +
Sbjct  1300  GSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVPYDRFFTIQSIPTLPAT--S  1357

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
              V + + ++ GWD   +           + +  L  D L  DR +W    NG +SV S Y
Sbjct  1358  RVCDLFTASGGWDVGKVFATFSFPEAEAILSIPLMGDNL--DRRIWNFTKNGRYSVKSGY  1415

Query  15    ELALE  1
               ALE
Sbjct  1416  WAALE  1420



>emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
 emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
Length=1274

 Score =   239 bits (610),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/562 (30%), Positives = 258/562 (46%), Gaps = 49/562 (9%)
 Frame = -1

Query  2933  LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLD  2754
             +G+     +   G SGG+ L+   ++ +EIL   P FI     DN S  W      G   
Sbjct  17    MGYAHRFTIPPEGLSGGLALYWKENVEVEILEAAPNFI-----DNRSVFWDKISSLGA--  69

Query  2753  MALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEEL  2574
                                  WL  GDFN +   SE              F  ++    L
Sbjct  70    ----------------QRSSAWLLTGDFNDILDNSEKQGGPLRWEGFFLAFRSFVSQNGL  113

Query  2573  IDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS  2394
              D+  TG+S +W RG     F  +RLDRAL N   S  FP +K  +L   GSDH PL+  
Sbjct  114   WDINHTGNSLSW-RGTRYSHFIKSRLDRALGNCSWSELFPMSKCEYLRFEGSDHRPLVTY  172

Query  2393  ITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMV------EALSVWS  2232
                 P +  S  F+F+         +A V+ VW    +L+   S +       +++  W+
Sbjct  173   FGAPPLKR-SKPFRFDRRLREKEEIRALVKEVW----ELARQDSVLYKISRCRQSIIKWT  227

Query  2231  RDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSR  2052
             ++   N  +  ++    LE    +LS  I    +        E      QEEL W Q SR
Sbjct  228   KEQNSNSAKAIKKAQQALES---ALSADIPDPSLIGSITQELEA--AYRQEELFWKQWSR  282

Query  2051  EEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV  1872
              +W+ SGDRN  ++   T  +R  + +S + D  G    ++  +   +  YF  +FTT  
Sbjct  283   VQWLNSGDRNKGYFHATTRTRRMLNNLSVIEDGSGQEFHEEEQIASTISSYFQNIFTTSN  342

Query  1871  DVNRTNFCYGCFPPLL----EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFH  1704
             + +          P++     E+   +++     +IK ALF +   KA GPDGF+  FFH
Sbjct  343   NSD-LQVVQEALSPIISSHCNEELIKISSLL---EIKEALFSISADKAPGPDGFSASFFH  398

Query  1703  KTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLI  1524
               W  +   +   +  FF D  L P  N+T ++LIPK+  P +++ +RPI LCNV YK++
Sbjct  399   AYWDIIEADVSRDIRSFFVDSCLSPRLNETHVTLIPKISAPRKVSDYRPIALCNVQYKIV  458

Query  1523  TKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDL  1347
              K++  RL+  + +L+  HQS+FV GR I DN L   EIL+  R     +   MA+K D+
Sbjct  459   AKILTRRLQPWLSELISLHQSAFVPGRAIADNVLITHEILHFLRVSGAKKYCSMAIKTDM  518

Query  1346  EKAYDRLSWCFIEDTLRDIGFN  1281
              KAYDR+ W F+++ L  +GF+
Sbjct  519   SKAYDRIKWNFLQEVLMRLGFH  540


 Score =   205 bits (521),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 137/429 (32%), Positives = 218/429 (51%), Gaps = 21/429 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR +M CV +     L NG     + P +GLRQGDP+SP LF+LC E LS +   +   
Sbjct  543   WIRWVMQCVCTVSYSFLINGSPQGSVVPSRGLRQGDPLSPYLFILCTEVLSGLCRKAQEK  602

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++V R +P ++HL FADD +FF + N      +   L  +   SGQ INL KS++
Sbjct  603   GVMVGIRVARGSPQVNHLLFADDTMFFCKTNPTCCGALSNILKKYELASGQSINLAKSAI  662

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    ++ +  +L I +   +GK+LGLP   GR K+D F +I++RI+ R    S 
Sbjct  663   TFSSKTPQDIKRRVKLSLRIDNEGGIGKYLGLPEHFGRRKRDIFSSIVDRIRQRSHSWSI  722

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  +++++VLS++P Y+M    +P+ +   I+ ++  F W S+  K K   V W
Sbjct  723   RFLSSAGKQILLKAVLSSMPSYAMMCFKLPASLCKQIQSVLTRFWWDSKPDKRKMAWVSW  782

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T     GGLG + ++       AKL+WR+ ++ + L + +   KY    S       
Sbjct  783   DKLTLPINEGGLGFREIE-------AKLSWRILKEPHSLLSRVLLGKYCNTSSFMDCSAS  835

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                +S+ W+GIL    + R G+ W +  G +   W ++WL           PI P +  N
Sbjct  836   PSFASHGWRGILAGRDLLRKGLGWSIGQGDSINVWTEAWLSP----SSPQTPIGPPTETN  891

Query  195   --LVANYWISNE--GWDWDMLDRVLP--EHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
               L  +  I ++   W+ + + + LP  E  + K++   L     L D LVW    +G +
Sbjct  892   KDLSVHDLICHDVKSWNVEAIRKHLPQYEDQIRKITINALP----LQDSLVWLPVKSGEY  947

Query  33    SVSSAYELA  7
             +  + Y LA
Sbjct  948   TTKTGYALA  956



>ref|XP_009135908.1| PREDICTED: uncharacterized protein LOC103860050 [Brassica rapa]
Length=1207

 Score =   233 bits (595),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 227/425 (53%), Gaps = 13/425 (3%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CV+S     L N  +   + P++G+RQGDP+SP LF+LC+E LS +   + + G   
Sbjct  471   IMNCVSSVSYSFLINDAVLGRVVPQRGIRQGDPLSPYLFILCSEVLSGLCSKAQQDGTLP  530

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+K+ + +P+++HL FADD +FF   +     ++K  L L+ S SGQ+IN  KSS+ F+K
Sbjct  531   GIKIAKNSPSVNHLLFADDTMFFIPTDRRSCAKLKHILTLYESASGQRINTDKSSISFAK  590

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
              T    +  +   LGI     +GK+LGLP   GR K+D F +I++RI  +    S+R LS
Sbjct  591   KTTSLVRNEVKDILGITKEGGVGKYLGLPEHFGRKKRDLFASIIDRIVVKAVSWSTRFLS  650

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG  VM+++VL+A+P ++M   L+P G+   I+  +  F W S  GK K   + W  +T
Sbjct  651   SAGKMVMLKAVLTAVPSFAMTCFLLPVGLCKMIQSALTRFWWDSNTGKKKMCWLSWDKLT  710

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K+ GGLG K ++  N+A LAKL WR+  + NCL + +   KY     +    Q  + +
Sbjct  711   KPKSLGGLGFKDIQTFNIALLAKLPWRMLTNPNCLLSRVLLGKYCHKAPLLKV-QLVKGA  769

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP--SSLNNLV  190
             S+ W GIL    +  + I   V  G   + W D+W+           P  P     N+L 
Sbjct  770   SHGWTGILAGRDLLASHIGRAVGEGTEIKVWTDAWISTTSRI----IPYGPLKEGTNDLY  825

Query  189   ANYWISNEG---WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              +  I N G   W+ +M+ R+LPE +   L+  +    T   D  +WY   +G++S  S 
Sbjct  826   VSDLI-NRGTCEWNIEMISRILPEFVEEILT--IKPSKTKARDSYIWYPAKSGIYSAKSG  882

Query  18    YELAL  4
             Y  A+
Sbjct  883   YAAAI  887


 Score =   208 bits (529),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 137/418 (33%), Positives = 211/418 (50%), Gaps = 11/418 (3%)
 Frame = -1

Query  2519  PSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNM  2343
             P     RLDRA+SN + S  FP A+  +L   GSDH PLL      P +  S R F+++ 
Sbjct  55    PLVVHCRLDRAVSNSDWSDMFPTARSHYLLFEGSDHRPLLSVFD--PTKLKSQRLFRYDR  112

Query  2342  AWTTHYSFQACVQSVWR--SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGV  2169
                 +      V+  W    +L++    S   +A+S WS+D F N  +    L   L+  
Sbjct  113   RLRHNSEVTILVEKTWNRYKNLNVMERLSNCRKAISKWSKDQFLNSKKAIDNLKMSLDS-  171

Query  2168  Q*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVK  1989
                LS  +  D +     L          EE  W QRSR+ W+  GDRNT ++  A   +
Sbjct  172   --ELSKPLADDPLISSLNLALLQAYK--AEEEYWRQRSRQMWLSLGDRNTGYFHAAARGR  227

Query  1988  RNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWA  1809
             R ++R S +  A+G  + ++  + + +  YF  +F++                +  E   
Sbjct  228   RARNRFSMIETAEGTAVFEEKQIAEVIAAYFTEIFSSSSSDCTDTVHSALKSKITAEQNE  287

Query  1808  SVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPP  1629
              +  P T  +I+ ALF + P KA GPDGF+  FF   W   G ++   +  FF  G +P 
Sbjct  288   MLIMPPTDFEIRAALFSIHPDKAPGPDGFSASFFQTNWDVTGPAMIKEIQEFFRTGSMPH  347

Query  1628  GCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVH  1449
               N T + LIPK+ +P+ ++ +RPI LCNV YK+I+K++ +RLK ++   +  +QS+F+ 
Sbjct  348   SINATHIRLIPKITSPKVVSDYRPIALCNVYYKVISKLLSLRLKPVLHCAISENQSAFIP  407

Query  1448  GRQITDNTLAYQEILNAFRTKKGRV-GWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             GR I+DN L   E L+  +T K +    MA+K D+ KAYDRL W FIE  L  +GF+ 
Sbjct  408   GRAISDNVLITHEFLHYLKTTKSKKRSSMAIKSDMSKAYDRLEWSFIECVLSTLGFHE  465



>ref|XP_010684763.1| PREDICTED: uncharacterized protein LOC104899296 [Beta vulgaris 
subsp. vulgaris]
Length=1107

 Score =   228 bits (580),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 141/428 (33%), Positives = 232/428 (54%), Gaps = 9/428 (2%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  I  CV+S     L NG   +  S  +G+RQGDP+SP LF+LCAE L+ ++ SS 
Sbjct  364   PQWIGWIKECVSSTSFSVLVNGLPGEKFSSSRGIRQGDPLSPYLFILCAELLARLL-SSA  422

Query  1101  RSGNWK--GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQ  928
              SG  K  GV + +    +  L FADD + F +A +   L +++ LD +CS SGQ +N  
Sbjct  423   ASGPTKPIGVPIGKTGMRIPFLTFADDTMIFAKATNYSCLIIRQILDKYCSMSGQLVNYH  482

Query  927   KSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarls  748
             KSS   + N     + N A+ L +    D+G +LG P IH ++ K++F +++ +  ++L 
Sbjct  483   KSSFQCTANIPEAEKCNFASILQMQETNDLGDYLGCPIIHSKVTKETFSSVVSKTTSQLP  542

Query  747   g*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCH  568
                +  LS AG  V++QS L+A   Y M+S L+P  ++ +++R  R F W         +
Sbjct  543   KWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFWNKETTNKSPN  602

Query  567   LVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS  388
             L+ W  +   K+ GGLG +  +  N A   KL WR+ ++ N LW  L + +Y  + S++ 
Sbjct  603   LIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVKLVRKRYIKNKSIF-  661

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
             S +  +++S  W+ +L    IF+ G++W + NG++  FW+D+W+    L +   +PI  +
Sbjct  662   SIKASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYSL-KSIISPIPGT  720

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
                NL  N  I   G WD  ML  ++P HI+ ++ +  +  ++   D L+W    +G +S
Sbjct  721   E--NLTVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIPSES-QPDNLIWGLTADGEYS  777

Query  30    VSSAYELA  7
             V S   LA
Sbjct  778   VKSGALLA  785


 Score =   213 bits (543),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 188/321 (59%), Gaps = 3/321 (1%)
 Frame = -1

Query  2237  WSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQ  2061
             W++  FGNI ++ R++  RL+ +Q  L     +   + ++ L  +   +L       W Q
Sbjct  42    WNKSQFGNIFRQLRKVDERLQEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNEFWKQ  101

Query  2060  RSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT  1881
             +S+ +++  GD N+ +Y    +++RN++++ ++V + G +I +   + + + + F   F+
Sbjct  102   KSKTDYLILGDSNSSYYHTHASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARFS  161

Query  1880  TEVDVN-RTNFCYGCFPPLL-EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFF  1707
             ++  V    ++ +     ++ EE+ A + +P + ++IK A FD+ P K+ GPDGF P FF
Sbjct  162   SDSSVYFHPDYDFSLLDNIISEENNAFLTSPVSGDEIKAATFDLAPDKSPGPDGFPPFFF  221

Query  1706  HKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKL  1527
              K W  VG S+   V  FF  G +    N T L+LIPK+ NP     FRPI LC+ +YK+
Sbjct  222   QKYWTLVGNSVIRAVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLCSTIYKI  281

Query  1526  ITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDL  1347
             I+K++  RLK+++ +++ P Q +F+  R I DN L   EI  +F+TK G  GW+A+K+D+
Sbjct  282   ISKIITNRLKEVMSQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWIAIKLDM  341

Query  1346  EKAYDRLSWCFIEDTLRDIGF  1284
             EKAYDRL W +I  TL  +GF
Sbjct  342   EKAYDRLEWNYIFSTLDKLGF  362



>ref|XP_010693613.1| PREDICTED: uncharacterized protein LOC104906541 [Beta vulgaris 
subsp. vulgaris]
Length=1067

 Score =   243 bits (619),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 140/441 (32%), Positives = 231/441 (52%), Gaps = 10/441 (2%)
 Frame = -1

Query  2579  ELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL  2400
             E I+L F GS +TW +    P     RLD+ ++N++    FP+ KV H     SDH  + 
Sbjct  9     ECIELPFLGSGFTWKKKRSGPDNILERLDKGVANLDFLNVFPNVKVQHHAFTTSDHCQVS  68

Query  2399  ISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLD------LSTNKSAMVEALSV  2238
             + +    Q   S  F+F+ AWTT   F+  ++  W +         L+     + E    
Sbjct  69    VKLDIL-QGRKSPPFRFDKAWTTRKDFEVIIKKAWSTRFHGSYMFRLTKKCKLLKEKAKN  127

Query  2237  WSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQ  2061
             W+   FGN+ ++ + + ++L+ +Q +L        +  +       +  L + +EL W  
Sbjct  128   WATTRFGNVIRQLKVVESKLKCIQDNLLANPSCPFLAAKLDKFHLKQVRLLELQELYWKT  187

Query  2060  RSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT  1881
             +++   +K  D NT+++    +++RN++ +S + D  G ++ D   +     + F+  FT
Sbjct  188   KAKSNHLKLSDSNTKYFHACASIRRNRNFISSIEDDTGVVLTDPKDVENCFTNSFVQRFT  247

Query  1880  TEVDVNRTNFC-YGCFPPLL-EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFF  1707
                +      C +     ++ EED   + +  + E+IK A+F++ P KA GPDGF P FF
Sbjct  248   ANQECFFDEHCDFSLLESIISEEDNMLLCSEVSAEEIKNAVFELAPDKAPGPDGFPPYFF  307

Query  1706  HKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKL  1527
              + W  VG S+   V  FF  G L    N T ++LIPKV++P    QFRPI LC+ +YK+
Sbjct  308   QQYWSLVGNSVCHAVRAFFFSGTLLKEVNHTFITLIPKVESPSNPNQFRPISLCSTIYKV  367

Query  1526  ITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDL  1347
             I K+M  RLK ++ K++ P Q +FV  R I DN L   E+ ++F+ K G  GW+A+K+D+
Sbjct  368   IAKIMASRLKIVLGKIIHPLQGAFVPERLIQDNVLIAHEVFHSFKKKTGNQGWLAIKLDM  427

Query  1346  EKAYDRLSWCFIEDTLRDIGF  1284
             EKAYDRL W FI    + +GF
Sbjct  428   EKAYDRLEWNFIFAVFKKLGF  448


 Score =   198 bits (503),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 211/423 (50%), Gaps = 5/423 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +  C++S     L NG   D   P +G+RQGDP+SP +F+LCAE L+  + ++ R 
Sbjct  452   WVGWMKECISSVSFSVLVNGIPGDVFYPSRGIRQGDPLSPYIFILCAEILARQLHAASRE  511

Query  1095  G-NWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
             G    GV +      +  L FADD + F +A       +++ LD +C  SGQ +N  KS+
Sbjct  512   GPKLVGVALGHSRVKIPFLTFADDTMIFAKATVDSCTVIREILDDYCRMSGQLVNYNKSA  571

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                S NT+     +  + L +     +GK+LG P I  ++  ++F NI E+++ +LS   
Sbjct  572   YQCSPNTDPILATSFTSFLRMGEACSLGKYLGCPIIDSKVTNNTFGNIQEKVQGQLSKWK  631

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             + +LS AG  V++QS L+    Y M+  L+P  +++S+++  R F W         +L+ 
Sbjct  632   ANSLSQAGRTVLIQSNLATKANYQMQCFLLPPHIVESLDKSYRNFFWNKSSESKSPNLIG  691

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  +   K NGGLG++  K MN+A   KL W++    + LW NL   KY     ++  ++
Sbjct  692   WDKICKPKQNGGLGLRKAKVMNMALQFKLLWKILFCPDNLWVNLVSKKYMKSDGLF-DYR  750

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
              K N S  W+ ++     F++G++W V  G    F  D+W+   PL    S      SL 
Sbjct  751   VKANVSWQWRKLMSLRDKFKHGLRWVVGRGDKISFCFDNWVFQYPLCSVCSVLRGSESL-  809

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              +V ++      WD   L   + E I   + +  +     L D+ VW   P+G +SV S 
Sbjct  810   -VVESFITQGNQWDVARLREFVKEEICLAICSIFIPTHP-LEDKCVWALSPDGCYSVKSG  867

Query  18    YEL  10
              +L
Sbjct  868   VQL  870



>ref|XP_008387315.1| PREDICTED: uncharacterized protein LOC103449768 [Malus domestica]
Length=2699

 Score =   258 bits (660),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/616 (29%), Positives = 291/616 (47%), Gaps = 35/616 (6%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLG--FDEWIRVEAVG  2895
             WN +G  S   R TLK   R  +P +I L E K +      + S  G  F EWI   A G
Sbjct  1005  WNVRGLGSKQKRLTLKQQFRRLQPDIIILQETKKTSIDRRLVASVWGSRFKEWIYAPAQG  1064

Query  2894  YSGGI---WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
              SGGI   W   ++S+   ++      I  + ++ +   W +S VYG      RR  + +
Sbjct  1065  SSGGIAVIWNTKNISVTESLIGVFSVSIKIKAFNGLE--WWLSGVYGPCKSRERREFWEE  1122

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             ++  +      W   GDFN V   +E SN    + S   +FND+I   EL DL    + +
Sbjct  1123  MAGLYGLCGPKWCVGGDFNVVRFVNEKSNGGRLTTS-MRNFNDFIRETELKDLELLNAQF  1181

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW    + P  +  RLDR L +      FP+ +   L  + SDH P  I + +   ++  
Sbjct  1182  TWSNFREEPVCR--RLDRFLVSAGCEEIFPEVRQMALARVISDHCP--IQLESNKVKWGP  1237

Query  2363  SRFKFNMAWTTHYSFQACVQSVWRSD-------LDLSTNKSAMVEALSVWSRDSFGNIPQ  2205
             S F+F   W  H  F+      W+S+               A  + +  WS++SFG + +
Sbjct  1238  SPFRFENMWLQHPEFRNKFNLWWQSEQVEGWEGYKFMIKLKAXKKKVQRWSKESFGEVEK  1297

Query  2204  KKRRLLARLEGVQ*SLSM-GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGD  2028
               +   A LE +     M G+  D  R    L     +  Y+EE+ W QRS+ EW K GD
Sbjct  1298  DFKEAEASLEELDRREGMEGLDVDARRKREELLFXXGDLAYKEEVKWRQRSKVEWXKEGD  1357

Query  2027  RNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFC  1848
              NT+F+    + +R ++ + +L    G +I D   +  H+  +F  LF++  +      C
Sbjct  1358  GNTKFFHRVASGRRKRNYIERLEXEVGGVIEDANEIEDHIVXFFKSLFSSNEEA-----C  1412

Query  1847  YGC----FPPL--LEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTV  1686
             +G     + P+  LE +W  +  PF   +++ A+FD    K+ GPDG++     + W  +
Sbjct  1413  WGLEGINWAPISELEANW--IERPFEEAEVQRAVFDCGKDKSPGPDGYSLQMIQQCWDIL  1470

Query  1685  GTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMI  1506
               ++   +  F+E GI+    N+T + LIPK  +  ++T FRPI L   +YK++ K +  
Sbjct  1471  KANIMKIMEEFYETGIINAVTNETFICLIPKKSDSMKVTDFRPISLVTGLYKIMAKTLAS  1530

Query  1505  RLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRL  1326
             RLK+++   +  +Q +FV  RQI D  L   E++   R KK     + LK+D EKAYD +
Sbjct  1531  RLKEVLGSTISQNQGAFVKDRQILDAVLIANEVVEEVRQKKEEG--LVLKIDFEKAYDHV  1588

Query  1325  SWCFIEDTLRDIGFNH  1278
              W F+++ L+   F +
Sbjct  1589  EWRFLDEVLQRKSFGN  1604


 Score =   182 bits (462),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 137/428 (32%), Positives = 210/428 (49%), Gaps = 12/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + +  C++S     L NG+        +GLRQGDP+SP LF L  + LS +++ +  +
Sbjct  1606  WRKWMQGCLSSANFSVLINGRPRGKFQXSRGLRQGDPLSPFLFTLVVDVLSRLMEKAQEN  1665

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                KG+ + +    + HL FADD +FF          + + L LFCS SG KIN  K  L
Sbjct  1666  HLIKGLCIGQEKVEIXHLQFADDTIFFLAXXEGGWNNLLELLKLFCSVSGLKINKAKCYL  1725

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarlsg*s  739
                 N++      +A + G        K+LGLP + GR +   F D ++++++ RL    
Sbjct  1726  X-GINSDCEKLNRLADSWGCEVGSXPIKYLGLP-LGGRPRALKFWDPVVDKMEKRLQSWK  1783

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
                LS  G   ++QSVL ++P Y M    +P GVI  +E+L++GFLW   E   K +LVK
Sbjct  1784  KAFLSRGGRLTLIQSVLGSLPTYYMSLFKMPCGVIGRLEKLMKGFLWEGVEEGKKNNLVK  1843

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W IV  SK  GGLG+ +L++ N A LAK  WR   + + LW  + ++KY    + W+++ 
Sbjct  1844  WEIVIKSKEEGGLGVGNLRNRNEALLAKWLWRFPXEPHSLWHKVIRSKYGLQDNGWNAFP  1903

Query  378   PKRNSSNA-WKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             P R SS + WK I     +F +  K+ V NG   RFW D WL    L E+       S  
Sbjct  1904  PIRGSSRSPWKDISIGSQLFLHCCKFEVGNGERVRFWEDGWLDGGXLKEQFPRLFLLSRK  1963

Query  201   NNLVANYWI----SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG----DRLVWYKEP  46
             +N   + ++    ++  W++D    +    I          E+  L     D   W  E 
Sbjct  1964  HNQNISSFVDLSTNSLSWNFDFRRNLNEAEIEEAARLLQKVEEVRLSQSRXDNRRWKMEA  2023

Query  45    NGLFSVSS  22
             +GLF+  S
Sbjct  2024  SGLFTCKS  2031



>ref|XP_010673997.1| PREDICTED: uncharacterized protein LOC104890275 [Beta vulgaris 
subsp. vulgaris]
Length=1098

 Score =   227 bits (579),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 141/428 (33%), Positives = 232/428 (54%), Gaps = 9/428 (2%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  I  CV+S     L NG   +  S  +G+RQGDP+SP LF+LCAE L+ ++ SS 
Sbjct  364   PQWIGWIKECVSSTSFSVLVNGLPGEKFSSSRGIRQGDPLSPYLFILCAELLARLL-SSA  422

Query  1101  RSGNWK--GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQ  928
              SG  K  GV + +    +  L FADD + F +A +   L +++ LD +CS SGQ +N  
Sbjct  423   ASGPTKPIGVPIGKTGMRIPFLTFADDTMIFAKATNYSCLIIRQILDKYCSMSGQLVNYH  482

Query  927   KSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarls  748
             KSS   + N     + N A+ L +    D+G +LG P IH ++ K++F +++ +  ++L 
Sbjct  483   KSSFQCTANIPEAEKCNFASILQMQETNDLGDYLGCPIIHSKVTKETFSSVVSKTTSQLP  542

Query  747   g*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCH  568
                +  LS AG  V++QS L+A   Y M+S L+P  ++ +++R  R F W         +
Sbjct  543   KWKANALSQAGRSVLLQSNLAAKASYQMQSFLLPKSILVNLDRTYRNFFWNKETTNKSPN  602

Query  567   LVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS  388
             L+ W  +   K+ GGLG +  +  N A   KL WR+ ++ N LW  L + +Y  + S++S
Sbjct  603   LIGWDRICKPKSAGGLGFRKAEANNQALQMKLLWRIVKNDNNLWVKLVRKRYIKNKSIFS  662

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
               +  +++S  W+ +L    IF+ G++W + NG++  FW+D+W+    L +   +PI  +
Sbjct  663   I-KASKSASWQWRNLLSLRDIFKKGLRWQIGNGKSINFWMDNWVFQYSL-KSIISPIPGT  720

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
                NL  N  I   G WD  ML  ++P HI+ ++ +  +  ++   D L+W    +G +S
Sbjct  721   E--NLTVNRCIMPSGQWDSQMLLSLVPPHIVLQICSIYIPSES-QPDNLIWGLTADGEYS  777

Query  30    VSSAYELA  7
             V S   LA
Sbjct  778   VKSGALLA  785


 Score =   213 bits (543),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 188/321 (59%), Gaps = 3/321 (1%)
 Frame = -1

Query  2237  WSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQ  2061
             W++  FGNI ++ R++  RL+ +Q  L     +   + ++ L  +   +L       W Q
Sbjct  42    WNKSQFGNIFRQLRKVDERLQEIQSFLLANPSNLTYQTKQDLFLKKRSSLLSFSNEFWKQ  101

Query  2060  RSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT  1881
             +S+ +++  GD N+ +Y    +++RN++++ ++V + G +I +   + + + + F   F+
Sbjct  102   KSKTDYLILGDSNSSYYHTHASIRRNRNQIKEIVSSTGEVITNPVAISQELSNAFKARFS  161

Query  1880  TEVDVN-RTNFCYGCFPPLL-EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFF  1707
             ++  V    ++ +     ++ EE+ A + +P + ++IK A FD+ P K+ GPDGF P FF
Sbjct  162   SDSSVYFHPDYDFSLLDNIISEENNAFLTSPVSGDEIKAATFDLAPDKSPGPDGFPPFFF  221

Query  1706  HKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKL  1527
              K W  VG S+   V  FF  G +    N T L+LIPK+ NP     FRPI LC+ +YK+
Sbjct  222   QKYWTLVGNSVIRAVQAFFHSGKILKEINHTFLALIPKIDNPSSANHFRPISLCSTIYKI  281

Query  1526  ITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDL  1347
             I+K++  RLK+++ +++ P Q +F+  R I DN L   EI  +F+TK G  GW+A+K+D+
Sbjct  282   ISKIITNRLKEVMSQIIHPLQGAFIPDRLIQDNILIAHEIFQSFKTKSGSNGWIAIKLDM  341

Query  1346  EKAYDRLSWCFIEDTLRDIGF  1284
             EKAYDRL W +I  TL  +GF
Sbjct  342   EKAYDRLEWNYIFSTLDKLGF  362



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   228 bits (580),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/564 (30%), Positives = 269/564 (48%), Gaps = 18/564 (3%)
 Frame = -1

Query  2951  NEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMS  2775
              +I +  GF E + + + G SGG+ L+ S +I++ +L      I   V D    P W   
Sbjct  8     EKIRNRCGFSEGLCLSSNGLSGGMGLWWS-NIDVAVLSFSAHHIEAAVLDEHKNPSWHAV  66

Query  2774  VVYGCLDMALRRHLFADLS*YFFNPQGTWLAM--GDFNSVTCQSEVSNKETFSMSRCTDF  2601
               YG  + A +      LS      Q     M  GDFN +T   E       S      F
Sbjct  67    GFYGWPETANKH-----LSWQLMRQQCPLPLMFFGDFNEITSVEEKEGGVLRSERLMDAF  121

Query  2600  NDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIG  2421
              + I    + DLGF G+ +TW RG    +    RLDR L++      FP  +V  LP   
Sbjct  122   REAIDDCAIKDLGFKGNKFTWQRGNSPSTLIRERLDRMLADDAWCDLFPSWEVQILPRYR  181

Query  2420  SDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRSD--LDLSTNKSAMVE  2250
             SDH+PLL+           ++ FKF   W +       V+  W      D++   + +  
Sbjct  182   SDHAPLLLKTGLNDSYRRGNKLFKFEALWLSKEECGKVVEEAWSGSRGADIAERLAGVSG  241

Query  2249  ALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELI  2070
              L+ W+   FG++ ++K+R L +L  +Q        + ++        EL+E    EE  
Sbjct  242   DLTKWATHCFGDLKKRKKRALEKLNILQ---QRAPDARVLEQCHAASTELDEICRLEESY  298

Query  2069  WFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLG  1890
             W  R+R   I+ GD+NT+++    + ++ ++ +  L+D +G        + + V  YF  
Sbjct  299   WHARARANEIRDGDKNTKYFHHKASQRKKRNAIKGLLDENGVWKKGKDEINEVVQRYFGD  358

Query  1889  LFTTEVDVNRTNFCYGCFPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPG  1713
             LF TE          G  P +  E + A + +P   ++++ ALF M P KA G DG    
Sbjct  359   LFATEGPNEMEAALTGISPCVSNEMNQALIKSP-AGDEVRDALFAMHPNKAPGIDGLHAL  417

Query  1712  FFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVY  1533
             FF K W  +G  + +FV  ++   +     N T + LIPK +NP+ +  FRPI LC V+Y
Sbjct  418   FFQKFWHILGPDIITFVQDWWSGLVDLTVINRTCIVLIPKCENPQSMKDFRPISLCTVLY  477

Query  1532  KLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALK  1356
             K+++K +  RLK ++  ++ P+QS+FV  R ITDN L   EI +A + K   R    ALK
Sbjct  478   KILSKTLANRLKVILPSIISPNQSAFVPRRLITDNALVAFEIFHAMKRKDANRDVICALK  537

Query  1355  VDLEKAYDRLSWCFIEDTLRDIGF  1284
             +D+ KAYDR+ WCF+E  +  +GF
Sbjct  538   LDMSKAYDRVEWCFLERVMEKLGF  561


 Score =   212 bits (540),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 212/427 (50%), Gaps = 16/427 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M C++        NG +   +SP +GLRQGDPISP LF+LCA+  S ++  +   
Sbjct  565   WISRVMACISGVSFTFKVNGVVEGSLSPSRGLRQGDPISPYLFLLCADAFSTLITKATEE  624

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G ++ R AP +SHLFFADD + F +A+  +   +   +  +   SGQK+NL K+ +
Sbjct  625   KKIHGARICRGAPMVSHLFFADDSILFTKASVQECSVVADIISKYERASGQKVNLSKTEV  684

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+N     +  I   LG+  V    K+LGLP++ GR KK +F  I ERI  +L G   
Sbjct  685   VFSRNVESDRRDAIVRVLGVNEVERQEKYLGLPTVIGRSKKVTFACIKERIWKKLQGWKE  744

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  ++++SV  AIP Y M    +PSG+ID I  ++  F WGS  G+ K H   W
Sbjct  745   KLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDEIHAMLARFWWGSNGGERKMHWHSW  804

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K+ GGLG + L   N A LAK AWRL Q    L + + +A+Y +    +   + 
Sbjct  805   DAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRDATLLSQVLQARY-YKNVEFLEARR  863

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N S  W+ +  +  +   G+KW V +G     W ++W+L          P   S++  
Sbjct  864   GYNPSFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGEG-SHHVPTPRHDSNMEL  922

Query  195   LVANYWISNEGWDWDMLDRVLP------EHILN-KLSTFVLQEDTLLGDRLVWYKEPNGL  37
              V +    N G  W++              IL+  LS F  +      D   W+   NG+
Sbjct  923   RVCDLIDVNRG-GWNVEVVQQVFVEEEWRSILDIPLSRFWPE------DHRYWWPSRNGV  975

Query  36    FSVSSAY  16
             FSV S Y
Sbjct  976   FSVRSCY  982



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score =   272 bits (695),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/606 (31%), Positives = 297/606 (49%), Gaps = 30/606 (5%)
 Frame = -1

Query  3059  QGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGI  2880
             +G +    +R LK    +H+  ++ + EP +  ++A      LGF++ I    V  S  I
Sbjct  895   RGISGRVIQRRLKKLQLMHRIKILAILEPMVDISKAEFFRRKLGFEKVI----VNSSQKI  950

Query  2879  WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*  2715
             WLF S+ ++ +I+  HPQ +  ++    ++PWL      + VY     + R  L+  L  
Sbjct  951   WLFHSLELHSDIILDHPQCLHVRL----TSPWLEKPFFATFVYAKCTRSERTLLWDCLRR  1006

Query  2714  YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI  2535
                + +  WL  GDFN +  + E             DF   +    L+D GF G+ +TW 
Sbjct  1007  LAADNEEPWLVGGDFNIILKREERLYGSAPHEGSMEDFASVLLDCGLLDGGFEGNPFTW-  1065

Query  2534  RGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRF  2355
                 T +    RLDR + N +    FP  ++ HL   GSDH PLLIS     ++  SS F
Sbjct  1066  ----TNNRMFQRLDRVVYNHQWINMFPITRIQHLNRDGSDHCPLLISCFISSEKSPSS-F  1120

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRR  2193
             +F  AW  H+ F+  V+  W   ++ S        +  + + L  W++  FG+I  K + 
Sbjct  1121  RFQHAWVLHHDFKTSVEGNWNLPINGSGLQAFWIKQHRLKQHLKWWNKAVFGDIFSKLKE  1180

Query  2192  LLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRF  2013
                R+E  +                +   +L + L  EE+ W Q+S  +W+  G+RNT+F
Sbjct  1181  AEKRVEECEILHQQEQTVGSRINLNKSYAQLNKQLNVEEIFWKQKSGVKWVVEGERNTKF  1240

Query  2012  YQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCF  1836
             + +    KR +S + K+ + DG  I D   L +   +YF  L   E  D++R  F     
Sbjct  1241  FHMRMQKKRIRSHIFKVQEPDGRWIEDQEQLKQSAIEYFSSLLKAEPCDISR--FQNSLI  1298

Query  1835  PPLLEEDWASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
             P ++      +  A    +++K A+FD+ P  A+GPDGF+  F+ + W T+   L   V 
Sbjct  1299  PSIISNSENELLCAEPNLQEVKDAVFDIDPESAAGPDGFSSYFYQQCWNTIAHDLLDAVR  1358

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
              FF    +P G   T L L+PK  +  + ++FRPI LC V+ K+ITK++  RL  ++  +
Sbjct  1359  DFFHGANIPRGVTSTTLVLLPKKSSASKWSEFRPISLCTVMNKIITKLLSNRLAKILPSI  1418

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             +  +QS FV GR I+DN L  QE++    T K R G +ALK+D+ KAYDRL W F+   L
Sbjct  1419  ITENQSGFVGGRLISDNILLAQELIRKLDT-KSRGGNLALKLDMMKAYDRLDWSFLIKVL  1477

Query  1298  RDIGFN  1281
             +  GFN
Sbjct  1478  QHFGFN  1483


 Score =   167 bits (424),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 206/423 (49%), Gaps = 12/423 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C+++     L NG++  +    +GLRQGD ISP LF+L AE LS  +++    
Sbjct  1486  WIGMIQKCISNCWFSLLLNGRIEGYFKSERGLRQGDSISPQLFILAAEYLSRGLNALY--  1543

Query  1095  GNWKGVKVTRIAP-NMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
               +  +  +   P ++SHL FADD++ F   +      +   L  +   SGQ+IN QKS 
Sbjct  1544  DQYPSLHYSSGVPLSVSHLAFADDVLIFTNGSKSALQRILVFLQEYEEISGQRINAQKSC  1603

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                  N     +Q IA   G    L    +LG P   G  K   F++++ +I+ R++G  
Sbjct  1604  FVTHTNIPNSRRQIIAQATGFNHQLLPITYLGAPLYKGHKKVILFNDLVAKIEERITGWE  1663

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             ++ LS  G   +++SVL+++P Y ++    P  V++ + RL   FLWG      + H   
Sbjct  1664  NKILSPGGRITLLRSVLASLPIYLLQVLKPPVCVLERVNRLFNSFLWGGSAASKRIHWAS  1723

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  +      GGL I+SL  +  AF  KL WR  +  + LWT   + KY     +    Q
Sbjct  1724  WAKIALPVTEGGLDIRSLAEVFEAFSMKLWWRF-RTTDSLWTRFMRMKY-CRGQLPMQTQ  1781

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             PK + S  WK +L +  I    ++W V  G    FW D W+ + PL   +S     SS+ 
Sbjct  1782  PKLHDSQTWKRMLTSSTITEQHMRWRVGQGNVF-FWHDCWMGEAPLI--SSNQEFTSSMV  1838

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              +    + +N  W+ + L  VL + ++++++   +  DT+  D   W   PNG FS  SA
Sbjct  1839  QVCD--FFTNNSWNIEKLKTVLQQEVVDEIAKIPI--DTMNKDEAYWTPTPNGDFSTKSA  1894

Query  18    YEL  10
             ++L
Sbjct  1895  WQL  1897


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 81/210 (39%), Gaps = 17/210 (8%)
 Frame = -3

Query  4311  LEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKL  4132
             L   +E+  L +   +       D + V     W + +  +   +W P+F+P   +   +
Sbjct  16    LTGAYEVRWLDYKHVLIHLSNEQDCNRVWTKQVWFIANQKMRVFKWTPDFEPE-KESAVV  74

Query  4131  LAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLD--------  3976
               W+ FP+L    F+   L  I K +G+P+ +D  T   S+   ARVC++ D        
Sbjct  75    PVWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEYDCRRSPIDQ  134

Query  3975  ---ITKPLLSNFVINGTEWPKEYEGIHQICFKCSIYGHRMETCGLSVPIPAASVDGTAGT  3805
                + +   +  V +G     E+  +   C  C   GH+   C     I   + D + G 
Sbjct  135   VWIVVQNRETGTVTSGYPQRVEFSQMPAYCDHCCHVGHKEIDC-----IVLGNKDKSLGR  189

Query  3804  SSTTGIDIPLPKPKEKYGAWMLVTRRDRRN  3715
             S +  +     + K  YG         R+N
Sbjct  190   SKSQSLRALTVEKKTGYGGGSEKNLEKRKN  219



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   236 bits (602),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 151/430 (35%), Positives = 226/430 (53%), Gaps = 13/430 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I+ CV+S     L NG     +SP +G+RQGDP+SP +F+LC+E LS + + +  +
Sbjct  351   WIAWILECVSSVTYAFLINGSPRGKVSPSRGIRQGDPLSPYIFILCSEVLSGLCNRAQET  410

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++V R  P ++HL FADD +FF +AN   A  +K  L  + S SGQ IN  KSS+
Sbjct  411   GQLTGIRVARGCPQVNHLLFADDTMFFVKANKENASALKAILQQYESASGQAINTNKSSI  470

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+   L  +  I   L IP    +GK+LGLP   GR K+D F +I++RIK + SG S+
Sbjct  471   TFSRKAPLSLKTMIKDCLHIPKEGGVGKYLGLPEHFGRKKRDLFTSIVDRIKVKSSGWSN  530

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  VM++SVL+ +P YSM    +P  +   I+  +  F W  R G  K   V W
Sbjct  531   KFLSTAGKMVMLKSVLTPVPSYSMTCFKLPRSLCKRIQSAVTRFWWDGRSGNRKMAWVSW  590

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T SK +GGLG +  +  N A+LAKL WR+  + + L + +   KY  D         
Sbjct  591   DKMTKSKQDGGLGFRDFESFNDAYLAKLGWRIHNNPSGLLSRVLTGKYCTDTPFLQVAH-  649

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
             +   S+ W+G+L    +  +   W + NG +   W D WL       E + P+ P+    
Sbjct  650   RSAESHGWRGVLIGRDLMMSNAGWALGNGESINIWSDPWL----SHSEQARPMGPAPEQF  705

Query  195   L---VANYWISNEGWDW--DMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
             +   V    + N G DW  +++ +V P      LS    + D  + D+L+W    +G ++
Sbjct  706   IHWTVKKLMLPN-GTDWNREIIQQVFPHEEARILSLKPSKTD--VADKLIWLGTTSGEYT  762

Query  30    VSSAYELALE  1
               S Y  ALE
Sbjct  763   TKSGYLKALE  772


 Score =   202 bits (515),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 161/273 (59%), Gaps = 8/273 (3%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W QRSR  W++ GDRN+ F+  AT  ++  + ++ + D  G+ +  +G + + +  
Sbjct  78    EEAYWRQRSRLLWLRLGDRNSGFFHAATKNRKRANALTVIEDGSGNPVFQEGEIAQVIVK  137

Query  1901  YFLGLFTTEVDVNRT---NFCYGCFPPLLE--EDWASVNAPFTPEDIKTALFDMVPCKAS  1737
             YF  LFTT +   R+   +       P++   E+   +  P TPE+IKTA+F +   KA 
Sbjct  138   YFETLFTT-LSGERSAIEDVVDKALKPMVSSSENEKLIRIP-TPEEIKTAVFSIHADKAP  195

Query  1736  GPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRP  1557
             GPDGF+ GFFH  W  +G  +   V  FFE   LPP  N+T + LIPK+Q+P+ +  +RP
Sbjct  196   GPDGFSAGFFHAHWEVIGADIVREVQGFFETSKLPPSINETFIRLIPKIQSPKVVADYRP  255

Query  1556  IGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-  1380
             I LCNV YK+I+K++  RL+ ++  L+  +QS+FV GR I+DN L   E+L   +  K  
Sbjct  256   IALCNVYYKIISKILTKRLQPLLPTLISENQSAFVPGRAISDNVLITHEVLYFLQNSKAE  315

Query  1379  RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             +   MA+K D+ KAYDRL W FI   L  +GF+
Sbjct  316   KRCSMAVKADMSKAYDRLEWEFIRLVLEKLGFH  348



>ref|XP_009101684.1| PREDICTED: uncharacterized protein LOC103827880 [Brassica rapa]
Length=1295

 Score =   246 bits (629),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/545 (32%), Positives = 268/545 (49%), Gaps = 18/545 (3%)
 Frame = -1

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             SGG+ LF    I+++I+ +    I   V     A   +S VYG  +++ R  ++  L   
Sbjct  52    SGGLALFWRQDIDLQIISSSKNLID-TVISYKGATVYVSFVYGEPEVSNRNIIWDSLIDL  110

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                    WL  GDFN +   SE S     +      F + +    L DL  +G S +W R
Sbjct  111   AQTRTSAWLLTGDFNEIVDNSEKSGGPERAEGSFGAFRNMLASCNLFDLQHSGISLSW-R  169

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
             G         RLDR+L N   S  FP  +  +L    SDH   LI++    ++  +  F+
Sbjct  170   GKRRTHLVYCRLDRSLVNPAWSDSFPSGRCQYLGFEASDHR-TLITVFDSAKRRRNRLFR  228

Query  2351  FNMAWTTHYSFQACVQSVWRSDLDLSTNK--SAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             F+     +   +  + + W S+ + S N   +    ALS W+R+   N  +K  +L   L
Sbjct  229   FDRRLRDNEEVKELIANTWNSNPEASVNSRLAQCRRALSTWTREQHFNSKEKINKLKQNL  288

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
             +      +M        L   L  EL      EE  W QRSR  W+  GDRN+ ++    
Sbjct  289   DE-----AMTDPQGNDDLIALLNAELMLAYKAEEEFWRQRSRIMWLSLGDRNSGYFHAVA  343

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFT------TEVDVNRTNFCYGCF  1836
               ++ ++R+S + D++G    ++  +   +  YF  +F+      TE D  R        
Sbjct  344   KGRKARNRMSVIEDSNGIAYYEEEQIASQITAYFTEMFSSLNSDATEGDT-REIVGSAIR  402

Query  1835  PPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHR  1656
             P + E   A ++A     +IKTALF + P KA GPDGF+  FFH  W TVGTSL   +  
Sbjct  403   PSVSESANARLSAIPNTAEIKTALFLIHPDKALGPDGFSASFFHSNWSTVGTSLIREIQA  462

Query  1655  FFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLV  1476
             FF  G+LP   N T + LIPK    + ++ +RPI LCNV YK+ITK++ +RLK +++ ++
Sbjct  463   FFRTGLLPTVTNVTYVRLIPKSTGAKLVSDYRPIALCNVAYKVITKILSLRLKPILQDII  522

Query  1475  GPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTL  1299
                QS+FV GR I+DN L   EIL++ +T +  +   MA+K D+ KAYDRL W FIE+ L
Sbjct  523   SETQSAFVPGRAISDNVLITHEILHSLKTSEAVIRCSMAVKTDMSKAYDRLEWRFIEEVL  582

Query  1298  RDIGF  1284
                GF
Sbjct  583   TRFGF  587


 Score =   191 bits (485),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 131/429 (31%), Positives = 211/429 (49%), Gaps = 51/429 (12%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             ++  IM CVTS     L N  +   I P +G+RQGDP+SP LF+LC E LS +   + R 
Sbjct  591   FVHLIMQCVTSVAYSFLINDSVHGKIIPSRGIRQGDPLSPYLFILCGEVLSGLCLRAQRI  650

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+  G++V   AP ++HL FADD +FF   + +  + + + +  +   SGQ IN  KSS+
Sbjct  651   GHLSGLRVAIPAPRINHLLFADDTMFFLGTDDLSCISLMEIIHKYRRSSGQMINASKSSI  710

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS  T    ++ + + LGI     +GK+LGLP   GR K+D F  I++RI+        
Sbjct  711   FFSAMTPQVIRERVKSHLGIEKEGGVGKYLGLPEHFGRRKRDLFTGIVDRIRQ-------  763

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
                              A  + S + +   SG +             S   K K   V W
Sbjct  764   ----------------QAACWCSRQLSPADSGGM-------------SPRKKRKMFWVAW  794

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  KA GGLGI+ ++  N A LAK +WR+    +CL + + + KY    S     +P
Sbjct  795   ETLTAPKALGGLGIRDIQAFNTALLAKQSWRIISKPDCLLSRVLRGKYCSKVSFLEV-EP  853

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              +++S+ W+GIL    +    +   + +G +TR W D WL   PL    + PI P++  +
Sbjct  854   LKSASHGWRGILAGRDLLATNLGKAIGDGESTRIWKDPWL--SPLL--PTRPIGPANEEH  909

Query  195   ---LVANYWI-SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLF  34
                +VA++    N  W+   +  VLP ++ + L+     + +++G  D  VW    +G++
Sbjct  910   QDLVVADFLCRGNTDWNIQRIKEVLPNYLTDILNV----KPSIMGVPDSFVWLASRSGVY  965

Query  33    SVSSAYELA  7
             +  S Y +A
Sbjct  966   TAKSGYYVA  974



>ref|XP_009130050.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1128

 Score =   237 bits (605),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/434 (35%), Positives = 234/434 (54%), Gaps = 26/434 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV +     L NG    ++ P +G+RQGDP+SP LF+LCAE LSHM++ ++  
Sbjct  361   WIQWIMACVNTVSFSVLINGSPEGYLEPGRGIRQGDPLSPYLFILCAEVLSHMMNRAMVD  420

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +  GVK++  AP ++HL FADD +FF  AN+    ++KK L  +   SGQ +NL KSS+
Sbjct  421   RSLLGVKISLQAPPVNHLLFADDSLFFSLANARACKKLKKILGDYERASGQAVNLMKSSI  480

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +   +  +   LGI +   +GK+LG+P    R K D F  I++++KA   G S 
Sbjct  481   TFGHKISDVVRTQMRNILGIHNEGGIGKYLGMPEQFTRRKSDMFTYIVDKVKAVTQGWSQ  540

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V+++S+  A+P +SM    +P  V D I R++  F WGS E K   H   W
Sbjct  541   KYLSPGGKEVLLKSIALAMPIFSMNVFRLPKEVCDEINRVLARFWWGSGENKG-MHWYDW  599

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               V+  K+ GGLG + L+  N A L K  WR+ Q+  CL   + KA+Y  D  + S+ + 
Sbjct  600   KRVSLPKSEGGLGFRDLEKFNQALLGKQVWRILQNPGCLMARILKARYFLDGDILSA-EL  658

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP----S  208
             K  +S AWK IL    + + G+++ + +G     W D W+ D      A  P  P     
Sbjct  659   KTKASYAWKSILYGRDLVKQGMRYIIGDGSLINTWTDPWIPDHT--PRAPRPRTPGLRIG  716

Query  207   SLNNLVANYWISNEGWDWD-------MLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKE  49
              +N L + Y     G+ WD       ++D  +P+ +  KLST   Q+  LLG    W+ +
Sbjct  717   KVNQLFSQY-----GYGWDEQKVRAVIVDEDIPKVLALKLSTTAKQD--LLG----WHYK  765

Query  48    PNGLFSVSSAYELA  7
              +G+++V S Y L+
Sbjct  766   DDGIYTVKSGYWLS  779


 Score =   200 bits (509),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 163/271 (60%), Gaps = 3/271 (1%)
 Frame = -1

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
             +EE+ W Q+SR +W++SGDRNT ++   T  KR ++ +S L D  G        + +   
Sbjct  88    EEEVYWQQKSRVQWLRSGDRNTTYFHAITKGKRYRNNISSLQDMAGVTHRGQRGIGRVAQ  147

Query  1904  DYFLGLFTTEV-DVNRTNFCYGCFPPLLEEDWAS-VNAPFTPEDIKTALFDMVPCKASGP  1731
             +YF  LFT+   D+   +  +  FP  + ED  + +    T E+IK A+FD+   +A GP
Sbjct  148   EYFCNLFTSSPPDLGLYDAVFEGFPIRVTEDINTDLTREVTEEEIKQAMFDIGSHRAPGP  207

Query  1730  DGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIG  1551
             DGF+  F+H+ W  + T +   V +FFE G+L    N T + LIPK+  P  +T FRPI 
Sbjct  208   DGFSAVFYHQYWDDLKTDIVREVQQFFETGVLDKQLNHTNICLIPKIYPPSGMTDFRPIA  267

Query  1550  LCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRV-  1374
             LCNV YK+I+KV++ RLK  +  L+  +Q +F+ GR ITDN +   E+ +  + +K +  
Sbjct  268   LCNVAYKVISKVLINRLKIHLHSLITENQQAFIPGRVITDNIIIAHEVFHCLKARKRQAT  327

Query  1373  GWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              +MA+K D+ KAYDRL W F+E+T+R +GF+
Sbjct  328   SYMAVKTDITKAYDRLEWGFLEETMRRMGFH  358



>ref|XP_010451822.1| PREDICTED: uncharacterized protein LOC104734004 [Camelina sativa]
Length=1120

 Score =   248 bits (632),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 237/479 (49%), Gaps = 17/479 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W  +GDFN +T   E    +    S    FN  I     ++  F G   +W RG      
Sbjct  17    WFTVGDFNELTGNHEKRGGKLRHPSSFLPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKP  75

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
                RLDRAL N +    FPD  + +LPMI SDH P++++I    +     RF F+  W  
Sbjct  76    IRCRLDRALGNEDWHDLFPDTVLEYLPMIASDHKPVVVNIGA-KRPRGKRRFMFDPRWIG  134

Query  2330  HYSFQACVQSVWRSDLDLST----NKSAMVE-ALSVWSRDSFGNIPQKKRRLLARLEGVQ  2166
                    +++ W      S+    +K  +   A+S W +D   ++P  +  +    E ++
Sbjct  135   KEGLMEAIEAGWVGGTPQSSPNFLDKIVICRRAISRWRKD---HVPFGRETI----EDLK  187

Query  2165  *SLSMGIRSDlvrlerrlrkele--ETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
               LS+    D   L           E    EE+ W+ +SR +W++ GD+N++++   T  
Sbjct  188   CQLSVAQADDATPLSVIADLNARLWEAYKDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQ  247

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++R+  L D +     +D  +      YF  LFTT    N         P +  E  
Sbjct  248   RRARNRIIGLYDKNEIWSTEDEDICNIAVSYFADLFTTLHPTNFDEVLREVHPVITAEAN  307

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
             A + A  T  +++ ALF M P KA GPDG T  F+ K W  V   L S V+ FFE+G+  
Sbjct  308   AQLTARVTESEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGDLVSLVNGFFEEGVFD  367

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
              G N T + LIPKV  P R+T+ RPI LCNV YK+I+K+M  RLK ++  L+   QS+FV
Sbjct  368   RGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLKKLLPDLISETQSAFV  427

Query  1451  HGRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              GR I+DN L  QE+ +  RT     G +MA+K D+ KAYDR+ W FI+  L  +GF+ 
Sbjct  428   PGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWEFIDKLLHKMGFDE  486


 Score =   190 bits (482),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 139/435 (32%), Positives = 207/435 (48%), Gaps = 26/435 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR IM CV+S     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  +   
Sbjct  488   WIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKAEAE  547

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +    Q   + + L  + + SGQ+IN  KSS+
Sbjct  548   KLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSI  607

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       T+  I   LGI +   MG +LGLP   G  K   F  + ER++ R +G S+
Sbjct  608   QFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFSFVRERLQGRTTGWSA  667

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  VM++S+ +A+P + M    +P  +   +   +  F W S       H + W
Sbjct  668   RLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSDGRTGGMHWLAW  727

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY--DFDPSVWSSW  382
               +  SK  GGLG +++   N A LAK  WRL +  + L+  + K +Y  + DP      
Sbjct  728   EKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSDP-----M  782

Query  381   QPKR--NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAP  211
             +P R  + S  W+ I+ A  + + G+   V +G +   W D W+    P    +  P   
Sbjct  783   EPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPFKD  842

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEH-------ILNKLSTFVLQEDTLLGDRLVWYK  52
              SL     ++ I +    W M   VL +H       ++  L      +D  LG    W+ 
Sbjct  843   PSLK---ISHLIDSRTRSWRM--DVLSDHFDPGDVALIGALPLGSCPKDDTLG----WHF  893

Query  51    EPNGLFSVSSAYELA  7
               NG ++V S Y +A
Sbjct  894   TKNGRYTVKSGYHVA  908



>ref|XP_010430691.1| PREDICTED: uncharacterized protein LOC104714925 [Camelina sativa]
Length=1239

 Score =   246 bits (627),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/479 (34%), Positives = 239/479 (50%), Gaps = 17/479 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W  +GDFN +T   E    +    S    FN  I     +D  + G   +W RG      
Sbjct  17    WFTVGDFNELTGNHEKRGGKLRHPSSFLAFNGMIQDCGFLDFPYLGDCLSW-RGWRDKKP  75

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
               +RLDRAL N +    FPD  + +LPMI SDH P++++I    +     RF F+  W  
Sbjct  76    IRSRLDRALGNEDWHELFPDTVLEYLPMIASDHKPIVVNIGA-KRPRGKRRFTFDPRWIG  134

Query  2330  HYSFQACVQSVW-RSDLDLSTNKSAMV----EALSVWSRDS--FGNIPQKKRRLLARLEG  2172
                    +++ W      +S N    +     A+S W ++   FG      R  +  L+ 
Sbjct  135   KDGLMEAIEAGWVGGSPQISPNFMDKIVNCRRAISQWRKNQVPFG------RDTIEDLKS  188

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
              Q S++    +  + +   L   L E    EE+ W+ +SR +W++ GD+N+R++   T  
Sbjct  189   -QLSVAQADDATPLSVITDLNARLWEAYKDEEVYWYLKSRNKWMQMGDQNSRYFHALTKQ  247

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++R++ L D +     +D  +      YF  LFTT    N         P +  E  
Sbjct  248   RRARNRITCLFDKNEIWSTEDVDICNIAVSYFADLFTTLHPTNFDEVLGEVRPVITAEAN  307

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
             A + AP T  +++ ALF M P KA GPDG T  F+ K W  V   L S V+ FFE+G+  
Sbjct  308   AQLTAPVTELEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGDLVSLVNGFFEEGVFD  367

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
              G N T + LIPKV  P R+T+ RPI LCNV YK+I+K+M  RLK  +  L+   QS+FV
Sbjct  368   RGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLKKFLPDLISETQSAFV  427

Query  1451  HGRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              GR I+DN L  QE+ +  RT     G +M +K D+ KAYDR+ W FIE  L  +GF+ 
Sbjct  428   PGRLISDNILIAQEMFHGLRTNPSCKGKFMTIKTDMSKAYDRVEWVFIEKLLYKMGFDE  486


 Score =   191 bits (486),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 207/432 (48%), Gaps = 20/432 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR IM CV+S     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  +   
Sbjct  488   WIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKAEVD  547

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +    Q   + K L  + + SGQ+IN  KSS+
Sbjct  548   KLITGIKVANQCPPITHLLFADDSLFFCKVAKDQCEVILKILRNYEAVSGQQINFAKSSV  607

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       T+  I   LGI +   MG +LGLP   G  K   F  + ER++ R +G S+
Sbjct  608   QFGHKVAEQTKMEIQGILGITTQGGMGSYLGLPESLGGSKTKVFSFVRERLQGRTTGWSA  667

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  VMV+S+ +A+P + M    +P  +   +   +  F W S       H + W
Sbjct  668   KLLSKGGKEVMVKSIATAVPTFVMSCFRLPKTITSKLTSAVANFWWSSDGRTGGMHWLAW  727

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  +K  GGLG +++   N A LAK  WRL +  + L+  +FK +Y  +    +  +P
Sbjct  728   DKLCCTKQMGGLGFRNVDDFNSALLAKQLWRLIEFPDSLFARVFKGRYYRNS---NPMEP  784

Query  375   KR--NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
              R  + S  W+ I+ A  + + G+   V +G +   W D W+L +  F   +    P   
Sbjct  785   IRSYSPSYGWRSIVSACSLVQKGLIIRVGSGESISIWTDPWILAQ--FPRPAISKGPFKD  842

Query  201   NNLVANYWISNEGWDWDMLDRVLPEH-------ILNKLSTFVLQEDTLLGDRLVWYKEPN  43
              +L  ++ I      W M   VL EH       ++  L      +D  LG    W+   N
Sbjct  843   PSLKISHLIDCRTRLWRM--DVLSEHFDPVDVELIGALPLGSCPKDDTLG----WHFTKN  896

Query  42    GLFSVSSAYELA  7
             G ++V S Y  A
Sbjct  897   GRYTVKSGYHAA  908



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   239 bits (611),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/546 (33%), Positives = 271/546 (50%), Gaps = 13/546 (2%)
 Frame = -1

Query  2897  GYSGGI-WLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFAD  2724
             G SGG+ + +  +++      TH  FIA  ++DN + P W    +YG  D   +   +  
Sbjct  26    GRSGGMGFWWRDINVVPSTFSTH-HFIA-DIFDNNNVPVWRAVGIYGWPDREHKYKTWEM  83

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             +       +   +  GDFN +  Q+E              F   +    L DLG+ G  +
Sbjct  84    MGRIKAMSREPCIMFGDFNEILRQAEKEGGAPRGEWEMDAFRRAVDDCHLCDLGYKGCQF  143

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW RG +  +    RLDR L++ +    FP   V H+    SDH+P+L+S T  P     
Sbjct  144   TWKRGNNPSTLVRERLDRFLADGQWCDMFPKVTVCHMAQYRSDHAPILLS-TWSPHDRGR  202

Query  2363  SR--FKFNMAWTTHYSFQACVQSVWR--SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
             ++  F+F   W +       V+  W   +  ++        E LS W+  SFGNI +K +
Sbjct  203   NKKLFRFEALWLSKPECANVVEQAWTNCTGENVVERVGNCAERLSQWAAVSFGNIKKKIK  262

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
                 +L   Q   +    + +++L   L KEL+E   QEE  WF R+R   ++ GD+NT 
Sbjct  263   DTEEKLRLNQ---TRYPDAAMLQLCSELSKELDELHQQEESYWFARARANDLRDGDKNTT  319

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             ++    + +R+ + +  L D +      +  L + V  YF  LF+TE   N      G  
Sbjct  320   YFHRKASQRRHYNSIDGLFDENNRWRDKEEDLEELVSSYFDNLFSTEGPTNIEQALEGLE  379

Query  1835  PPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHR  1656
               + E+    +N   T E+IK ALF M P KA GPDG    FF K W  VG  +  FV  
Sbjct  380   TRITEDMNKMLNTEPTDEEIKGALFQMHPNKAPGPDGMHALFFQKFWHIVGKDIILFVKN  439

Query  1655  FFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLV  1476
             ++   +     N T + LIPK  NP+R+T+FRPI  CNV+YK+I+K M  +LK ++  L+
Sbjct  440   WWRALVGLEEVNKTCVVLIPKCANPKRMTEFRPISCCNVLYKIISKTMANKLKPLLGDLI  499

Query  1475  GPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
               +QS+FV  R ITDN L   EI +A + K +GR G  ALK+D++KAYDR+ W F+E  L
Sbjct  500   SENQSAFVPKRLITDNALIALEIFHAMKRKGEGRDGSFALKLDMKKAYDRVEWSFLEKVL  559

Query  1298  RDIGFN  1281
               +GF+
Sbjct  560   YKLGFS  565


 Score =   197 bits (502),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 118/340 (35%), Positives = 184/340 (54%), Gaps = 1/340 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM C+ S       N +++  + P +GLRQGDPISP LF++ A+  S ++  + + 
Sbjct  568   WVTKIMYCLASVSFTFKINRKVSGSVIPSRGLRQGDPISPYLFLIVADAFSALLTKAAQE  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K+   AP +SHLFFADD + F +A   Q   + + +  +   SGQ +NL K+ +
Sbjct  628   KRIHGAKICNGAPRISHLFFADDSILFAKATVRQCSVITEIISQYERASGQSVNLDKTDV  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK  +   +Q I ATLG+  V+   K+LGLP+I GR KK  F ++ ERI  ++ G   
Sbjct  688   VFSKCVDANRRQEIVATLGVKEVVQHAKYLGLPTIIGRSKKVIFASLKERIWKKIQGWKE  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             ++LS  G  V++++V+ AI  Y M    IP G+I+ I  L+  F WGS + + K H   W
Sbjct  748   KSLSRPGKEVLLKAVVQAILTYMMSVFKIPEGLINEIHTLMARFWWGSTDTQRKMHWSSW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   KA GG+G  +L   N A LAK  WRL  +   L   L KA+Y     V ++ + 
Sbjct  808   AELCKPKAMGGMGFCNLHVFNQALLAKKIWRLHTNPTSLLHKLLKARYFKHDEVLNA-RR  866

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL  256
               + S +W+ +  A  +   G++W V +G     W ++W+
Sbjct  867   GFDPSYSWRSLWGAKSLLLEGLQWRVGDGVNISAWENAWV  906



>ref|XP_010506884.1| PREDICTED: uncharacterized protein LOC104783422 [Camelina sativa]
Length=1248

 Score =   248 bits (632),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/479 (33%), Positives = 235/479 (49%), Gaps = 17/479 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W  +GDFN +T   E    +    S    FN  I     ++  F G   +W RG      
Sbjct  17    WFTVGDFNELTGNHEKRGGKLRHPSSFLPFNGMIQDCGFLEFPFLGDCLSW-RGWRDKKP  75

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
                RLDRAL N +    FPD  + +LPMI SDH P++++I    +     RF F+  W  
Sbjct  76    IRCRLDRALGNEDWHDLFPDTVLEYLPMIASDHKPVVVNIGA-KRPRGKRRFMFDPRWIG  134

Query  2330  HYSFQACVQSVW-----RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ  2166
                    +++ W     +S  +          A+S W +D   ++P  +  +    E ++
Sbjct  135   KEGLMEAIEAGWVGGTPQSSPNFLDKIVICRRAISRWRKD---HVPFGRETI----EDLK  187

Query  2165  *SLSMGIRSDlvrlerrlrkele--ETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
               LS+    D   L           E    EE+ W+ +SR +W++ GD+N++++   T  
Sbjct  188   CQLSVAQADDATPLSVIADLNARLWEAYKDEEVYWYLKSRNKWMQMGDQNSKYFHALTKQ  247

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++R+  L D +     +D  +      YF  LFTT    N         P +  E  
Sbjct  248   RRARNRIIGLYDKNEIWSTEDEDICNIAVSYFADLFTTLHPTNFDEVLREVHPVITAEAN  307

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
             A + A  T  +++ ALF M P KA GPDG T  F+ K W  V   L S V+ FFE+G+  
Sbjct  308   AQLTARVTESEVRAALFMMHPDKAPGPDGMTALFYQKAWQIVKGDLVSLVNGFFEEGVFD  367

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
              G N T + LIPKV  P R+T+ RPI LCNV YK+I+K+M  RLK ++  L+   QS+FV
Sbjct  368   RGLNTTHICLIPKVAKPTRMTELRPISLCNVGYKIISKIMCQRLKKLLPDLISETQSAFV  427

Query  1451  HGRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              GR I+DN L  QE+ +  RT     G +MA+K D+ KAYDR+ W FI+  L  +GF+ 
Sbjct  428   PGRLISDNILIAQEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWEFIDKLLHKMGFDE  486


 Score =   189 bits (480),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 139/435 (32%), Positives = 207/435 (48%), Gaps = 26/435 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR IM CV+S     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  +   
Sbjct  488   WIRWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIRKAEAE  547

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +    Q   + + L  + + SGQ+IN  KSS+
Sbjct  548   KLITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSI  607

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       T+  I   LGI +   MG +LGLP   G  K   F  + ER++ R +G S+
Sbjct  608   QFGHTVAEQTKLEIQGVLGITAQGGMGSYLGLPESLGGSKTKVFSFVRERLQGRTTGWSA  667

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  VM++S+ +A+P + M    +P  +   +   +  F W S       H + W
Sbjct  668   RLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSDGRTGGMHWLAW  727

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY--DFDPSVWSSW  382
               +  SK  GGLG +++   N A LAK  WRL +  + L+  + K +Y  + DP      
Sbjct  728   EKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSDP-----M  782

Query  381   QPKR--NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAP  211
             +P R  + S  W+ I+ A  + + G+   V +G +   W D W+    P    +  P   
Sbjct  783   EPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPFKD  842

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEH-------ILNKLSTFVLQEDTLLGDRLVWYK  52
              SL     ++ I +    W M   VL +H       ++  L      +D  LG    W+ 
Sbjct  843   PSLK---ISHLIDSRTRSWRM--DVLSDHFDPGDVALIGALPLGSCPKDDTLG----WHF  893

Query  51    EPNGLFSVSSAYELA  7
               NG ++V S Y +A
Sbjct  894   TKNGRYTVKSGYHVA  908



>gb|EPS72636.1| hypothetical protein M569_02121, partial [Genlisea aurea]
Length=1503

 Score =   228 bits (581),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/558 (30%), Positives = 269/558 (48%), Gaps = 26/558 (5%)
 Frame = -1

Query  2897  GYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHLFADL  2721
             G SGG+ L    SI ++I       I   +     +P W ++  YG    A R   ++ L
Sbjct  388   GKSGGLALLWLGSIIVDIKSFSTNHIDAVISPQDGSPKWRLTGFYGNPLQASRSDSWSLL  447

Query  2720  S*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
             +         WL +GDFN V  Q E  +    S S    F + +   +L DLGF G  +T
Sbjct  448   TRLHHQFSLPWLVVGDFNEVLWQDEHLSSCLRSCSSMGLFRNALEECDLSDLGFQGYPFT  507

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI---SITTCPQQF  2370
             W      PS   ARLDR ++N       P   V+HL   GSDH P+L+    +  C    
Sbjct  508   WTNNRTHPSTVKARLDRFVANTSWINIVPHFSVSHLKFGGSDHCPILLMFKDVVGCHTTL  567

Query  2369  CSSRF-KFNMAWTTHYSFQACV-------QSVWRSDLDLSTNKSAMVEALSVWSRDSFGN  2214
                RF KF   W  + + +  +       +S W   L L        + L  W R S G+
Sbjct  568   RRKRFFKFEKIWCENETCRVIIDGCWAVPRSSWCPQLSLLRRLQNCRQKLQCWHRTSIGS  627

Query  2213  IPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIK  2037
             +  +   +  RL     +L  G+ SD V  + R  K     L + +E+ W QRS+  W++
Sbjct  628   LRHRISSIQDRLS----TLMEGVISDSVGDQIRDLKAQLSQLLKLDEIWWKQRSKVHWLR  683

Query  2036  SGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY-----DYFLGLFTTEV  1872
              GD+N +F+    + ++ ++++ +L  +  ++  ++   + H +     D F   + +E 
Sbjct  684   EGDKNNKFFHGVASSRQRRNKIERL-KSRNNIWLENTSDIHHEFISVYEDLFKSTYPSED  742

Query  1871  DVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWP  1692
              +N  N        + +E    +   FT E+I TA+  M    A GPDGF P F+ K WP
Sbjct  743   AIN--NIVRTAPRMVTDEMNRKLTQAFTSEEILTAVMQMNADSAPGPDGFPPLFYQKFWP  800

Query  1691  TVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVM  1512
             T+G+ + + V  F  +       N T +  IPKV +P  +  +RPI LCNV+YK+ +K +
Sbjct  801   TIGSEVCNSVLDFLNNRKCFRKFNHTNIVFIPKVSDPVEVAHYRPISLCNVIYKMASKCI  860

Query  1511  MIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAY  1335
               RLK+ V +++ P QS+FV  R ITDN L   E+ ++ R  ++G+  +++LK+D+ KAY
Sbjct  861   TNRLKEFVSEIISPWQSAFVPDRLITDNILVAFEVNHSIRNLRRGKKSFVSLKLDMNKAY  920

Query  1334  DRLSWCFIEDTLRDIGFN  1281
             DR+ W F++  L  +GF+
Sbjct  921   DRVEWSFLKAMLIQLGFH  938


 Score =   208 bits (530),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 222/425 (52%), Gaps = 16/425 (4%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+  V+S     + NG     I+P++GLRQGDP+SP LF+ CAE LS  + ++ +S +  
Sbjct  945   ILLAVSSVSYSLVINGDRVGLINPQRGLRQGDPLSPYLFLFCAEGLSSALRAAEQSQSIT  1004

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G +VTR  P++SHLFFADD + F EA+      +   L  +   SGQK+N  KS++ FS 
Sbjct  1005  GFRVTRRGPSISHLFFADDAMIFCEASCAALSRVSDILQDYERASGQKVNTHKSAMVFSP  1064

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             NT    ++  +  LG         +LGLPS+ G  KK  F  +LER+  ++ G +S+ LS
Sbjct  1065  NTPDSEKEIWSRGLGFLVKSHHDIYLGLPSLTGSSKKRLFSGLLERVNRKIEGWNSKFLS  1124

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG  V++++VL AIP Y+M    +P   +  ++  I  + W +R GK   H   W  ++
Sbjct  1125  QAGKLVLIKAVLQAIPAYTMSCFALPKSFLGDLQSAISRYWWRNRNGKG-IHWKSWDFIS  1183

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
              S   GGLG + L   NLA L K  WR++   + + + +F+AKY  +  +W++ +P    
Sbjct  1184  RSFKEGGLGFRDLHDFNLALLGKQVWRIASAPHSILSRVFRAKYFPNGDIWTA-RPCARG  1242

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  W GI+++  +   GI+  + +G +   W D W+   P F+  +  +        VA 
Sbjct  1243  SYVWNGIMKSRDLVSKGIRHLIGDGSSVDIWHDPWIPKPPTFKPTN--LLGERRRASVAT  1300

Query  183   YWISNEGWDWDM------LDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
                S   W WD+       D V   HI++     +   ++   D+++W+   +G ++V S
Sbjct  1301  LIDSRTKW-WDVGRIREKFDPVDANHIIS-----IPLSESPSEDKILWHYSKSGTYTVRS  1354

Query  21    AYELA  7
             AY L 
Sbjct  1355  AYHLV  1359



>ref|XP_009103791.1| PREDICTED: uncharacterized protein LOC103829852 [Brassica rapa]
Length=1374

 Score =   252 bits (643),  Expect(2) = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/608 (29%), Positives = 284/608 (47%), Gaps = 24/608 (4%)
 Frame = -1

Query  3068  WNCQGAAS------PSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRV  2907
             WNC+G         P  +   K +L    P ++ L E K  + +  ++   LG+D    V
Sbjct  6     WNCRGLGRSQDLMIPHLKEIRKKYL----PEIVFLMETKQQKDKVLDLQVWLGYDRVFTV  61

Query  2906  EAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFA  2727
             E  G SGG+ L  S  +N+ I Y     I  +V       + MS VYG    + +  ++ 
Sbjct  62    EPEGLSGGLALMWSNKVNMCIHYADKNLIDVEVTFG-GVRFFMSFVYGVPGHSGKEIVWE  120

Query  2726  DLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSS  2547
              L  Y  +    W  +GDFN +    E     + S      F D + +  + +L   G S
Sbjct  121   RLMRYGVSRNAGWSWVGDFNEILHNGEKIGGPSRSDGSFDSFRDCVSVCGMTELSGWGDS  180

Query  2546  YTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFC  2367
             +TW  G+    +  ++LDR   N E    FP A    L  +GSDH P+L+ +    Q   
Sbjct  181   FTW-SGVRCKKYIQSKLDRCFGNTEWKRNFPLATQVFLERLGSDHKPVLVRLFG-HQSGP  238

Query  2366  SSRFKFNMAWTTHYSFQACVQSVWR-----SDLDLSTNKSAMVEALSVWSRDSFGNIPQK  2202
                FKF+         + C+   W+         LS     +  +L  W R+   N    
Sbjct  239   RGSFKFDKRMVGKQKVRECIMEAWKRQNGNDQRSLSERFGCVRRSLGRWKRECSNN---S  295

Query  2201  KRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRN  2022
             K RL      ++   S G+        + L+ E+ +    EE  W Q+SR++W+ +GD N
Sbjct  296   KERLCGLRYDLEAEYSSGV--PDWGKIKFLKLEISQAFRDEEEFWRQKSRDKWLVAGDNN  353

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYG  1842
             T F+  +    R ++++SKL+D  G    +   + +   +YF  LF++    + ++   G
Sbjct  354   TSFFHASVKDTRLRNQISKLIDDSGQEATNTEAMGQVAVEYFTSLFSSGAGGDPSDIFDG  413

Query  1841  CFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
                 +  E   ++    +  +I+ A+F +    A G DG    FF K W  +G  +   +
Sbjct  414   FPARVTAEMNRTLLREVSDAEIRDAVFGIKSSSAPGWDGLNGLFFQKYWDIIGLDIGKEI  473

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               FF DG  P   N T L LIPKV NPER+   RPI LC ++YK+I+++++ RLK M+  
Sbjct  474   KTFFSDGSFPRDWNVTQLCLIPKVINPERMVDLRPISLCTIMYKIISRILVSRLKPMLET  533

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIED  1305
             +V P QS+FV  R I+DN +   E+++  RT +     ++A+K D+ KAYDR+ W ++E+
Sbjct  534   VVSPTQSAFVPERLISDNIIIAHEVVHGLRTHQAISSEFIAIKTDMSKAYDRIEWRYLEN  593

Query  1304  TLRDIGFN  1281
              L  +GF+
Sbjct  594   LLTALGFD  601


 Score =   183 bits (465),  Expect(2) = 8e-112, Method: Compositional matrix adjust.
 Identities = 131/429 (31%), Positives = 204/429 (48%), Gaps = 23/429 (5%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CVTS     L NG+    I+P++GLRQGDP+SP LF LC E LS++++ +   G  +
Sbjct  608   IMFCVTSVTYSVLINGEEKGNINPKRGLRQGDPLSPFLFDLCTEGLSYLLNKAESMGEIE  667

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+K +   P + HLFFADD     +A+  Q  +++  L ++   SGQ I+L KSS+ F  
Sbjct  668   GIKFSAEGPVIHHLFFADDSFLMVKASDEQCTKLRSILKVYEENSGQMISLTKSSITFGA  727

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
                   +  I   LGI +    GK+LGLP      K +    I E++K+R  G   R LS
Sbjct  728   KIAPSRKVKIKEILGIEAEGGTGKYLGLPECFSGSKVEMLQYIQEKMKSRFHGWYGRFLS  787

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
               G  +++++V  A+P ++M    +P     ++   +  F W  +EGK+K H + W  + 
Sbjct  788   AGGKDILLKTVAMAMPVFAMSVFKLPKTTCKNLTSAMSKFWWDVQEGKSKIHWISWEKLC  847

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K  GG+G + ++  N A LAK  WRL  D   L     +++Y  +     +    R  
Sbjct  848   LGKNQGGMGFRDIEKFNQALLAKQGWRLLMDSESLCARFLRSRYYPNGKFMEASLGAR-P  906

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL--------LDRPLFEEASAPIAPS  208
             S AW+ IL    +   G++  + +G  T  W D WL        L +P+F E    +  S
Sbjct  907   SYAWRSILFGRQLLEKGLRRTIGSGEDTSVWWDKWLFSESPMAPLRKPIFFEVDLRV--S  964

Query  207   SLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLF  34
              L N     W   +     + D   P  +       +L++  + G  D   W     G +
Sbjct  965   ELINPQTKSWDRGK-----LEDNFFPPDVER-----ILKQRPVWGEKDSYEWVHTHWGGY  1014

Query  33    SVSSAYELA  7
             +V S Y LA
Sbjct  1015  TVKSGYWLA  1023



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score =   226 bits (576),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 230/480 (48%), Gaps = 16/480 (3%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W  +GDFN ++   E         S    FN  I    +++    G   +W         
Sbjct  31    WFMIGDFNELSGNHEKRGGALRPASSFVPFNSMIRHCGMLEFPCYGEHLSWRGNRCNNQV  90

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFC--SSRFKFNMAW  2337
                RLDRAL N +    FP++KV +L MIGSDH P+L    TC +     + +F+F+  W
Sbjct  91    VRCRLDRALGNEDWQGFFPNSKVDYLDMIGSDHCPIL---ATCLKTHIKRNRQFRFDKCW  147

Query  2336  TTHYSFQACVQSVWRSDLDLSTNK-----SAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
                      V+S W   ++               ++S W +++  + P    RL++ L+ 
Sbjct  148   LGKDGLSGAVESGWNRTINFRPTGFVDKIKNCRNSISWWRKNNIFSGP----RLISSLKA  203

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
                   M   S      R + ++L+E    EEL W Q+SR+ W++ GD+NT+F+Q +T  
Sbjct  204   ALQEAKMD-DSISQEEIRGIERKLKEAYRDEELYWQQKSRKFWLRVGDKNTKFFQASTKQ  262

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +R ++R+  L D D         +      YF  LF        +       P + +   
Sbjct  263   RRVRNRIIGLFDTDNVWNESASGMENIATKYFEDLFRNSDAQGVSEMLQEVTPLISDTMN  322

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
               +    +  +++ ALF M P K  GPDG T  FF + W ++   L + V  FF  G   
Sbjct  323   RDLIRDISEAEVRKALFAMHPEKTPGPDGMTALFFQRFWSSLKGDLVALVREFFRSGRFD  382

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
             P  N+T + LIPKV  P+R+ +FRPI LCNV YK+I+K++  RLK  +  LV   QS+FV
Sbjct  383   PCLNETNICLIPKVDRPQRMAEFRPISLCNVSYKIISKILCFRLKRFLPSLVSETQSAFV  442

Query  1451  HGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
              GR ITDN L  QE+ +   T  + +  ++A K D+ KAYDR+ W F+E  +  +GF+  
Sbjct  443   SGRLITDNILVAQEMFHGLNTNNRCKSEFLAFKTDMSKAYDRVEWAFLEAVMVKLGFDRN  502


 Score =   208 bits (530),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 218/431 (51%), Gaps = 14/431 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CV+S     L NGQ   +I P++GLRQGDP+SP LF+LC E L   +  + R 
Sbjct  503   WISWIMWCVSSVSYQVLLNGQPRGFIKPQRGLRQGDPLSPYLFILCTEVLIANIKKAERE  562

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+ + R +P +SHL FADD +FF +A + +   + + +  +   SGQ++NL+KSS+
Sbjct  563   KKVTGITIARDSPTISHLLFADDSLFFCKAEATECQTVMEIIRNYGKASGQEVNLEKSSI  622

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K      +  + + +GI     MG +LG+P      K   F  + +R+  R++G ++
Sbjct  623   MFGKKVPTEIRDQLKSVIGITKEGGMGSYLGIPESLQGSKNKVFGYVKDRLDDRVNGWNA  682

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  +M++SV  A+P + M    +P  +   +   I  F W S +  +  H V W
Sbjct  683   KLLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAISTFWWKSNDKAHGLHWVAW  742

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K +GGLG ++L+  N A LAK  WRL Q    L   + K +Y  +     + +P
Sbjct  743   DKLCKDKCDGGLGFRALEQFNDAMLAKQYWRLIQHPTSLMARVLKGRYFSNKHPLMAKKP  802

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAPSSLN  199
               N S AW+ I     +   G +W V +G +   W D W+ D RP        +    L 
Sbjct  803   S-NPSFAWRSIFSTKDLVEYGARWAVGSGSSISVWRDPWIPDIRPRPANGRGRLW---LP  858

Query  198   NLVANYWISNEGWDWDM--LDRVLPE---HILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
             +L+ N+ I+    DW +  L+  L      I+ ++S   +Q+     DRLVW+   +G +
Sbjct  859   SLMVNHLINPVTKDWHLPTLEEFLDPGDIPIIRRMSVSKVQQR----DRLVWHFTKSGKY  914

Query  33    SVSSAYELALE  1
             +V S Y LA E
Sbjct  915   TVKSGYRLARE  925



>gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1656

 Score =   256 bits (653),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/593 (29%), Positives = 281/593 (47%), Gaps = 17/593 (3%)
 Frame = -1

Query  3032  RTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSIN  2853
             +TL+   + H P ++ L E +       E   +L F +   V+ +    G+ LF   ++ 
Sbjct  622   KTLRRICKKHNPEILFLMETRQQEGIIKEWKRNLKFTDHHVVDPIATGRGLALFWGDAVQ  681

Query  2852  IEILYTHPQFIAFQVYDNVSAPWLMSV--VYGCLDMALRRHLFADLS*YFFNPQGTWLAM  2679
             + IL + P ++   V   +S  ++  +  +YG      +R  +  +   F      WL +
Sbjct  682   VSILDSSPNYVD-TVVSFLSDAFVCKITWMYGNPHDNEKRAFWRLMYSRFPVQSLPWLVL  740

Query  2678  GDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGAR  2499
             GDFN V   SE          R   F D++    L DL F G  ++W        F   R
Sbjct  741   GDFNEVLDPSEKWGGGPPLPWRIKLFRDFLNNGHLRDLHFKGPGFSWFAMRHGRVFIKER  800

Query  2498  LDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYS  2322
             LDRAL N+  S   P+ ++ HLP IGSDH PLL+   + P+    +R F+F   WTTH  
Sbjct  801   LDRALGNIAWSSSQPNTQILHLPKIGSDHRPLLLD--SNPKMLNKTRLFRFEQMWTTHEE  858

Query  2321  FQACVQSVWRSDLDLSTNKS------AMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*S  2160
             +   +Q  W      S  +S      +  +AL +WS++ F N   +   LL+ +E     
Sbjct  859   YSDVIQRSWPPAFGGSAMRSWNRNLLSCGKALKMWSKEKFSNPSVQVADLLSDIE----K  914

Query  2159  LSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQ  1980
             L      D       L  ++ +   Q+E+ W QRSR  W+K GD+N+ F+   T  +R  
Sbjct  915   LHQSNPPDAHHQINILTDQVTKLWTQDEMYWHQRSRVNWLKLGDQNSSFFHQTTIQRRQY  974

Query  1979  SRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVN  1800
             +++ +L D  G+ +  +  +     DYF  L+ +                +  E    ++
Sbjct  975   NKIVRLKDDHGNWLDSEADVALQFLDYFTALYQSNGPQQWEEVLDFVDTAVTAEMNKILS  1034

Query  1799  APFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCN  1620
             +P +  ++K A+FD+   KA GPDGF+  F+   W  V + +     +      L    N
Sbjct  1035  SPVSLLEVKKAVFDLGATKAPGPDGFSGIFYQNQWEWVQSIIHESALQHQTSSSLLQVMN  1094

Query  1619  DTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQ  1440
              T L+LIPKV+ P   + +RPI LCN  YK++TK++  RL+  + +L+  +QS+FV  RQ
Sbjct  1095  RTHLALIPKVKAPTHPSHYRPIALCNFSYKILTKIIASRLQPFMSELISDNQSAFVSNRQ  1154

Query  1439  ITDNTLAYQEILNAFR-TKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             I DN +   EI +  + T+    G   LK+D+ KAYDR+ W F+E  LR +GF
Sbjct  1155  IQDNVIIAHEIYHHLKLTRSCNNGAFGLKLDMNKAYDRVEWNFLEAVLRKMGF  1207


 Score =   178 bits (452),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 134/428 (31%), Positives = 207/428 (48%), Gaps = 17/428 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CVT+  L  L NG+      P +GLRQGDP+SP LF+   + LS M++   + 
Sbjct  1211  WIGLVMSCVTTSSLSVLINGKPGPSFLPSRGLRQGDPLSPFLFLFVNDVLSRMINKMCQD  1270

Query  1095  GNWKGVKVTRIAPN---MSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQK  925
                  V    I PN   +SHLFFADD +FF  A       +   L  +C  SGQ IN++K
Sbjct  1271  SLLTPVT---IGPNNLPVSHLFFADDSLFFLRATLQNCETLSDLLHTYCIASGQLINVEK  1327

Query  924   SSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg  745
             SS+FFS NT       +++ + IP V D G +LGLP+   R KK +   I + I  ++ G
Sbjct  1328  SSIFFSPNTPPEIAHLLSSIMQIPVVSDPGTYLGLPTFWHRSKKKALGFIKDSILRKVKG  1387

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL  565
                 TLS AG  V++++V +AIP Y M     PS +   +  ++  F WG+ + +   H 
Sbjct  1388  WKQATLSQAGKEVLIKAVATAIPAYPMGCFKFPSTLCKELNGILADFWWGNVDTRG-IHW  1446

Query  564   VKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS  385
               W  +   K +GG+G ++L+  N + LAK AWRL Q+   LW  + +  Y +  S +  
Sbjct  1447  KSWDFLARPKKDGGMGFRNLEDFNNSLLAKQAWRLHQNPFALWARVLEQLY-YPRSSFLE  1505

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSS  205
                  N S  W  +L   +       W++ NG +     D+W+   P    ++  +  + 
Sbjct  1506  APKGPNPSWIWNSLLIGRNFIHKEALWNIGNGFSVNIVGDNWI---PSIPPSTVSLPLNE  1562

Query  204   LNNLVANY--WISNEGWDWDML-DRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
              N+ V     W   + W+ D   + + P   L  L + +        D L+W    +G++
Sbjct  1563  DNSRVCELINW-DTKSWELDHFAETITPTQRL--LISAIPITSLAAPDTLIWPYTKDGVY  1619

Query  33    SVSSAYEL  10
             SV S Y L
Sbjct  1620  SVKSGYHL  1627



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   226 bits (575),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/479 (32%), Positives = 233/479 (49%), Gaps = 23/479 (5%)
 Frame = -1

Query  2678  GDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFK-GA  2502
             GDFN +    E              F + I    L DL   G  YTW RG D+P  +   
Sbjct  326   GDFNEILSYDEKQGGADRERRAMRGFREVIDTCGLRDLRAVGQWYTWERG-DSPETRIRE  384

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHY  2325
             RLDR L +      FP+A V HL    SDH+ +++       + C  R FKF   W    
Sbjct  385   RLDRFLVSQTWLQLFPEAVVEHLVRYKSDHAAIVLKTQAPKMKQCHMRQFKFETKWLLEE  444

Query  2324  SFQACVQSVWRSDLD--LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSM  2151
               +A V+  W   +   + +    +   L  WS+   G++ +K  R+  +L   Q     
Sbjct  445   GCEATVREAWDGSVGDPIQSRLGVVARGLVGWSKAGSGDLAKKIDRVEKQLHNAQ---KE  501

Query  2150  GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRV  1971
              I     +    L KEL+    + E  W+ RSR   IK GDRNT ++    + ++ ++R+
Sbjct  502   EISETTCKKCGELEKELDSLNAKLEAHWYMRSRVAEIKDGDRNTSYFHHKASQRKKRNRI  561

Query  1970  SKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNA--  1797
               L D  G    ++  L + V  YF  +FT+      ++   G    +L+    SV    
Sbjct  562   KGLFDEHGEWREEEEELERLVQKYFREIFTS------SDPSTGAMDEVLQFVKKSVTTEF  615

Query  1796  ------PFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
                   P++ E+I  AL  M PCKA GPDG    F+ + W  +G  +F FV         
Sbjct  616   NDILLKPYSKEEIHEALKQMHPCKAPGPDGLHAIFYQRFWHIIGDEVFHFVSNILHSYCC  675

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
             P   N T ++LIPKV+NP  +++FRPI LCNV+YK+ +K +++RLK  +  +V  +QS+F
Sbjct  676   PSSVNCTNIALIPKVKNPTLVSEFRPISLCNVLYKIASKALVLRLKQFLPDIVTENQSAF  735

Query  1454  VHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             V GR ITDN+L   EI ++ + +   R G +A+K+D+ KAYDR+ W F+   L  +GF+
Sbjct  736   VPGRLITDNSLIALEIFHSMKKRNNSRKGLIAMKLDMSKAYDRVEWGFLRKLLLTMGFD  794


 Score =   208 bits (529),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 134/421 (32%), Positives = 218/421 (52%), Gaps = 6/421 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M C++S     L NG+    ++P +GLRQGDP+SP LF+L A+  S M+   V S
Sbjct  797   WVNLVMSCISSVSYSFLINGRAGGSVTPSRGLRQGDPLSPFLFILVADAFSQMIQQKVLS  856

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K +R  P +SHL FADD + F  A   + L++   L+ + + SGQKIN +KS +
Sbjct  857   KELHGAKASRSGPEISHLLFADDSLLFTRATRQECLKIVDILNKYEAASGQKINYEKSEV  916

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK  N   +++++  L +  V    K+LG+P++ GR KK  F ++L+R+  +L G   
Sbjct  917   SFSKGVNCVQRESLSGILQMRQVDRHQKYLGIPTLWGRSKKGMFRDLLDRVWKKLRGWKE  976

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ ++P Y M     P  +I  I   +  F WG +  + K H V W
Sbjct  977   KLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQEIHSAMARFWWGGKGMERKMHWVSW  1036

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++  K  GG+G K L   N A L +  WRL    N L + +  AKY  D  V  +   
Sbjct  1037  EKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYKNSLLSRVLSAKYYPDGDVLQARLG  1096

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAPSSLN  199
               NS  +W+ I  A  + + G+ W V  GR    W D W+ D R  F  ++     ++++
Sbjct  1097  FSNSF-SWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDERGRFILSNRAEGLNTVS  1155

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
             +L+ +   + + W ++ +++   E     + +  L       D L W    +GL+SV +A
Sbjct  1156  DLIDD---TTKEWKFEAIEQHFGERDQQCILSIPLSSRE-TEDVLTWAYSKDGLYSVKTA  1211

Query  18    Y  16
             Y
Sbjct  1212  Y  1212


 Score = 63.9 bits (154),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 86/183 (47%), Gaps = 8/183 (4%)
 Frame = -3

Query  4386  SLILRVLG-RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPW  4210
             +L+ +VL  R+ ++  L + L  +W ++ G     + +  F+ +F    D + V  G PW
Sbjct  39    TLVGKVLTVRNYNFDALKRTLNQIWAIKTGALFRPIENGLFVVQFACRRDKEKVLDGRPW  98

Query  4209  MVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDL  4030
                   ++ QE   +  P   ++ +   W+R  +LP+ Y  + ++++IG  IG  ++++ 
Sbjct  99    TFDQHLVMLQEVEDHVQPSNIELRRCPFWMRLYNLPMGYRSESYVRRIGGCIGDVLEVE-  157

Query  4029  TTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPK-----EYEGIHQICFKCSIYGHRM  3865
              +      + ARV + LDI KPL     I+  +        +YE +   C+ C + GH  
Sbjct  158   -SDGVQWDRSARVRILLDIKKPLRRVQRISLKDGSTVLVDVKYERLPTFCYACGLIGHIE  216

Query  3864  ETC  3856
               C
Sbjct  217   RDC  219



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score =   268 bits (685),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 188/604 (31%), Positives = 290/604 (48%), Gaps = 28/604 (5%)
 Frame = -1

Query  3056  GAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIW  2877
             G+     +R LK    +H   L+ + EP ++  +A+      GFD  I       S  IW
Sbjct  599   GSEGVGIQRRLKKLKIMHNIKLLVILEPMVNPNRADYFRRRFGFDRVIS----NCSQKIW  654

Query  2876  LFCSVSINIEILYTHPQFIAFQVYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*Y  2712
             +F S+ +N E+L  H Q +  ++    S PWL      + VY       R  L+  L   
Sbjct  655   IFSSMEVNCEVLMDHIQCLHVRL----SLPWLPHPISATFVYAKCTRQERLELWNCLRSL  710

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
               + QG W+  GDFN++   +E  N          DF   +F   LID GF G+S+TW  
Sbjct  711   SSDMQGPWMVGGDFNTIVSCAERLNGAPPHGGSMEDFVATLFDCGLIDAGFEGNSFTW--  768

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
                T +    RLDR + N E +  F   +V HL   GSDH PLLIS  T  Q+  S+ F+
Sbjct  769   ---TNNHMFQRLDRVVYNPEWAHCFSSTRVQHLNRDGSDHCPLLISCATASQKGPST-FR  824

Query  2351  FNMAWTTHYSFQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRL  2190
             F  AWT H+ F   V+  W+  L+ S        +  +   L  W++  FG+I +K +R 
Sbjct  825   FLHAWTKHHDFLPFVERSWQVPLNSSGLTAFWIKQQRLKRDLKWWNKQIFGDIFEKLKRA  884

Query  2189  LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY  2010
                 E  +        S    L  +   +L   L  EEL W Q+S  +W+  G+RNT+F+
Sbjct  885   EIEAEKREKEFQQDPSSINRNLMNKAYAKLNRQLSIEELFWQQKSGVKWLVEGERNTKFF  944

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPP  1830
              +    KR ++ + ++ D++G++  D   +      YF  L T E   + + F     P 
Sbjct  945   HLRMRKKRVRNNIFRIQDSEGNIYEDPQYIQNSAVQYFQNLLTAE-QCDFSRFDPSLIPR  1003

Query  1829  LLE-EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRF  1653
              +   D   + A  + ++IK  +F++     +GPDGF+  F+   W  +   L   V  F
Sbjct  1004  TISITDNEFLCAAPSLKEIKEVVFNIDKDSVAGPDGFSSLFYQHCWDIIKQDLLEAVLDF  1063

Query  1652  FEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVG  1473
             F    +P G   T L L+PK  N  + + FRPI LC V+ K++TK +  RL  ++  ++ 
Sbjct  1064  FNGTPMPQGVTSTTLVLLPKKPNSCQWSDFRPISLCTVLNKIVTKTLANRLSKILPSIIS  1123

Query  1472  PHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRD  1293
              +QS FV+GR I+DN L  QE++      K R G + LK+D+ KAYDRL+W F+   ++ 
Sbjct  1124  ENQSGFVNGRLISDNILLAQELVGKLDA-KARGGNVVLKLDMAKAYDRLNWDFLYLMMKQ  1182

Query  1292  IGFN  1281
              GFN
Sbjct  1183  FGFN  1186


 Score =   165 bits (417),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 206/421 (49%), Gaps = 10/421 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C+++     L NG L  +    +GLRQGD ISPLLFVL A+ LS  ++  + +
Sbjct  1189  WISMIKACISNCWFSLLINGSLVGYFKSERGLRQGDSISPLLFVLAADYLSRGINQ-LFN  1247

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +   + ++     +SHL FADD+V F         ++   L  +   SGQ++N QKS  
Sbjct  1248  RHKSLLYLSGCFMPISHLAFADDIVIFTNGCRPALQKILVFLQEYEEVSGQQVNHQKSCF  1307

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               +    +  +Q IA T G         +LG P   G  K   FD+++ +I+ R+SG  +
Sbjct  1308  ITANGCPMTRRQIIAHTTGFQHKTLPVIYLGAPLHKGPKKVTLFDSLITKIRDRISGWEN  1367

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLS  G   +++SVLS++P Y ++    P  VI+ IERL   FLWG      + H   W
Sbjct  1368  KTLSPGGRITLLRSVLSSLPLYLLQVLKPPVVVIEKIERLFNSFLWGDSTNDKRIHWAAW  1427

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T   + GGL I+ L  M  AF  KL WR S     LWT   K KY     +     P
Sbjct  1428  HKLTFPCSEGGLDIRRLTDMFDAFSLKLWWRFS-TCEGLWTKFLKTKYCMG-QIPHYVHP  1485

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
             K + S  WK +++   +     +W +  G +  FW D W+ D+PL    S P   + ++ 
Sbjct  1486  KLHDSQVWKRMVRGREVAIQNTRWRIGKG-SLFFWHDCWMGDQPLV--TSFPHFRNDMST  1542

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
              V N++ +   WD D L+  LP ++++++    +  D    D   W    NG FS  SA+
Sbjct  1543  -VHNFF-NGHNWDVDKLNLYLPMNLVDEILQIPI--DRSQDDVAYWSLTSNGEFSTRSAW  1598

Query  15    E  13
             E
Sbjct  1599  E  1599


 Score = 58.9 bits (141),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 12/134 (9%)
 Frame = -3

Query  4179  EWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKF  4000
             +W P+F P   +   +  W+ FP+LP    +   L  + + +G+P+ +D  T   S+   
Sbjct  5     KWSPDFQPE-KESSVVPVWISFPNLPAHLHEKSALMMVARTVGKPLFVDEATANRSRPSV  63

Query  3999  ARVCVQLDITKPLLSNFVI-----------NGTEWPKEYEGIHQICFKCSIYGHRMETCG  3853
             ARVCV+ D  KP L +  I            G     E+  + + C  C   GH +  C 
Sbjct  64    ARVCVEYDCQKPPLDHVWIVSRNRKTETMTGGLSQRVEFAKLPEYCQHCCHVGHAVTECM  123

Query  3852  LSVPIPAASVDGTA  3811
             +    P ++   TA
Sbjct  124   VLGNKPVSTKPKTA  137



>ref|XP_009124968.1| PREDICTED: uncharacterized protein LOC103850017 [Brassica rapa]
Length=1053

 Score =   231 bits (589),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 150/427 (35%), Positives = 227/427 (53%), Gaps = 9/427 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C+++     L NG     ++P +G+RQGDP+SP +F+LC+E LS +   +   
Sbjct  308   WIGLIMQCISTVTYSFLINGSPRGKVTPSRGIRQGDPLSPYIFILCSEVLSGLCSKAQVE  367

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G KV R +P ++HL FADD +FF  A+     E+K  L  +   SGQ IN +KSS+
Sbjct  368   GRMRGFKVARGSPRINHLLFADDTMFFLNADKGSTEELKAILSRYEKASGQSINKEKSSI  427

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+      +Q + + L I +   +GK+LGLP   GR K+D F +I+ERIK +  G S+
Sbjct  428   TFSRKAPRELKQRVHSELQIQNEGGVGKYLGLPEHFGRRKRDLFTSIIERIKQKAEGWST  487

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  VM+QSVL+ IP ++M    +P  +   IE  ++ F W  R GK K   + W
Sbjct  488   RFLSPAGKLVMLQSVLTPIPSHAMSCFKLPVSLCQRIETALKRFWWDDRTGKRKMAWISW  547

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+NGGLG++ ++  N A+LAK++WRL +  + L      +KY  D +  +   P
Sbjct  548   PKLTLPKSNGGLGVRDIQAFNEAYLAKISWRLLEKPHGLLGRTLLSKYCPDGNFLACSSP  607

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
               ++S+ W  IL    +    + W + +G +   W D WL LD P+      P   +S N
Sbjct  608   S-SASHGWHSILAGRDLLNKNLGWVIGDGNSINIWEDQWLSLDSPI--RPMGPATETSAN  664

Query  198   NLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQ-EDTLLGDRLVWYKEPNGLFSVS  25
              LV +  +   G WD   + ++LP     +     LQ       D L W     G +SV 
Sbjct  665   LLVKDLILPGSGEWDRARIQQILP---FEEERILCLQTSKNGAPDVLRWLGTSLGQYSVK  721

Query  24    SAYELAL  4
             S Y +A+
Sbjct  722   SGYLVAM  728


 Score =   201 bits (512),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 156/270 (58%), Gaps = 3/270 (1%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W QRSR  W++ GDRN+ F+  AT  ++  +  + L D DG+++  +  + K V +
Sbjct  38    EEAFWKQRSRLLWLQLGDRNSGFFHAATKNRKRANAFTVLEDTDGNMVYKEEDIAKTVVE  97

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             Y+  +FT+          Y   P + +ED   + A  T  +IK ALF +   KA GPDGF
Sbjct  98    YYKMMFTSVKGDCADTVRYALQPLITQEDNEVLIAIPTAAEIKEALFAVNAEKAPGPDGF  157

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  F+   W  VG  L   +   F  G +P G N T + LIPK++ P+R++ +RPI LCN
Sbjct  158   SASFYQAHWAEVGPDLVVEIQEAFRTGTIPKGINGTHVCLIPKIKTPQRVSDYRPIALCN  217

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG--RVGW  1368
             V YK+ +K++  RL+ ++ K++  +QS+FV GR I DN L   E+L+  +T K   RV  
Sbjct  218   VYYKIYSKILQRRLQPLLEKIISENQSAFVPGRAIGDNILITHEVLHTLKTSKAAKRVS-  276

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             +A+K D+ KAYDRL W FI   L  +GF+H
Sbjct  277   LAVKTDMSKAYDRLEWDFISTVLERLGFHH  306



>ref|XP_009121338.1| PREDICTED: uncharacterized protein LOC103846184 [Brassica rapa]
Length=1285

 Score =   225 bits (574),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/544 (29%), Positives = 260/544 (48%), Gaps = 19/544 (3%)
 Frame = -1

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             SGG++L  +  I + +  ++  FI   +       + ++ VYG  D   R  ++ ++S  
Sbjct  32    SGGLFLIWNNEIQLTVRSSNKNFID-TIITQKGVTFQITFVYGEPDHTKRLEVWNEISTL  90

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                    W   GDFN +T  SE       +      F  ++   +L D+   G+  +W R
Sbjct  91    KPASGQPWFLTGDFNEITENSEKKGGPERAEGTFCAFRSFLSENDLFDIKHYGNYLSW-R  149

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
             G         RLDRA+SN      FP  +  +L    SDH PLL  + T  ++     F+
Sbjct  150   GKRNTHMVQCRLDRAISNSNWMEVFPSCRSQYLKYEASDHRPLLTFLDTGRKKGLKI-FR  208

Query  2351  FNMAWTTHYSFQACVQSVWRS--DLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             F+     H   +  ++ VW S   LD+    +    A+  WS++   N     R+++  L
Sbjct  209   FDRRLKDHIEVKQIIREVWESTTHLDVGGRLACCRRAICEWSKEFQAN----SRKMIETL  264

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
               +Q   +M        L  ++  +L     QEE  W QRSR+ W+  GD NT ++   T
Sbjct  265   R-IQLDDAMSNHVPDDDLIHQINMQLLTAYKQEEEYWKQRSRQLWLALGDSNTSYFHATT  323

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLF----TTEVDVNRTNFCYGCFPP  1830
               +++++R++ + +  G    ++  +   +  Y+  LF    TT++ +        C   
Sbjct  324   KARKSKNRMTVIENDAGVPWFEEEQIANVICKYYANLFKANQTTDLHIVEEAL-RPCVSS  382

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
              + E  A +  P   E I+ A F + P KA GPDGF+  FF   W  VG ++   V  FF
Sbjct  383   QINE--ALIQDPSAAE-IREATFAIHPDKAPGPDGFSASFFQANWEVVGPAVIKEVQLFF  439

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
               G+L P  N T + LIPK    +++  +RPI LCNV +K+I+K++ +RLK ++  ++  
Sbjct  440   TTGVLRPAQNVTHVRLIPKTVGAKKVADYRPIALCNVFFKIISKLLALRLKTVLHLIISE  499

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRD  1293
             +QS+F+ GR I DN L   E+L   +  +  +   MA+K D+ K YDR+ W FIE  L+ 
Sbjct  500   NQSAFIPGRAIADNILITHEVLQFLKISQAQKRCTMAVKTDMSKTYDRIEWGFIEKVLQR  559

Query  1292  IGFN  1281
             +GF+
Sbjct  560   LGFH  563


 Score =   207 bits (527),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 138/424 (33%), Positives = 220/424 (52%), Gaps = 28/424 (7%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + IM CV++     L N  +   ++P++G+RQGDP+SP LF+LC + LS +   + + 
Sbjct  566   WSQLIMQCVSTVSYSYLINDSVHGSVTPQRGIRQGDPLSPYLFILCGQVLSGLCQKAEKE  625

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G++V R +P ++HL FADD +                       S +KIN +KSS+
Sbjct  626   GTLQGIRVARGSPRVNHLLFADDTIR----------------------STEKINSEKSSI  663

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T   T++++   LGI      GK+LGLP   GR KKD F  +++RI+ R S  S+
Sbjct  664   TFSSRTPEDTKRSVKEALGIVKEGGQGKYLGLPEHFGRRKKDLFTTLVDRIRQRASSYST  723

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M+++VL+AIP ++M    +P  +   I+ ++  F W S +G  K   V W
Sbjct  724   RHLSKAGKLTMLKAVLTAIPTFTMSCFELPVSLCKRIQSVLTRFWWDSSDGVKKMCWVAW  783

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  KA GGLG++ ++  N A LAK AWR+  + NCL   +   KY  + S      P
Sbjct  784   DRLTMPKAGGGLGLRDIQLFNQALLAKQAWRILTNPNCLLARVLLGKYCHNKSFMEVSVP  843

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
                 S+ W+ IL    + R+ +   + NG +T+ W DSW+ LD+    +   PI  S+L+
Sbjct  844   A-VCSHGWRSILHGRELLRDNVGKALGNGLSTKVWKDSWISLDKNT--KPYGPIQESALD  900

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V++   S+  W+   ++ +LP  ++ K    +        D  VW    +G ++  S 
Sbjct  901   LTVSDLLTSDMKWNKSKVEALLP--LMAKEIQLLNPGHPTTEDIHVWQPLHSGKYTTKSG  958

Query  18    YELA  7
             Y  A
Sbjct  959   YYTA  962



>gb|EAZ20803.1| hypothetical protein OsJ_36426 [Oryza sativa Japonica Group]
Length=787

 Score =   240 bits (613),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/481 (32%), Positives = 244/481 (51%), Gaps = 42/481 (9%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL +GDFN    Q E  +    + ++   F D +   +L  LGF+G  YT+    +  + 
Sbjct  16    WLVLGDFNEALWQFEHFSVRQRNETQMQSFRDVLQTCDLHALGFSGVPYTYDNRREGRNN  75

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQ---FCSSRFKFNMA  2340
                RLDRAL++ +    F +A+V+HL    SDH P  IS+   P+    F +    + + 
Sbjct  76    IRVRLDRALADNDWREMFGNARVSHLTSTRSDHCP--ISVCFSPEDCRPFHTKCLHYEIC  133

Query  2339  WTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             W    S Q  +   W     +SDL ++ST    ++  L  WS+    N+ ++  +   RL
Sbjct  134   WEREPSLQEVITDAWSEGVSKSDLGEISTALHRVMTRLHSWSKVKVKNVGKELEKARKRL  193

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
                    S+ +      L R+    L E LY+EE++W QRSR  W+K GDRNTRF+    
Sbjct  194   T------SLLVSDAESSLVRQALDHLNELLYREEMLWLQRSRINWLKEGDRNTRFFHSKG  247

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
               +  ++++S L DA G +     ++ +   DYF  LF+ + +++ +         L++E
Sbjct  248   VWRAKKNKISALRDASGTVHHLTNVMEQMATDYFKTLFSADPNLDHSRVT-----TLIQE  302

Query  1817  DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
                                 + P KA GPDGF   FF + W  +   +   V  FF  G+
Sbjct  303   K-------------------IGPLKAPGPDGFPARFFQRNWGLLKEEVVKAVKEFFNTGV  343

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
             +P G N+T + LIPKV  P  +  +RPI LCNV+YK+++K ++ RL+ ++ +L+ P+QS+
Sbjct  344   MPAGVNETAIVLIPKVDQPIELRDYRPISLCNVLYKVVSKCLVNRLRPILDELISPNQSA  403

Query  1457  FVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             FV GR ITDN L   E  ++  + KK      A K+DL KAYDR+ W F+E ++  +GF 
Sbjct  404   FVPGRMITDNALIAFECFHSIQKNKKLSSATCAYKLDLSKAYDRVDWKFLEQSMYKLGFA  463

Query  1280  H  1278
             H
Sbjct  464   H  464


 Score =   192 bits (487),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 173/322 (54%), Gaps = 1/322 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM C+TS R    +NG L    +P +GLRQGDP+SP LF+   + LS +++  V  
Sbjct  466   WVNWIMSCITSVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFVVDGLSLLLEERVAQ  525

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    V + R AP +S+L F DD + F +A S QA  +   L  +  C+GQ IN +K S+
Sbjct  526   GALSPVHICRRAPGISNLLFTDDTLLFFKATSEQANVVMNVLADYAWCTGQLINQEKCSI  585

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F + +    Q+++ + L + S     K+LG P+  GR+ K  F ++ E++  R+     
Sbjct  586   MFGEASPPDVQESVRSVLQVGSTSFDDKYLGFPTPEGRMNKGKFQSLQEKLCKRIMQWGE  645

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  +++++VL AI  Y M    +P  + D + +L R F WGS +GK K H   W
Sbjct  646   NFLSSGGKEILIKAVLQAITVYVMGIFKLPDSICDELTKLTRNFWWGSEKGKRKAHWKSW  705

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K  GGLG +  +  N A LA+ AWRL ++ + L   + KAKY  + S+  +   
Sbjct  706   DCITKPKHCGGLGFRDFRLFNQALLARQAWRLIENPHSLCVQVLKAKYYPNGSLIDT-SF  764

Query  375   KRNSSNAWKGILQALHIFRNGI  310
               N+S+ W+ I   L + + G+
Sbjct  765   GGNASSGWRAIEYGLELLKKGL  786



>gb|AAD29058.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1229

 Score =   216 bits (551),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 143/437 (33%), Positives = 220/437 (50%), Gaps = 17/437 (4%)
 Frame = -3

Query  1296  RYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHM  1117
             R+     WI  ++ CVTS     L NG     + P +GLRQGDP+SP LF+LC E LS +
Sbjct  490   RFGFHSIWIDWVLECVTSVSYSFLINGTPQGKVVPTRGLRQGDPLSPCLFILCTEVLSGL  549

Query  1116  VDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKI  937
                + R     GV+V+   P ++HL FADD +FF +++     ++ + L  +   SGQ I
Sbjct  550   CTRAQRLRQLPGVRVSINGPRVNHLLFADDTMFFSKSDPESCNKLSEILSRYGKASGQSI  609

Query  936   NLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKa  757
             N  KSS+ FS  T    +  +   L I      GK+LGLP   GR K+D F  I+++I+ 
Sbjct  610   NFHKSSVTFSSKTPRSVKGQVKRILKIRKEGGTGKYLGLPEHFGRRKRDIFGAIIDKIRQ  669

Query  756   rlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKN  577
             +    +SR LS AG  VM+++VL+++P YSM    +PS +   I+ L+  F W ++    
Sbjct  670   KSHSWASRFLSQAGKQVMLKAVLASMPLYSMSCFKLPSALCRKIQSLLTRFWWDTKPDVR  729

Query  576   KCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPS  397
             K   V W  +TN K  GGLG + ++  N + LAKL WRL      L + +   KY    S
Sbjct  730   KTSWVAWSKLTNPKNAGGLGFRDIERCNDSLLAKLGWRLLNSPESLLSRILLGKYCHSSS  789

Query  396   VWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAP  220
                   P +  S+ W+ I+    I + G+ W + NG     W D WL + +PL      P
Sbjct  790   FMECKLPSQ-PSHGWRSIIAGREILKEGLGWLITNGEKVSIWNDPWLSISKPL-----VP  843

Query  219   IAPS--SLNNLVANYWISNEG--WDWDMLDRVLP--EHILNKLSTFVLQEDTLLGDRLVW  58
             I P+     +L  +  I+     WDW+ +  +LP  E+++ +L        +   D+L W
Sbjct  844   IGPALREHQDLRVSALINQNTLQWDWNKIAVILPNYENLIKQLPA----PSSRGVDKLAW  899

Query  57    YKEPNGLFSVSSAYELA  7
                 +G ++  S Y +A
Sbjct  900   LPVKSGQYTSRSGYGIA  916


 Score =   215 bits (547),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 141/447 (32%), Positives = 225/447 (50%), Gaps = 14/447 (3%)
 Frame = -1

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
             DF  +I    L DL ++G+ ++W RG+    F   RLDRA+SN      FP  +  +L  
Sbjct  57    DFRSFISKNGLWDLKYSGNPFSW-RGMRYDWFVRQRLDRAMSNNSWLESFPSGRSEYLRF  115

Query  2426  IGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLS--TNKSAMV  2253
              GSDH PL++ +     +    +F+F+     +    A +Q  W +  D S  T  +   
Sbjct  116   EGSDHRPLVVFVDEARVKR-RGQFRFDNRLRDNDVVNALIQETWTNAGDASVLTKMNQCR  174

Query  2252  EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSD--lvrlerrlrkeleETLYQE  2079
               +  W+R    N  +        +E  Q +L   + +D         L   LE     E
Sbjct  175   REIINWTRLQNLNSAE-------LIEKTQKALEEALTADPPNPTTIGALTATLEHAYKLE  227

Query  2078  ELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDY  1899
             E  W QRSR  W+ SGDRNT ++   T  +R Q+R++ + D +G    ++  + + +  Y
Sbjct  228   EQFWKQRSRVLWLHSGDRNTGYFHAVTRNRRTQNRLTVMEDINGVAQHEEHQISQIISGY  287

Query  1898  FLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFT  1719
             F  +FT+E D + +       P + + D   +      E++K A+F +   KA GPDGFT
Sbjct  288   FQQIFTSESDGDFSVVDEAIEPMVSQGDNDFLTRIPNDEEVKDAVFSINASKAPGPDGFT  347

Query  1718  PGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNV  1539
              GF+H  W  + T +   +  FF     P   N+T + LIPK   P ++  +RPI LCN+
Sbjct  348   AGFYHSYWHIISTDVGREIRLFFTSKNFPRRMNETHIRLIPKDLGPRKVADYRPIALCNI  407

Query  1538  VYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MA  1362
              YK++ K+M  R++ ++ KL+  +QS+FV GR I+DN L   E+L+  RT   +    MA
Sbjct  408   FYKIVAKIMTKRMQLILPKLISENQSAFVPGRVISDNVLITHEVLHFLRTSSAKKHCSMA  467

Query  1361  LKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             +K D+ KAYDR+ W F++  L+  GF+
Sbjct  468   VKTDMSKAYDRVEWDFLKKVLQRFGFH  494



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   236 bits (601),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/611 (28%), Positives = 282/611 (46%), Gaps = 25/611 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG  +P   R L+  +  + P  + + E K+++    +   SLGF     V  VG +
Sbjct  6     WNCQGMGNPWTVRQLRRLMASNTPDSLFMSETKVTKNIVEQKKESLGFSGAFGVSCVGRA  65

Query  2888  GGIWLFC-SVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ +F    +I+  ++      I   V  N    W    +YG  +   +   +A +   
Sbjct  66    GGLCMFWKEETISFRMVSFSQNHICGDVGSNGDVRWRFVGIYGWPEEENKHKTWALIKGL  125

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                 +G  +  GDFN +    E     +        F + +    L DL F G  +TW R
Sbjct  126   CDEYEGPIVFGGDFNEILSYDEKEGGASRERRAIVGFRNVMDDCSLGDLRFVGQWHTWER  185

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI---TTCPQQFCSS  2361
             G    S    RLDR + +      FP+A + H     SDH+ +++        P++    
Sbjct  186   GRSPESRIRERLDRFIVSRSWLHLFPEAFIDHQVRYCSDHAAIVLRCLGNEGMPRRRAGG  245

Query  2360  RFKFNMAWTTHYSFQACVQSVWRSDLD--LSTNKSAMVEALSVWSRDSFGNIPQKKRRLL  2187
              F F   W    + +  V+  W +     +     A+   L  WS+ +FG++ +K   + 
Sbjct  246   -FWFETFWLLDDTCEEVVRGAWNAAEGGRICEKLGAVARELQGWSKKTFGSLRKKIEAVE  304

Query  2186  ARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQ  2007
              +L   Q         D       L +EL+E   + E  W+ RSR   +K GDRNT ++ 
Sbjct  305   KKLHAAQ---GEATSIDSWERCVGLERELDELHAKNEAYWYLRSRVAEVKDGDRNTSYFH  361

Query  2006  VATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPL  1827
                + ++ ++ +  + D  G    +   +   V  YF  +FT+    +        F  +
Sbjct  362   HKASQRKKRNLIHGIFDGGGRWQTEGEEIECVVERYFQEIFTSSEPSSND------FQEV  415

Query  1826  LEEDWASVN--------APFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLF  1671
             L+    SV          P++ E+I  AL DM PCKA GPDG    F+ + W  +G  +F
Sbjct  416   LQHVKRSVTQEYNDILLKPYSKEEIFAALSDMHPCKAPGPDGMHAIFYQRFWHIIGDEVF  475

Query  1670  SFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDM  1491
             +FV     +   P   N T ++LIPKV++P  +++FRPI LCNV+YK+ +K +++RLK  
Sbjct  476   NFVSSILHNYSCPGNVNCTNIALIPKVKSPTVVSEFRPISLCNVLYKIASKAIVLRLKRF  535

Query  1490  VRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCF  1314
             +  +   +QS+FV GR I+DN+L   EI +  + +   R G MA+K+D+ KAYDR+ W F
Sbjct  536   LPCIATENQSAFVPGRLISDNSLIALEIFHTMKKRNNSRKGLMAMKLDMSKAYDRVEWGF  595

Query  1313  IEDTLRDIGFN  1281
             +   L  +GF+
Sbjct  596   LRKLLLTMGFD  606


 Score =   195 bits (495),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 133/428 (31%), Positives = 210/428 (49%), Gaps = 14/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CV +     + NG++   ++P +GLRQGDP+SP LF+L A+  S MV   V S
Sbjct  609   WVNLVMSCVATVSYSFIINGRVCGSVTPSRGLRQGDPLSPFLFILVADAFSQMVKQKVVS  668

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K +R  P +SHL FADD + F  A   + L +   L+ + + SGQKIN +KS +
Sbjct  669   KEIHGAKASRNGPEISHLLFADDSLLFTRATRQECLTIVDILNKYEAASGQKINYEKSEV  728

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+  +   ++ +   L +  V    K+LG+P++ GR KK  F  +L+R+  +L G   
Sbjct  729   SFSRGVSCEKKEELITLLHMRQVDRHQKYLGIPALCGRSKKVLFRELLDRMWKKLRGWKE  788

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ A+P Y M    +P  VI  I   +  F WG +  + K H + W
Sbjct  789   KLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQEIHSAMARFWWGGKGDERKMHWLSW  848

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G K L   N A L K  WRL  +   L + +  AKY     V  + + 
Sbjct  849   EKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNKESLLSRVMSAKYYPHGDVRYA-RL  907

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S +W+ I  A  +   G+ W V +G     W   W+ D       SA +    +  
Sbjct  908   GYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARVEGLEVVG  967

Query  195   LVANYWISNEGWDWDMLDRVLPEH-----ILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
              + +  +  + W+ ++++R   E      +   LST  LQ      D L W    +G +S
Sbjct  968   DLMD--VERKEWNVELIERHFNERDQQCILAIPLSTRCLQ------DELTWAYSKDGTYS  1019

Query  30    VSSAYELA  7
             V +AY L 
Sbjct  1020  VKTAYMLG  1027



>ref|XP_008801646.1| PREDICTED: uncharacterized protein LOC103715697 [Phoenix dactylifera]
Length=1203

 Score =   248 bits (632),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 147/463 (32%), Positives = 237/463 (51%), Gaps = 13/463 (3%)
 Frame = -1

Query  2633  ETFSMSR-CTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRF  2457
             + FS +R   +F ++I +  LIDLGF G  YTW       +    RLDRA +  E    F
Sbjct  4     KNFSYNRKVREFQEFITVNGLIDLGFVGPRYTWCNNQQGSARVWERLDRAFATAEWIQEF  63

Query  2456  PDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW----RS  2289
             P+ +V HLP I SDHSP+L+S        C   F+F   W  +      V   W    R 
Sbjct  64    PEYRVNHLPRIASDHSPILVSTEISIPYRCP--FRFEKFWCCYPRSWEVVSEAWGMPVRG  121

Query  2288  D--LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRL---LARLEGVQ*SLSMGIRSDlvrl  2124
             D    +S         L  W+R+  GNI ++   +   + RL+  Q +L  G+ +  +  
Sbjct  122   DAMYRVSRRLELTRRRLIRWNREEVGNIFRRIEEIEEAITRLQS-QEALRGGLLAGEMTE  180

Query  2123  errlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGH  1944
              R L    +  L Q+E+ W Q+SR +WI  GDRNT+F+  +T ++R ++++  + + DG 
Sbjct  181   LRSLLSLHDSLLRQQEIFWRQKSRVQWILEGDRNTKFFYRSTLIRRQRNKIRIIREDDGQ  240

Query  1943  LICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTAL  1764
             L  +   +++ V  +F   +T +     +         +  E+ + +  P +  +I+ A+
Sbjct  241   LTEEPDRIIRVVEQFFRARWTEQTGSGISTDLPLPSVGVSAEETSVLIRPVSGREIQEAV  300

Query  1763  FDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQN  1584
             + +   KA GPDGF P FF + W  VG  +   + +FF    +      T ++LIPK Q+
Sbjct  301   WSLAGDKAPGPDGFPPVFFRRYWMLVGQDVIEAIQQFFHTAAMSSDWQRTFVALIPKRQD  360

Query  1583  PERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEIL  1404
             P     +RPI LC+ +YK   K++ +RL+D++ +L+ P Q +FV GR ITDN L  QE +
Sbjct  361   PTEPGHYRPISLCSTLYKATAKILAVRLRDILPRLISPEQGAFVAGRSITDNVLIAQEFM  420

Query  1403  NAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
                     R   M +K+D+E+AYDRLSW F++ + +  GF+ T
Sbjct  421   YDLGRAPRRRSLMGIKLDMERAYDRLSWDFVQHSFQSFGFHET  463


 Score =   182 bits (462),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 125/421 (30%), Positives = 208/421 (49%), Gaps = 11/421 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR +M CV  P    L NG  + +     GLRQG P+SPLLF+ CA+ LS  +  +  S
Sbjct  464   WIRWVMGCVRGPSFAILVNGTPSHFFESSVGLRQGCPLSPLLFITCADSLSRALRGASDS  523

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                +  +  R    +SHL FADD +   +A    A  ++  +  +C+ SGQ++N  K+++
Sbjct  524   QQLEAYRPARGTRPISHLLFADDSLLLAQATRQAAQVIRSIVFDYCAASGQRVNFAKTTI  583

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F        +  I   LG+       ++LG+P    RL++    ++    + RL G  +
Sbjct  584   HFCPKIIPQVKAAIMEILGVRQQDSGLRYLGVPITGRRLRRGDCLSLETSFRHRLEGWQT  643

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              TLS+ G   + ++VLS+IP Y M S+++P  ++ S+ERLIR F+WG R  +   HL+ W
Sbjct  644   HTLSMMGRVTLARTVLSSIPIYLMSSSILPVALLRSLERLIRDFIWGRRGDRGGIHLMAW  703

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              +V      GGLG+ SL     A   + A R   + + + ++L +AKY    S+  S + 
Sbjct  704   EVVCQPIRQGGLGVTSLTLRQEALAMRHAARFLLEPDSMCSSLMRAKYG---SLLISTRA  760

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R+SS  W+ I     +  + I+W V +GR+     DSW+ + P+ +  +          
Sbjct  761   GRHSSPIWREICARGPLVLSAIRWAVGDGRSIDVLEDSWVTEFPISQMPTMVDTERFQGF  820

Query  195   LVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVL--QEDTLLGDRLVWYKEPNGLFSVS  25
              V +  +  EG W   ++  V  E +  ++    +  +E+    DRL+W  EP G   V 
Sbjct  821   RVCDLIVPGEGRWHEGLIREVFGEQLAARVMALPVPSREEP---DRLIW--EPTGRSGVR  875

Query  24    S  22
             +
Sbjct  876   A  876



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   233 bits (594),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 149/424 (35%), Positives = 225/424 (53%), Gaps = 10/424 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R +M C+T+  L   +NG+      P +GLRQGDP+SP +F+L A  LS ++  +V  
Sbjct  738   WVRLVMACITTTSLSVRFNGEQLASFQPSRGLRQGDPLSPYIFILLANALSTLITQAVEM  797

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+K  R  P +SHLFFADD VFF +A   +A  +   L+ +C  +GQ IN  KS L
Sbjct  798   GQLQGIKFNRACPTLSHLFFADDSVFFLKATISEAQNLANILNQYCLATGQIINRNKSGL  857

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             +FSKN  L  QQNIA+   +P +   GK+LG+PS  GR K++ F  IL +  A+L G   
Sbjct  858   YFSKNCPLSLQQNIASEFRMPMMNRYGKYLGIPSDWGRSKREMFSWILAKANAKLDGWKE  917

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS +G  ++++SV+ A+P Y+M    +P  +   IE+ I  F W +  GK   H   W
Sbjct  918   RLLSKSGKEILLKSVVQALPQYAMSIFKLPLSLCRLIEKKISVFWWSNNNGKTGIHWQNW  977

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK +GG+G + L   N A L K AW L Q  N LW+ LFK  Y F  S +   Q 
Sbjct  978   TSLKLSKDSGGMGFRDLVSFNKAMLGKQAWHLFQQPNALWSQLFKGLY-FRNSSFQCAQA  1036

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPL--FEEASAPIAPSSL  202
                +   W+ IL+        ++W V +G   +   D+WL   P+       A   P  +
Sbjct  1037  GNRTLWGWQSILKGREAILPRLRWLVGDGSKIKIREDNWL---PMGTLGGTVAQGEPVLV  1093

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
              +L+ N   S+  W+  ++  +    +  ++    +    LL D+LVW    +G++SV S
Sbjct  1094  ADLIDN---SHHTWNSTLISNLFDSQVSEEILKIPI-NPLLLTDQLVWTATSSGVYSVKS  1149

Query  21    AYEL  10
             +Y L
Sbjct  1150  SYHL  1153


 Score =   196 bits (499),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 204/398 (51%), Gaps = 16/398 (4%)
 Frame = -1

Query  2447  KVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW---RSD-LD  2280
             +V  LP +GSDH PLL++ +T P +   + F +   W      +  +Q  W   R+D   
Sbjct  345   EVLALPALGSDHCPLLLTTSTSPVKRKKT-FTYEAFWNQDQQCKEIIQHSWNISRADKTS  403

Query  2279  LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkel  2100
             L+     +   L+ WS+  F N   +   L  +L+ +        +SD   L   +R E+
Sbjct  404   LAAKLQTVSHELARWSKSKFSNGHLRIAHLQHQLQTLM--NRKYYQSDDKELAHSIRDEI  461

Query  2099  eETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLL  1920
             ++   QEE  W  RSR  W++ GD+N++F+  +T  +R ++R+  L D   H I +   L
Sbjct  462   QQIWQQEEQFWAMRSRINWLRWGDKNSKFFHASTVQRRQRNRICLLKDELQHWIREPEQL  521

Query  1919  LKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPF----TPEDIKTALFDMV  1752
              +    +F  L+ +    N   F    FP ++ +D   +N       T +++  A F + 
Sbjct  522   KELTLGFFSNLYKSVSYCNFGPFL-NQFPEVVTKD---INDHLLRTVTEDEVYQATFQLG  577

Query  1751  PCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERI  1572
               KA GPDG    FF + W  +   +   V  FF  GI+P   N  IL L+PKV +PE I
Sbjct  578   ASKAPGPDGLNGLFFQQHWEIIKADVIKTVRDFFTSGIMPRSLNRMILVLVPKVHHPESI  637

Query  1571  TQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFR  1392
              Q+ PI LCN  YK+I+KVM  RLK  +  L+    ++FV  RQI DN +  QE+L+ F+
Sbjct  638   DQYIPISLCNFAYKIISKVMANRLKPWLPNLISKEHAAFVKDRQIQDNIMVVQEVLHQFK  697

Query  1391  TKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              +K +  + + LK D++KAYDR+ W F++  +  +GFN
Sbjct  698   VRKSKKKFNLLLKTDMQKAYDRVEWDFLQAYMLQLGFN  735


 Score = 61.2 bits (147),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 74/178 (42%), Gaps = 12/178 (7%)
 Frame = -3

Query  4377  LRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLD  4198
              R++  +V+   L   ++  W+L+   ++       +I KF    +   V  G  W+   
Sbjct  8     FRIVNPTVNLPALQIAMKKAWRLDQ-VDISLCDGGLYIVKFRLEIEKQRVLAGSSWLFSG  66

Query  4197  DYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGM  4018
                  Q WRPN      +      W+    LP+E+  +  L+K  K +GR +++   T  
Sbjct  67    HLFHFQPWRPNTPLHCYEFSHCAFWMHVIGLPLEWNTEHILRKAVKQVGRVIEVKPDTS-  125

Query  4017  ASKGKFARVCVQLDITKPLLSNFVIN---GTEWPK-EYEGIHQICFKCSIYGHRMETC  3856
                    RV +QLD+ +PL +  +I+    T W    YE +   C+ C   GH    C
Sbjct  126   ------GRVRIQLDLKEPLRTGKLISIEGKTLWLDFRYERLSHFCYSCGKLGHYATAC  177



>ref|XP_010513001.1| PREDICTED: uncharacterized protein LOC104788939 [Camelina sativa]
Length=1583

 Score =   238 bits (608),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/578 (30%), Positives = 263/578 (46%), Gaps = 16/578 (3%)
 Frame = -1

Query  2984  LFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVS-INIEILYTHPQFIAFQV  2808
             L E K       +     G+     ++ +G SGG+ LF +     + +L+   + I  + 
Sbjct  324   LMETKQPSPILEKFVGHFGYKNLKTIDPIGCSGGMALFYNQDDFQVSVLFESNRLIDIEA  383

Query  2807  YDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKET  2628
                     L + VYG      R  ++  +     N    W  +GDFN +T   E      
Sbjct  384   VFKGRIIHL-TFVYGDPVPNKRDLVWERILRISANRSTPWFLVGDFNELTGNHEKRGGGK  442

Query  2627  FSM-SRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPD  2451
                 S    FN  I     +D  F G   +W RG         RLDRAL N +    FPD
Sbjct  443   LRHPSSFLAFNGMIRDCGFLDFPFIGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPD  501

Query  2450  AKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLST  2271
                 +LPMI SDH PL++ I    +   +  F F+  W         + S W   LD  +
Sbjct  502   TVTEYLPMIASDHKPLVVKIG-AKRPRGNRSFMFDRRWIGKTGLMDAIASGWDGGLDQVS  560

Query  2270  NKSAMV-----EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrk  2106
             +          + +S W +       +    L  +LE     +++   S        L+ 
Sbjct  561   DTFTYKIVNCRKTISQWRKSQVPYGRETIDDLKRQLE-----VALADDSIPPATISDLQS  615

Query  2105  eleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDG  1926
              L +    EE+ W+Q+SR +W++ GD+N++++   T  +R ++R++ L + D     +D 
Sbjct  616   RLRQAYGDEEIYWYQKSRSKWMRLGDKNSKYFHALTKQRRARNRINGLFNKDDIWSTEDV  675

Query  1925  LLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPC  1746
              +      YF  LFT+    N           +  ED   +  P T  ++K+ALF M P 
Sbjct  676   GICNTAVSYFEDLFTSTNPTNFEEVLREVQTVITAEDNERLTRPATEAEVKSALFMMHPD  735

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             KA G DG T  FF K W  V T L   V+RF  +G+   G N T + LIPKV  P R+ +
Sbjct  736   KAPGSDGMTALFFQKAWGIVKTDLVDLVNRFLVEGVFDKGLNRTHICLIPKVAKPTRMAE  795

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK  1386
              RPI LCNV YK+I+KV+  RLK ++  L+   QS+FV GR I+DN L  QE+ +  RT 
Sbjct  796   LRPISLCNVGYKIISKVLCQRLKGVLPGLISETQSAFVPGRLISDNILIAQEMFHDLRTN  855

Query  1385  KGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
                 G +MA+K D+ KAYDR+ W F+   L+ +GF  +
Sbjct  856   PSCKGKFMAIKTDMSKAYDRVEWDFVAALLQKMGFAES  893


 Score =   191 bits (485),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 138/432 (32%), Positives = 204/432 (47%), Gaps = 20/432 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM C+TS     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  + R 
Sbjct  894   WVSWIMVCITSVEYRVLINGQPNGLIVPERGLRQGDPLSPYLFILCTEVLIANIRKAERD  953

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +A+  Q   +   L  + S SGQ+IN  KSS+
Sbjct  954   KLITGIKVANKCPPITHLLFADDSLFFCKADRGQCQVILDILKKYESVSGQQINFSKSSV  1013

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +  T+  +   LGI ++  MG +LGLP   G  K   F    ERI++R +G ++
Sbjct  1014  QFGHKIDDQTKTELQGVLGIMTLGGMGSYLGLPESLGGAKTKVFSFARERIQSRTNGWTA  1073

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  VM++SV +A+P + M    +P  +   +   +  F W +       H + W
Sbjct  1074  NLLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTNGQSGGMHWLAW  1133

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY-----DFDPSVW  391
               +  SK  GGLG +++   N A LAK  WRL      L+  +FK++Y       DP   
Sbjct  1134  EKLCVSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPESLFARVFKSRYYRNTNPLDPI--  1191

Query  390   SSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP  211
              S+ P    S  W+ I  A  +   G+   V +G     W D W+  +  F   +    P
Sbjct  1192  RSYSP----SYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQ--FPRPAVSKGP  1245

Query  210   SSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG----DRLVWYKEPN  43
                + L  N+ I  +   W M   +L EH  + L   +++   L G    D   W+    
Sbjct  1246  LKDHYLQMNHLIDRQTNTWRM--DMLNEH-FDPLDVALIRAIPLGGNQKDDPFGWHFTKT  1302

Query  42    GLFSVSSAYELA  7
             G ++V S Y  A
Sbjct  1303  GKYTVKSGYHTA  1314


 Score =   125 bits (314),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 141/322 (44%), Gaps = 12/322 (4%)
 Frame = -1

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
              +D  F G   +W RG         RLDRAL N +    FPD    +LPMI SDH PL++
Sbjct  7     FLDFPFIGDCLSW-RGWRDKKPIRCRLDRALGNEDWHDLFPDTVTEYLPMIASDHKPLVV  65

Query  2396  SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMV-----EALSVWS  2232
              I    +   +  F F+  W         + S W   LD  ++          + +S W 
Sbjct  66    KIG-AKRPRGNRSFMFDRRWIGKTGLMDAIASGWDGGLDQVSDTFTYKIVNCRKTISQWR  124

Query  2231  RDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSR  2052
             +       +    L  +LE     +++   S        L+  L +    EE+ W+Q+SR
Sbjct  125   KSQVPYGRETIDDLKRQLE-----VALADDSIPPATISDLQSRLRQAYGDEEIYWYQKSR  179

Query  2051  EEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV  1872
              +W++ GD+N++++   T  +R ++R++ L + D     +D  +      YF  LFT+  
Sbjct  180   SKWMRLGDKNSKYFHALTKQRRARNRINGLFNKDDIWSTEDVGICNTAVSYFEDLFTSTN  239

Query  1871  DVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWP  1692
               N           +  ED   +  P T  ++K+ALF M P KA G DG T  FF K W 
Sbjct  240   PTNFEEVLREVQTVITAEDNERLTRPATEVEVKSALFMMHPDKAPGSDGMTALFFQKAWG  299

Query  1691  TVGTSLFSFVHRFFEDGILPPG  1626
              V T L   V+RF  +G+   G
Sbjct  300   IVKTDLVDLVNRFLVEGVFDKG  321



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score =   236 bits (603),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/479 (33%), Positives = 239/479 (50%), Gaps = 20/479 (4%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             W  +GDFN +T   E       S S    FN  +    +++    G   +W         
Sbjct  31    WFLIGDFNELTGNHEKQGGALRSASSFVSFNSMLRHCGMLEFPCYGEQLSWRGNRCNNQV  90

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
                RLDRAL N +    FP+++V +L MIGSDHSP+L +     ++ C  +F+F+  W  
Sbjct  91    VRCRLDRALGNEDWQGFFPNSRVDYLEMIGSDHSPILATCLKTARR-CHRQFRFDKRWLG  149

Query  2330  HYSFQACVQSVWRSDLDLST-----NKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ  2166
                  A V+S W    +               +LS W +++  + P     L   L+  +
Sbjct  150   KEGITAVVESGWNRTKNFRIPGFVDKIRNCRNSLSWWRKNNINSGPSTISSLKEALQEAK  209

Query  2165  *SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKR  1986
               +   I +D +R+  R  KE       EE+ W Q+SR+ W++ GD+NT+++Q +T  +R
Sbjct  210   --MDDLISTDEIRVIERKLKE---AYRDEEIYWQQKSRKFWLRVGDKNTKYFQASTKQRR  264

Query  1985  NQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWAS  1806
              ++R+  L   D   I     +      YF GLF  +VD    +       PL+ ++   
Sbjct  265   VRNRIIGLFGDDDAWIESPSGMENIATKYFEGLFK-KVDGGGISEVLQEIKPLVTDN---  320

Query  1805  VNAPFTPE----DIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
             +N   T +    +++ ALF M P K  GPDG T  FF + W ++   L + V  FF  G 
Sbjct  321   INRDLTRDISEAEVRKALFAMHPEKTPGPDGMTALFFQRFWASLKGDLVALVREFFRTGC  380

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
               P  N+T + LIPKV NP+R+  FRPI LCNV YK+I+KV+  RL+ ++  LV   QS+
Sbjct  381   FDPRLNETNICLIPKVANPQRMANFRPISLCNVSYKIISKVLCFRLRRVLPLLVSETQSA  440

Query  1457  FVHGRQITDNTLAYQEILNAFRT-KKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             FV GR ITDN L  QE+ +   T ++ +  ++A K D+ KAYDR+ W F+E  L   GF
Sbjct  441   FVSGRLITDNILVAQEMFHGLNTNRRCKSEFLAFKTDMSKAYDRVEWDFLEAVLVKFGF  499


 Score =   192 bits (487),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 208/430 (48%), Gaps = 12/430 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CV+S     L NGQ    I P++GLRQGDP+SP LF+LC E L   +  + R 
Sbjct  503   WISWIMWCVSSVTYQVLMNGQPRGSIIPQRGLRQGDPLSPYLFILCTEVLIANIKKAERD  562

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+ + R +P++SHL FADD +FF +A   +   +   +  +   SGQ++NL KSS+
Sbjct  563   KKLTGISIARDSPSVSHLLFADDSLFFCKAEESECRTVISIIGNYGKASGQEVNLTKSSI  622

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K      +  + + +GI     MG +LG+P      K   F  + +R+  R++G S+
Sbjct  623   MFGKKVPPEIRAQLKSVIGISQEGGMGSYLGIPENLQGSKTKVFSYVKDRLDDRVNGWSA  682

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  VM++SV  A+P + M    +   +   +   I  F W S +     H + W
Sbjct  683   KLLSKGGKEVMIKSVALALPTHVMSCYKLTQDLTSKLTSAISSFWWKSNDKARGMHWLAW  742

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K +GGLG ++L+  N A LAK  WRL    + L   + K +Y F        + 
Sbjct  743   DKMCKEKCDGGLGFRALEQFNDAMLAKQYWRLIHYPDSLMARVMKGRY-FRNQHPIMAKK  801

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAPSSLN  199
               N S AW+ I     +   G +W V +G +   W D WL D RP        +      
Sbjct  802   SYNPSFAWRSIYSTKDLVEEGARWTVGSGVSISVWRDPWLPDVRPRPANGRGRLLHP---  858

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQ----EDTLLGDRLVWYKEPNGLFS  31
             NL+ N+ I+    DW +    + E  ++ +   +++      T   DRLVW+   +G +S
Sbjct  859   NLMVNHLINPITKDWHL---PILEEFMDPVDIQLIRNMAVSKTNRPDRLVWHFTKSGKYS  915

Query  30    VSSAYELALE  1
             V + Y +A E
Sbjct  916   VKTGYRVARE  925



>emb|CAB40051.1| putative protein [Arabidopsis thaliana]
 emb|CAB81184.1| putative protein [Arabidopsis thaliana]
Length=1294

 Score =   221 bits (564),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/607 (28%), Positives = 288/607 (47%), Gaps = 25/607 (4%)
 Frame = -1

Query  3059  QGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGI  2880
             +G   P  +  L    ++ K  ++ L E        + + S LGF   I     G+SGG+
Sbjct  370   KGIGVPLTQSQLSNLCKVFKFDVLFLIETLNKCEVISNLASVLGFPNVITQPPQGHSGGL  429

Query  2879  WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHL---FADLS*YF  2709
              L    S+ +  LY   + I   +  N +  + +S VYG    + R  L   F +LS   
Sbjct  430   ALLWKDSVRLSNLYQDDRHIDVHISIN-NINFYLSRVYGHPCQSERHSLWTHFENLSKTR  488

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
              +P   W+ +GDFN +   +E              F + +   +L D+   G  ++W+  
Sbjct  489   NDP---WILIGDFNEILSNNEKIGGPQRDEWTFRGFRNMVSTCDLKDIRSIGDRFSWVGE  545

Query  2528  LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI-TTCPQQFCSSRFK  2352
               + + K   LDRA  N E +  FP A++  L   GSDH PL +S+  T  ++    RF 
Sbjct  546   RHSHTVKCC-LDRAFINSEGAFLFPFAELEFLEFTGSDHKPLFLSLEKTETRKMRPFRFD  604

Query  2351  FNMAWTTHYSFQACVQSVWRSDLD-----LSTNKSAMVEALSVWSRDSFGNIPQKKRRLL  2187
               +    H  F+  V++ W   ++     L        +A++     S  N   +  +L 
Sbjct  605   KRLLEVPH--FKTYVKAGWNKAINGQRKHLPDQVRTCRQAMAKLKHKSNLNSRIRINQLQ  662

Query  2186  ARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQ  2007
             A L+    S++   R         +++EL      EE  W Q+SR +W+K GDRNT F+ 
Sbjct  663   AALDKAMSSVNRTERR----TISHIQRELTVAYRDEERYWQQKSRNQWMKEGDRNTEFFH  718

Query  2006  VATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFPP  1830
               T  + + +R+  + D +G +   D  +  H  ++F  ++ +    V+  +F  G  P 
Sbjct  719   ACTKTRFSVNRLVTIKDEEGMIYRGDKEIGVHAQEFFTKVYESNGRPVSIIDFA-GFKPI  777

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             + E+    +    +  +I  A+  +   KA GPDG T  F+   W  VG  +   V  FF
Sbjct  778   VTEQINDDLTKDLSDLEIYNAICHIGDDKAPGPDGLTARFYKSCWEIVGPDVIKEVKIFF  837

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
                 +    N T + +IPK+ NPE ++ +RPI LCNV+YK+I+K ++ RLK  +  +V  
Sbjct  838   RTSYMKQSINHTNICMIPKITNPETLSDYRPIALCNVLYKIISKCLVERLKGHLDAIVSD  897

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRV--GWMALKVDLEKAYDRLSWCFIEDTLR  1296
              Q++F+ GR + DN +   E++++ +T+K RV   +MA+K D+ KAYDR+ W F+E T+R
Sbjct  898   SQAAFIPGRLVNDNVMIAHEMMHSLKTRK-RVSQSYMAVKTDVSKAYDRVEWNFLETTMR  956

Query  1295  DIGFNHT  1275
               GF+ T
Sbjct  957   LFGFSET  963


 Score =   207 bits (526),  Expect(2) = 9e-110, Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 186/332 (56%), Gaps = 1/332 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM  V S     L NG     I P++G+RQGDP+SP LF+LCA+ L+H++ + V  
Sbjct  964   WIKWIMGAVKSVNYSVLVNGIPHGTIQPQRGIRQGDPLSPYLFILCADILNHLIKNRVAE  1023

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +G+++    P ++HL FADD +FF ++N      +K   D++   SGQKIN+ KS +
Sbjct  1024  GDIRGIRIGNGVPGVTHLQFADDSLFFCQSNVRNCQALKDVFDVYEYYSGQKINMSKSMI  1083

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +  TQ  +   LGI S    GK+LGLP   GR K+D F+ I+ER+K R S  S+
Sbjct  1084  TFGSRVHGTTQNRLKNILGIQSHGGGGKYLGLPEQFGRKKRDMFNYIIERVKKRTSSWSA  1143

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  +M++SV  ++P Y+M    +P  ++  IE L+  F W     K +   + W
Sbjct  1144  KYLSPAGKEIMLKSVAMSMPVYAMSCFKLPLNIVSEIEALLMNFWWEKNAKKREIPWIAW  1203

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + L   N A LAK  WR+  + N L+  + KA+Y  + S+  + + 
Sbjct  1204  KRLQYSKKEGGLGFRDLAKFNDALLAKQVWRMINNPNSLFARIMKARYFREDSILDA-KR  1262

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRAT  280
             +R  S  W  +L  L + + G ++ V +G+  
Sbjct  1263  QRYQSYGWTSMLAGLDVIKKGSRFIVGDGKTV  1294



>gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam: rvt.hmm, score: 
42.57) [Arabidopsis thaliana]
Length=1662

 Score =   219 bits (559),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/608 (28%), Positives = 284/608 (47%), Gaps = 24/608 (4%)
 Frame = -1

Query  3056  GAASPSF-----RRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGY  2892
             GA SP       +  L    ++ K  ++ L E        + + S LGF   I     G+
Sbjct  386   GAGSPGIGVPLTQSQLSNLCKVFKFDVLFLIETLNKCEVISNLASVLGFPNVITQPPQGH  445

Query  2891  SGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             SGG+ L    S+ +  LY   + I   +  N +  + +S VYG    + R  L+      
Sbjct  446   SGGLALLWKDSVRLSNLYQDDRHIDVHISIN-NINFYLSRVYGHPCQSERHSLWTHFENL  504

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                    W+ +GDFN +   +E              F + +   +L D+   G  ++W+ 
Sbjct  505   SKTRNDPWILIGDFNEILSNNEKIGGPQRDEWTFRGFRNMVSTCDLKDIRSIGDRFSWVG  564

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI-TTCPQQFCSSRF  2355
                + + K   LDRA  N E +  FP A++  L   GSDH PL +S+  T  ++    RF
Sbjct  565   ERHSHTVKCC-LDRAFINSEGAFLFPFAELEFLEFTGSDHKPLFLSLEKTETRKMRPFRF  623

Query  2354  KFNMAWTTHYSFQACVQSVWRSDLD-----LSTNKSAMVEALSVWSRDSFGNIPQKKRRL  2190
                +    H  F+  V++ W   ++     L        +A++     S  N   +  +L
Sbjct  624   DKRLLEVPH--FKTYVKAGWNKAINGQRKHLPDQVRTCRQAMAKLKHKSNLNSRIRINQL  681

Query  2189  LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY  2010
              A L+    S++   R         +++EL      EE  W Q+SR +W+K GDRNT F+
Sbjct  682   QAALDKAMSSVNRTERR----TISHIQRELTVAYRDEERYWQQKSRNQWMKEGDRNTEFF  737

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFP  1833
                T  + + +R+  + D +G +   D  +  H  ++F  ++ +    V+  +F  G  P
Sbjct  738   HACTKTRFSVNRLVTIKDEEGMIYRGDKEIGVHAQEFFTKVYESNGRPVSIIDFA-GFKP  796

Query  1832  PLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRF  1653
              + E+    +    +  +I  A+  +   KA GPDG T  F+   W  VG  +   V  F
Sbjct  797   IVTEQINDDLTKDLSDLEIYNAICHIGDDKAPGPDGLTARFYKSCWEIVGPDVIKEVKIF  856

Query  1652  FEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVG  1473
             F    +    N T + +IPK+ NPE ++ +RPI LCNV+YK+I+K ++ RLK  +  +V 
Sbjct  857   FRTSYMKQSINHTNICMIPKITNPETLSDYRPIALCNVLYKIISKCLVERLKGHLDAIVS  916

Query  1472  PHQSSFVHGRQITDNTLAYQEILNAFRTKKGRV--GWMALKVDLEKAYDRLSWCFIEDTL  1299
               Q++F+ GR + DN +   E++++ +T+K RV   +MA+K D+ KAYDR+ W F+E T+
Sbjct  917   DSQAAFIPGRLVNDNVMIAHEMMHSLKTRK-RVSQSYMAVKTDVSKAYDRVEWNFLETTM  975

Query  1298  RDIGFNHT  1275
             R  GF+ T
Sbjct  976   RLFGFSET  983


 Score =   208 bits (530),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 190/337 (56%), Gaps = 3/337 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM  V S     L NG     I P++G+RQGDP+SP LF+LCA+ L+H++ + V  
Sbjct  984   WIKWIMGAVKSVNYSVLVNGIPHGTIQPQRGIRQGDPLSPYLFILCADILNHLIKNRVAE  1043

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +G+++    P ++HL FADD +FF ++N      +K   D++   SGQKIN+ KS +
Sbjct  1044  GDIRGIRIGNGVPGVTHLQFADDSLFFCQSNVRNCQALKDVFDVYEYYSGQKINMSKSMI  1103

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +  TQ  +   LGI S    GK+LGLP   GR K+D F+ I+ER+K R S  S+
Sbjct  1104  TFGSRVHGTTQNRLKNILGIQSHGGGGKYLGLPEQFGRKKRDMFNYIIERVKKRTSSWSA  1163

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  +M++SV  ++P Y+M    +P  ++  IE L+  F W     K +   + W
Sbjct  1164  KYLSPAGKEIMLKSVAMSMPVYAMSCFKLPLNIVSEIEALLMNFWWEKNAKKREIPWIAW  1223

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + L   N A LAK  WR+  + N L+  + KA+Y  + S+  + + 
Sbjct  1224  KRLQYSKKEGGLGFRDLAKFNDALLAKQVWRMINNPNSLFARIMKARYFREDSILDA-KR  1282

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGR--ATRFW  271
             +R  S  W  +L  L + + G ++ V +G+  + R+W
Sbjct  1283  QRYQSYGWTSMLAGLDVIKKGSRFIVGDGKTGSYRYW  1319



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score =   222 bits (565),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/582 (29%), Positives = 263/582 (45%), Gaps = 78/582 (13%)
 Frame = -1

Query  2969  ISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSA  2790
             I+++    +   +GF+    V + G +GG+ LF    +   ++      I   V D V  
Sbjct  2     INKSDVEALKDRIGFENAFGVASRGRAGGLCLFWKEEVQFSLVSFSHHHICGDVEDGVK-  60

Query  2789  PWLMSVVYGC-------LDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKE  2631
              W    +YG           +L RHL  D       P    L  GDFN + C +E     
Sbjct  61    KWRFVGIYGWPKEEEKHRTWSLIRHLCEDT----ILPI---LFGGDFNEILCYAEKEGGA  113

Query  2630  TFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPD  2451
                    ++F + +    L DLG+ G+ +TW RG    +    RLDR +S+      +P 
Sbjct  114   DRIRREMSNFRETMDNLALRDLGYVGTWHTWERGTSPSTCIRERLDRFISSDSWFTLYPH  173

Query  2450  AKVTHLPMIGSDHSPLLISITTCPQQFC-----SSRFKFNMAWTTHYSFQACVQSVWRSD  2286
               V H     SDHS ++I     PQ+F        R  F   W    + +A V++ W + 
Sbjct  174   TSVEHTLRYKSDHSAIVIK----PQKFSRPTKRKKRRYFETCWLLDENCEAVVRTAWDAS  229

Query  2285  LDLSTNK--SAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrl  2112
             +  S      +M +AL  WS ++F  I                                 
Sbjct  230   IGTSVTGRVESMGQALLTWSAENFTKIA--------------------------------  257

Query  2111  rkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICD  1932
                           W+ RSR   +K GDRNT+++    T +R ++ V  L D  G    D
Sbjct  258   -------------YWYLRSRVAEVKDGDRNTKYFHHKATQRRKRNYVKGLFDEQGTW-WD  303

Query  1931  DGLLLKHVY-DYFLGLFTTE--VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALF  1761
             D   +++++  YF  +FT+    D +         P +       +  PFT ++I  A+ 
Sbjct  304   DADNIENIFTSYFDSIFTSSNPSDSDFDEVLQFIDPVVSAACNQQLLRPFTKDEIYAAIQ  363

Query  1760  DMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGC-NDTILSLIPKVQN  1584
              M PCKA G DG    F+ + W  +G  +  FV      GIL P C N+T ++LIPKV+N
Sbjct  364   QMHPCKAPGHDGMHAIFYQRFWHIIGDDVTLFVSNILH-GILSPSCVNNTNIALIPKVKN  422

Query  1583  PERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEIL  1404
             P +   FRPI LCNV+YKL++K ++IR+KD + +++   QS+FV GR ITDN L   E+ 
Sbjct  423   PTKAADFRPIALCNVLYKLVSKSLVIRMKDFLPQMISEQQSAFVPGRLITDNALIAMEVF  482

Query  1403  NAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             ++ + + + + G +A+K+D+ KAYDR+ W F+   L  +GF+
Sbjct  483   HSMKNRSRSQRGTIAMKLDMSKAYDRVEWGFLRKLLLTMGFD  524


 Score =   206 bits (523),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 139/426 (33%), Positives = 216/426 (51%), Gaps = 10/426 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+   M CV+S     + NG +   + P +GLRQGDP+SP LF++ A+  S M+   V+ 
Sbjct  527   WVNLSMNCVSSVTYSFIINGGVCGSVVPARGLRQGDPLSPYLFIMIADAFSKMIQKKVQD  586

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K +R  P++SHLFFADD + F  A   +   +   L+L+   SGQKIN +KS +
Sbjct  587   KQIHGAKASRSGPDISHLFFADDKLLFTRATRQECTVIVDILNLYELASGQKINYEKSEV  646

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK  +   ++ + + L +  V    K+LG+PSI  R KK  FD++ +RI  +L G   
Sbjct  647   SFSKGVSSTQREELTSILNMRQVDKHEKYLGIPSISSRSKKAIFDSLTDRIWKKLQGWKE  706

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  ++++SV+  IP Y M    IP  +I  I+  +  F WGS   + K H   W
Sbjct  707   KLLSRAGKEILLKSVIQVIPTYLMGVYKIPCMIIQKIQSAMARFWWGSSNSQRKVHWKSW  766

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               + + K  GG+G K LK  N A L + AWRL ++ N L+  + KAKY F    +     
Sbjct  767   DSLCSPKCLGGMGFKDLKVFNDALLGRQAWRLIREPNLLFGRVMKAKY-FPHCDFLDAPL  825

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD---RPLFEEASAPIAPSS  205
               +SS +W+ I  +  + + G+ W V NG   + W D W+ D   R L  E +     S 
Sbjct  826   GYSSSYSWRSIWSSKALVKEGVIWRVGNGTQIKLWDDPWVADENGRFLTSEKNPNF--SL  883

Query  204   LNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
             +++L+    + N  W  ++ D    E  +  +    L     + D L W    +  +SV 
Sbjct  884   VSDLID---LENMEWRTEIFDSSFNERDIRCILGTPLSS-APVKDELTWAFTRDAHYSVK  939

Query  24    SAYELA  7
             +AY + 
Sbjct  940   TAYMIG  945



>ref|XP_009129032.1| PREDICTED: uncharacterized protein LOC103853884 [Brassica rapa]
Length=1091

 Score =   246 bits (627),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 148/424 (35%), Positives = 229/424 (54%), Gaps = 8/424 (2%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W R +M C+ +     L N  +   + P +G+RQGDP+SP +F+LC+E LS M  ++ 
Sbjct  346   PIWTRWMMQCIATVSYSYLINDTVYGNVIPYRGIRQGDPLSPYVFILCSEVLSGMCKNAS  405

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
             RSG  +GV+V R +P ++HL FADD +FF +AN      +   L  +   SGQKIN  K 
Sbjct  406   RSGALQGVRVARGSPRVNHLLFADDTMFFTQANQKSCETLMSILQEYERVSGQKINKAKI  465

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ FS  T+   ++N  + LGIP    +GK+LGLP   GR K+D F +I++RI+ +    
Sbjct  466   SITFSSKTSPTIRENAKSILGIPKEGGLGKYLGLPEHFGRRKRDLFTSIVDRIRQKAISW  525

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             S++ LS AG   M+QS+LSAIP Y+M   L+P  +   I+ ++  F W   +GK K   V
Sbjct  526   STKRLSRAGKLTMLQSILSAIPTYTMSCFLLPVSLCKRIQSVLTRFWWDGNDGKRKICWV  585

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +T  KA GGLG+K ++  N A LAKLAWR+    N L   +   KY    S     
Sbjct  586   AWDKMTKPKALGGLGLKDIQRFNQALLAKLAWRIITVPNSLLARILMGKYCHRKSFLEV-  644

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             +  +N S+ W+ IL    + +  +   + NG+ TR W DSW+  +   +    PI  ++L
Sbjct  645   ESNQNCSHGWRSILHGRDLLKTNLGRAIGNGQTTRVWQDSWISLKENIKPM-GPITEATL  703

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSV  28
             +  VA+   ++  W+   ++ +LP          +  + +L G  D  +W    +G++S 
Sbjct  704   DLTVADLLTTDMKWNKRRIEGLLPAFA----DKILCLQPSLRGAEDSFIWRATNSGVYST  759

Query  27    SSAY  16
              S Y
Sbjct  760   KSGY  763


 Score =   182 bits (461),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 154/276 (56%), Gaps = 10/276 (4%)
 Frame = -1

Query  2090  LYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLK  1914
             LYQ EE  W QRSR+ W+  GD NT ++   +  +  ++R+S + + +G  + ++  + +
Sbjct  74    LYQKEEEFWKQRSRQLWLSLGDSNTGYFHAVSKGRSAKNRMSVIENKEGRPVYEEEQIAE  133

Query  1913  HVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFT----PEDIKTALFDMVPC  1746
              +  Y+  LF + +D + +        P + +   + N   T     ++IK A F +   
Sbjct  134   VIASYYTDLFKS-IDYDGSQTIAEALRPCITD---AHNEKLTEIPQAQEIKMATFTIHAD  189

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             KA GPDGF+  FFH  W  VG ++   +  FF  G L P  N T + LIPK+Q   ++  
Sbjct  190   KAPGPDGFSAAFFHSNWEVVGPAVIKEIQMFFISGNLAPDVNMTHVRLIPKIQGAAKVED  249

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK  1386
             +RPI LCN+ YK+I+K++ +RLK ++  ++  +QS+F+ GR I DN L   E+L+  +  
Sbjct  250   YRPIALCNIYYKIISKLLSLRLKTVLSSIISENQSAFIPGRAIADNVLITHELLHFLKAS  309

Query  1385  KGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             K      MA+K D+ KAYDRL W FI+  L  +GF+
Sbjct  310   KAEKNCTMAVKTDMSKAYDRLEWSFIDQVLGRLGFS  345



>ref|XP_009349611.1| PREDICTED: uncharacterized protein LOC103941142 [Pyrus x bretschneideri]
Length=1468

 Score =   269 bits (688),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/603 (29%), Positives = 296/603 (49%), Gaps = 15/603 (2%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S +  R L   +R H+P LI L E K+   + + +   +G+ E   V  +G +
Sbjct  632   WNCRGLGSDTVVRALHGLIRKHRPDLIFLAETKMRDIRVDGVRRRMGYREAFHVSPIGRA  691

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ ++ + S+++ I +T    I   V Y +++    ++ VYG    + +   +  +  +
Sbjct  692   GGLSMWWNESVDVTIGFTSKHIIDATVNYVDLNHQARVTWVYGTAYRSEKVEFWRWMREW  751

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
             F      WL  GDFN +    E S   + + +R     +++ + +L+DL + G  +TW R
Sbjct  752   FKPTNSPWLCGGDFNEIIWDHEKSGGASSNYNRPRYLEEFLKVTDLMDLDYNGPCFTW-R  810

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
             G+        RLDR L+N +    +P   V H  +IGSDH PL+I  T    Q     F+
Sbjct  811   GMRNGHLVEERLDRGLANRQWQDSWPYTMVIHETVIGSDHCPLIIR-THHGAQKTKKLFR  869

Query  2351  FNMAWTTHYSFQACVQSVWRSD------LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRL  2190
             F   W      +  V+  WR +      +      +     L+ WS+ +F +  ++   L
Sbjct  870   FEAFWAKEERCKEIVECCWRQEGQGDRIMRWQRKLNECRVRLTRWSQQAFHSRGRELTCL  929

Query  2189  LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY  2010
             L RL GV   L    R +   ++    +       +E+  W QRSR +W+K GD NT F+
Sbjct  930   LNRL-GV---LQHNWRQNWEEIKLVSGRIDRLGEIEEQF-WQQRSRVKWLKEGDANTAFF  984

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPP  1830
               +T  +R +++V K+ D +G  I     + KH+ + F  LF+T       +        
Sbjct  985   HQSTLQRRRRNKVVKIKDGNGVWIDKQCEVQKHIEEQFKELFSTSGPREWGSMLDCLHHK  1044

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             + +E  A +    T E++++A   M   KA GPDGF   F+H  W  +   +   V  F 
Sbjct  1045  VSDEMNAGLIKSVTLEEVQSAALQMGGLKAPGPDGFQGIFYHSFWNYLIEDVNGIVQDFM  1104

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
             +    P   N T + L+PK+ NP+ + QFRPI LCN  YK+++K++  RLK ++ +++  
Sbjct  1105  QGVSNPQRLNSTHIVLVPKITNPDSVGQFRPISLCNYSYKIVSKILANRLKPLLPEIIST  1164

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRD  1293
              Q +FV GRQI DN     E+ +  + +K R  + M +K+D+ KAYDR+ W F+E  +  
Sbjct  1165  TQGAFVGGRQIQDNIGIAHEMFHFLKLRKARSKFEMGVKLDMHKAYDRVEWDFLEAVMEK  1224

Query  1292  IGF  1284
             +GF
Sbjct  1225  MGF  1227


 Score =   158 bits (400),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 127/233 (55%), Gaps = 0/233 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M CV +  L  L NGQ      P +G+RQGDP+SP LF+L  E L+ ++   V  
Sbjct  1231  WRNLVMGCVKTVELAILLNGQPGKSFIPSRGIRQGDPLSPYLFILVGEVLARLIQQEVER  1290

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+++    P +SHLFFADD + F  A+    + + + LD +C  SGQ++N QKS +
Sbjct  1291  RRLTGIQLNNGCPTISHLFFADDTLIFMRADQQNCVCLLRILDAYCRASGQQVNYQKSCI  1350

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF  N        +   +G+P   D GK+LGLPSI GR KK     + ERI  ++ G   
Sbjct  1351  FFGANVPRSLSVELGHIVGMPLAEDPGKYLGLPSIWGRSKKQGLAFVKERILEKVQGWKQ  1410

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKN  577
              TLS AG  VM+++V+ AIP YSM     P  +   ++ +I  F WG R G+ 
Sbjct  1411  CTLSQAGKEVMIKAVIQAIPAYSMHLFKFPKTLCSDLDAIIAEFWWGKRGGQE  1463



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score =   268 bits (685),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/608 (30%), Positives = 299/608 (49%), Gaps = 25/608 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  S +  R L   +R H+P++I L E K+   + + +   LGF +   V  +G +
Sbjct  59    WNCRGLGSDTVVRALYGLIRKHRPAMIFLSETKMKDHRVDGVRRRLGFSKGFHVSPIGRA  118

Query  2888  GGIWLFCSVSINIEILYTHPQFI--AFQVYDNVSAPWL-MSVVYGCLDMALRRHLFADLS  2718
             GG+ ++   S+++E+ ++    I   F++ D  S  W  ++ VYG    A +   +  + 
Sbjct  119   GGLSMWWDESVDVEVGFSSKYSIDARFKLVD--SEGWTRVTWVYGTSYRAEKEAFWGWMH  176

Query  2717  *YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW  2538
              +F      WL  GDFN +    E S     + +R     +++   EL+D+ F G  +TW
Sbjct  177   TWFKPSNIPWLCGGDFNEILWDYEKSGGXDLNYNRPWFLEEFLNSSELMDMEFKGPPFTW  236

Query  2537  IRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR  2358
              RG+        RLDR LSN      +P++ V H P+IGSDH PL+I   + P      +
Sbjct  237   -RGMRNGQLVEERLDRVLSNKLWQECWPNSLVIHEPVIGSDHCPLIIQ--SQPHGHKPKK  293

Query  2357  -FKFNMAWTTHYSFQACVQSVWR---SDLDLSTNKSAMVEA---LSVWSRDSFGNIPQKK  2199
              F+F   W      +  V+S WR   S   ++  +  M +    LS WSR++F +   + 
Sbjct  294   VFRFEAFWAKEEKCKEIVESCWRRQYSGDGIARWQKKMHQCRSQLSCWSRNAFKSRGIEL  353

Query  2198  RRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRN  2022
               LL +L  +Q + +            +        L++ EE  W QRSR +W++ GD N
Sbjct  354   DCLLNQLGDLQYNWNQNFEQ------IQELTVSIGRLWEIEESYWLQRSRVKWLQEGDAN  407

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYG  1842
             T F+  +T  +R ++ V KL D     + +   +     D+++ LFT+   +        
Sbjct  408   TAFFHQSTLQRRRRNCVVKLQDGRQGWVENQDSIRHTFEDHYINLFTSS-GLRDWGQSLH  466

Query  1841  CFPPLLEEDW-ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSF  1665
             C   ++ +     +  P   E+IK A F M   KA GP+GF   F+   W T+   +   
Sbjct  467   CIQHMVSDQMNEELTRPVGVEEIKLAAFQMGGLKAPGPNGFQGIFYQTFWNTLLDDVNCI  526

Query  1664  VHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVR  1485
             V  + +    P   N T + L+PKV+NP  + QFRPI LCN  YK+++KV+  RLK ++ 
Sbjct  527   VQDYMQGACSPKRLNSTYIVLVPKVKNPVSVGQFRPISLCNYSYKIVSKVLANRLKPILP  586

Query  1484  KLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIE  1308
              L+ P QS+FV GRQI DN     E+ +    +K +  + M +K+D+ KAYDR+ W F+E
Sbjct  587   DLISPMQSAFVSGRQIQDNIGIAHEMFHFLHXRKAKYKFEMGIKLDMHKAYDRVEWDFLE  646

Query  1307  DTLRDIGF  1284
               +  +GF
Sbjct  647   AVMERMGF  654


 Score =   159 bits (401),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 127/423 (30%), Positives = 177/423 (42%), Gaps = 72/423 (17%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M CV +     + NGQ     +P +G+RQGDP+SP LF+L   + S M       
Sbjct  658   WRNLVMGCVKTVDFAVILNGQPGRKFTPSRGIRQGDPLSPYLFILVNVQKSCM-------  710

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                                      FFG AN   +L  + C                   
Sbjct  711   -------------------------FFG-ANVPNSLSAELC-------------------  725

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                              +G+PS  + G +LGLPS  GR KK S   +  RI  ++     
Sbjct  726   ---------------TVMGMPSAENPGLYLGLPSSWGRSKKQSLAFVKGRILEKIQXWKQ  770

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              TLS AG  VM+++VL AIP Y M     P+ +   ++ LI  F WG + G+ + H V  
Sbjct  771   NTLSQAGKEVMIKAVLQAIPAYPMNXFKFPATLCSEMDSLIAAFWWGQKGGEKRIHWVSK  830

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              ++   K  GG+G +  K  N A LAK  W L QD + LW  + KA+Y  + S   + + 
Sbjct  831   DLLGLPKQAGGMGFRGFKEFNDALLAKQCWXLIQDPDSLWAKILKARYFPNGSFLDAIR-  889

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                +S  W  +L    +   G  W + NGR TR W+D W+   P          P S N 
Sbjct  890   GGXASWGWSSLLVGREVLLQGAHWQIMNGRTTRVWMDMWIPSIPEGHPLPISAVPVSRNL  949

Query  195   LVANYWISNEG-WDWDMLDRVL-PEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
              V      + G WD D L   + PE     L T +   D LL DRLVW    NG+++V S
Sbjct  950   RVGTLISDSSGTWDLDFLQPFISPEDFSAILDTCI--GDPLLEDRLVWPGTRNGIYTVKS  1007

Query  21    AYE  13
              Y 
Sbjct  1008  GYH  1010



>gb|ABB46931.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1853

 Score =   226 bits (576),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 223/434 (51%), Gaps = 25/434 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ IM C+T  R     NG L +  +P +GLRQGDP+SP LF+  A+ LS +++  V  
Sbjct  1138  WVKWIMACITLVRYAVKLNGTLLNTFAPSRGLRQGDPLSPFLFLFVADGLSFLLEEKVDQ  1197

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    + + R AP + HL FADD   F +A + QA+ MK+ L+ + SC+GQ IN  K S+
Sbjct  1198  GAMNPIHICRHAPAVLHLLFADDTPLFFKAANDQAVVMKEVLETYASCTGQLINPSKCSI  1257

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +++    Q  I  TL I +  +  K+LG P+  GR+ K  F ++ ER+  R+     
Sbjct  1258  MFGQSSPTAVQNQIKQTLQISNSFE-DKYLGFPTPEGRMTKGKFQSLQERLWKRIMLWGE  1316

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  +++++VL A+P Y M    +P  V + + +L+R F WG+ +G  + H   W
Sbjct  1317  KFLSTGGKEILIKAVLQAMPVYVMGLFKLPESVCEELTKLVRNFWWGAEKGMRRTHWKSW  1376

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G +  +  N A LA+ AWRL    + L   + KA Y  + S+  +   
Sbjct  1377  DCLIAQKLKGGMGFRDFRLFNQALLARQAWRLLDRPDSLCARILKAIYYPNGSLIDT-SF  1435

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N+S  W+ I   L + + GI W + NG++ R W D W+         S    P S   
Sbjct  1436  GGNASPGWRAIEYGLELLKKGIIWRIGNGKSVRLWRDPWI-------PRSYSRRPISAKR  1488

Query  195   LVANYWISN-----EGWDWDMLDR-VLP---EHILN-KLSTFVLQEDTLLGDRLVWYKEP  46
                  W+S+       WD D + +  LP   E ILN +LS+       L  D + W+ + 
Sbjct  1489  NCRLRWVSDLIDQSGSWDTDKISQHFLPMDAEAILNIRLSS------RLEDDFIAWHPDK  1542

Query  45    NGLFSVSSAYELAL  4
              G FSV SAY LA+
Sbjct  1543  LGRFSVRSAYHLAV  1556


 Score =   200 bits (508),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 153/268 (57%), Gaps = 1/268 (0%)
 Frame = -1

Query  2078  ELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDY  1899
             ++IW QRSR  W+K GDRNTRF+      +  +++++KL D+D  +      L +   +Y
Sbjct  869   QMIWLQRSRIAWLKEGDRNTRFFHNKAVWRAKKNKITKLRDSDDTVHSTTKELERMATEY  928

Query  1898  FLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFT  1719
             F  LFT +  ++ +       P + +     +   F+ E+I  ALF + P KA GPDGF 
Sbjct  929   FQRLFTADPSIDHSRVTSLMKPKVTDAMNEELCKTFSEEEIANALFQIGPLKAPGPDGFP  988

Query  1718  PGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNV  1539
               F+ + W  +   +   V  FF  G +P G N+T + LIPK + P+ +  FRPI LCNV
Sbjct  989   GRFYQRNWAILKDDIVRAVQEFFSLGTMPSGVNETAIVLIPKTEQPQELKDFRPISLCNV  1048

Query  1538  VYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTL-AYQEILNAFRTKKGRVGWMA  1362
             VYK+++K ++ RL+ ++  LV  +QS+FV GR ITDN L A++   +  R K     + A
Sbjct  1049  VYKIVSKCLVNRLRPILDDLVSQNQSAFVPGRLITDNALIAFEYFHHIQRNKNPENAYSA  1108

Query  1361  LKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              K+DL KAYDR+ W F+E  +  +GF H
Sbjct  1109  YKLDLSKAYDRVDWEFLEQAMVKLGFAH  1136


 Score = 67.8 bits (164),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 8/178 (4%)
 Frame = -3

Query  4362  RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVT  4183
             R+ +   L   ++  W+L A     +L  + FI  F    DYD V  GGPW+   D L+ 
Sbjct  255   RTPNQVALFDDMRRAWRLRADISYKSLRDNMFIITFSAEGDYDFVIKGGPWIHRGDALLV  314

Query  4182  QEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGK  4003
               +     P    +D +  W+R   LP+        +  G  +G+  ++D+     +K  
Sbjct  315   ASFDGITCPSNVPLDVVPIWVRIYDLPLVLMTKVRGEMFGSKLGKVREVDVGDDGRNKHD  374

Query  4002  FARVCVQLDITKPLLSNFVINGTEWPKE--------YEGIHQICFKCSIYGHRMETCG  3853
             F  + V L + +PL S   I  T   KE        YE +   CF C   GH    C 
Sbjct  375   FFHIRVDLPVKRPLKSQIAIRMTVQGKEVLRRFDLHYERVPHFCFICGFIGHSDRDCN  432


 Score = 65.9 bits (159),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 75/145 (52%), Gaps = 1/145 (1%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHL  2733
             V + G SGG+ LF   SI++EI+  + ++I   V  +V+AP W  + VYG   +  R  +
Sbjct  714   VNSDGMSGGLALFWHESIHVEIISMNERYIDAYVRLSVNAPVWHATFVYGEPRVENRHRM  773

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             +A L+         WL +GDFN    Q E  + +  S  +   F D +   +L DLGF+G
Sbjct  774   WALLNSIKQVSDLPWLVVGDFNETLWQFEHFSLKQRSELQMQAFRDVVQRCDLHDLGFSG  833

Query  2552  SSYTWIRGLDTPSFKGARLDRALSN  2478
               YT+    +  S    RLDRAL++
Sbjct  834   VPYTYDNRREGRSNVKVRLDRALAD  858



>emb|CCA66180.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score =   233 bits (594),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 174/604 (29%), Positives = 291/604 (48%), Gaps = 23/604 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQAN--EICSSLGFDEWIRVEAVG  2895
             WN +G  +   R +L+  + ++ P  + + E K+    A     C      EWI   + G
Sbjct  7     WNIRGLNARMKRASLRKLIAINNPGCVFVQETKMENINARLMRTCWKSNEIEWIFSPSRG  66

Query  2894  YSGGIWLFCSVSI-NIEILYTHPQFIAFQ-VYDNVSAPWLMSVVYGCLDMALRRHLFADL  2721
              SGGI      +I N      H  +IA   ++        +  VY   ++A R  ++  +
Sbjct  67    SSGGILAIWDKNIFNANSNVIHQSWIAISGIFSTDQFECTLITVYNPCEIAARSEVWKQI  126

Query  2720  S*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
               +  +     L +GDFN V   SE     +FS +   DF  ++   +L+++  +  +YT
Sbjct  127   IEFQNSNPLPCLLVGDFNEVLRPSE-RGSLSFSHNGINDFKSFVQELKLLEIPSSSRAYT  185

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSS  2361
             W R  ++ S     LDR L + E     P+ KV+ L    SDH PLL+   +  Q++   
Sbjct  186   WYRA-NSKSL----LDRLLVSPEWVSHCPNIKVSILQRGLSDHCPLLVH--SHIQEWGPK  238

Query  2360  RFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKS--AMVEALSVWSRDSFGNIPQKKRRL-  2190
              F+FN  W T       V++ W S   +S  +      + L  W+ + FG+I    R+L 
Sbjct  239   PFRFNNCWLTDPKCMKIVEASWSSSPKISVVEKLKETKKRLKEWNLNEFGSIDANIRKLE  298

Query  2189  --LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTR  2016
               +A  +  + +    +  + +   R  + +L + + ++E+ W QRSR  W+K+GD+NT+
Sbjct  299   DCIANFD--KEADERELDKEELEKRREAQADLWKWMKRKEIYWAQRSRITWLKAGDKNTK  356

Query  2015  FYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCF  1836
             F+    + K+ ++ ++  ++ DG    D   + K    +F  +F  E  V R        
Sbjct  357   FFHAIASNKKRKNMMA-CIETDGQSTNDPSQIKKEARAFFKKIFK-EDHVKRPTLENLHL  414

Query  1835  PPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHR  1656
               L +    S+  PFT E+I TA+      KA GPDGF   F    W  + T ++  V+ 
Sbjct  415   KRLSQNQANSLITPFTTEEIDTAVSSCASDKAPGPDGFNFKFVKSAWDIIKTDIYGIVND  474

Query  1655  FFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLV  1476
             F+E G LP GCN   ++LIPK+ NP  +  +RPI +   +YK++ K++  RL+ ++  L+
Sbjct  475   FWETGCLPQGCNTAYIALIPKIDNPSSLKDYRPISMVGFIYKIVAKLLAKRLQSVISSLI  534

Query  1475  GPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLR  1296
              P QSS+V GRQI D  L   EI+ +   KK  +  + LK+D  KAYD +SW F++ TL 
Sbjct  535   SPLQSSYVKGRQILDGALVASEIIES--CKKRNIEAILLKLDFHKAYDSVSWNFLQWTLD  592

Query  1295  DIGF  1284
              + F
Sbjct  593   QMNF  596


 Score =   192 bits (487),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 225/434 (52%), Gaps = 18/434 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   I  CVTS     L NG  T      +GLRQGDP+SP LFVL  E LS M+  +   
Sbjct  600   WCEWIKTCVTSASASILVNGSPTPPFKLHRGLRQGDPLSPFLFVLVGEVLSQMISKATSL  659

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               W+G+        ++HL +ADD + F EAN+     ++K L +F   SG ++N  KSSL
Sbjct  660   QLWRGIPACSRGSEITHLQYADDTLMFCEANTNSLKNIQKTLIIFQLVSGLQVNFHKSSL  719

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                  T+   Q+   + +     +    +LGLP      +  ++D I+++++ +L+    
Sbjct  720   MGLNVTSSWIQEAANSLMCKIGTIPFS-YLGLPIGDNPARIRTWDPIIDKLEKKLASWKG  778

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LSL G   ++++ LS +P Y M    +P GVI+ I +L+R FLW    GK    +V W
Sbjct  779   KLLSLGGRLTLIKASLSNLPLYYMSLFPVPKGVIEKINKLMRAFLWCGDFGKRPFSMVSW  838

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              IV   K +GGLGI ++ H NL+ L K  WRL ++ + +W ++ ++KY++  +   S   
Sbjct  839   SIVQQPKTSGGLGIGNILHKNLSLLFKWIWRLFENPSSMWGSIIRSKYNYSSTCSISDLK  898

Query  375   KRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPI  217
             K  S   WK I  A+        I  NG++ +V NG ++ FW D+WL ++PL   A    
Sbjct  899   KPVSGGPWKSICAAVLGHEGARLIAVNGMRKNVGNGISSLFWHDTWLCEQPLKRIAPRLF  958

Query  216   APS-SLNNLVANYWISNEGWDWDML---DRVL-PEHILNKLSTFVLQEDTLL----GDRL  64
             + + + N+ +A+Y +  EG++W  +    RVL P+ ++ K     L +   L     D+L
Sbjct  959   SIAINKNSSIASYGVW-EGFNWVWVFSWKRVLRPQDLVEKAHLDELLKSVRLDPNADDQL  1017

Query  63    VWYKEPNGLFSVSS  22
             +W  E +G FS  S
Sbjct  1018  IWAPEKSGRFSTKS  1031



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score =   227 bits (579),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/423 (35%), Positives = 218/423 (52%), Gaps = 30/423 (7%)
 Frame = -1

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYS  2322
             RLDRAL N +    FPD    +LP I SDH+PL+++I    +      F F+  W     
Sbjct  159   RLDRALGNEDWHDLFPDTVTEYLPRIASDHAPLIVNIG-AKRSRGKRTFMFDRRWIGKAG  217

Query  2321  FQACVQSVWR--------SDLDLSTNKSAMVEALSVWSRDS--FG-NIPQKKRRLLARLE  2175
                 +   W         S +D   N      A+S W ++   FG +I +  +R LA  +
Sbjct  218   LMESISQGWNGGHHEGPTSVVDKIVN---CRRAISHWRKEQVPFGRDIIEDLKRQLAVAQ  274

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
                 ++S G+ +DL    R            EE+ W+Q+SR  W++ GD+NT+++Q  T 
Sbjct  275   ADD-AVSSGVITDLTMRLRD-------AYNDEEIYWYQKSRNRWMRVGDKNTKYFQAQTK  326

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNF--CYGCFPPLLE  1821
              +R ++R++ L D +      D  +      YF  LFT+   ++ +NF         ++ 
Sbjct  327   QRRARNRITGLYDRNNVWSTKDDDICTVAVSYFEDLFTS---IHPSNFEAALSEVKRVIT  383

Query  1820  EDWAS-VNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFED  1644
             ED    + AP    +++ ALF M P KA GPDG T  FF K W  V   L + V+RFFE+
Sbjct  384   EDVNERLTAPAMEAEVRKALFLMSPDKAPGPDGMTALFFQKAWRVVKEDLVAMVNRFFEE  443

Query  1643  GILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQ  1464
             G+     N T + LIPKV  P R+ + RPI LCNV YKLI+K +  RLK ++ +L+   Q
Sbjct  444   GVFDKSLNRTHICLIPKVAKPTRMAEMRPISLCNVGYKLISKNLCQRLKGVLPELISETQ  503

Query  1463  SSFVHGRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIG  1287
             S+FV GR I+DN L   E+ +  RT     G +MA+K D+ KAYDR+ W FIE  LR +G
Sbjct  504   SAFVPGRLISDNILIAHEMFHGLRTNPSCKGKFMAIKTDMSKAYDRVEWGFIEALLRKMG  563

Query  1286  FNH  1278
             F  
Sbjct  564   FGE  566


 Score =   197 bits (502),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 204/430 (47%), Gaps = 18/430 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CVTS     L NGQ    I P +GLRQGDP+SP LF+LC E L   +  + R 
Sbjct  568   WISRIMFCVTSVEYKVLLNGQPNGRIVPERGLRQGDPLSPYLFILCTEVLVANIKRAERE  627

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV    P ++HL FADD +FF +A   Q   +   L+ + + SGQ+IN  KSS+
Sbjct  628   KQITGIKVANKCPPITHLLFADDSLFFCKAEKAQCEVILGILNQYEAVSGQQINFAKSSV  687

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +   +  +   LGI ++  MG +LGLP   G  K   F  + +R++ R +G S+
Sbjct  688   QFGHKVDDTVRSEMQGVLGISNLGGMGSYLGLPESLGGSKTKVFSFVRDRLQGRTTGWSA  747

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  VM++SV +A+P + M    IP  +   +   +  F W +       H + W
Sbjct  748   KLLSKGGKEVMIKSVATAVPTFVMSCFRIPKIITSKLTSAVANFWWSTSGQSGGLHWLAW  807

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY-----DFDPSVW  391
               +  SK  GGLG +++   N A LAK  WRL +  + L+  +FK +Y       DP   
Sbjct  808   DKLCFSKQLGGLGFRNVDAFNTALLAKQLWRLIEAPDTLFARVFKGRYYRNSNPMDP--L  865

Query  390   SSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLL---DRPLFEEASAP  220
              S+ P    S  W+ I  A  +   G+   V +G +   W D W+     RP F +    
Sbjct  866   RSYSP----SYGWRSITSARSLVNKGLIIRVSSGESISIWTDPWVPAQSPRPAFSKGPHK  921

Query  219   IAPSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNG  40
                  +++L+  +      W  D L        ++ +    L     L D + W+   +G
Sbjct  922   DPSLKISHLIDCH---TNTWRMDRLKEFFAPEDVDLIGAIPLGSRR-LDDSMGWHYTKSG  977

Query  39    LFSVSSAYEL  10
              ++V S YE+
Sbjct  978   KYAVKSGYEV  987



>gb|ABA98898.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1188

 Score =   240 bits (612),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/481 (32%), Positives = 244/481 (51%), Gaps = 42/481 (9%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL +GDFN    Q E  +    + ++   F D +   +L  LGF+G  YT+    +  + 
Sbjct  16    WLVLGDFNEALWQFEHFSVRQRNETQMQSFRDVLQTCDLHALGFSGVPYTYDNRREGRNN  75

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQ---FCSSRFKFNMA  2340
                RLDRAL++ +    F +A+V+HL    SDH P  IS+   P+    F +    + + 
Sbjct  76    IRVRLDRALADNDWREMFGNARVSHLTSTRSDHCP--ISVCFSPEDCRPFHTKCLHYEIC  133

Query  2339  WTTHYSFQACVQSVW-----RSDL-DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             W    S Q  +   W     +SDL ++ST    ++  L  WS+    N+ ++  +   RL
Sbjct  134   WEREPSLQEVITDAWSEGVSKSDLGEISTALHRVMTRLHSWSKVKVKNVGKELEKARKRL  193

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
                    S+ +      L R+    L E LY+EE++W QRSR  W+K GDRNTRF+    
Sbjct  194   T------SLLVSDAESSLVRQALDHLNELLYREEMLWLQRSRINWLKEGDRNTRFFHSKG  247

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
               +  ++++S L DA G +     ++ +   DYF  LF+ + +++ +         L++E
Sbjct  248   VWRAKKNKISALRDASGTVHHLTNVMEQMATDYFKTLFSADPNLDHSRVT-----TLIQE  302

Query  1817  DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
                                 + P KA GPDGF   FF + W  +   +   V  FF  G+
Sbjct  303   K-------------------IGPLKAPGPDGFPARFFQRNWGLLKEEVVKAVKEFFNTGV  343

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
             +P G N+T + LIPKV  P  +  +RPI LCNV+YK+++K ++ RL+ ++ +L+ P+QS+
Sbjct  344   MPAGVNETAIVLIPKVDQPIELRDYRPISLCNVLYKVVSKCLVNRLRPILDELISPNQSA  403

Query  1457  FVHGRQITDNTLAYQEILNAF-RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             FV GR ITDN L   E  ++  + KK      A K+DL KAYDR+ W F+E ++  +GF 
Sbjct  404   FVPGRMITDNALIAFECFHSIQKNKKLSSATCAYKLDLSKAYDRVDWKFLEQSMYKLGFA  463

Query  1280  H  1278
             H
Sbjct  464   H  464


 Score =   184 bits (468),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 127/430 (30%), Positives = 198/430 (46%), Gaps = 64/430 (15%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM C+TS R    +NG L    +P +GLRQGDP+SP LF+   + LS +++  V  
Sbjct  466   WVNWIMSCITSVRYSVKFNGTLLSTFAPSRGLRQGDPLSPFLFLFVVDGLSLLLEERVAQ  525

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    V + R AP +S+L F DD + F +A S QA  +   L  +  C+GQ IN +K S+
Sbjct  526   GALSPVHICRRAPGISNLLFTDDTLLFFKATSEQANVVMNVLADYAWCTGQLINQEKCSI  585

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F + +    Q+++ + L + S     K+LG P+  GR+ K  F ++ E++  R+     
Sbjct  586   MFGEASPPDVQESVRSVLQVGSTSFDDKYLGFPTPEGRMNKGKFQSLQEKLCKRIMQWGE  645

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  +++++VL AI  Y M    +P  + D + +L R F WGS +GK K H   W
Sbjct  646   NFLSSGGKEILIKAVLQAITVYVMGIFKLPDSICDELTKLTRNFWWGSEKGKRKAHWKSW  705

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K  GGLG +  +  N A LA+ AWRL ++ + L                     
Sbjct  706   DCITKPKHCGGLGFRDFRLFNQALLARQAWRLIENPHSL---------------------  744

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                                           + + W D WL      + +  PI P     
Sbjct  745   ------------------------------SIKIWRDPWLPR----DFSRRPITPKGNCR  770

Query  195   L--VANYWISNEGWDWDMLDRV---LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
             L  VA+    N  WD D++ ++   L   I+  +     Q++    D + WY +  G FS
Sbjct  771   LKWVADLLDQNGSWDRDVISQLFWPLDGEIIKSIRLSSRQDE----DFIAWYPDKMGQFS  826

Query  30    VSSAYELALE  1
             + SAY LA++
Sbjct  827   IRSAYMLAVQ  836



>ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica]
 gb|EMJ04149.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica]
Length=1162

 Score =   249 bits (637),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 180/601 (30%), Positives = 283/601 (47%), Gaps = 31/601 (5%)
 Frame = -1

Query  3035  RRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLG--FDEWIRVEAVGYSGGIW-LFCS  2865
             R  +K  LR  KP ++ L E K        +    G  F EW+   ++G SGGI  L+ S
Sbjct  3     RLLVKEQLRRLKPDIVILLETKKETVDRQLVAGVWGSRFKEWVFSPSLGRSGGIAVLWNS  62

Query  2864  VSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWL  2685
              S+++         ++ ++ +N+   W +S +YG      R   + +L+  +      W 
Sbjct  63    QSVSVIDSMVGEFSVSIRIVENIGTDWWLSGIYGPCRQRERNSFWEELADLYGFCGDKWC  122

Query  2684  AMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKG  2505
               GDFN V   +E SN+   + S   DFND+I    L D     +S+TW    +    + 
Sbjct  123   LGGDFNVVRFSAEKSNEGRVTKS-MRDFNDFIQETNLRDPNLLNASFTWSNLRENAVCR-  180

Query  2504  ARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHY  2325
              RLDR L +      FP  +   LP I SDH P  I + T   ++  S F+F   W  H 
Sbjct  181   -RLDRFLVSGSWEDHFPHYRHKALPRITSDHCP--IELDTSRVKWGPSPFRFENMWLNHP  237

Query  2324  SFQACVQSVWRSD-------LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL----  2178
              F   ++  W  D           T    +   L VWS++ FG++ +  R   ARL    
Sbjct  238   DFMRKIKLWWGEDQIPGWEGYKFMTRLKMLKSKLKVWSKEEFGDVERDLREAEARLLVLD  297

Query  2177  --EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQV  2004
               EG +  L   +RS+   L  ++    +    +EE+ W QR + +W + GD NT+F+  
Sbjct  298   QREGTE-GLDHLLRSERDNLLLKIGDLAQ----KEEVKWRQRGKVKWAREGDGNTKFFHR  352

Query  2003  ATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVN-RTNFCYGCFPPL  1827
                  R ++ + KL   D  +I  D  + + V  +F GL+++  +V         C    
Sbjct  353   VANGARKRNYIEKLEVEDLGVIEVDANIEREVIRFFKGLYSSNKNVGWGVEGLNWCPISQ  412

Query  1826  LEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFE  1647
             +E DW  +  PF  E+++ A+F+    K+ GPDGF+  FF   W  V   L   +  FF+
Sbjct  413   VEADW--LERPFDLEEVQKAVFECGKDKSPGPDGFSMSFFQSCWEVVKGDLMKVMQDFFQ  470

Query  1646  DGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPH  1467
              GI+    N+T + LIPK  N  ++T  RPI L   +YK+I+KV+  RL++++   +   
Sbjct  471   SGIVNGVTNETFICLIPKKANSVKVTDNRPISLVTSLYKVISKVLASRLREVLGNTISQS  530

Query  1466  QSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIG  1287
             Q +FV  RQI D  L   E++   R +K R G +  K+D EKAYD + W F++D L   G
Sbjct  531   QGAFVQKRQILDAVLVANEVVEEVRKQK-RKG-LVFKIDFEKAYDHVEWNFVDDVLARKG  588

Query  1286  F  1284
             F
Sbjct  589   F  589


 Score =   174 bits (440),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 210/428 (49%), Gaps = 20/428 (5%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+ C+ S     + NG+        +GLRQGDP+SP LF L ++ LS +++ +       
Sbjct  597   IIGCLESVNFSIMINGKPRGKFRASRGLRQGDPLSPFLFTLVSDVLSRIIERAQDVNLVH  656

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+        +SHL FADD +F  +      L + + L LFC  SG KIN  KS +    
Sbjct  657   GIVSGHDQVEVSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCDVSGMKINKAKSCIL---  713

Query  903   NTNLGTQ--QNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDN-ILERIKarlsg*ssr  733
               N  T+   N+A + G         +LGLP + G  +  +F N ++++++ RL      
Sbjct  714   GINFSTEALNNMAGSWGCEVGCWPMVYLGLP-LGGNPRALNFWNPVMDKVEKRLQKWKRA  772

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLW-GSREGKNKCHLVKW  556
              LS  G   ++Q+VLS+IP Y M    +P GV   +E+L+R FLW G  EGKN CHLV+W
Sbjct  773   CLSKGGRLTLIQAVLSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEEGKN-CHLVRW  831

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ-  379
               VT SK  GGLGI SL+  N A  AK  WR   + N LW  + K+KY  D + W + Q 
Sbjct  832   ERVTKSKEEGGLGIGSLRERNEALRAKWLWRFPLEPNSLWHRIIKSKYGIDSNGWDTKQI  891

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD---RPLFEEASAPIAPS  208
              K +  N W+ I +  + F    ++ V NG   RFW D WL +   + LF   S+     
Sbjct  892   DKVSCRNPWREISKGYNSFLQCCRFSVGNGEKIRFWEDLWLKEGILKDLFPRLSSLSRRK  951

Query  207   SLN-NLVANYWISNEGWDWDMLDRVLPEHILNKLSTF--VLQEDTLLG---DRLVWYKEP  46
             + +    AN  +    WD+D   R L E  + ++     +L    L G   DR  W  E 
Sbjct  952   NQSIACFANNHVMPLNWDFD-FRRNLSEAEIAEVVILLDILGNVRLYGSRPDRRSWEVEE  1010

Query  45    NGLFSVSS  22
              G FS  S
Sbjct  1011  QGSFSCKS  1018



>gb|EEC75227.1| hypothetical protein OsI_11496 [Oryza sativa Indica Group]
Length=1059

 Score =   214 bits (546),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 217/432 (50%), Gaps = 25/432 (6%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             +M CVT+ +    +NG L +  SP +GLRQGDP+SP LF+  A+ LS ++   V++G  +
Sbjct  364   VMACVTTVKYSVSFNGNLLEPFSPSRGLRQGDPLSPYLFLFVADGLSTILSQDVQAGRLE  423

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              +KV R AP +SHL FADD + F  A   QA  +++ L L+  C+GQ ++  K SL  S 
Sbjct  424   ELKVCRRAPGVSHLLFADDSLLFFRACPQQASVVRQALALYQRCTGQLLSSSKCSLLASA  483

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
             +      ++I   L + +     K+LGLP+  GR+  + F  I ER+  RL+    + +S
Sbjct  484   HCPTDVLEDIKIVLQVETSTFESKYLGLPTPEGRMSAERFKAIKERLVKRLNSWVEKFMS  543

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
             L     +++SV  AIP Y M    +P    ++  +LIR F WG  E K K H   W I+T
Sbjct  544   LGAKDTLIKSVAQAIPTYVMGLFRLPVSTCEAYTKLIRDFWWGDEENKRKIHWTAWDIIT  603

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
               K  GGLG + LK  N A L K AWRL Q    L   + KAKY  +  +  +  P  ++
Sbjct  604   RPKGLGGLGFRDLKLFNQALLGKQAWRLIQFPGSLCARILKAKYFPNCELVDAVFPG-DT  662

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVAN  184
             S  WKGI   L + + G+ W + +G   + W D W+     F             N    
Sbjct  663   SPTWKGIEYGLELLKKGLVWRICDGNKVKIWRDQWVQRESSFNLIGK-------KNRCRL  715

Query  183   YWIS------NEGWDWDMLDRVL-----PEHILNKLSTFVLQEDTLLGDRLVWYKEPNGL  37
              W+S      ++ W+ D++  V       E +  KL  F  +      D L W+ E +G+
Sbjct  716   RWVSQLIRQEDKSWNEDLIRHVCHPIDAAEILKIKLPQFPAE------DFLAWHFEKSGV  769

Query  36    FSVSSAYELALE  1
             ++V S Y LA++
Sbjct  770   YTVRSGYRLAMK  781


 Score =   208 bits (530),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 197/362 (54%), Gaps = 11/362 (3%)
 Frame = -1

Query  2339  WTTHYSFQACVQSVWRSDLD------LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARL  2178
             W   Y+    ++S W  +L+      +++  S ++ AL  WS + FG++ Q+ + + A++
Sbjct  2     WERVYTLADTIKSAWEKELETRDLGEVTSKLSKVMAALREWSINVFGSVTQELKEIKAKV  61

Query  2177  EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVAT  1998
             E     LS+          R L   ++E LY+EE++W QRSR  W+K GDRNT+F+    
Sbjct  62    E----ELSIADPLLHDAEIRMLYARMDELLYREEMMWLQRSRVAWLKEGDRNTKFFHRQA  117

Query  1997  TVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEE  1818
               +  ++++++L   D   + +   +     ++F  L+  +  V+         P + + 
Sbjct  118   AWRSKKNKITRLKAEDSRFVENKEEMEHMAREFFQTLYLKDNSVDPRELIDALTPRVDDG  177

Query  1817  DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
               A +  PF+ ++I  ALF + P KA GPDGF   FF + W  +   + + V  FF  G+
Sbjct  178   MNAGLCKPFSDDEIAYALFQIGPLKAPGPDGFPARFFQRNWAVLKKEVTTAVRNFFLQGV  237

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
             +  G NDT + LIPKV  PE++ +FRPI LCNV+YK+++K M+ RL+ +++ ++   QS+
Sbjct  238   MLAGVNDTSIVLIPKVSKPEQLKEFRPISLCNVIYKVVSKCMVNRLRPILKDIISVTQSA  297

Query  1457  FVHGRQITDNTL-AYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             F+  R ITDN L A++ I +  +       + A K+DL KAYDR+ W F+   L  +GF 
Sbjct  298   FIPERLITDNALIAFECIHHIQKETSAGKQFCAYKLDLAKAYDRVDWDFLRGALTKVGFC  357

Query  1280  HT  1275
              T
Sbjct  358   ST  359



>ref|XP_011085143.1| PREDICTED: uncharacterized protein LOC105167219 [Sesamum indicum]
Length=1203

 Score =   269 bits (688),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/578 (31%), Positives = 283/578 (49%), Gaps = 24/578 (4%)
 Frame = -1

Query  2993  LICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAF  2814
             ++ + EPK+ +      C  LGFD+ I       +  IW F    ++ EIL +  QF+  
Sbjct  1     MLVIIEPKV-KLDEQYFCRRLGFDKVIS----NSNSKIWCFMKEDLDCEILISQEQFLHL  55

Query  2813  QVYDNVSAPWLMSV-VYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSN  2637
             +++ +     ++   VY     A RR L+  L     + +  WL  GDFN+V   SE   
Sbjct  56    RIFSDFWPNGILCTWVYAKHTRAERRELWDALR-NIDDGEEPWLLGGDFNTVLYCSERKG  114

Query  2636  KETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRF  2457
                  +    DF D +    L D GF GS +TW R     S    RLDR L +   +  F
Sbjct  115   GAAPKIRTMEDFGDMMMDCGLQDAGFEGSKFTWSR-----SRLWQRLDRFLFSHTWTQAF  169

Query  2456  PDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLD-  2280
             P +++ HL    SDH PLL+S+    ++   + F+F   WT H+ F+ CV + W+  +  
Sbjct  170   PLSRIQHLTRNVSDHCPLLLSVKQ-EKKTGPTPFRFQNMWTKHHDFKHCVTTSWQHPIHG  228

Query  2279  -----LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerr  2115
                         +  AL +W+ + FGNI Q       R++  + +       + +    +
Sbjct  229   HGMFAFQQKLHRIKAALKLWNTEVFGNIFQNITDAEQRVKIAEQAYDGDPSDENLIAMNK  288

Query  2114  lrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLIC  1935
                EL   L  EE  W Q++  +W++ G++NT+++   T  KR QSR+ K +  +G  + 
Sbjct  289   ATAELTFALSVEESYWKQKAACKWLEEGEKNTKYFHSLTKKKRKQSRIYK-IQHNGATLT  347

Query  1934  DDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLL-EEDWASVNAPFTPEDIKTALFD  1758
                 +   V DYF   FT +  V+  +  +   P +L EED   +NA  T ED+KT +FD
Sbjct  348   KAEDIKVSVVDYFTQAFTRDDTVSVDDLHW--VPNILSEEDRHQLNATPTIEDVKTIIFD  405

Query  1757  MVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPE  1578
             M P   +GPDGF+  FF   W  +G  L+  V  F      P     T + LIPK++ P 
Sbjct  406   MCPHSTAGPDGFSAHFFQCCWEIIGQDLYGAVLDFLSGSTPPKNFTTTTIVLIPKIEAPS  465

Query  1577  RITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNA  1398
                 FRPI LCNV  K+++KV+  ++  ++ K++ P QSSFV GR I+DN L  QE+ + 
Sbjct  466   TWKDFRPISLCNVTGKILSKVINNQMAKLLPKIISPSQSSFVQGRMISDNILLAQELSHC  525

Query  1397  FRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
                K G +     K+D+EKAYDR++W F+   L  +GF
Sbjct  526   L-GKNGSLSNTIFKIDMEKAYDRVNWTFLYHMLMRVGF  562


 Score =   151 bits (382),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 127/426 (30%), Positives = 199/426 (47%), Gaps = 20/426 (5%)
 Frame = -3

Query  1278  YWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVR  1099
             +WI  I   + +     L NG+   +    +GLRQGDP+SP LFV+ AE LS  +D   +
Sbjct  565   HWINMIKKLIENCWFSILINGEGVGFFKSTRGLRQGDPLSPTLFVIAAECLSRGLDWLFQ  624

Query  1098  SGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
                       R + N+SHL FADD++ F +        + + L  +   SGQ+IN +KSS
Sbjct  625   QQPRMNF-FARSSKNISHLAFADDIIIFSKGTRKDLKTLMEFLRHYELISGQRINKEKSS  683

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                 K T+    + I    G         +LG P   G  K   FD ++++I+ +++G  
Sbjct  684   FTVDKKTSNMRIRCIQQVTGFRLKYLPITYLGAPLFKGNKKGALFDELIQKIRNKITGWE  743

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
                LS  G   +++SVLSA+P Y ++    P  V++ IERL   FLWG+   + K +   
Sbjct  744   KALLSHGGRLQLIKSVLSAMPTYLLQVLKPPKYVMERIERLFNKFLWGNTGEQRKLNWSS  803

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  +      GG G++ ++ +  AF  KL WR  ++ + LW   F  KY       S   
Sbjct  804   WDDICYPTEEGGFGVRRIQDVVHAFQLKLRWRF-RNQSSLWALFFLEKY----CTGSHPV  858

Query  378   PKRNS---SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
             P + S   S  WK + +        I W +  G  + FW D+W+ ++PLFE     I P 
Sbjct  859   PAKLSYIASPNWKRMCRHRKEADRQIFWSLGKGHIS-FWFDNWIGEKPLFE-----IMPD  912

Query  207   SLNNL--VANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
                N   V NYW  N  W+   L  VL   +++++       DT   D  +W    +G+F
Sbjct  913   FEWNTTPVNNYW-ENNSWNVAKLREVLTADMVHQICQIPFDVDT--SDTPLWKLSGDGIF  969

Query  33    SVSSAY  16
             S+ + +
Sbjct  970   SMKATW  975



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score =   255 bits (652),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/592 (30%), Positives = 289/592 (49%), Gaps = 18/592 (3%)
 Frame = -1

Query  3032  RTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSIN  2853
             R L+     + P +I L E K  R+    +   LG+ +   VE +G SGG+ L     ++
Sbjct  467   RHLREICGQYFPEVIFLCETKNKRSYLENVVGHLGYHDLHTVEPLGKSGGLALMWKEEVH  526

Query  2852  IEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGD  2673
             I++L++  + I  QV       + +S +YG      R  ++  L+      +G W+  GD
Sbjct  527   IKVLHSDKRTIDVQVKWQ-DKEFFLSCIYGDPVRGERGKVWERLTRIGIERRGPWMMTGD  585

Query  2672  FNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLD  2493
             FN +   SE       SM+ C +F   +    L ++   G  ++W  G         RLD
Sbjct  586   FNELVDPSEKKGGPVRSMATCVEFQQMLSACGLWEVRHKGYQFSWF-GNRNEELVQCRLD  644

Query  2492  RALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQA  2313
             R ++N E    FP+A+  +L  + SDHSPL+ ++     +     FK++  W     F  
Sbjct  645   RTVANQEWMELFPEAQAVYLKKVSSDHSPLITTLMGEKWRRWVG-FKYDQRWVQREGFCD  703

Query  2312  CVQSVWRSDLDLSTNKSAMVEAL-------SVWSRDSFGNIPQKKRRLLARLEGVQ*SLS  2154
              ++  W S+    +N  ++VE L       S W R +  N   + + L +R++       
Sbjct  704   FMKETWESEKVKQSN--SLVEKLTRCRKEISGWKRRNKPNSSLRIQELHSRIDRATQQSP  761

Query  2153  MGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSR  1974
               I        RRL+ EL +   QEE  W Q+SR  W+ +GD+NT+F+  AT  +R Q+R
Sbjct  762   FSIEE-----VRRLKSELNKEYVQEEKFWQQKSRFIWLNNGDKNTKFFHAATKNRRAQNR  816

Query  1973  VSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAP  1794
             +  L D DG     +  L +    YF  L+T+E    R          +  E    ++A 
Sbjct  817   IQVLEDKDGIEWFAEEDLGRVAESYFKMLYTSEDVGYRLQEMEQGTNTVSTEMNEMLSAE  876

Query  1793  FTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDT  1614
              + E++K A+F++ P K  GPDG T  FF + W  VG  +   V  F   G L    N T
Sbjct  877   VSLEEVKEAVFEINPNKCPGPDGLTGFFFQQFWERVGEDITEMVRSFMRTGRLEEEINRT  936

Query  1613  ILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQIT  1434
              + LIPK     ++  FRPI LCNVVYK+++K++  RLK ++  ++   Q++FV GR I+
Sbjct  937   NICLIPKKMKASKLQDFRPISLCNVVYKIVSKLLASRLKRILPNIISETQAAFVKGRLIS  996

Query  1433  DNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             DN L   E+L+A  ++ K    ++A+K D+ KAYDR+ W F+ + +  +GF+
Sbjct  997   DNILIAHEMLHALSSRNKCAENFIAIKTDISKAYDRVEWSFLGNAMTYLGFS  1048


 Score =   165 bits (418),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 124/429 (29%), Positives = 192/429 (45%), Gaps = 36/429 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR +M CV +     L NG     I P +GLRQGDP+SP LFV+C E L  M++ +   
Sbjct  1051  WIRLVMECVKTVEYQVLINGVPYRDIQPTRGLRQGDPLSPYLFVICTEMLVRMLNKAEEE  1110

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+   AP++SHL FADD +F+      +  +M + ++ +   SGQ++N QKSS+
Sbjct  1111  GKITGLKIASGAPSISHLLFADDSLFYCRKEEEEINQMVRIIEEYSLASGQRVNYQKSSI  1170

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             +F K     T+  I   LGI      G +LGLP      K      + ER+  R++G  +
Sbjct  1171  YFGKLIPEETRGEIKHKLGISKEGGEGIYLGLPEAFKGSKVTILSYLKERLNQRVNGWQT  1230

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  V++++V+ A+P Y+M    +P   + S+                       
Sbjct  1231  MFLSQGGKEVLLKAVVMALPTYTMTCFKLPRNALASM-----------------------  1267

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY--DFDP-SVWSS  385
             G    +K+ GG+  + ++  N A L K  WR+      L   +FK++Y    DP +    
Sbjct  1268  GRADQAKSRGGIEFRDIEAFNDALLGKQLWRIITQKESLVARVFKSRYFRKSDPLTAPLG  1327

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSS  205
             ++P    S AW+ +  A  + R G +  V NG+    W   WL  +P    +     P  
Sbjct  1328  YRP----SYAWRSLQAAQELLRQGARAVVGNGKEINIWQHQWLQSKPARGLSRVKQIPPG  1383

Query  204   LNNLVANYWISNE--GWDWDMLDRVLPEHILNKLSTFVLQEDTLLG----DRLVWYKEPN  43
               + VA      +  G D    +R L            ++E    G    D   W    +
Sbjct  1384  FQSSVAQLVTVKDLLGPDGREWNRDLLSLAFENEDKQCIEEIRPGGFQTKDGYTWDYTKS  1443

Query  42    GLFSVSSAY  16
             GL+SV S Y
Sbjct  1444  GLYSVKSGY  1452


 Score = 56.6 bits (135),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = -3

Query  4257  FETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDF  4078
             FET  D   V + GPW V    +   +W+PN DP  + ++K+L W+R   +PI       
Sbjct  89    FETEADLYHVLFRGPWFVNGWIVSLDQWKPNPDP--DYLNKILFWIRIKGIPIHLLKRQT  146

Query  4077  LKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPL----LSNFVINGTEWPKE--Y  3916
             ++ I + +G+   ++L    ++  ++ R    +   +PL    ++NF  +G   P E  Y
Sbjct  147   VESIIRPLGKVDAVELHAKNSNSLEYVRERTWVKADEPLQFCKVANFA-SGERVPVELTY  205

Query  3915  EGIHQICFKCSIYGHRMETCGLSVP-IPAASVDGTA  3811
             E + ++C  C    H    C   +  +   +  GTA
Sbjct  206   EKLLKVCLLCKRLTHERSICPFQINDLMGGNGKGTA  241



>ref|XP_010667704.1| PREDICTED: uncharacterized protein LOC104884717 [Beta vulgaris 
subsp. vulgaris]
Length=1578

 Score =   219 bits (559),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 217/425 (51%), Gaps = 12/425 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   +M CV S     L NG+ T+  +P +G+RQGDP+SP LF+LCAE  SH++  +   
Sbjct  857   WRCRVMDCVRSVSFSILVNGKPTNDFTPHRGIRQGDPLSPYLFILCAEVFSHLLRKAEER  916

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              + KG+KV   AP++ HL FADD + F  A+   A  +++ L ++   SGQK+N  K+++
Sbjct  917   NSLKGIKVAPSAPSVDHLLFADDCIVFFRASMRDAEAIQEALTIYELSSGQKVNFDKTNI  976

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+      +  +A  L +  V    ++LGLP++ GR KK     + E++  +L G   
Sbjct  977   SFSRGVPQDRRNAVAVHLRVREVDIHDRYLGLPTVVGRSKKVITRGVKEKLWKKLQGWKG  1036

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS AG  VM++ V  ++P Y+M     PS + D I  LI  F WG + G+ K H V W
Sbjct  1037  MVLSKAGREVMIKVVAQSLPTYAMSVFKFPSSLCDEIRSLISQFWWGQKRGERKIHWVAW  1096

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG + +K  N A L K AWRL+     L   +++A+Y +  S +     
Sbjct  1097  KKLCRPKVEGGLGFRDMKLFNWALLGKQAWRLTLQNGSLIEQIWRARY-YPNSNFMDSNL  1155

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                 S  W+GI +A  + R G++W V +G + R W D+W+       ++   I+P    N
Sbjct  1156  GATPSYTWRGIWEAKWVLRRGVRWRVGDGESIRIWKDAWIPG----SQSRKIISPRGNAN  1211

Query  195   LVANYWI----SNEGWDWDML-DRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
             + A          + W  D++ D  LP      LS  +     L  D L W  E +G +S
Sbjct  1212  VDAEVGALIDPITKSWKEDLVADLFLPFEAARVLSIPISHR--LPADTLCWDLEKDGCYS  1269

Query  30    VSSAY  16
             V SAY
Sbjct  1270  VKSAY  1274


 Score =   199 bits (507),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/589 (28%), Positives = 264/589 (45%), Gaps = 42/589 (7%)
 Frame = -1

Query  3029  TLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINI  2850
             +L+  +R   PSLI L E K+S  + + I    G    + V+ VG SGG+ L     +  
Sbjct  302   SLRDLIRREAPSLIFLSETKLS-VEFSRIRDRFGDFHSLAVDFVGRSGGLALLWKKDVVA  360

Query  2849  EILYTHPQFIAFQVYDNV-SAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGD  2673
             +++      I  ++ + +  A W  +  YG  +   R   ++ L+         W+ +GD
Sbjct  361   DLISMSVHHIDVKMSEGLWEAEWRSTGFYGWPETNNRHLSWSLLATLATQSDLPWVCIGD  420

Query  2672  FNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLD  2493
             FN +    E       +  +  +F   +    L D+ ++G  +T+  G +       RLD
Sbjct  421   FNEILFHHEKKGGNDRADWQINNFRRVVDECGLSDVPYSGYEFTYDNGRELVENVQCRLD  480

Query  2492  RALSNVE*SLRFPDAKVTHLPMIGSDHSP--LLISITTCPQQFCSSRFKFNMAWTTHYSF  2319
             RAL        FP+  + HL    SDH+P  LL+       Q     F+F   W T    
Sbjct  481   RALVTTTWWEIFPEGFLHHLDREWSDHAPIKLLLWKKGPDVQLGPKPFRFEHLWATEGEC  540

Query  2318  QACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNI---PQKKRRLLARLEGVQ*SLSMG  2148
             +  ++  W     L +        L  WS   FG +    +KKR+ L RL         G
Sbjct  541   EGVIEIAWLGGYSLDSKLEMCASDLKDWSARKFGKVFAELKKKRKALQRLN------KGG  594

Query  2147  IRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVS  1968
             +    +   R+L  E+ E +  EE+ W QRSR  W+  GDRN++F+    + ++ ++ + 
Sbjct  595   LTEAQLNRRRKLLGEIAELMSVEEVYWKQRSRVLWLAEGDRNSKFFHQRASGRKWRNTIR  654

Query  1967  KLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFT  1788
             KL D + +       + +   DYF  +FT       TN      PP++E+      A   
Sbjct  655   KLKDDEDNEHVGVREVGRIAMDYFRNMFTF------TN------PPMIEQ------ALID  696

Query  1787  PEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTIL  1608
              E   T + +    +    D        +T           V      G +P   N T +
Sbjct  697   FEPRVTGVMNEALRRPYNEDEIRLALMSQT-----------VLGILNGGNIPHYLNRTYI  745

Query  1607  SLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDN  1428
             +LIPK  N + ++QFRPI LCNVVYKL++KV+  RLK  + ++V  +QS+F  G  ITDN
Sbjct  746   TLIPKKSNADHMSQFRPIALCNVVYKLVSKVLANRLKIFLNEIVSVNQSAFTPGHLITDN  805

Query  1427  TLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              L   ++ +  +  K R G MA+K+D+ KAYDR+ W F+E  LR  GF+
Sbjct  806   ILVAFDMFHHMKNLKIREGCMAMKLDMSKAYDRIEWNFLEAVLRRFGFD  854



>ref|XP_010671205.1| PREDICTED: uncharacterized protein LOC104888072 [Beta vulgaris 
subsp. vulgaris]
Length=1592

 Score =   235 bits (599),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/501 (31%), Positives = 255/501 (51%), Gaps = 19/501 (4%)
 Frame = -1

Query  2771  VYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDW  2592
             VY   D+A R  ++++L  +        L  GDFN V   +E  ++    M R ++FN++
Sbjct  320   VYNPCDIAERAEVWSELLEFQKENALPCLISGDFNEVLKANERGSQLLSQMGR-SNFNNF  378

Query  2591  IFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDH  2412
             +    L+++  +   +TW RG        + LDR   + E   + P  KV  L    SDH
Sbjct  379   VQDSHLLEISSSSGGFTWFRGNSR-----SILDRLFVHPEWLSKLPTIKVDLLQRGLSDH  433

Query  2411  SPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKS--AMVEALSV  2238
              PLL+   T  Q +    F+F   W T       V++VW+    L T +    + + L+ 
Sbjct  434   CPLLVH--TKDQNWGPKPFRFQNCWLTDPDCLKIVKNVWQESAALQTREKLKEVKKRLNE  491

Query  2237  WSRDSFGNIPQKKRRL---LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIW  2067
             W+++ FGNI  K ++L   + RL+ +  +    + +  V   ++ + EL   + ++EL W
Sbjct  492   WNQNEFGNIDTKIKKLENEIQRLDEI--NNFRDLEAQEVDNRKKAQSELWVWMKRKELYW  549

Query  2066  FQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGL  1887
              Q SR  W+K GDRNT+F+    + KR ++ ++ ++  DG  + D   +      +F G+
Sbjct  550   AQNSRISWLKEGDRNTKFFHDIASNKRRKNSINSII-IDGQPVDDPSCIKNEARAFFKGI  608

Query  1886  FTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFF  1707
             F  E D+ R +F    F  + EE  + +  PF+ E+I  A+      KA GPDGF   F 
Sbjct  609   FREEYDI-RPHFDNLNFKQVTEEQGSQLTLPFSREEIDNAVASCDSDKAPGPDGFNFKFI  667

Query  1706  HKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKL  1527
                W  V   ++  VH+F+    LP GCN   ++LIPK+ NP     FRPI +   +YK+
Sbjct  668   KSAWDIVKHDIYEMVHKFWASSQLPQGCNVAYIALIPKIDNPSSFKDFRPISMVGCLYKI  727

Query  1526  ITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDL  1347
             I K+M  RL+ ++  L+G  QSS++ GRQI D  L   EI+++++ K G+   +  K+D 
Sbjct  728   IAKLMASRLQKIMSSLIGTLQSSYIEGRQILDGALVAGEIIDSYK-KNGKEA-ILFKLDF  785

Query  1346  EKAYDRLSWCFIEDTLRDIGF  1284
              KAYD +SW F++  L  + F
Sbjct  786   HKAYDSVSWGFLKWVLEQMNF  806


 Score =   183 bits (465),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 146/437 (33%), Positives = 213/437 (49%), Gaps = 22/437 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   IM CV+S     L NG  +     ++GLRQGDP+SP LF+L  E L+ ++  +   
Sbjct  810   WREWIMSCVSSAYASILVNGSPSAPFKLQRGLRQGDPLSPFLFLLIGEVLNQVILKASNM  869

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G W G+++ +   N++HL +ADD++ F EA       +KK L LF   SG ++N  KSS+
Sbjct  870   GLWSGLEIRKDGLNITHLQYADDILIFSEAKMESLKNIKKALILFHLASGLQVNFHKSSI  929

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKK-DSFDNILERIKarlsg*s  739
                    +  QQ  AA L   +      +LGLP I G L +  ++D I+ ++  +L+   
Sbjct  930   IGLNTPKIWLQQ-AAADLQCKTGDIPFTYLGLP-IGGDLSRIHAWDPIINKVSKKLATWK  987

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
              R LS+ G   +++S LS +P Y M    IP+GVI  I ++ R FLW     K    LV 
Sbjct  988   GRMLSIGGRLTLIKSSLSNLPIYYMSIFPIPTGVIKKINKITRQFLWSGNMEKRSLSLVS  1047

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFD--PSVWSS  385
             W IV   K  GGLGI S+ H N+A L+K  WRL QD   LW+ +   KY +   PS+   
Sbjct  1048  WEIVQLPKTMGGLGIGSILHKNIAMLSKWFWRLLQDPTPLWSQVICDKYRYSSAPSISDI  1107

Query  384   WQPKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEAS  226
               PK  S   W+ I  A+        I   GI+ ++ NG  TRFW + WL   PL  E  
Sbjct  1108  VIPK--SGGPWRKICAAILHQADVKEIISKGIRKNIGNGSQTRFWHEPWLASSPLKREFP  1165

Query  225   APIAPSSLNNLVA---NYWIS-NEGWDWDMLDRVLPEHILNK--LSTFVLQ--EDTLLGD  70
                + S   N+      +W   N  W +     + P+  + K  L   +LQ        D
Sbjct  1166  RLFSISIDPNVTVAAQGFWEGMNWVWTFSWKRALRPQDCVEKKRLDEMLLQVCPSQKAHD  1225

Query  69    RLVWYKEPNGLFSVSSA  19
              ++W    +G+FS  S 
Sbjct  1226  SIIWVYNKSGIFSTKSV  1242



>ref|XP_008794416.1| PREDICTED: uncharacterized protein LOC103710479 [Phoenix dactylifera]
Length=1252

 Score =   222 bits (565),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/530 (28%), Positives = 235/530 (44%), Gaps = 55/530 (10%)
 Frame = -1

Query  2810  VYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKE  2631
             + + V  PW+ + VY   D   RR L+ + S      Q   +A GDFN +    E     
Sbjct  3     ISEGVGRPWIFAAVYASTDFRARRSLWEEASKLVDQGQPMLIA-GDFNCIDDPQEKMGGR  61

Query  2630  TFSMSR-CTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFP  2454
             +FS  R   +F ++I    LIDLGFTG  +TW      P+    RLDRA +       F 
Sbjct  62    SFSYQRKVREFQEFISTNGLIDLGFTGPRFTWCNNQQGPARVWERLDRAFATAGWIQEFS  121

Query  2453  DAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLS  2274
             D  V HLP I SDHSP+L+         C   F+F   W  +      V  VW    ++ 
Sbjct  122   DYHVKHLPRIASDHSPILVCTDRPIPYHCP--FRFERLWLCYPRSWGVVSEVW----NMP  175

Query  2273  TNKSAMVEA----------LSVWSRDSFGNIPQKKRRLLARLEGVQ*--SLSMGIRSDlv  2130
                +AM             L  W+R   GNI ++   L   +  +Q   +   G+    +
Sbjct  176   VRGNAMYRVSRRLELARRHLRRWNRVEVGNIFRRIEELEEAIANLQLREASGGGLSQAEL  235

Query  2129  rlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDAD  1950
                R         L Q+E+ W                         +R ++R+  + D D
Sbjct  236   SELRSFLSMHNALLSQQEIFW-------------------------RRQRNRIRSIRDED  270

Query  1949  GHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNA-----PFTP  1785
             G    D  ++ + +  +F   +T      RT        PL  E  + V++     P + 
Sbjct  271   GQSTEDPNMICRVLEQFFRTRWT-----ERTGSGMHTELPLSSERVSDVDSLALIRPVSG  325

Query  1784  EDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILS  1605
             ++I+ AL+ +   KA GPDGF P FF + W  VG  +   + +FF   ++ P    T ++
Sbjct  326   QEIQEALWSLEGDKAPGPDGFPPVFFRRYWSIVGLDVIEAIQQFFSMAVMSPEWQRTFIA  385

Query  1604  LIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNT  1425
             LIPK QN      FRPI LC+ +YK+  K++ +RL+ ++  ++ P Q +F+ GR I+DN 
Sbjct  386   LIPKRQNATEPGHFRPISLCSTLYKITAKILAMRLRGILPSIICPEQGAFIGGRNISDNV  445

Query  1424  LAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             L  QE +        R   M +K+D+E+AYDR+ W F+  +L+  GF+  
Sbjct  446   LIAQEFMFDLVKAPMRRCLMGVKLDMERAYDRMCWEFLRHSLQSFGFHEV  495


 Score =   195 bits (496),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 204/413 (49%), Gaps = 7/413 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR +M CV       L NG  + +     GLRQG P+SPLLF++CA+ LS  + ++V +
Sbjct  496   WIRWVMGCVMGTSFSILVNGTPSPFFQTSVGLRQGCPLSPLLFIICADALSRALRAAVGT  555

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                +  +  + A  +SHL FADD +    A    A  +++ L  +CS SGQ+INL KSS+
Sbjct  556   QTLEVYRPVQGATPISHLLFADDCLLLARATRQNAHVIRRILLAYCSASGQRINLDKSSI  615

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    +  I  TLG+   +    +LG+P +  R++      +   I+ RL G   
Sbjct  616   LFSPKTKAQIKAGIMETLGVGEQVGTLTYLGVPILGRRMRSGDTITLEHSIRHRLEGWQM  675

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              +LS+ G   + +SVLSAIP Y +  T+ P   + S+ERLIR F+WG R  + + HLV W
Sbjct  676   HSLSMMGRVTLARSVLSAIPVYLVSHTVPPVASLRSVERLIRDFIWGRRGDRGRVHLVAW  735

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              +V    + GGLG+ SL     A + +LA  L  + + LW++L +AKY    ++    + 
Sbjct  736   EVVCQPVSCGGLGVPSLVSRREASVMRLAASLMLEPDSLWSSLMRAKYG---ALTVGIRA  792

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R  S  W+ I          I+W + +G +     DSW+ + P+    +       L  
Sbjct  793   GRLQSPIWREISARAFSVLPAIRWAIGDGMSVDVLEDSWVTELPISRLPALVDTSRLLGR  852

Query  195   LVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNG  40
              V +  +  EG WD   +     E ++ ++    +       DRL+W   P G
Sbjct  853   RVGDLLVPGEGSWDEVFIRETFGEQLVERILALPIPSRA-EPDRLIWL--PTG  902



>gb|EEE52912.1| hypothetical protein OsJ_35521 [Oryza sativa Japonica Group]
Length=1003

 Score =   228 bits (581),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 130/344 (38%), Positives = 192/344 (56%), Gaps = 9/344 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ +M CVTS R    +NG +     P +GLRQGDP+SP LF+  A+ LS ++ S+VR+
Sbjct  622   WIQWMMACVTSVRYAVRFNGSMLKSFQPSRGLRQGDPLSPYLFLFVADGLSTILSSAVRT  681

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+   +KV R AP +SHL FADD + F +AN  QA  +K+ L+L+  C+ Q ++  K S+
Sbjct  682   GDLVPLKVCRQAPGISHLLFADDSLLFFKANVEQATVVKEALNLYERCTSQLLSPAKCSM  741

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K+ +  TQ  I + L +       K+LGLP+  GR+K D F +I ER   RL   + 
Sbjct  742   LFGKHCSDQTQPGIKSLLDVQQNSFEDKYLGLPTPEGRMKADRFQSIKERFFKRLIDWAE  801

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + L + G  V+++SV+ A+P Y M    +P    +   +L+R F WG    + K H   W
Sbjct  802   KHLPMGGKEVLIKSVIQALPTYMMSVFKLPPSFCEEYMQLVRKFWWGEDRSQRKVHWASW  861

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY----DFDPSVWS  388
               +   K+ GG+G K +K  N A LA+ AWRL Q  + L   + KAKY    D   + +S
Sbjct  862   QQLIKPKSMGGMGFKDMKIFNQALLARQAWRLVQFPDSLCARVLKAKYYPNGDLLDTAFS  921

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL  256
             S      SS++WKGI+  L + + G+ W +  GR    W D WL
Sbjct  922   S-----VSSDSWKGIVHGLELLKKGVIWRIGTGRKVHIWRDDWL  960


 Score =   189 bits (480),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/518 (28%), Positives = 242/518 (47%), Gaps = 76/518 (15%)
 Frame = -1

Query  2804  DNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETF  2625
             D  +  W  + VYG      R +++  L     N    W  MGDFN    Q E  ++   
Sbjct  172   DRSAMQWRCTFVYGEPKAHERHNMWTLLRRIKPNSTAPWCLMGDFNEAMWQFEHFSEHKR  231

Query  2624  SMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAK  2445
                +  DF + +   ++ DLGF G+ +T+            RLDRA+++   S+ +P A+
Sbjct  232   KEKQMLDFREILSHCDVFDLGFIGTPWTYDNKRKGGYNVRVRLDRAVASQSWSVLYPQAQ  291

Query  2444  VTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWR-----SDL  2283
             V HL    SDH P+L+  T    +   SR  ++ + W    S    +++ W      +DL
Sbjct  292   VRHLVSSRSDHCPILVQCTPDEDKDKPSRCMRYEILWEREESLSEEIRTAWEQHHAATDL  351

Query  2282  DLSTNKSAMV-EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrk  2106
                ++K  +V  AL  WSR+ FG++ ++   L  ++E +Q    +G R    +  +   +
Sbjct  352   GSVSSKLKLVMGALQHWSREKFGSVNKELGALRKKMEELQ----LGGRHTHDQEYQSCSR  407

Query  2105  eleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDG  1926
              +EE LY+EE++W QRSR  W++ GDRNT F++ A    R ++++SKL   DG       
Sbjct  408   RMEEILYREEMMWLQRSRVAWLREGDRNTSFHRKAAWRHR-KNKISKLFLPDGSWTDQRK  466

Query  1925  LLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPC  1746
              +     ++F  L+T +              PL+           TP+     L D++  
Sbjct  467   EMETMATNFFKDLYTKD--------------PLV-----------TPQ----PLLDLIML  497

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             K   P+G                                  N T + LIPK +  + +  
Sbjct  498   KVM-PEG---------------------------------VNTTAIVLIPKKKESKELKD  523

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTL-AYQEILNAFRT  1389
             FRPI LCNV+YK++ K ++  L+ ++  ++   QS+F+ GR ITDN L A++   N  ++
Sbjct  524   FRPISLCNVIYKVVAKCLVNHLRPILESIISQEQSAFIPGRMITDNALIAFECFHNIAQS  583

Query  1388  KKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             K+    + A K+DL KAYDR+ W ++E  L  +GF++T
Sbjct  584   KRESQEFCAYKLDLAKAYDRVDWQYLEGVLDRMGFSNT  621



>ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa]
Length=1257

 Score =   211 bits (538),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 213/421 (51%), Gaps = 5/421 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W   I+ CV++     L N  +   + P +G+RQGDP+SP LF+LC + LS +   + R 
Sbjct  513   WTNWILQCVSTVSYSYLINETVLGSVKPHRGIRQGDPLSPYLFILCGQVLSGLCSKAERD  572

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G++V R +P ++HL FADD +FF  A+     ++K  L  +   SGQKIN +KSS+
Sbjct  573   GTLQGIRVARGSPRVNHLLFADDTMFFCNASPESCSKLKSILLDYEKASGQKINSEKSSI  632

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    +      LGI      GK+LGLP   GR K+D F ++++RI+ R S  ++
Sbjct  633   TFSSKTPEDKKSAAKTLLGIDKEGGTGKYLGLPEYFGRKKRDMFTSVVDRIRQRASSWAT  692

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL-VK  559
             R LS AG   M++SVL +IP Y M    +P+ +   I+ ++  F W   +  +K    + 
Sbjct  693   RRLSKAGKLTMLKSVLLSIPTYPMSCFELPASLCKRIQSVLTRFWWDDPQSNSKKMCWIA  752

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  +T  KA GGLG++ ++  N A LAK AWR+    +CL   +   KY    S   +  
Sbjct  753   WSKMTKPKAGGGLGLRDIQLFNQALLAKQAWRILTAPDCLLARVLLGKYCHKASFLQAET  812

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             P    S+ W+ IL    + +  +   + NG  T+ W DSWL  +    +   PI  S ++
Sbjct  813   PAV-CSHGWRSILHGRDLLKGNVGKAIGNGEDTKVWNDSWLALQENI-KIYGPIPESGID  870

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V++   S   W+   L   +P  ++      +   +T   D  +W    +G +S  S 
Sbjct  871   LRVSDLLTSEMKWNESRLQEFIP--LVADRVKCIRPSETGASDTFIWQASKSGKYSFKSG  928

Query  18    Y  16
             Y
Sbjct  929   Y  929


 Score =   204 bits (518),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 141/467 (30%), Positives = 218/467 (47%), Gaps = 39/467 (8%)
 Frame = -1

Query  2678  GDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGAR  2499
             GDFN +   SE       +      F  ++   +L DL   G+  +W RG         R
Sbjct  82    GDFNELVDNSEKKGGAERAEGTFCAFRTFLSENDLYDLKHYGNFLSW-RGKRGSHVVQCR  140

Query  2498  LDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSF  2319
             LDR L+N   S  FP A+  +L   GSDH PLL  + T       SR K    +      
Sbjct  141   LDRTLTNSGWSDLFPAARCQYLKFEGSDHRPLLSFLDT-------SRSKGRKVFR-----  188

Query  2318  QACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRS  2139
               C + + +       N  A +E L +   D   +    K  L+ +L             
Sbjct  189   --CRREICKWSKQFQENSRANIEDLRL-KLDEAMSSGLNKEDLIYQLNA-----------  234

Query  2138  DlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLV  1959
                        +L ++   EE  W QRSR+ W+  GD NT ++   T  ++ ++R+S + 
Sbjct  235   -----------QLLQSYKSEEAFWRQRSRQLWLILGDANTAYFHAVTKGRKAKNRLSVME  283

Query  1958  DADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPED  1779
             D  G    ++  +   V  Y+  LFT+     ++       P + ++    +    +PE+
Sbjct  284   DDSGVPWFEEDQIASVVCKYYNSLFTSSHHDGQSTVWEALQPCITQQINEELTKDPSPEE  343

Query  1778  IKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLI  1599
             I+ A F + P KA GPDGF+  FF   W  VG ++   V  FF  G L P  N+T + LI
Sbjct  344   IREATFAIHPDKAPGPDGFSVSFFQANWCVVGPAIIKEVQLFFSTGTLRPSQNNTHVRLI  403

Query  1598  PKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLA  1419
             PK    +R+  +RPI LCNV +K+I+K++ +RLK ++  ++  + S+F+ GR ITDN L 
Sbjct  404   PKKTGAKRVADYRPIALCNVFFKIISKILSLRLKPVLNIIISENHSAFIPGRAITDNVLI  463

Query  1418  YQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
               E+L   +  K      MA+K D+ KAYDR+ W FIE  L+ +GF+
Sbjct  464   THEVLQFLKHSKAEKNCTMAVKTDMSKAYDRIEWKFIEKVLQRLGFS  510



>ref|XP_010674085.1| PREDICTED: uncharacterized protein LOC104890338 [Beta vulgaris 
subsp. vulgaris]
Length=1568

 Score =   233 bits (594),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/552 (30%), Positives = 267/552 (48%), Gaps = 21/552 (4%)
 Frame = -1

Query  2918  WIRVEAVGYSGGIW-LFCSVSINIEILYTHPQFIAFQVYDNVSAPWL---MSVVYGCLDM  2751
             WI   + G SGGI  L+ + + N+     +  +IA  +  N+ A      +  VY   D+
Sbjct  245   WIFSPSEGNSGGILSLWNNKNFNMTSNNINKHWIA--ISGNLRATEFECTLINVYNPCDI  302

Query  2750  ALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELI  2571
             ALR  ++ +++ +  +     L +GDFN V    E       S +  T+F  ++    L+
Sbjct  303   ALRTEVWKEITEFIQSNMLPCLIIGDFNEVLRAKE-RGSLLLSQTGVTNFKQFVQESHLL  361

Query  2570  DLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI  2391
             ++  T   +TW R     S   + LDR   + E   +FP  KVT L    SDH PLL+  
Sbjct  362   EIPSTCGGFTWFR-----SNSKSILDRLFVHSEWISKFPALKVTLLQRGLSDHCPLLVH-  415

Query  2390  TTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKS--AMVEALSVWSRDSFG  2217
              +    +    F+F   W T       V +VW+    L T +    + + L  W+ D FG
Sbjct  416   -SKELNWGPKPFRFQNCWLTDPRCLKIVNNVWQKSAALHTVEKLREVKKQLKTWNHDEFG  474

Query  2216  NIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleET-LYQEELIWFQRSREEWI  2040
             NI    +RL   ++ +    ++    D    ER+  +      + ++E+ W Q SR  W+
Sbjct  475   NIDSSIKRLEEEIQKLDRINNLRDLDDQELEERKKAQSELWMWIKRKEMYWAQNSRITWL  534

Query  2039  KSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNR  1860
             K GDRNT+F+    + KR ++ ++  +D  G +I +   +      +F  +F  E  V R
Sbjct  535   KEGDRNTKFFHAIASNKRRKNFIAS-IDIGGQIIDEPSRIKFEATAFFKSIFKEE-HVRR  592

Query  1859  TNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGT  1680
               F    F  + +E  + +  PF+ E+I +A+      KA GPDGF   F    W  V  
Sbjct  593   PVFENLNFKHVSQEQASQLTLPFSCEEIDSAVASCSVDKAPGPDGFNFKFIKSAWEIVKH  652

Query  1679  SLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRL  1500
              ++  VH F+    LP GCN   ++LIPKV+NP  +  +RPI +   +YK+I KVM  RL
Sbjct  653   DIYEIVHNFWASAHLPKGCNTAYITLIPKVENPTSLKDYRPISMVGSIYKIIAKVMARRL  712

Query  1499  KDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSW  1320
             + +V  L+GP QSS++ GRQI D  L   E++++++        +  K+D  KAYD +SW
Sbjct  713   QKVVNSLIGPLQSSYIEGRQILDGALVAGEVIDSYKKSGNEA--ILFKLDFHKAYDSISW  770

Query  1319  CFIEDTLRDIGF  1284
              F++ TL  + F
Sbjct  771   SFLKWTLEQMKF  782


 Score =   182 bits (462),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 141/442 (32%), Positives = 211/442 (48%), Gaps = 30/442 (7%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W   IM CVT+     L NG        ++GLRQGDP+SP LFVL  E L+ ++  +V
Sbjct  784   PKWCEWIMTCVTTASASILINGSPCTPFKLKRGLRQGDPLSPFLFVLIGEVLNQVIAKAV  843

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G W GV+V +    ++HL +ADD + F EA       +KK L LF   SG ++N  KS
Sbjct  844   EKGLWSGVEVCKNGLKVTHLQYADDTLIFSEAKMESLKNIKKALILFHLASGLQVNFHKS  903

Query  921   SLF---FSKNTNLGTQQNIAATLG-IPSVLDMGKHLGLPSIHGRLKK-DSFDNILERIKa  757
             S+     SK   L    ++   +G IP       +LGLP I G L +  ++D I+++I  
Sbjct  904   SIIGMNTSKEWILEAASSLLCKIGNIPFT-----YLGLP-IGGNLSRLQAWDPIIDKISH  957

Query  756   rlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKN  577
             +L+    + LS+ G   +++S L+ +P Y M    IP GV++ + ++ R FLW     K 
Sbjct  958   KLASWKGKMLSIGGRITLIKSSLANLPLYYMSLFSIPKGVVEKMNKITRQFLWSGSMEKR  1017

Query  576   KCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPS  397
                LV W I+   K+ GGL I ++ H N+A L+K  WR  QD +  W  + + KY + P+
Sbjct  1018  SLPLVAWNIIQLPKSLGGLSIGNIIHKNIAMLSKWIWRFLQDPSPFWCAVIREKYKYAPN  1077

Query  396   VWSSWQPKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRPLF  238
             +             W+ I  A+        I  NGI+ ++  G  TRFWLD WL   PL 
Sbjct  1078  ISILDLDVPKFGGPWRHICAAILHHTNAKSILCNGIRKNIGRGSQTRFWLDPWLSSTPLK  1137

Query  237   EEASAPIAPSSLNNLVANYWISNEGWDW----------DMLDRVLPEHILNKLSTFVLQE  88
              +     A S   N   + +   EG++W             DR   + +  +L      +
Sbjct  1138  SDFPRLFAISINPNATVDSYGFWEGFNWVWTFSWKREFRPQDRSEKKRLDMRLQQVHPSQ  1197

Query  87    DTLLGDRLVWYKEPNGLFSVSS  22
             +    D+LVW     G FS  S
Sbjct  1198  EA--RDQLVWAHTKAGNFSTKS  1217



>ref|XP_009147172.1| PREDICTED: uncharacterized protein LOC103870758 [Brassica rapa]
Length=1637

 Score =   228 bits (581),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/590 (29%), Positives = 272/590 (46%), Gaps = 19/590 (3%)
 Frame = -1

Query  3026  LKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIE  2847
             L+   + H P ++ L E K  R    ++   LG+D    +   G SGG+ LF    I ++
Sbjct  277   LREIRQTHFPEIMFLMETKNCRDVLVDLQQWLGYDRVFTINPRGLSGGLALFWKSDIKLD  336

Query  2846  ILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDF  2670
             I Y     I  +V Y  VS  + +S +YG      +  ++  +S      +  W  +GDF
Sbjct  337   IKYADKNLIDMKVHYGEVS--FFLSCIYGEPASEGKEIVWERISRIGVRRREKWCLIGDF  394

Query  2669  NSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDR  2490
             N +    E         S    F D +    + +L  +G  +TW  G     +    LDR
Sbjct  395   NEILSNDEKIGGPQRPESSFKPFGDMLSACGMEELESSGIRFTWA-GQRWQKWIQCCLDR  453

Query  2489  ALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQAC  2310
             A  N      FP +    L   GSDH P+L+      Q   +  F+F+  +      +  
Sbjct  454   AFGNKAWLQAFPASNQKFLDKRGSDHRPVLVKFQVS-QAREAGLFRFDKKFLFQPGVKQK  512

Query  2309  VQSVWRSDLDLSTNKSAMVE------ALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMG  2148
             +   WR     S N+S +         LS W ++   N   +   L  RLE  Q      
Sbjct  513   IIEAWRISEVGSVNRSVVKRLRDCRGVLSTWKKERIFNAKDRIHILERRLEWFQ------  566

Query  2147  IRSDlvrlerrlrkeleETLY-QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRV  1971
              R+       R+ ++     Y +EEL W Q+S E+W+K GDRN+ F+  +    R + ++
Sbjct  567   SRNYPCWHAIRVIRKELCRAYKEEELFWQQKSMEKWLKYGDRNSNFFHESVKANRAKIKL  626

Query  1970  SKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPF  1791
              K+ D +G     +    +   DYF  LF +    +         P + +     + A  
Sbjct  627   IKIKDVNGVERWSEEAKAQVALDYFNELFKSSNPPSYQQVFQEMVPRVSDAMNQGLMAEV  686

Query  1790  TPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTI  1611
             T E+IK+A+F +    A GPDG +  FF + W  VGT +   V  FFE G +P   N T 
Sbjct  687   TEEEIKSAVFSIKASSAPGPDGMSGLFFQQFWEEVGTKVSLEVKNFFERGRMPTDWNFTY  746

Query  1610  LSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITD  1431
             L L+PKVQ+PE +   RPI LC+V+YK+I+KV++ RL+ ++ +++  +QS+FV  R ITD
Sbjct  747   LCLLPKVQDPETMADLRPISLCSVLYKIISKVIVRRLQPLLPEIISVNQSAFVAERLITD  806

Query  1430  NTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             N     E ++A R  +  +  +M +K D+ KAYD++ W ++   +  +GF
Sbjct  807   NIGIAHEAVHALRVNQSIMKEYMVVKTDMSKAYDKVEWSYLRTLMEALGF  856


 Score =   187 bits (474),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 138/428 (32%), Positives = 209/428 (49%), Gaps = 9/428 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CV+S     L N +    I P++GLRQGDP+SP LFV+C E L+H+++ + R 
Sbjct  860   WIDLVMACVSSVSFAVLVNDKPFGMIRPQRGLRQGDPLSPFLFVICTEGLTHLLNRAERM  919

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+K +   P++ HL FADD +F  +A   +A  + + L  +   +GQ INLQKS++
Sbjct  920   SLLNGLKFSEEGPSVHHLLFADDSLFMCKATQNEAQILHEVLLRYGKATGQTINLQKSAI  979

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +   +  I   LGI +     K+LGLP      K +  D +  R+  RL+    
Sbjct  980   SFGAQIDHECKVVIQEVLGIMNEGGSSKYLGLPECFSGSKIELLDYLRSRVNGRLNAWYL  1039

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  +++++  SA+P + M    +P  VI +I   +  F WGS     K H + W
Sbjct  1040  RKLSQGGKEILLKTTASALPVFPMSVFKLPKKVIANISGAMANFWWGSDAHLRKIHWIAW  1099

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK +GG+G + L+  N A LAK AW++    +CL   L K++Y F  S +   + 
Sbjct  1100  EKLCLSKESGGMGFRDLEAFNQALLAKQAWKVLSAPHCLLAQLLKSRY-FPNSNFLEAKI  1158

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAP-IAPSSLN  199
                 S AW+ +L    +   G++  V +G +   W D W+ D        AP I   + N
Sbjct  1159  GDRPSYAWRSLLFGRELLIKGLQKRVGDGNSINVWTDRWMEDEADGYGLRAPWIKNCTFN  1218

Query  198   -NLVANYWI--SNEGWDWDMLDRV-LPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
              NL A   I   N  W+   L+ V +P  I   +     Q  T   D   W    +G +S
Sbjct  1219  VNLRARDLIDFQNRRWNVQALEEVFVPSDIQILIKN---QPVTSKEDFWTWKFNKSGAYS  1275

Query  30    VSSAYELA  7
             V S Y LA
Sbjct  1276  VKSGYWLA  1283



>ref|XP_009102778.1| PREDICTED: uncharacterized protein LOC103828890 [Brassica rapa]
Length=1302

 Score =   273 bits (697),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/492 (34%), Positives = 251/492 (51%), Gaps = 38/492 (8%)
 Frame = -1

Query  2696  GTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTP  2517
             G W  +GDFN + C +E         S    F   +    +++  FTG   +W+      
Sbjct  138   GPWFMIGDFNEIICHNEKEGGRRRPDSSFLPFKQMLHDCGMLEFPFTGDMLSWVGKRAGG  197

Query  2516  SFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAW  2337
             S    RLDRA+ N +   +FP + V ++ + GSDH P+L  I   P +  S +FKF+  W
Sbjct  198   STVRCRLDRAVGNADWHEKFPHSAVKYMRLWGSDHRPILADILIKPMRR-SKKFKFDKRW  256

Query  2336  TTHYSFQACVQSVWRSDLDLSTNKSAMV------EALSVWSRDSFGNIPQKKRRLLARLE  2175
               +   +  +   W+S  DL  N + M       +ALS W +    N  +    L  ++E
Sbjct  257   LDNEELRQVILEGWKSP-DLPPNATIMEHISSCRKALSEWRKQHNVNSAKLVEELKEKVE  315

Query  2174  GVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
             G+         +          KEL + L  EE+ W Q+SR  W++ GDRNT+F+   T 
Sbjct  316   GL-----YADDNATTEEIAAALKELSDALKAEEMFWKQKSRVFWLREGDRNTKFFHALTK  370

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
              +R ++++++L+D +G+++ D+  L+     YF  +F +              P  +EE 
Sbjct  371   QRRARNKITQLLDENGNIVEDEEGLVAIATSYFRQIFESSN------------PEDIEEA  418

Query  1814  WASVN------------APFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLF  1671
              A V             AP T  ++K ALF M P KA GPDG T  F+ K W  V   L 
Sbjct  419   LAQVPSTITGAMNDNLIAPVTEWEVKLALFAMHPEKAPGPDGMTALFYQKFWDIVKEDLT  478

Query  1670  SFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDM  1491
               V++F  +G +  G NDT + LIPK+  P  + QFRPI LCNV YK+I+KV+  RLK +
Sbjct  479   LMVNQFLFEGTMASGLNDTNICLIPKITKPNAMAQFRPISLCNVSYKIISKVLCQRLKKV  538

Query  1490  VRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCF  1314
             +  L+   QS+FV GRQI+DN +  QE+ +A RTK  GR   MA+K D+ KAYDR+ W F
Sbjct  539   LPGLISETQSAFVAGRQISDNIMIAQEMFHALRTKPSGRNKRMAIKTDMRKAYDRMEWSF  598

Query  1313  IEDTLRDIGFNH  1278
             IE  +R +GF+ 
Sbjct  599   IEAVMRKMGFSE  610


 Score =   142 bits (357),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 119/433 (27%), Positives = 184/433 (42%), Gaps = 72/433 (17%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C++S +   L NG+    I P +GLRQGDP+SP +F+LC E L+ +++ +   
Sbjct  612   WIAWIMRCISSVKYKVLMNGEPRGNIVPGRGLRQGDPLSPFIFILCTEALASLLNHAESQ  671

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G++VTR  P+                                              
Sbjct  672   GKITGMRVTRACPS----------------------------------------------  685

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                      ++Q I   LGI +   MG +LG+P      K   F  + +++  R++G + 
Sbjct  686   ----RITATSRQEIKDVLGIQNEGGMGTYLGIPEDISGSKCKLFAFLKDKLMHRVNGWTG  741

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS  G  V+++S+L A+P Y M + L+P  + +++   I  F W S   K   H  KW
Sbjct  742   RWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIAKFWWSSNPPKRGIHSAKW  801

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               V   +  GG+G + +   NLA LAK  WRL Q  + L   + + +Y      +    P
Sbjct  802   EKVCLPREEGGMGFRMIHEFNLALLAKQLWRLVQFPDSLVARVLRGRY------YKMSSP  855

Query  375   KR-----NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP  211
              R     N S  W  I  A  +   GI+  + +G   + W D W+   P     + PIAP
Sbjct  856   LRVISASNPSYVWSSISAARKLLLTGIRQKIHSGYEVKVWEDPWIPTIP--ARPALPIAP  913

Query  210   SSLNNLVANYWISNEGWDWD---MLDRVLPEHI--LNKLSTFVLQEDTLLGDRLVWYKEP  46
                 N+  + +I  E  +WD   +   V PE I  +  L+T          D   W    
Sbjct  914   VMHPNMRVSDFIDPETKEWDVGLLESYVNPEDIPLIRSLATSSAHRR----DTFCWNYTR  969

Query  45    NGLFSVSSAYELA  7
             NG ++V S Y +A
Sbjct  970   NGQYTVKSGYWVA  982



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   207 bits (526),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 128/400 (32%), Positives = 208/400 (52%), Gaps = 10/400 (3%)
 Frame = -1

Query  2459  FPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR--FKFNMAWTTHYSFQACVQSVWRSD  2286
             FP A VTHL    SDH P+++ +    +Q   SR  F+F  AW      ++ V+  W   
Sbjct  10    FPTAVVTHLLKYKSDHCPIVVRLVQPRRQREGSRRTFRFETAWLLEEGCESVVKQAWDGS  69

Query  2285  LDLSTNK--SAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrl  2112
             +     +    +   L  WS  S  N+ ++ +     L+  Q      I          L
Sbjct  70    VGAGVMERIGGVAGGLVSWSSKSLHNLGKQIKNTEKALKEAQ---QRRISPANCLTCNNL  126

Query  2111  rkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICD  1932
               +L++   ++E  WF RSR   ++ GD+NT+++    + +R ++R+  L+D++G    D
Sbjct  127   EAKLDDLNCKQEAYWFMRSRASEVRDGDKNTKYFHHKASHRRTRNRMKGLLDSEGVWHED  186

Query  1931  DGLLLKHVYDYFLGLFT-TEVDVNRTNFCYGCFPPLLEEDWASV-NAPFTPEDIKTALFD  1758
             +  + + V  Y+  LFT TE    +          ++  +   V + P+T  +I  AL  
Sbjct  187   EDKMQEIVEKYYHDLFTSTEPTTAQMQEVLKHMERVISPEINEVLSRPYTKAEIFEALQQ  246

Query  1757  MVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPE  1578
             M P KA GPDG    FF K W  VG  +   V      G +P   N T + +IPK+++P 
Sbjct  247   MHPSKAPGPDGMHAIFFQKFWHIVGDDVAGLVINILHGGEMPEHFNRTNIVMIPKIKDPT  306

Query  1577  RITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNA  1398
              ++++RPI LCNV+YKL++K ++IRLK ++  LV  +QS+FV GRQITDN L   E+ + 
Sbjct  307   ELSKYRPISLCNVIYKLVSKAIVIRLKTILPDLVTENQSAFVPGRQITDNVLIAMELFHT  366

Query  1397  FRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              + + K R G +A+K+D+ KAYDR+ W F++  L  +GF+
Sbjct  367   MKQRNKCRRGIIAMKLDMSKAYDRVEWGFLKKLLLTMGFD  406


 Score =   207 bits (526),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 140/425 (33%), Positives = 214/425 (50%), Gaps = 14/425 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CVT+ +   + NGQ+   +SP +GLRQGDP+SP LF+L A+  S M+ ++V+ 
Sbjct  409   WVNLIMNCVTTVQYSFVINGQVRGAVSPSRGLRQGDPLSPYLFILVADAFSKMLLNAVQE  468

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K +R  P +SHL FADD + F  A   + L +    + +   SGQKIN +KS +
Sbjct  469   KRIHGAKASRSGPVISHLLFADDSLLFARATRQECLAVVDLFNKYEEASGQKINYEKSEV  528

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK      ++ +   L +  V   GK+LG+ ++ G+ KK  F  IL+RI  +L G   
Sbjct  529   SFSKGVRFEQKEELLGLLNMRQVDRHGKYLGITTVAGQSKKAIFTAILDRIWKKLRGWKE  588

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V+++SV+ AIP Y M     P  V  +I   +  F WG   G  + H   W
Sbjct  589   KLLSRAGKEVLLKSVIQAIPTYLMGIYKFPVSVTSTISSAMAQFFWGQSGGGRRIHWKNW  648

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS---  385
               +   K  GGLG K L+  N A L + AWR+    + L   + KAKY    S   +   
Sbjct  649   KAMCELKCLGGLGFKDLEIFNDALLGRQAWRIMNGEHTLLGKVMKAKYYRHCSFLDAPLG  708

Query  384   WQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRP-LFEEASAPIAPS  208
             + P    S +W+GI  +  + + G+ W V NG+    W D W+ D    F ++      S
Sbjct  709   YAP----SYSWRGIWSSKALVKEGMLWRVGNGQDINIWRDPWIADETGRFIQSDEAEEVS  764

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
              ++ L+     S+ G W+ ++L R+  E     +    L E +   D + W    +G +S
Sbjct  765   KVSELIH----SDTGEWNLELLARLFTERDQECILAIPLSERSQR-DIITWAFTKSGEYS  819

Query  30    VSSAY  16
             V +AY
Sbjct  820   VKTAY  824



>emb|CCA66198.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   240 bits (612),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 182/608 (30%), Positives = 290/608 (48%), Gaps = 31/608 (5%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPK---ISRAQANEICSSLGFDEWIRVEAV  2898
             WN +G  +   R  LK  L  ++P  + + E K   IS      I ++    E+    ++
Sbjct  6     WNIRGLGAKIKRNVLKKSLLTYEPWFVFIQESKLESISGIMMKTIWNNSDL-EFCLSPSI  64

Query  2897  GYSGGIW-LFCSVSINIEILYTHPQFIAFQ---VYDNVSAPWLMSVVYGCLDMALRRHLF  2730
             G SGGI  L+ +    ++       +IA     +  + +   L+  +Y   D  +R   +
Sbjct  65    GSSGGILTLWRASKFRMDFSRCERNWIAVGGCVLSSDFNC--LLINIYNSCDDVIREETW  122

Query  2729  ADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
               L  +  N     L  GDFN V    +  + +    S    F ++I    LI++     
Sbjct  123   NSLFEFCSNSNLPCLIAGDFNEVLSSKDRGSHQ-IDESSSLKFRNFINNLRLIEVSPVEG  181

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQF  2370
              YTW RG        ++LDR L   E   +FP   V+ L    SDH PLL+  +     +
Sbjct  182   WYTWFRGNSR-----SKLDRVLVQAEWIEKFPALAVSILNRSISDHCPLLLQSSIV--DW  234

Query  2369  CSSRFKFNMAWTTHYSFQACVQSVW--RSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                 FKF   W +H      V+  W    +L L      +   L  W+ +SFGNI     
Sbjct  235   GPRPFKFQDVWLSHKGCMEIVEKAWIQSKELTLMQKLKKVKLDLKTWNSESFGNI---DA  291

Query  2195  RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQ----EELIWFQRSREEWIKSGD  2028
              +L R   +Q   S     DL   E + R + +  L++    +E+ W Q+SR +W+KSGD
Sbjct  292   NILLREAEIQKWDSEANSRDLEPEEIKTRAQAQLELWEWLKKKEIYWAQQSRIKWLKSGD  351

Query  2027  RNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFC  1848
             RNT+F+ +  +++R+++ +S ++   G  I D  ++ +    YF  LFT +    R  F 
Sbjct  352   RNTKFFHICASIRRSKNNISSIL-LQGKKIEDPIIIKEEAVKYFKNLFTEDFK-ERPTFT  409

Query  1847  YGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
                F  L E    S++APF+  +I  A+    P K+ GPDGF   F   +W  +    +S
Sbjct  410   NLSFKKLSESQAFSISAPFSTTEIDEAVASCNPSKSPGPDGFNFKFIKASWDLIKHDFYS  469

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              +  F+  GILP G N   ++LI K+++P     FRPI +   VYK+I+K++  RLK ++
Sbjct  470   IIQEFWHTGILPRGSNVAFIALIAKIESPSGFKDFRPISMVGCVYKIISKLLAGRLKQVM  529

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
               LVGPHQSSF+ GRQI D+ L   E+  + + +K     + LK+D  KA+D +SW F++
Sbjct  530   NDLVGPHQSSFIEGRQILDSILIASELFESCKRRKKAT--VMLKIDFHKAFDSVSWSFLD  587

Query  1307  DTLRDIGF  1284
              TL  +GF
Sbjct  588   WTLSQMGF  595


 Score =   173 bits (439),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/441 (34%), Positives = 213/441 (48%), Gaps = 24/441 (5%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W + I  CV+S     L NG  +     ++GLRQGDP+SP LFVL  E ++ M+  + 
Sbjct  597   PRWKKWISSCVSSAAASVLLNGSPSLPFKLQRGLRQGDPLSPFLFVLVVEVMNLMIKKAE  656

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALE-MKKCLDLFCSCSGQKINLQK  925
                +W+G+++T+  P ++HL FADD + F   N ++ALE +KK L LF   SG KIN  K
Sbjct  657   SLNSWQGIEITKNGPILTHLQFADDTILFAPHN-MEALENIKKTLILFQLSSGLKINFHK  715

Query  924   SSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarls  748
             S L    N      Q  A  L          +LG+P + G   K SF D ++E+I  +LS
Sbjct  716   SEL-LGINVPQDWMQRAAKNLCCKVGSFPITYLGMP-VGGSCSKLSFWDPLIEKISKKLS  773

Query  747   g*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCH  568
                   LSL G   ++++ L  +P Y M    +P GVID I R+ R FLW     K    
Sbjct  774   LWKGNLLSLGGRLTLIKASLLNLPIYYMSLFPMPQGVIDKITRIQRNFLWSGGLNKKSLA  833

Query  567   LVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS  388
             L+KW      K  GGL I +L   NL  L K  WR  Q+ N LW  + +AKY +   +  
Sbjct  834   LIKWSYAQLPKIFGGLNIGNLLARNLGLLFKWIWRYFQEPNALWRQIIEAKYGYPKELCI  893

Query  387   SWQPKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRP-----  244
             S      +   WK I  +L        +   G++  V NG +TRFW D W+ +       
Sbjct  894   SDLELLKNGGPWKLICNSLLKKEEVRELINQGLRMRVSNGESTRFWHDIWIDNSALKFQF  953

Query  243   --LFEEASAPIA-PSSLNNLVANYWISNEGWDWDM--LDRVLPEHILNKLSTFVLQEDTL  79
               LF  A  P+A  SS+     N W     W  ++   D+V  E + + L    + ++  
Sbjct  954   PRLFLIAEQPLAVVSSMGQFQGNEWRWLIPWSRELRSRDQVEWETLCSLLQNIKISKEG-  1012

Query  78    LGDRLVWYKEPNGLFSVSSAY  16
               D L+W  + +G+FSV S Y
Sbjct  1013  -EDVLIWRHDKSGIFSVKSFY  1032



>ref|XP_009102116.1| PREDICTED: uncharacterized protein LOC103828254 [Brassica rapa]
Length=1131

 Score =   213 bits (542),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 208/413 (50%), Gaps = 11/413 (3%)
 Frame = -1

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYS  2322
             RLDRAL+N E    FP +   +L M+GSDH P++  +          +F+F+  W     
Sbjct  19    RLDRALANEEWHTLFPYSYTEYLRMVGSDHRPVVAFLDDKVPGRKRGQFRFDKRWIGQEG  78

Query  2321  FQACVQSVWRSDL-----DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SL  2157
                 + S W  +      D +T  +     +S W ++   N P  K ++      ++   
Sbjct  79    LMESIVSGWTENQEGISGDFTTKINNCRHEISTWRKN---NQPYGKDKIFNLQNALEEVQ  135

Query  2156  SMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQS  1977
             +   RS    +E   + +       EE  W Q+SR  W  SGD NT+FY   T  +R ++
Sbjct  136   TDNNRSQEEIIEISRKLQE--AYRDEEEYWHQKSRNMWYSSGDLNTKFYHALTKQRRIRN  193

Query  1976  RVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNA  1797
             ++  L D +G+ I ++  + K   DYF GLF++       +F     P +  +    +  
Sbjct  194   KIVGLHDEEGNWISEENGVEKVAVDYFTGLFSSSNPREFDSFLEEIGPSISPQMNQLLLR  253

Query  1796  PFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCND  1617
               T E+++ ALF M P KA GPDG T  FF  +W  V   +   V+ F   G +    N 
Sbjct  254   RATEEEVRQALFMMHPEKAPGPDGMTALFFQHSWSVVKKDVVDLVNNFLVSGDMDSRLNI  313

Query  1616  TILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQI  1437
             T + +IPKV+ P R+ + RPI LCNV YK+I+KV+  RLK  +  L+   QS+FV GR I
Sbjct  314   TNICMIPKVERPTRMAELRPISLCNVGYKIISKVLCQRLKICLPHLISETQSAFVAGRLI  373

Query  1436  TDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             +DN L  QE+ +  RT K  +  +MA+K D+ KAYDR+ W FIE  L  +GF+
Sbjct  374   SDNILIAQEMFHGLRTNKSCQNKFMAIKTDMSKAYDRIEWSFIEALLTKMGFD  426


 Score =   200 bits (508),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 135/428 (32%), Positives = 210/428 (49%), Gaps = 10/428 (2%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P+W++ +  C++S +   L NGQ    I P++GLRQGDP+SP LF++C E L   +  + 
Sbjct  427   PHWVKLMQECISSVQYRVLLNGQPRGLIIPKRGLRQGDPLSPYLFIMCTEALIMNIKKAE  486

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
             R     G+KV R  P +SHL FADD +FF +AN  +   + + L  + + SGQ+IN QKS
Sbjct  487   RMKQLTGMKVARACPAVSHLLFADDSLFFCKANKEECHTILRILKDYEAVSGQQINFQKS  546

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ F       ++Q +   LGI ++  MG +LGLP   G  K   F  + +R+  R++G 
Sbjct  547   SIQFGHKIEESSRQELRDILGIQNLGGMGSYLGLPESLGGSKVQVFGFVQDRLNNRVNGW  606

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             + R  +  G  V+++SV++A+P + M    +P   +  +   +  F W         H  
Sbjct  607   TFRFFTKGGKEVIIKSVITALPNHVMSVYRLPKATVKKLTSAVAQFWWNPGGSTRGMHWK  666

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K NGGLG K L   N A L K  WRL +  N L++ +FK +Y  +    S  
Sbjct  667   SWDKLCEHKDNGGLGFKDLNDFNTAMLGKQLWRLIEKPNSLFSRVFKGRYYRNA---SPL  723

Query  381   QPKR--NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-RPLFEEASAPIAP  211
             +P R  + S  W+ I  A  +   G+   V  G +   W D W+   RP     +     
Sbjct  724   EPIRSYSPSYGWRSITSARSLVCKGLIKRVGTGSSISVWNDPWIPSTRP---RPANKNFH  780

Query  210   SSLNNLVANYWISNEGWDWDMLD-RVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLF  34
             +S  +L  +  I  E   W++   R L E    KL   +      + DR  W+   NG +
Sbjct  781   NSYPDLTVDSLIHQESRTWNLQALRTLVEPDDAKLIEGIPLSRNQMEDRNGWHFTNNGKY  840

Query  33    SVSSAYEL  10
             SV S Y++
Sbjct  841   SVQSGYQV  848



>ref|XP_008393538.1| PREDICTED: uncharacterized protein LOC103455726 [Malus domestica]
Length=1401

 Score =   211 bits (536),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 145/435 (33%), Positives = 221/435 (51%), Gaps = 33/435 (8%)
 Frame = -3

Query  1308  GYSPRYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAER  1129
             G++P +     WI+    C+++     L NG  T  + P +GLR GDP+SP LF+LC E 
Sbjct  662   GFAPLFC---NWIKE---CISTASFSILVNGNPTGLVLPXRGLRXGDPLSPYLFLLCTEG  715

Query  1128  LSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCS  949
             LS ++   +  G   G  V+     +SHLFFADD V FG A+  +A  M + L  +   S
Sbjct  716   LSMLIRRGIDRGALHGXXVSANGTPISHLFFADDSVLFGHASVEEARGMVEVLRTYARGS  775

Query  948   GQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILE  769
             GQ +NL KSS+FF   T+   ++ I  T+GI      G++LGL S  G  KK  F+ + +
Sbjct  776   GQAVNLSKSSIFFGSKTSNRVRKXIGRTMGIQCKSGFGRYLGLQSDFGHSKKVVFEEVRD  835

Query  768   RIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSR  589
             R+++RL+G + + LS AG  V+V++V  A+P Y+M    +P GV   +E+ IR F W   
Sbjct  836   RLESRLAGWAEQFLSQAGKEVLVKAVAMAMPNYAMSCFKLPIGVCRDLEKAIRNFWWRGS  895

Query  588   EGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYD  409
             E +   H +    +   K  GG G + ++  N AFLAK+ WRL Q+   L   + + KY 
Sbjct  896   EQRKXVHWISXERLMKQKRVGGXGFRDIQCFNXAFLAKIGWRLIQNPGSLLATVLQEKY-  954

Query  408   FDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEA  229
             +    +      RN+S  WKGI  A  +  +G++W V +G       D W   RP    +
Sbjct  955   YPGKCFXEAGKGRNTSWGWKGIFDARMVLLHGLRWRVGDGACINIRXDPW-XPRP----S  1009

Query  228   SAPIAPSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKE  49
             +  + P    +L A             +D V P  IL+     +    T   DR+VW+  
Sbjct  1010  TFKVKP--FESLHAT------------MDDVRP--ILS-----IPLSKTGCRDRMVWHHN  1048

Query  48    PNGLFSVSSAYELAL  4
              NG++SV S Y +A+
Sbjct  1049  ANGVYSVRSGYGVAM  1063


 Score =   201 bits (512),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 140/503 (28%), Positives = 226/503 (45%), Gaps = 66/503 (13%)
 Frame = -1

Query  2786  WLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCT  2607
             W +  +Y   D   R   +  LS    N +G  L +GDFN + C  E         S   
Sbjct  225   WYLFAIYASTDEKKRWDQWGYLSRRLGNNRGKSLLIGDFNDILCNDEKEGGNYRPTSSMR  284

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
             DF +++   EL+DLGF G  +TW    +    +  RLD  L+ +E    +P+  + H+ +
Sbjct  285   DFREFVAQNELMDLGFVGYPFTWRNNQEAKPIQ-QRLDMGLATMEWQDLYPENTIRHVVL  343

Query  2426  IGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEA  2247
              GSDH+ L +S T   + +   +F ++  W+T                   T +    + 
Sbjct  344   EGSDHALLFLS-TEKVKAWKGRKFSYDARWST-------------------TEECPKAQG  383

Query  2246  LSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIW  2067
             +  W R    N  +   +L   +      +S    S++V+++ R  +        EE  W
Sbjct  384   VKDWYRGRGRNSKKVIEQLKEEIRTAY--MSTEFASEVVKMKERELRAAHRN---EEAYW  438

Query  2066  FQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGL  1887
               +SR +W+K GD+N++F+   T  +R  +++  L D +G    D+  +      YF  L
Sbjct  439   RVKSRAQWLKEGDKNSKFFHAQTLKRRRFNQIKGLEDVNGVWQEDEAAISSIATSYFEVL  498

Query  1886  FTTEV--DVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPG  1713
             F +     ++    C    P +  ED  ++ A  T E+IKTA+F + P +A GPDG++  
Sbjct  499   FKSSSPGXIDEIGECLA--PRVTAEDNIALTAAVTEEEIKTAVFQIPPIRAPGPDGYSGC  556

Query  1712  FFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVY  1533
             F+   W TVG  +   V  F+  G +    N T L LIPKV+ P  +TQ+RPI LCNV+Y
Sbjct  557   FYQDHWDTVGKDVIKIVKAFWHSGTILRKLNHTNLVLIPKVKCPRNMTQYRPIALCNVIY  616

Query  1532  KLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKV  1353
             K+I KV+  RLK ++ K                                      MA+K+
Sbjct  617   KVIAKVLTNRLKTVMPKTG------------------------------------MAIKL  640

Query  1352  DLEKAYDRLSWCFIEDTLRDIGF  1284
             D+ KAYDR+ W F+   +  +GF
Sbjct  641   DMAKAYDRVEWVFLLSMMAKLGF  663



>ref|XP_007207581.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
 gb|EMJ08780.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
Length=1146

 Score =   224 bits (571),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 226/478 (47%), Gaps = 11/478 (2%)
 Frame = -1

Query  2690  WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSF  2511
             WL +GD N +    E      +   R      ++    L++L  T   YTW    D  S 
Sbjct  38    WLCIGDMNEILGNDEKEGGIPWPWGRTRYLRSFMDTNGLLELRSTSQFYTWENQHDPVSL  97

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
                +LDR L N +    +PD  V   P +GSDHSPL++      Q+     FKF   W  
Sbjct  98    IRMKLDRGLINDQWLFLWPDLCVHVEPRVGSDHSPLVLYFAPKIQRRAGG-FKFEAYWAD  156

Query  2330  HYSFQACVQSVWRSDL------DLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGV  2169
              +     +Q  W++D+       LS N     E L  WS++ F N   +   L+  L  +
Sbjct  157   EHDCGTIIQRGWKNDIVGDSFAALSANLGVCREELQKWSKEKFPNNLSRINLLMKSLSNL  216

Query  2168  Q*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVK  1989
             Q   S  +  +    E  +  E+     +EE  W QRSR  W+ +GD NT+F+   T  +
Sbjct  217   Q---SGPLEENYRHQESAIWDEMSVLWSREETYWKQRSRLNWLSAGDANTKFFHTTTLQR  273

Query  1988  RNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWA  1809
             R ++++  L+ ++G+ I  D  + +    +F  LF +    N           + E    
Sbjct  274   RQRNKIETLLKSEGNCISGDQAIREEFGIFFGNLFKSGGPRNWGGILNCVHASITEAQNK  333

Query  1808  SVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPP  1629
              +  PF+ E+++TA+  +   KA GPDGF   F+ + W  +   + + V  FF       
Sbjct  334   RLTDPFSMEEVRTAVKQLGSLKAPGPDGFPGLFYDRFWEIIQNFVNNLVTDFFLGNSRLE  393

Query  1628  GCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVH  1449
               N T + LIPK+  P  +  FRPI LCN  YK+++K++  RLK ++  L+  HQ++FV 
Sbjct  394   LLNHTHIVLIPKIPKPTSVNHFRPISLCNNSYKILSKLLANRLKTLLPMLISQHQNAFVP  453

Query  1448  GRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
             GRQI DN L   E  +  R K  +  + + LK+D+ KAYDR+ W F+E TL    F++
Sbjct  454   GRQIQDNILLAHEAFHYLRLKSSKKSFELGLKLDMNKAYDRVEWDFLEATLCKFSFDN  511


 Score =   187 bits (476),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 135/435 (31%), Positives = 210/435 (48%), Gaps = 63/435 (14%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CV +     + NG      SP +GLRQGDP+SP LF+L +E LS  + +S  +
Sbjct  513   WVELVMLCVKTITFSLVLNGSPGSPFSPSRGLRQGDPLSPYLFLLVSEVLSLNIINSTDT  572

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  +G+K++R  P +SHLFFADD +FF +A       +K  ++ +CS SGQ++N  KSSL
Sbjct  573   GMLRGIKLSRGGPELSHLFFADDSLFFLQATPPNCSALKSIIECYCSASGQEVNFNKSSL  632

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             +FS NT+ GT+      LG                 GR K ++   + +RI ++++G   
Sbjct  633   YFSPNTDTGTRNQFGLILG-----------------GRSKVEALAYVRDRINSKIAGWKL  675

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS A   V+++SV +AIP + M   L+P+ + +SI   +  F                
Sbjct  676   KLLSQAVREVLIKSVAAAIPAHPMSCFLLPATICNSINTDLARF----------------  719

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
                      GG+G   L+  N + LAK  WR+ ++ N LW  + KA+Y  + S   + + 
Sbjct  720   -------CGGGMGFLDLQAFNRSLLAKQCWRIMRNPNALWARILKARYFPECSFLDAKKG  772

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R +S A   +L    I   G  W + NGR+   W D WL+        S  I+P   +N
Sbjct  773   GR-ASWALSSLLVGRDIIEKGAYWQIGNGRSVSVWKDRWLMGY-----GSGKISPLPSSN  826

Query  195   -----LVANYW-ISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG-----DRLVWYKE  49
                  LVA+   + N  W+   ++  +P       S  +L   T +G     D LVW   
Sbjct  827   RFTPLLVADLIDVGNRSWNISHIEPFIPP------SEAMLIRSTPIGSLATRDPLVWPAV  880

Query  48    PNGLFSVSSAYELAL  4
              NG ++V S Y  A+
Sbjct  881   KNGDYTVKSGYYHAI  895



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   224 bits (572),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/432 (35%), Positives = 225/432 (52%), Gaps = 14/432 (3%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P + + I  C+++     + NG  T +I P++GLRQGDP+SP LF+LC E LS ++   +
Sbjct  323   PIFCKWIKACISTVSFSIVVNGTPTGFIVPQRGLRQGDPLSPFLFLLCTEGLSVLLRKGL  382

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
                   G K T     ++HLFFADD V FG A   +A  + + L ++   SGQ++NL KS
Sbjct  383   EQDALHGFKFTDTGTPITHLFFADDSVVFGNATVDEARAVAEALKVYACGSGQEVNLTKS  442

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+FFS  T   T+++I  TLGI      GK+LGL +  G  KK  F  + ++++ARL+G 
Sbjct  443   SVFFSPKTPNRTKRDIEGTLGIQCKQGFGKYLGLQADFGHSKKAVFAEVRDKVEARLAGW  502

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             + + LS AG  V+++SV  A+P Y+M    +P GV   IE+ IR F W   + ++  H V
Sbjct  503   TEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVCRDIEKAIRKFWWKGNDQRHGIHWV  562

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  ++  K +GGLG K ++  NLA LAK+ WRL+     L   + K KY    +   + 
Sbjct  563   SWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTCYPTSLLATVLKDKYHPGCTFKEAG  622

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFE----EASAPIA  214
             + K  +S  WKGI +A  +   GI+W V NG+      D W      F     E      
Sbjct  623   RGKL-TSWGWKGIYEARKVLLQGIRWRVGNGQRINIRDDPWFPKPSTFRVCPYENLDATM  681

Query  213   PSSLNNLVANYWISNEGWDWDMLDRVLPEHILN-KLSTFVLQEDTLLGDRLVWYKEPNGL  37
                L    +N W  N    +    R   E IL+  LS F  +      D+L+W+   NG+
Sbjct  682   VCELIEPASNSWKDNR--IFAGFHREDAETILSIPLSHFGCE------DKLMWHYSVNGV  733

Query  36    FSVSSAYELALE  1
             +SV S Y +A E
Sbjct  734   YSVKSGYGIARE  745


 Score =   187 bits (475),  Expect(2) = 8e-105, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 155/269 (58%), Gaps = 3/269 (1%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EEL W  +SR +W+  GD+NT+F+   T  +R+++++  +VD+ G    +D  +      
Sbjct  55    EELYWKTKSRNQWLNEGDKNTKFFHAQTLKRRSRNQIRGIVDSQGVWQEEDKKIADTAVG  114

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  LF +       +        +  ED  ++  P T  +I  A+  + P +A GPDGF
Sbjct  115   YFSELFQSSRPGQIEDIVRNVDARISPEDNNALTGPVTTAEIVLAVSQIPPSRAPGPDGF  174

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  F+   W TVG  +   +  F+  G L    N T L LIPKV+ P+ + QFRPI LCN
Sbjct  175   SGCFYQDHWNTVGEDVVKIIKAFWHSGTLLRQLNHTNLVLIPKVRCPKNMAQFRPIALCN  234

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF--RTKKGRVGW  1368
             V+YK++ KV+  RLK ++ K++G +QS+FV G+QI DN L   E+L++   + ++ + G 
Sbjct  235   VIYKILAKVLTNRLKLVMPKVIGDNQSAFVAGKQIQDNILVVHEVLHSLLHQRREDQAG-  293

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             MA+K+D+ KAYDR+ W F+   +  +GF+
Sbjct  294   MAIKLDMAKAYDRVEWNFLIAIMSKLGFS  322



>ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica]
 gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica]
Length=1421

 Score =   249 bits (636),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 179/611 (29%), Positives = 285/611 (47%), Gaps = 31/611 (5%)
 Frame = -1

Query  3065  NCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLG--FDEWIRVEAVGY  2892
             +C          + K  LR  KP ++ L E K        +    G  F EW+   ++G 
Sbjct  275   SCNSKGETGSMGSGKEQLRRLKPDIVILLETKKEIVDRQLVAGVWGSRFKEWVFSPSLGR  334

Query  2891  SGGIW-LFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*  2715
             SGGI  L+ S S+++         ++ ++ +N+   W +S +YG      R   + +L+ 
Sbjct  335   SGGIAVLWNSQSVSVIDSMVGEFSVSIRIVENIGTDWWLSGIYGPCRQRERNSFWEELAD  394

Query  2714  YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI  2535
              +      W   GDFN V   +E SN+   + S   DFND+I    L D     +S+TW 
Sbjct  395   LYGYCGDKWCLGGDFNVVRFSAEKSNEGRVTKS-MRDFNDFIQETNLRDPILLNASFTWS  453

Query  2534  RGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRF  2355
                +    +  RLDR L +      FP  +   LP I SDH P  I + +   ++  S F
Sbjct  454   NLRENAVCR--RLDRFLVSGSWEEHFPHYRHKALPRITSDHCP--IELDSSRVKWGPSPF  509

Query  2354  KFNMAWTTHYSFQACVQSVWRSD-------LDLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
             +F   W  H  F+  ++  W  D           T    +   L VWS++ FG++ +  R
Sbjct  510   RFENMWLNHPDFKRKIKLWWGEDQIPGWEGYKFMTRLKMLKSKLKVWSKEEFGDVERDLR  569

Query  2195  RLLARL------EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKS  2034
                ARL      EG +  L   +RS+   L  ++    +    +EE+ W QR + +W + 
Sbjct  570   EAEARLLVLDQREGTE-GLDHLLRSERDNLLLKIGDLAQ----REEVKWRQRGKVKWARE  624

Query  2033  GDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVN-RT  1857
             GD NT+F+       R ++ + KL   D  +I  D  + + V  +F GL++   +V    
Sbjct  625   GDGNTKFFHRVANGARKRNYIEKLEVEDLGVIEVDANIEREVIRFFKGLYSRNKNVGWGV  684

Query  1856  NFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTS  1677
                  C    +E DW  +  PF  E+++ A+FD    K+ GPDGF+  FF   W  V   
Sbjct  685   EGLNWCPISQVEADW--LERPFDLEEVQKAVFDCGKDKSPGPDGFSMSFFQSCWEVVKGD  742

Query  1676  LFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLK  1497
             L   +  FF+ GI+    N+T + LIPK  N  ++T +RPI L   +YK+I+KV+  RL+
Sbjct  743   LMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLR  802

Query  1496  DMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWC  1317
             +++   +   Q +FV  RQI D  L   E++   R +K R G +  K+D EKAYD + W 
Sbjct  803   EVLGNTISQSQGAFVQKRQILDAVLVANEVVEEVRKQK-RKG-LVFKIDFEKAYDHVEWN  860

Query  1316  FIEDTLRDIGF  1284
             F++D +   GF
Sbjct  861   FVDDVMARKGF  871


 Score =   162 bits (410),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 198/427 (46%), Gaps = 44/427 (10%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+ C+ S     + NG+        +GLRQGDP+SP LF L  E                
Sbjct  879   IIGCLESVNFSIMINGKPRGKFRASRGLRQGDPLSPFLFTLVME----------------  922

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
                       +SHL FADD +F  +      L + + L LFC  SG KIN  KS +    
Sbjct  923   ----------VSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCDVSGMKINKAKSCIL---  969

Query  903   NTNLGTQ--QNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDN-ILERIKarlsg*ssr  733
               N  T+   N+A + G         +LGLP + G  +  +F N ++E+++ RL      
Sbjct  970   GINFSTEVLNNMAGSWGCEVGCWPMIYLGLP-LGGNPRALNFWNPVMEKVEKRLQKWKRA  1028

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWG  553
              LS  G   ++Q+VLS+IP Y M    +P GV   +E+L+R FLW   E   KCHLV+W 
Sbjct  1029  CLSKGGRLTLIQAVLSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEEGKKCHLVRWE  1088

Query  552   IVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ-P  376
              VT SK  GGLGI SL+  N A  AK  WR   + N LW  + K+KY  D + W + +  
Sbjct  1089  RVTKSKEEGGLGIGSLRERNEALRAKWLWRFPLETNSLWHRIIKSKYGIDSNGWDTKRID  1148

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD---RPLFEEASAPIAPSS  205
             K +  N W+ I +  + F    ++ V NG   RFW D WL +   + LF   S+     +
Sbjct  1149  KVSCRNPWREISKGYNSFLQCCRFSVGNGEKIRFWEDLWLKEGILKDLFPRLSSLSRRKN  1208

Query  204   LN-NLVANYWISNEGWDWDMLDRVLPEHILNKLSTF--VLQEDTLLG---DRLVWYKEPN  43
              +    AN  +    WD+D   R L E  L ++     +L    L G   DR  W  E  
Sbjct  1209  QSIACFANNHVLPLNWDFD-FRRNLSEAELAEVVILLDILGNVRLYGSRPDRRSWEVEEQ  1267

Query  42    GLFSVSS  22
             G FS  S
Sbjct  1268  GSFSCKS  1274



>ref|XP_010041058.1| PREDICTED: uncharacterized protein LOC104429964 [Eucalyptus grandis]
Length=1350

 Score =   211 bits (537),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 215/408 (53%), Gaps = 33/408 (8%)
 Frame = -1

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYS  2322
             RLDR+L N +  L FPDA V+ LP +GSDHSPLL++  T P              + H+ 
Sbjct  233   RLDRSLRNFDWRLAFPDAVVSALPTVGSDHSPLLLN--TQPT-------------SAHH-  276

Query  2321  FQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIR  2142
                        DL     K ++  ALS WSR +F N  ++   L  +L+ +   L +   
Sbjct  277   -----------DLPYLLKKVSL--ALSSWSRRTFSNANKRIYELQYKLQQITNQLDIPYE  323

Query  2141  SDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKL  1962
                V   +   ++L +   QEE  W  RSR +W++ G++NT+F+   T  +R  +R++ L
Sbjct  324   RHEVTTLKSEIQQLWQ---QEEQFWAMRSRIKWLQWGNKNTKFFHATTIQRRQCNRITML  380

Query  1961  VDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPE  1782
             +D +   + D+ +L      YF  L+ +    +       C   +  E   ++ A  T  
Sbjct  381   LDEELGWVRDETILKDKTQLYFSNLYQSVGFRDYGPILDQCPCLVTPEMNMALTARVTKA  440

Query  1781  DIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSL  1602
             ++ T  F +   KA GPDG    F+   W T+   +F+ VH+FF  G +P   N T ++L
Sbjct  441   EVHTTTFQLGGNKAPGPDGLNGLFYQSNWATLEDVVFNSVHQFFLSGKMPLALNQTAVTL  500

Query  1601  IPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTL  1422
             +PK+  P+ +  +RPI LCN  YK+I++V+  RLK ++ +L+ P QS+FV G QI DN L
Sbjct  501   VPKIPLPQSLDHYRPISLCNFAYKIISRVLANRLKPILPQLISPEQSTFVSGHQIQDNIL  560

Query  1421  AYQEILNAFRTKKGRVGWMA-LKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
               QE+++  +T+K    + A +++D++KA+DR+ W F+   L  IGF+
Sbjct  561   VVQEVIHQIKTRKHWRHYPAIIRMDMQKAFDRVEWDFLMAYLHKIGFH  608


 Score =   200 bits (509),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 210/423 (50%), Gaps = 43/423 (10%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W++ I  C+++  +   +NGQ  D+  P +G+RQGDP+SP LF+L    LS+++  ++
Sbjct  609   PQWVQWIFQCISTVSISIKFNGQQLDYFRPTRGIRQGDPLSPYLFILLTNLLSNLIHRAI  668

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G   GVK+ R +P +S+LFFA+D +FF    +     +   L  +C  SGQ IN  KS
Sbjct  669   DMGQLTGVKLNRFSPTLSNLFFANDAIFFVNGTTTDCHTLASILSQYCLASGQSINRNKS  728

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
              +F SK+     + N+A+ L IP +  MG++LG+P   G  K++ F  IL ++ ++L G 
Sbjct  729   GIFLSKDCPSPLKANLASELRIPVLERMGRYLGIPIDWGCSKRELFSWILGKVNSKLEGW  788

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
                 +S  G  V++++V+ AIP Y+M    IP  +  SIE+    F W +   K   H  
Sbjct  789   KENLISKGGKEVLIKTVVQAIPQYAMSVFKIPFSICKSIEKQTARFWWQNDCRKTGIHWK  848

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
             +W ++   KA GGLG + L   N A L K AWRL Q  + LW+ L K         WS  
Sbjct  849   QWVVLKEPKAKGGLGFRDLAAFNKAMLGKQAWRLIQQPSSLWSKLLK---------WS--  897

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
                                  +G   ++R  R    WL   +L  PL  E      P+ +
Sbjct  898   -------------------VGDGTNINIRQDR----WLPRGILGGPLQRE-----EPTMV  929

Query  201   NNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
             ++L+     ++  WD + L+     H ++ + +  ++ + L  D+L+W    NG ++  S
Sbjct  930   SDLLVQ---NSNNWDIETLNTYYDAHTVHDILSIPVRRN-LTNDKLIWTATTNGQYTFHS  985

Query  21    AYE  13
              Y 
Sbjct  986   GYH  988



>ref|XP_009114416.1| PREDICTED: uncharacterized protein LOC103839673 [Brassica rapa]
Length=1267

 Score =   232 bits (592),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/477 (34%), Positives = 230/477 (48%), Gaps = 19/477 (4%)
 Frame = -1

Query  2678  GDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWI----RGLDTPSF  2511
             GD N +T   E       S      FN  I    L++    G+  +W     +G+     
Sbjct  76    GDLNEITGNHEKDGGAIRSPDSFVPFNTMIRNGGLLEFPARGNKLSWQGRRGKGVGAVMV  135

Query  2510  KGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTT  2331
             +  RLDRAL+N E    FP +   +L ++ SDH P++  +     +    +FKF+  W  
Sbjct  136   R-CRLDRALANEEWHTLFPCSYTEYLRVVASDHRPVVAFLGDKVVRR-KGQFKFDKRWIG  193

Query  2330  HYSFQACVQSVWRSD-----LDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ  2166
                    + S W+           T  S     ++ W +D+     +K   L   LE VQ
Sbjct  194   QDGLLEAITSGWKEQNGSQPEPFVTKISNCRHEIAKWRKDNPPFGKEKINELQKALEEVQ  253

Query  2165  *SLSMGIRSDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVK  1989
                   + ++  + +        +  Y+ EE  WFQ+SR  W  SGDRNT FY   T  +
Sbjct  254   ------MDNNRSQEDILDVSRKLQEAYKDEENYWFQKSRNMWYSSGDRNTEFYHALTRQR  307

Query  1988  RNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWA  1809
             R ++R+  L D DG+ I DD  + K   +YF  LFTT       NF     P +  +   
Sbjct  308   RVRNRIVGLHDVDGNWITDDEGVEKVAVNYFDELFTTTSPTAFDNFLSEIQPSISTQTNG  367

Query  1808  SVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPP  1629
              +    T E+I+ ALF M P KA GPDG T  FF  +W  + T L   V++F   G L  
Sbjct  368   WLLRLATEEEIRQALFMMHPGKAPGPDGMTALFFQHSWHIIKTDLVELVNKFLLTGELDT  427

Query  1628  GCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVH  1449
               N T + +IPK + P R+T+ RPI LCNV YK+I+KV+  RLK  +  L+   QS+FV 
Sbjct  428   RLNITNICMIPKTERPTRMTELRPISLCNVGYKIISKVLCQRLKICLPSLISETQSAFVA  487

Query  1448  GRQITDNTLAYQEILNAFRTKKGRVG-WMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             GR I+DN L  QE+ +  R  K   G +MA+K D+ KAYDRL W FI+  L  +GF+
Sbjct  488   GRLISDNILIAQEMFHGLRANKACQGKFMAIKTDMSKAYDRLEWDFIQAILLKMGFD  544


 Score =   179 bits (453),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 164/320 (51%), Gaps = 11/320 (3%)
 Frame = -3

Query  1278  YWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVR  1099
             +W++ +M C++S +   L NGQ    I P++GLRQGDP+SP LF+LC E L   +  + R
Sbjct  546   HWVKLMMACISSVQYRVLLNGQPRGLIIPQRGLRQGDPLSPYLFILCTEALIANIKKAER  605

Query  1098  SGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
                  G+KV R  P++SHL FADD +FF +A   +   + + L  + + SGQ IN QKSS
Sbjct  606   ENQLTGMKVARACPSISHLLFADDSLFFCKAQEAECQTILRILQDYAAVSGQLINFQKSS  665

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
             + F        +Q +   LGI +V  MG +LGLP   G  K   F  + +R+ +R++G +
Sbjct  666   IQFGHKIEDSRRQMMRDILGIQNVGGMGTYLGLPENMGGSKIQIFGFVQDRVSSRVNGWT  725

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
              R  +  G  V+++SV++A+P + M    +P      I  ++  F W         H   
Sbjct  726   FRYFTKGGKEVVIKSVVTAMPNHVMSCYRLPKANTKKITSVVARFWWSPGGSTRGMHWKS  785

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY-----DFDPSV  394
             W  V   K  GGLG K +   N A L K  WRL +  N L+  +FK +Y       DP  
Sbjct  786   WDKVCAPKDQGGLGFKDIMDFNTAMLGKQLWRLIEKPNTLFARVFKGRYYRNASPLDPI-  844

Query  393   WSSWQPKRNSSNAWKGILQA  334
               S+ P    S  W+ I+ A
Sbjct  845   -RSYSP----SYGWRSIISA  859



>gb|ABF95850.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=940

 Score =   213 bits (541),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 142/436 (33%), Positives = 218/436 (50%), Gaps = 25/436 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CVT+ +    +NG L +  SP +GLRQGDP+SP LF+  A+ LS ++   V++
Sbjct  325   WVEWVMACVTTVKYSVSFNGNLLEPFSPSRGLRQGDPLSPYLFLFVADGLSTILSQDVQA  384

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G  + +KV R AP +SHL FADD + F  A   QA  +++ L L+  C+GQ ++  K SL
Sbjct  385   GRLEELKVCRRAPGVSHLLFADDSLLFFRACPQQASVVRQALALYQRCTGQLLSSSKCSL  444

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               S +      ++I   L + +     K+LGLP+  GR+  + F  I ER+  RL+    
Sbjct  445   LASAHCPTDVLEDIKIVLQVETSTFESKYLGLPTPEGRMSAERFKAIKERLVKRLNSWVE  504

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + +SL     +++SV  AIP Y +    +P    ++  +LIR F WG  E K K H   W
Sbjct  505   KFMSLGAKDTLIKSVAQAIPTYVLGLFRLPVSTCEAYTKLIRDFWWGDEENKRKIHWTAW  564

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              I+T  K  GGLG + LK  N A L K AWRL Q    L   + KAKY  +  +  +  P
Sbjct  565   DIITRPKGLGGLGFRDLKLFNQALLGKQAWRLIQFPGSLCARILKAKYFPNCELVDAVFP  624

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               ++S  WKGI   L + + G+ W + +G   + W D W+     F             N
Sbjct  625   G-DTSPTWKGIEYGLELLKKGLVWRICDGNKVKIWRDQWVQRESSFNLIGK-------KN  676

Query  195   LVANYWIS------NEGWDWDMLDRVL-----PEHILNKLSTFVLQEDTLLGDRLVWYKE  49
                  W+S      ++ W+ D++  V       E +  KL  F  +      D L W+  
Sbjct  677   RCRLRWVSQLIRQEDKSWNEDLIRHVCHPIDAAEILKIKLPQFPAE------DFLAWHFG  730

Query  48    PNGLFSVSSAYELALE  1
              +G+++V S Y LA++
Sbjct  731   KSGVYTVRSGYRLAMK  746


 Score =   198 bits (504),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 110/328 (34%), Positives = 182/328 (55%), Gaps = 5/328 (2%)
 Frame = -1

Query  2255  VEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEE  2076
             + AL  WS + FG++ Q+ + + A++E     LS+          R L   ++E LY+EE
Sbjct  1     MAALREWSINVFGSVTQELKEIKAKVE----ELSIADPLLHNAEIRMLYARMDELLYREE  56

Query  2075  LIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYF  1896
             ++W QRSR  W+K GDRNT+F+      +  ++++++L   D   + +   +     ++F
Sbjct  57    IMWLQRSRVAWLKEGDRNTKFFHRQAAWRSKKNKITRLKAEDSRFVENKEEMEHMAREFF  116

Query  1895  LGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTP  1716
               L+  +  V+         P + +   A +  PF+ ++I  ALF + P KA GPDGF  
Sbjct  117   QTLYLKDNSVDPRELIDALTPRVDDGMNAGLCKPFSYDEIADALFQIGPLKAPGPDGFPA  176

Query  1715  GFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVV  1536
              FF + W  +   + + V  FF  G++  G NDT + LIPKV  PE++ +FRPI LCNV+
Sbjct  177   RFFQRNWAVLKKEVTTAVRNFFLQGVMLAGVNDTSIVLIPKVSKPEQLKEFRPISLCNVI  236

Query  1535  YKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTL-AYQEILNAFRTKKGRVGWMAL  1359
             YK+++K M+ RL+ +++ ++   QS+F+  R ITDN L A++ I +  +       + A 
Sbjct  237   YKVVSKCMVNRLRPILKDIISVTQSAFIPERLITDNALIAFECIHHIQKETSAGKQFCAY  296

Query  1358  KVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             K+DL KAYDR+ W F+   L  +GF  T
Sbjct  297   KLDLAKAYDRVDWDFLRGALTKVGFCST  324



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   213 bits (543),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 190/340 (56%), Gaps = 13/340 (4%)
 Frame = -1

Query  2291  SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSD-lvrlerr  2115
              DL+ S+     V A   W+ ++FGN+ ++KR++LARL G Q +L     S+ L  LE+ 
Sbjct  336   EDLEESSISDLAVGAAD-WNINTFGNVYKRKRKVLARLHGAQKALHDKPYSNFLHELEKD  394

Query  2114  lrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLIC  1935
             L+ EL + L QEE +W  +++ E I+ G+RNTRF+  +  +KRN SR+  L +  G  I 
Sbjct  395   LQNELIQILMQEEALWAAKNKSERIREGERNTRFFHRSVMIKRNASRIFSLRNEVGLDIH  454

Query  1934  DDGLLLKHVYDYFLGLFTTEVDVNR--TNFCYGCFPPLLEEDWASVNAPFTPEDIKTALF  1761
             D   L  HV  +F  L++TE       TN   G            +  P + E+I+ +L 
Sbjct  455   DPDQLRSHVQCFFESLYSTEHKKCDWGTNASRGLI---------DIAYPPSDEEIRASLK  505

Query  1760  DMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNP  1581
              M P KA GPDGF P FF K W  VG  +   +  +F    +P      ++ LIPK   P
Sbjct  506   QMKPIKAPGPDGFHPVFFQKMWDIVGKDVCENIRSWFYHRKVPQEMCQAVICLIPKQNPP  565

Query  1580  ERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILN  1401
             E +   RPI LCN +YKL TKV++ RLK ++   + P+Q+SF+ GR    N +   EIL+
Sbjct  566   ETVKHLRPISLCNTLYKLTTKVIVNRLKPLIPYWISPNQNSFIKGRGPDVNLVVATEILH  625

Query  1400  AFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             +   KKG+ GW ALK+DLEKAYDR+ W F+   L+++  N
Sbjct  626   SMNKKKGKWGWFALKIDLEKAYDRIEWSFVRTCLQNLDLN  665


 Score =   197 bits (502),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 132/409 (32%), Positives = 203/409 (50%), Gaps = 15/409 (4%)
 Frame = -3

Query  1227  LWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVKVTRIAPNMS  1048
             L NG+ ++     +GLRQGDP+SP LF +C E LSHM++ +     W    V +    +S
Sbjct  684   LMNGRRSNTFKHSRGLRQGDPMSPYLFNICLESLSHMINQATIDKTWAPFWVGKDRVPVS  743

Query  1047  HLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTNLGTQQNIAA  868
             HL FADDL+ FG  +      +++ L  FC  SGQKIN  KS L FS NT+   +     
Sbjct  744   HLMFADDLLIFGRVDESTTFAVRETLRAFCEISGQKINESKSRLIFSPNTSTEHRSLFQQ  803

Query  867   TLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtlslag*HVMVQSVL  688
             TL I    ++G +LGLP  H R  K+    +++++K +L+   ++ LS AG   ++ S L
Sbjct  804   TLNIEENANLGTYLGLPLSHKRPSKNQVQFVVDKVKKKLANWKTKYLSRAGRLCLISSTL  863

Query  687   SAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKANGGLGIKS  508
             S IP Y M++  +P+  +  ++R+   FLWG  E + + HLV        K  GGLG+++
Sbjct  864   STIPAYYMQAMALPAATLKDLDRVCNNFLWGDVENQKRIHLVGMERTFRPKTMGGLGVRN  923

Query  507   LKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAWKGILQALH  328
                MN A++AKL W+LSQ    L      +KY  +  V S  +     S  W+ I +   
Sbjct  924   QTLMNKAYMAKLGWKLSQGPENLAQKCITSKYIHNHYVTSFAK----GSPIWQSIGKGWD  979

Query  327   IFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVANYWISNEG----W  160
             +     +W + NG    FW D+WL    +  + + P     LN     Y + +      W
Sbjct  980   LLTKDSQWILGNGADIDFWEDNWLGIGNIRSQIAGP-----LNQYEETYKVRDVTGGGVW  1034

Query  159   DWDMLDRVLPEHILNKLSTFVLQEDTLLGD-RLVWYKEPNGLFSVSSAY  16
               + L   LP HI++++            D R   + EP G FS++ AY
Sbjct  1035  KLERLSLTLPAHIVSRILCLEPPHPEDQKDIRAPIFLEPQG-FSLALAY  1082


 Score =   120 bits (300),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 100/194 (52%), Gaps = 0/194 (0%)
 Frame = -3

Query  4437  IRVTKEEKIRLRRPWRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAK  4258
             I +++EE   L +PW  +LI +V+GRS S  FL   LQ +WK E   E+  L   F+  +
Sbjct  29    IPISEEEYKNLAQPWESALICKVMGRSFSREFLRMELQKLWKWEGTLEMTTLGKGFYSIQ  88

Query  4257  FETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDF  4078
               +      +   GPW +L  ++ TQ W   F P + +  +   W+  P LPIE+F+ + 
Sbjct  89    CPSQARRAEIILEGPWTLLGSHVWTQCWEAGFRPSLAQFTERPRWVALPELPIEFFNKNI  148

Query  4077  LKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSNFVINGTEWPKEYEGIHQI  3898
             L+K+G  +G+ +KID+ +    K +FA +CV +D  K L     +  T  P  Y      
Sbjct  149   LEKVGNSLGKLLKIDVHSLTGDKRRFAAMCVLMDKDKMLPKGAWLGRTFQPLIYCEGPWF  208

Query  3897  CFKCSIYGHRMETC  3856
             C  C+ +GH+M  C
Sbjct  209   CEACNKFGHQMRNC  222



>gb|AAD24601.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1319

 Score =   207 bits (527),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/425 (34%), Positives = 212/425 (50%), Gaps = 11/425 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CVTS     L NGQ    I+P +G+RQGDPISP LFVLC E L H++  +  S
Sbjct  554   WISWIMGCVTSVTYSVLINGQHFGHITPERGIRQGDPISPFLFVLCTEALIHILQQAENS  613

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G++     P+++HL F DD      A      +M  CL  +   SGQ IN++KSS+
Sbjct  614   KKVSGIQFNGSGPSVNHLLFVDDTQLVCRATKSDCEQMMLCLSQYGHISGQLINVEKSSI  673

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +  T++ I    GI      GK+LGLP      K+D F  I E++++ LSG   
Sbjct  674   TFGVKVDEDTKRWIKNRSGIHLEGGTGKYLGLPENLSGSKQDLFGYIKEKLQSHLSGWYD  733

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLS  G  ++++S+  A+P Y M    +P G+   +  ++  F W S E  NK H +  
Sbjct  734   KTLSQGGKEILLKSIALALPVYIMTCFRLPKGLCTKLTSVMMDFWWNSMEFSNKIHWIGG  793

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T  K+ GG G K L+  N A LAK AWRL  D   + + +FK++Y  +    ++ Q 
Sbjct  794   KKLTLPKSLGGFGFKDLQCFNQALLAKQAWRLFSDSKSIVSQIFKSRYFMNTDFLNARQG  853

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R  S  W+ IL    +   G+K  + NG  T  W+D WL D      +  P+   SL N
Sbjct  854   TR-PSYTWRSILYGRELLNGGLKRLIGNGEQTNVWIDKWLFD----GHSRRPMNLHSLMN  908

Query  195   --LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG--DRLVWYKEPNGLFSV  28
               +  ++ I     +W++  + L E    K    ++ +  L+   D   W    NGL++V
Sbjct  909   IHMKVSHLIDPLTRNWNL--KKLTELFHEKDVQLIMHQRPLISSEDSYCWAGTNNGLYTV  966

Query  27    SSAYE  13
              S YE
Sbjct  967   KSGYE  971


 Score =   203 bits (517),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/559 (28%), Positives = 262/559 (47%), Gaps = 29/559 (5%)
 Frame = -1

Query  2933  LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLD  2754
             LG+D +  +E VG SGG+ +F    + I+ L+     +  +V     + W +S VYG   
Sbjct  14    LGYDYFHTIEPVGKSGGLAIFWKNHLEIDFLFEDKNLLDLKVSQGKKS-WFVSCVYGNPV  72

Query  2753  MALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEEL  2574
             + LR  L   LS         W  +GDFN +          +  +S    F + +   ++
Sbjct  73    LHLRYLLLDKLSSIGVQRNSAWCMIGDFNDILSNDGKLGGPSRLISSFQPFKNMLLNCDM  132

Query  2573  IDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS  2394
               +G +G+S+TW  G     +   +LDR   N E    F ++    L  +GS H P+L++
Sbjct  133   HQMGSSGNSFTW-GGTRNDQWIQCKLDRCFGNSEWFTMFSNSHQWFLEKLGSHHRPVLVN  191

Query  2393  ITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSD--LDLSTNKSAMVE---ALSVWSR  2229
                  Q+    +F ++  +       A   S W  +   D+S++   MV+   A+S W +
Sbjct  192   FVN-DQEVFRGQFCYDKRFAEDPQCAASTLSSWIGNGISDVSSSMLRMVKCRKAISGWKK  250

Query  2228  DSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSRE  2049
             +S  N   +  RL + L+  +       +         ++ +L     +EE  W  +S++
Sbjct  251   NSDFNAQNRILRLRSELDEEK-----SKQYPCWSRISVIQTQLGVAFREEESFWRLKSKD  305

Query  2048  EWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADG--HLICDDGLLLKHVYDYFLGLFTTE  1875
             +W+  GDRN++F+Q      R ++ +  LVD +G  H +  +   +  VY  F  LF + 
Sbjct  306   KWLFGGDRNSKFFQAMVKANRTKNSLRFLVDENGNEHTLNREKGNIASVY--FENLFMSS  363

Query  1874  VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTW  1695
                N  +   G    + EE    +    T  +I +A+F +     S P+           
Sbjct  364   YPANSQSALDGFKTRVSEEMNQELTQAVTELEIHSAVFSINV--ESAPEKL---------  412

Query  1694  PTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKV  1515
                  S +  +  FFE G+LP   N T L LIPK  NP+R++  RPI LC+V+YK+I+K+
Sbjct  413   ECCQGSDYIEILGFFETGVLPQEWNHTHLYLIPKFTNPQRMSDIRPISLCSVLYKIISKI  472

Query  1514  MMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKA  1338
             +  +LK  +  +V P QS+F   R I+DN L   EI+++ RT  K    +M  K D+ KA
Sbjct  473   LSFKLKKHLPSIVSPSQSAFFAERLISDNILIAHEIVHSLRTNDKISKEFMVFKTDMSKA  532

Query  1337  YDRLSWCFIEDTLRDIGFN  1281
             YDR+ W F+++ L  +GFN
Sbjct  533   YDRVEWSFLQEILVALGFN  551



>ref|XP_010687489.1| PREDICTED: uncharacterized protein LOC104901596 [Beta vulgaris 
subsp. vulgaris]
Length=1102

 Score =   249 bits (636),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/426 (36%), Positives = 227/426 (53%), Gaps = 4/426 (1%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  +M C++S       NG +  +++P +GLRQGDPISP LF+LCA+  S ++  + 
Sbjct  322   PAWIVRVMACISSVSFTFKINGAVQGFLAPSRGLRQGDPISPYLFLLCADAFSTLLTKAA  381

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
                   G ++ R AP +SHLFFADD + F +A+  +   +   +  +   SGQ++NL K+
Sbjct  382   EEKKIHGAQICRGAPRISHLFFADDSILFTKASVQECSVVADIISKYERASGQQVNLSKT  441

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
              + FS+N + G +  I   LG+  V    K+LGLP+I GR KK +F  I ERI  +L G 
Sbjct  442   EVVFSRNVDSGCRSEIVNVLGVTEVAKQEKYLGLPTIIGRSKKVTFVCIKERIWKKLQGW  501

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
               + LS  G  V++++V+ AIP Y M    +PSG++D I  LI  F WGS+EG+ K H  
Sbjct  502   KEKLLSHPGKEVLIKAVVQAIPTYMMSVFCLPSGLVDEIHSLIARFWWGSKEGERKMHWY  561

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
             KW  +   K+ GGLG + L   N A LAK AWRL+++   L   + KA+Y        + 
Sbjct  562   KWETLCMPKSMGGLGFRDLHCFNQALLAKQAWRLTKNSYSLLALVLKARYHKKVEFVDA-  620

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             +   N S  W+ I  +  +   G+KW V +GR+ R W D+WLL          P   S +
Sbjct  621   RRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWEDAWLLGEGA-HFTPTPSMNSDM  679

Query  201   NNLVANYWISNE-GWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
                V+     +E GW+ DM+ +   E   + +    L       D L W+   +GLFSV 
Sbjct  680   ELRVSALLDYDEGGWNVDMVQQTFVEEEWDMILKIPLSR-YWPDDHLYWWPTKDGLFSVR  738

Query  24    SAYELA  7
             S Y LA
Sbjct  739   SCYWLA  744


 Score =   161 bits (408),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 146/270 (54%), Gaps = 7/270 (3%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W  R+R   ++ GD+NT+++    + ++ ++ ++ L+D +G        + + V  
Sbjct  54    EESYWHARARANELRDGDKNTKYFHHKASQRKKRNTINGLLDENGVWKKGKDEIGEIVTA  113

Query  1901  YFLGLFTTEVDVNRTNFCYG---CFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGP  1731
             YF  LFT+           G   C   L+ E   S+ AP T +DI+ ALF M P KA G 
Sbjct  114   YFQNLFTSSNPDEMEAALEGVPCCVTDLMNE---SLMAPPTGDDIRAALFSMHPNKAPGI  170

Query  1730  DGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIG  1551
             DG    FF + W  +   + SFV  ++   +     N T + LIPK   P  +  FRPI 
Sbjct  171   DGLHALFFQRFWHILWGDIISFVLNWWNGDVDLSSVNKTCVVLIPKCATPLSMKDFRPIS  230

Query  1550  LCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RV  1374
             LC V+YK+++K +  +LK  + +++  +QS+FV  R ITDN L   EI +A + + G   
Sbjct  231   LCTVLYKILSKTLANKLKLFLPEIISTNQSAFVPRRLITDNALVAFEIFHAMKRRDGTNN  290

Query  1373  GWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             G  ALK+D+ KAYDR+ WCF+E  ++ +GF
Sbjct  291   GVCALKLDMSKAYDRVEWCFLEKVMQRMGF  320



>ref|XP_008350747.1| PREDICTED: uncharacterized protein LOC103414113 [Malus domestica]
Length=2297

 Score =   223 bits (569),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/607 (27%), Positives = 272/607 (45%), Gaps = 71/607 (12%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLG--FDEWIRVEAVG  2895
             WN +G  S   R TLK   R  +P +I L E K +      + S  G  F EWI   A G
Sbjct  608   WNVRGLGSKQKRLTLKQQFRRLQPDIIILQETKKTSIDRRLVASVWGSRFKEWIYAPAQG  667

Query  2894  YSGGI---WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
              SGGI   W   ++S+   ++      I  + ++ +   W +S VYG      RR  + +
Sbjct  668   SSGGIAVIWNTKNISVTESLIGVFSVSIKIKAFNGLE--WWLSGVYGPCKSRERREFWEE  725

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             ++  +      W   GDFN V   +E SN    + S   +FND+I   EL DL    + +
Sbjct  726   MAGLYGLCGPKWCVGGDFNVVRFVNEKSNGGRLTTS-MRNFNDFIRETELKDLELLNAQF  784

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW    + P  +  RLDR L +      FP+ +       G +    +I +         
Sbjct  785   TWSNFREEPVCR--RLDRFLVSAGCEEIFPEVE-------GWEGYKFMIKL---------  826

Query  2363  SRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLA  2184
                                               A+ + +  WS++SFG + +  +   A
Sbjct  827   ---------------------------------KAIKKKVQRWSKESFGEVEKDFKEAEA  853

Query  2183  RLEGVQ*SLSM-GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQ  2007
              LE +     M G+  D  R    L     +  Y+EE+ W QRS+ EW K GD NT+F+ 
Sbjct  854   SLEELDRREGMEGLDVDARRKREELLFXXGDLAYKEEVKWRQRSKVEWXKEGDGNTKFFH  913

Query  2006  VATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC----  1839
                + +R ++ + +L    G +I D   +  H+  +F  LF++  +      C+G     
Sbjct  914   RVASGRRKRNYIERLEXEVGGVIEDANEIEDHIVXFFKSLFSSNEEA-----CWGLEGIN  968

Query  1838  FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
             + P+ E +   +  PF   +++ A+FD    K+ GPDG++     + W  +  ++   + 
Sbjct  969   WAPISELEANWIERPFEEAEVQRAVFDCGKDKSPGPDGYSLQMIQQCWDILKXNIMKIME  1028

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
              F+E GI+    N+T + LIPK  +  ++T FRPI L   +YK++ K +  RLK+++   
Sbjct  1029  EFYETGIINAVTNETFICLIPKKSDSMKVTDFRPISLVTGLYKIMAKTLASRLKEVLGST  1088

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             +  +Q +FV  RQI D  L   E++   R KK     + LK+D EKAYD + W F+++ L
Sbjct  1089  ISQNQGAFVKDRQILDAVLIANEVVEEVRQKKEEG--LVLKIDFEKAYDHVEWRFLDEVL  1146

Query  1298  RDIGFNH  1278
             +   F +
Sbjct  1147  QRKSFGN  1153


 Score =   187 bits (475),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/431 (33%), Positives = 218/431 (51%), Gaps = 18/431 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + +  C++S     L NG+        +GLRQGDP+SP LF L  + LS +++ +  +
Sbjct  1155  WRKWMQGCLSSANFSVLINGRPRGKFQASRGLRQGDPLSPFLFTLVVDVLSRLMEKAQEN  1214

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                KG+ + +    + HL FADD +FF   +      + + L LFCS SG KIN  K  L
Sbjct  1215  HLIKGLCIGQEKVEIXHLQFADDTIFFLAEDEGGWNNLLELLKLFCSVSGLKINKAKCYL  1274

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarlsg*s  739
                 N++      +A + G        K+LGLP + GR +   F D ++++++ RL    
Sbjct  1275  A-GINSDCEKLNRLADSWGCEVGSWPIKYLGLP-LGGRPRALKFWDPVVDKMEKRLQSWK  1332

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
                LS  G   ++QSVL ++P Y M    +P GVI  +E+L++GFLW   E   K +LVK
Sbjct  1333  KAFLSRGGRLTLIQSVLGSLPTYYMSLFKMPCGVIGRLEKLMKGFLWEGVEEGKKNNLVK  1392

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W IV  SK  GGLG+ +L++ N A LAK  WR  ++ + LW  + ++KY    + W+++ 
Sbjct  1393  WEIVIKSKEEGGLGVGNLRNRNEALLAKWLWRFPKEPHSLWHKVIRSKYGLQDNGWNAFP  1452

Query  378   PKRNSSNA-WKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
             P R SS + WK I     +F +  K+ V NG   RFW D WL   PL E+       S  
Sbjct  1453  PIRGSSRSPWKDISIGSQLFLHCCKFEVGNGERVRFWEDGWLDGGPLKEQFPRLFLLSRK  1512

Query  201   NNLVANYWI----SNEGWDWDMLDRVLPE-------HILNKLSTFVLQEDTLLGDRLVWY  55
             +N   + ++    ++  W++D   R L E        +L K+    L +  +  D   W 
Sbjct  1513  HNQNISSFVDLSTNSLSWNFD-FRRNLNEAEIEEAARLLQKVEEVRLSQSRM--DNRRWK  1569

Query  54    KEPNGLFSVSS  22
              E +GLF+  S
Sbjct  1570  MEASGLFTCKS  1580



>ref|XP_010473926.1| PREDICTED: uncharacterized protein LOC104753360 [Camelina sativa]
Length=811

 Score =   253 bits (645),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 221/380 (58%), Gaps = 14/380 (4%)
 Frame = -3

Query  1185  GLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEA  1006
             GL +GDP+SP LFVLC ERL H++D +V +  WK + ++R  P +SH+ FADDL+ F EA
Sbjct  438   GLSEGDPLSPFLFVLCMERLCHLIDRAVVNKQWKPISLSRGGPQLSHICFADDLILFAEA  497

Query  1005  NSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHL  826
             +  Q   ++  L+ FC  SGQK++L+KS +FFS N +    + I+   GI S  D+GK+L
Sbjct  498   SVAQIRVLRSVLEQFCGASGQKVSLEKSKIFFSNNVSRELGKLISEESGIKSTKDLGKYL  557

Query  825   GLPSIHGRLKKDSFDNILERIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIP  646
             G+P +  RL K++F  +LER+ +RL+G  S TLSLAG   + +++LS+IP +SM + ++P
Sbjct  558   GMPVLQKRLNKETFGEVLERVSSRLAGWKSHTLSLAGRLTLTKALLSSIPVHSMSTIMLP  617

Query  645   SGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAW  466
                + S++++ R FLWG    + K +LV W  V   K +GGLGI++ K MN A +AK+ W
Sbjct  618   KATLASLDKISRTFLWGGTGERRKQNLVSWKKVCMPKGDGGLGIRASKDMNKALIAKVGW  677

Query  465   RLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAWKGILQAL-HIFRNGIKWHVRNG  289
             RL  D   LW  + ++KY     V S+W      S+ W+     L  +   G  W + +G
Sbjct  678   RLLHDKQSLWARVLRSKYKVG-VVKSNW------SSTWRSTGTGLREVVCKGQNWVLGDG  730

Query  288   RATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVANYWISNEGWDWDMLDRVLP---EHIL  118
             +  +FW D WL   PL E  +  +    ++    + W    GWD   LD++LP       
Sbjct  731   QRVKFWTDRWLSHSPLVELETRDVPAEVVHEKACDLWKVGVGWD---LDKILPYVSSDTR  787

Query  117   NKLSTFVLQEDTLLGDRLVW  58
              +L+ FVL  DT   D++ W
Sbjct  788   LELAAFVLVNDTDNEDQISW  807


 Score =   158 bits (399),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/504 (28%), Positives = 203/504 (40%), Gaps = 141/504 (28%)
 Frame = -1

Query  2774  VVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFND  2595
             VVY    ++ R  L+  L+       G  +  GDFN++    E +            F D
Sbjct  74    VVYATPTISRRSGLWDRLTEVMSGVVGPLVVGGDFNTIVRLDERAGGNGRLSYDSLAFGD  133

Query  2594  WIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSD  2415
             WI    LID+GF      W                          + DA+VTHLP + S 
Sbjct  134   WINDSSLIDMGF------W--------------------------WQDARVTHLPFLSSH  161

Query  2414  HSPLLI----SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEA  2247
             H+PL +     I+  P+     R  F                                  
Sbjct  162   HAPLYVQFAPEISRDPK-----RRPFR---------------------------------  183

Query  2246  LSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIW  2067
                W+++ FG + ++K  LL  LE VQ  + +    +L+ +E  L K+ +  L QEE++W
Sbjct  184   ---WNKEVFGAVQKRKELLLTELERVQNFIELSPTDELLEIEDSLLKDFDLFLEQEEMLW  240

Query  2066  FQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGL  1887
             FQ+SRE+WI  G RNT ++  +T ++R ++R+  L + +G  I D   L      Y+  L
Sbjct  241   FQKSREKWINFGGRNTSYFHTSTVIRRRRNRIEMLKNEEGGWITDTQELESLAVHYYTRL  300

Query  1886  FT-TEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGF  1710
             ++  +V           F  L   D A +N PF   DI+ A+                  
Sbjct  301   YSLQDVHAVVEKLPSSGFMSLSVADHALLNRPFLLVDIEGAI------------------  342

Query  1709  FHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYK  1530
                                   G  PP  ND +L LI KV  PERITQFRPI        
Sbjct  343   ---------------------RGTFPPETNDVLLVLIAKVAKPERITQFRPI--------  373

Query  1529  LITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVD  1350
                           R  V      F+ GR  TDN +  QE +++ + KKGR GWM LK+D
Sbjct  374   --------------RGYV--KTGGFIPGRLSTDNIVVVQEAVHSMKRKKGRKGWMLLKLD  417

Query  1349  LEKAYDRLSWCFIEDTLRDIGFNH  1278
             LEKAYDR+ W F+EDTL   G + 
Sbjct  418   LEKAYDRIRWDFLEDTLGVAGLSE  441



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score =   240 bits (613),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/566 (31%), Positives = 281/566 (50%), Gaps = 14/566 (2%)
 Frame = -1

Query  2954  ANEICSSLGFDEWIRVEAVGYSGGIWLF-CSVSINIEILYTHPQFIAFQVYDNVSAPWLM  2778
             A  I S LG+D    V++VG SGG+ ++  S  ++  ++      I   V       W  
Sbjct  425   AENIKSRLGYDCAFGVDSVGRSGGLCIYWKSAMLDFSLVSFSNNHICGDVVVANGVKWRF  484

Query  2777  SVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFN  2598
               +YG  + A  ++   DL     + +G  L  GDFN V   SEV            DF 
Sbjct  485   VGIYGWPE-AGNKYKTWDLLRSLGDYEGPVLFGGDFNEVLSMSEVEGGRVSDRRAMHDFR  543

Query  2597  DWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGS  2418
             + +    L DLGF+G  YTW RG +  +    RLDR L++ +    FP   V H+    S
Sbjct  544   EVVDELHLRDLGFSGLWYTWERGKNPTTQIRERLDRFLASPQWFDCFPQVHVEHMVRYKS  603

Query  2417  DHSPLLISITTCPQQFCSSRFKF---NMAWTTHYSFQACVQSVW--RSDLDLSTNKSAMV  2253
             DH+P+++ +  C ++    + K      AW    S ++ V++ W   S L       A+ 
Sbjct  604   DHTPIMVQLFGCKRRRKKRKKKRFRFGTAWLLEDSCESLVRTAWDHSSGLPFEARIGAVA  663

Query  2252  EALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEEL  2073
             + L VWS+D+  ++ ++   +   ++ +Q S    I +D   L     K     L ++E 
Sbjct  664   QDLVVWSKDTLNHLGREICLVEEEIKRLQHS---SIAADQEHLMECHSKLDG-LLEKQEA  719

Query  2072  IWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFL  1893
              W+ RSR   IK GD+NT+++    + ++ ++ ++ L D       DD  + + V  Y+ 
Sbjct  720   YWYLRSRVAEIKDGDKNTKYFHHKASQRKRRNYINGLFDEGDVWRDDDEDIERVVEAYYK  779

Query  1892  GLFTTEV--DVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFT  1719
              LFT+ +  D   +       P + EE    +      E++  AL  M P KA GPDG  
Sbjct  780   NLFTSSLPSDEALSAVLDAVVPIISEEMNVVLCRRVVKEEVWEALRQMHPSKAPGPDGMH  839

Query  1718  PGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNV  1539
               F+ + W  VG  + S V         P   N+T ++LIPKV++P  +++FRPI LCNV
Sbjct  840   AVFYQRFWHIVGDDVTSVVAGIIHGTRPPDALNNTNIALIPKVKSPTLVSEFRPISLCNV  899

Query  1538  VYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMA  1362
             ++KL+TKV+  RLK ++  +V  +QS+FV GR ITDN L   E+ ++ + + KG  G++A
Sbjct  900   IFKLVTKVLANRLKTILPGVVSENQSAFVPGRLITDNALIALELFHSMKYRCKGNRGFVA  959

Query  1361  LKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +K+D+ KAYDR+ W F+   L  +GF
Sbjct  960   MKLDMSKAYDRVEWSFLRSLLDKMGF  985


 Score =   170 bits (430),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 121/420 (29%), Positives = 202/420 (48%), Gaps = 30/420 (7%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ +M CV+S R   + NG +   + P +GLRQGDPISP LF+L A+  S +V  +V  
Sbjct  989   WVKCVMDCVSSVRYSFVVNGDVCGSVIPSRGLRQGDPISPYLFILVADAFSALVRKAVAD  1048

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +  G++   +  ++                          L+ + + SGQKIN++KS +
Sbjct  1049  KSIHGIQECSVIVDI--------------------------LNKYEAASGQKINIEKSEV  1082

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK  +   ++ +   L +  V    K+LG+P++ GR K+  F  I++R+  +L G   
Sbjct  1083  SFSKGVSSVQKKELVEFLAMRQVDRHSKYLGIPTLAGRSKQHLFSGIMDRVWKKLQGWKE  1142

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ AIP Y M     P  ++ SI   +  F WGS+  +   +   W
Sbjct  1143  KLLSRAGKEVLLKTVIQAIPTYVMGVYRFPVAIVKSIHSAMAKFWWGSKGDRRPMYWKSW  1202

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               + N K  GG+G + L   N A L + AWRL Q  + L + + KAKY +  S +     
Sbjct  1203  ESMCNPKCLGGMGFRDLSVFNEALLGRQAWRLIQCEDSLLSKVLKAKY-YPSSSFLDASL  1261

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                 S +W+ I  +  + + GI W V NG     W D W+L+      +S  +    L  
Sbjct  1262  GPVGSYSWRSIWGSKSLVKEGILWRVGNGATINIWDDPWVLNGESRFISSGRV--ERLKY  1319

Query  195   LVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
             +       +  WD ++++ +  E  +  +    L E  L  DR+ W    +G +SV +AY
Sbjct  1320  VCDLIDFGSMEWDANVVNELFNEQDIQAILAVPLSE-RLPHDRVAWAFTKDGRYSVKTAY  1378


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (44%), Gaps = 9/189 (5%)
 Frame = -3

Query  4386  SLILRVLG-RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPW  4210
             SL+ +VL  R  ++  + + L  +W +        + +  F+ +F    D   V  G PW
Sbjct  39    SLVGKVLTIRPYNFEAMKKTLNQIWSISKSALFRTIENGLFVVQFANPRDKTKVMAGRPW  98

Query  4209  MVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDL  4030
                 + ++  E   N  P    +     WLR  +LP++   ++ ++ IG  +G  +++D 
Sbjct  99    SFDQNLVLFNEIEGNAQPSNIALSHSPFWLRLYNLPMDSRTENRIRMIGSGVGTVLEVDF  158

Query  4029  TTGMASKGKFARVCVQLDITKPLLSNFVI-----NGTEWPKEYEGIHQICFKCSIYGHRM  3865
                +  K   ARV V +D++KPL     I     N      +YE +   C+ C I GH  
Sbjct  159   DGIVWDKS--ARVKVLVDVSKPLRRIQQIRSKGGNVAIVEVKYERLPNFCYVCGILGHIE  216

Query  3864  ETCGLSVPI  3838
               C L VP+
Sbjct  217   RDC-LRVPV  224



>ref|XP_008791119.1| PREDICTED: uncharacterized protein LOC103708118 [Phoenix dactylifera]
Length=1071

 Score =   234 bits (596),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/617 (27%), Positives = 281/617 (46%), Gaps = 71/617 (12%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFD-EWIRVEAVGY  2892
             WN +GAA PSF  + K  +++H P +  + E ++S      +   LG D E    ++ G 
Sbjct  6     WNYRGAAKPSFMSSFKRLVQVHCPEICFISETRLSGEGLVHLRRRLGRDWESYTFDSRGL  65

Query  2891  SGGI---WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADL  2721
             SGGI   W     + ++ ++ + P            APW++  VY   D  +RR L+ ++
Sbjct  66    SGGILLLWRRGVATFDVVMVVSAPDV----------APWVLCGVYTSTDYRVRRVLWQEI  115

Query  2720  S*YFFNPQGT-WLAMGDFNSVTCQSEVSNKETFSMSRC--TDFNDWIFMEELIDLGFTGS  2550
             +      QG   + +GDFN +    +      F M R    +F D++    L+DLGF+G 
Sbjct  116   T--SLTAQGVPTVVVGDFNCILSLGDKRGGAAF-MDRADRREFRDFVSRTGLVDLGFSGP  172

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQF  2370
              +TW       +    RLDRA ++ +  LRFP                            
Sbjct  173   QFTWCNNQLGNARVSERLDRAFASPDWILRFPT---------------------------  205

Query  2369  CSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRL  2190
             C S      AW       A    ++R    L   K      L  W+R+  G+I       
Sbjct  206   CRSWDIVREAWRIPVRGDA----MYRVSRKLELAK----RRLRRWNREVVGDI-------  250

Query  2189  LARLEGVQ*SLSM---------GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIK  2037
               R+EGV+ ++S           +  D +   + L       L Q E+ W Q+SR +W++
Sbjct  251   FRRVEGVETAISELQRKEDLEGALSVDDMGDLQGLLATHHSLLRQHEIFWRQKSRVQWVR  310

Query  2036  SGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRT  1857
              GDRNT F+   T ++R +S +  L D  GH +  +  + + + D+F   +T + +    
Sbjct  311   EGDRNTSFFHQTTIIRRQRSTIHSLQDGSGHRVEGEPAIRQVLLDFFHDRWTEDENSGDR  370

Query  1856  NFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTS  1677
             +        + + + A++  P + +++  A++ + P KA GPDGF P FF + W  + T+
Sbjct  371   DHPMRMDARIEDTENAALVRPVSAQEVHEAVWALAPDKAPGPDGFPPFFFRQYWAIIRTA  430

Query  1676  LFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLK  1497
             +   +  FF   ++P     T ++LIPK Q       FRPI LC  +YK++ ++M+ R+K
Sbjct  431   VVEAIQCFFSQKMMPDDWKATFITLIPKRQEAAEPDHFRPISLCTALYKVVARIMVRRMK  490

Query  1496  DMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWC  1317
              ++  ++   Q +F+ GR I+ N L  QE++   +    R   MA+K+D+E+AYD + W 
Sbjct  491   PLLPGIISQEQGAFIAGRNISHNVLLAQEMMWDLQRASKRRSLMAIKLDMERAYDMIRWR  550

Query  1316  FIEDTLRDIGFNHTGSG  1266
             F++  L    F+    G
Sbjct  551   FLQQALEAYDFHRQWIG  567


 Score =   176 bits (447),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 179/345 (52%), Gaps = 2/345 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CV  PR   L NG  + +     GLRQG P+SP LF+LCA+ LS  +      
Sbjct  565   WIGWIMGCVRGPRFSILVNGTPSPFFESIMGLRQGCPLSPYLFILCADILSRDLQRVCAH  624

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                +       A  +SHL FADD +    A    A  +++ +  +C  SGQ++N QKSS+
Sbjct  625   RELEAYVPAPGASPLSHLLFADDCLLLARARVSDAWILRRVVADYCVASGQRVNFQKSSV  684

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS +T    +Q I   L IP  ++   +LG+     RL+      +++R+++RL G  +
Sbjct  685   HFSPSTESRVRQEIRGILQIPEQVETLTYLGVSITVRRLRVAECSYLVQRVESRLEGWRA  744

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
              +LS+ G   +++SVL ++P Y M +T++P   +  +ERL++ FLWGS +G +  HLV W
Sbjct  745   ASLSMMGRLTLIRSVLGSMPVYLMANTVVPKMTLLRVERLLQCFLWGSYDGGHGVHLVAW  804

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               V    + GGL ++SL      F+A+ A R   + + LW+ +  A+Y  + S   + + 
Sbjct  805   EHVCQPTSEGGLRVQSLLERRELFIARHAARFLLEPHGLWSQVMAARYGREVS--EAARR  862

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPL  241
              R  S  W+ I + L       +W + +GR+     D W+   PL
Sbjct  863   GRRVSFMWREIGRYLPTVSANTRWLIGDGRSIDVTADPWVDTVPL  907



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score =   207 bits (527),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/574 (27%), Positives = 252/574 (44%), Gaps = 69/574 (12%)
 Frame = -1

Query  2969  ISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSA  2790
             I +  A  I   +G+     V + G +GG+ ++    ++  ++      I   +      
Sbjct  2     ICKNAAELIKDKIGYKNAFGVTSQGRAGGLCIYWKEEVDFSLVSFSSHHICGDIRVE-GQ  60

Query  2789  PWLMSVVYGCLDMA-------LRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKE  2631
              W    +YG            L RHL  ++S          L  GDF+ +    E     
Sbjct  61    MWRFIGIYGWAKEEEKFKTWDLIRHLCENISLPL-------LVGGDFSEILSYDEKDGGV  113

Query  2630  TFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPD  2451
               +      F D +    L +LGF    YTW RGL   +    RLDR +SN+  +  FP+
Sbjct  114   DRNRREMGAFRDLLDDCALRNLGFDNPRYTWERGLSVTTRIRERLDRFVSNLAWTQIFPN  173

Query  2450  AKVTHLPMIGSDHSPLLISITTCPQQFCSSR-FKFNMAWTTHYSFQACVQSVWRSDLDLS  2274
               V +L    SDHSP++  +     +    R F+F   W      +  V+  W +     
Sbjct  174   HGVENLLRYKSDHSPIVTRLKAAATERGKRRGFRFETCWLLDAGCEEAVKEAWEA-----  228

Query  2273  TNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleE  2094
                             S G+   ++  LL  L   Q                        
Sbjct  229   ----------------SSGDKITRRLSLLDELNEKQ------------------------  248

Query  2093  TLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLK  1914
                  E  W+ RSR   +K GD+NT+++    + ++ ++ V  L + DG    +   +  
Sbjct  249   -----EAYWYLRSRVAEVKDGDKNTQYFHHKASQRKKRNFVKGLQNDDGVWCSEIEEIEI  303

Query  1913  HVYDYFLGLFTT--EVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKA  1740
                +YF  +FT+    DVN  +      P + ++   ++  P+T ++I  AL  M PCKA
Sbjct  304   FFANYFSTIFTSCNPSDVNLQHVLQYISPIVSDDCNCALLRPYTKDEIYAALSQMHPCKA  363

Query  1739  SGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFR  1560
              GPDG    F+ + W  +G  +  FV         P   N T ++LIPKV++P+   +FR
Sbjct  364   PGPDGMHAIFYQRFWHIIGDDISDFVCGILHGHHFPADLNCTNIALIPKVKDPKVAAEFR  423

Query  1559  PIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-K  1383
             PI LCNV+YKL++K +++RLKD +  +V  +QS+FV GR ITDN L   E+ +  + + +
Sbjct  424   PIALCNVLYKLVSKAIVLRLKDFLPDIVTEYQSAFVPGRLITDNALIAMEVFHLMKHRSR  483

Query  1382  GRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              R G +A+K+D+ KAYDR+ W F+   L  +GF+
Sbjct  484   SRRGTIAMKLDMSKAYDRVEWGFLRKMLLTMGFD  517


 Score =   202 bits (515),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 212/425 (50%), Gaps = 8/425 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV+S     + NG++   + P +GLRQGDP+SP LF+L A+  S M+   V+ 
Sbjct  520   WVNLIMWCVSSVSYSFIINGRVRGSVVPNRGLRQGDPLSPYLFILVADIFSKMIQKKVQE  579

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G K +R  P +SHL FADD + F  A   +  E+   L+ +    GQKIN +KS +
Sbjct  580   KRLHGAKASRSEPEISHLLFADDSLLFTRATRQECFEIVDILNRYELAFGQKINYEKSEV  639

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FSK   +  ++ +   L +  V    K+LG+P + GR KK  F ++L+RI  +L G   
Sbjct  640   SFSKGVRVEQKEALMGILKMRQVEKHEKYLGIPFVAGRSKKLIFASLLDRIWKKLQGWKE  699

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V+ AIP Y M    +P+ +I  I+  +  F WGS + K K H   W
Sbjct  700   KLLSRAGKEVLLKAVIQAIPTYLMGGYKLPTMIIQKIQAAMARFWWGSSDTKRKIHWKNW  759

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G K L   N A L + AWRL      L + + KAKY +    +     
Sbjct  760   EAMCTLKCLGGMGFKDLGVFNDALLGRQAWRLIHAPQSLLSRVLKAKY-YPSCEFLDASL  818

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               + S +W+ I  A  + + G+ W V NG++   W   W++D    E      +P + + 
Sbjct  819   GYSCSYSWRSIWSAKALVKEGLVWRVGNGQSINIWEAPWVVD----ENGRYITSPRNNDI  874

Query  195   LVANYWI--SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
              +  + I  +N  W  D++D V  E     +    L   +   D L W    +G +SV +
Sbjct  875   TMVQHLIDPNNIEWRLDVIDAVFNERDKKCILAIPLCSSS-PHDMLSWALTKDGHYSVKT  933

Query  21    AYELA  7
             AY L 
Sbjct  934   AYMLG  938



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score =   238 bits (607),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/534 (31%), Positives = 262/534 (49%), Gaps = 24/534 (4%)
 Frame = -1

Query  2846  ILYTHPQFIAFQVYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*YFFNPQGTWLA  2682
             +++ HPQ +  ++    ++PWL     +++VY     + R  L+  L     + +  WL 
Sbjct  960   VIFDHPQCLHVRL----TSPWLETPFFVTIVYAKCTRSERTLLWDCLRRLADDIEVPWLV  1015

Query  2681  MGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGA  2502
              GDFN +  + E             DF   +    L+D GF G+S+TW     T +    
Sbjct  1016  GGDFNVILKREERLYGSAPHEGAMEDFASTLLDCGLLDGGFEGNSFTW-----TNNRMFQ  1070

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYS  2322
             RLDR + N     +FP  ++ HL   GSDH PLLIS     ++  SS F+F  AW  H+ 
Sbjct  1071  RLDRIVYNHHWINKFPVTRIQHLNRDGSDHCPLLISCFNSSEKAPSS-FRFQHAWVLHHD  1129

Query  2321  FQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*S  2160
             F+  V+S W   ++ S      + +  + + L  W++  FG+I  K +    R+E  +  
Sbjct  1130  FKTSVESNWNLPINGSGLQAFWSKQHRLKQHLKWWNKAVFGDIFSKLKEAEKRVEECEIL  1189

Query  2159  LSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQ  1980
                    +      +   +L + L  EEL W Q+S  +W+  G+RNT+F+ +    KR +
Sbjct  1190  HQQEQTFESRIKLNKSYAQLNKQLNIEELFWKQKSGVKWVVEGERNTKFFHMRMQKKRIR  1249

Query  1979  SRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASV-  1803
             S + K+ D +G  I D   L     +YF  L   E   + + F     P ++      + 
Sbjct  1250  SHIFKVQDPEGRWIEDQEQLKHSAIEYFSSLLKVEPCYD-SRFQSSLIPSIISNSENELL  1308

Query  1802  NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGC  1623
              A  + +++K A+F +    A+GPDGF+  F+ + W  +   L   V  FF    +P G 
Sbjct  1309  CAEPSLQEVKDAVFGINSESAAGPDGFSSYFYQQCWNIIAQDLLDAVRDFFHGANIPRGV  1368

Query  1622  NDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGR  1443
               T L L+PK  +  + + FRPI LC V+ K+ITK++  RL  ++  ++  +QS FV GR
Sbjct  1369  TSTTLILLPKKSSASKWSDFRPISLCTVMNKIITKLLSNRLAKVLPSIITENQSGFVGGR  1428

Query  1442  QITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              I+DN L  QE++    T K R G +ALK+D+ KAYD+L W F+   L+  GFN
Sbjct  1429  LISDNILLAQELIGKLNT-KSRGGNLALKLDMMKAYDKLDWSFLFKVLQHFGFN  1481


 Score =   171 bits (432),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 127/426 (30%), Positives = 207/426 (49%), Gaps = 18/426 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSH----MVDS  1108
             WI+ I  C+++     L NG+   +    +GLRQGD ISP LF++ AE LS     + D 
Sbjct  1484  WIKMIQKCISNCWFSLLLNGRTEGYFKSERGLRQGDSISPQLFIIAAEYLSRGLNALYDQ  1543

Query  1107  SVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQ  928
                     GV ++     +SHL FADD++ F   +      +   L  +   SGQ+IN+Q
Sbjct  1544  YPSLHYSSGVSIS-----VSHLAFADDVLIFTNGSKSALQRILAFLQEYQEISGQRINVQ  1598

Query  927   KSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarls  748
             KS      N +   +Q IA T G    L +  +LG P   G  K   F++++ +I+ R++
Sbjct  1599  KSCFVTHTNVSSSRRQIIAQTTGFSHQLLLITYLGAPLYKGHKKVILFNDLVAKIEERIT  1658

Query  747   g*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCH  568
             G  ++ LS  G   +++SVL+++P Y ++    P  V++ + R+   FLWG      K H
Sbjct  1659  GWENKILSPGGRITLLRSVLASLPIYLLQVLKPPICVLERVNRIFNSFLWGGSAASKKIH  1718

Query  567   LVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS  388
                W  ++     GGL I++L  +  AF  KL WR  +  + LWT   + KY     +  
Sbjct  1719  WASWAKISLPIKEGGLDIRNLAEVFEAFSMKLWWRF-RTIDSLWTRFMRMKY-CRGQLPM  1776

Query  387   SWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPS  208
               QPK + S  WK ++    I    ++W V  G+   FW D W+ + PL    ++     
Sbjct  1777  HTQPKLHDSQTWKRMVANSAITEQNMRWRVGQGKLF-FWHDCWMGETPL----TSSNQEL  1831

Query  207   SLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             SL+ +    +  N  WD + L  VL + ++++++   +  D +  D   W   PNG FS 
Sbjct  1832  SLSMVQVCDFFMNNSWDIEKLKTVLQQEVVDEIAKIPI--DAMSKDEAYWAPTPNGEFST  1889

Query  27    SSAYEL  10
              SA++L
Sbjct  1890  KSAWQL  1895


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 84/200 (42%), Gaps = 17/200 (9%)
 Frame = -3

Query  4338  LQRLQGMWK---LEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRP  4168
             LQ ++  +K   L   +E+  L +   +       D + V     W + +  +   +W P
Sbjct  13    LQDIRSAFKGIGLAGAYEVRWLDYKHILIHLTNEHDCNRVWTKQVWFIANQKMRVFKWTP  72

Query  4167  NFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVC  3988
             +F+P   +   +  W+ FP+L    F+   L  I K +G+P+ +D  T   S+   ARVC
Sbjct  73    DFEPE-KESAVVPVWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVC  131

Query  3987  VQLDITKPLLSNFVINGTEWPKEYEGIHQICFKCSIYGHRMETCGLSVPIPAASVDGTAG  3808
             ++ D  +P +   V        E+  +   C  C   GH+   C     I   + D   G
Sbjct  132   IEYDCRRPPIDQRV--------EFSQMPAYCDHCCHVGHKEIDC-----IVLGNKDKPLG  178

Query  3807  TSSTTGIDIPLPKPKEKYGA  3748
             +S +  + +   + K+ YG 
Sbjct  179   SSKSQYLRVLEAEKKKGYGG  198



>emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera]
Length=1881

 Score =   243 bits (621),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 192/611 (31%), Positives = 296/611 (48%), Gaps = 27/611 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICS--SLGFDEWIRVEAVG  2895
             WN +G  S   RR +K FLR  KP ++   E K        + S  +    +W  + A G
Sbjct  835   WNTRGLGSKKKRRVVKDFLRSEKPDVVMFQETKKEECDRRFVGSVWTARNKDWAALPACG  894

Query  2894  YSGGI---WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
              SGGI   W    +S    +L +    I F + +   + WL S VYG  + ALR+ L+ +
Sbjct  895   ASGGILIIWDTKKLSREEVMLGSFSVSIKFTL-NGCESLWL-SAVYGPNNSALRKDLWVE  952

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             LS         W   GDFN +   SE       + S   DF+D+I   ELIDL    +S+
Sbjct  953   LSDIAGLASPRWCVGGDFNVIRRSSEKLGGSRLTPS-MKDFDDFISDCELIDLPLRSASF  1011

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW      P  K  RLDR L + E    FP +    LP   SDH P+++   T P ++  
Sbjct  1012  TWSNMQVNPVCK--RLDRFLYSNEWEQTFPQSIQGVLPRWTSDHWPIVLE--TNPFKWGP  1067

Query  2363  SRFKFNMAWTTHYSFQACVQSVWRS------DLDLSTNKSAMVEA-LSVWSRDSFGNIPQ  2205
             + F+F   W  H SF+      WR       +      K   V+A L VW++ SFG + +
Sbjct  1068  TPFRFENMWLQHPSFKENFGRWWREFQGNGWEGHKFMRKLQFVKAKLKVWNKASFGELSK  1127

Query  2204  KKRRLLARLEGVQ*SLSM--GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSG  2031
             +K  +L+ L     SL    G+  +L+      + ELEE + +EE+ W Q++R +W+K G
Sbjct  1128  RKEDILSALVNFD-SLEQEGGLSHELLAQRAIKKGELEELILREEIHWRQKARVKWVKEG  1186

Query  2030  DRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNF  1851
             D N++F+      +RN+  + +L + +G ++ +   + + +  YF  L+T+      +  
Sbjct  1187  DCNSKFFHKVANGRRNRKFIKELENENGQMMNNSESIKEEILRYFEKLYTS--PSGESWR  1244

Query  1850  CYGC-FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSL  1674
               G  + P+  E    + +PFT E+I  A+F M   KA GPDGFT   F   W  +   L
Sbjct  1245  VEGLDWSPISGESAVRLESPFTEEEICKAIFQMDRDKAPGPDGFTIAVFQDCWEVIKEDL  1304

Query  1673  FSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKD  1494
                   F   GI+    N + + L+PK     RI+ FRPI L   +YK+I KV+  R+++
Sbjct  1305  VKVFTEFHRSGIINQSTNASFIVLLPKKSMSRRISDFRPISLITSLYKIIAKVLAGRIRE  1364

Query  1493  MVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCF  1314
             ++ + +   Q +FV GRQI D  L   EI++  R + G  G +  K+D EKAYD +SW F
Sbjct  1365  VLHETIHSTQGAFVQGRQILDAVLIANEIVDEKR-RSGEEG-VVFKIDFEKAYDHVSWDF  1422

Query  1313  IEDTLRDIGFN  1281
             ++  +   GF 
Sbjct  1423  LDHVMEMKGFG  1433


 Score =   165 bits (417),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 123/354 (35%), Positives = 175/354 (49%), Gaps = 18/354 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + +  C++S     L NG    W+   +GLRQGDP+SP LF + A+ LS M+  +   
Sbjct  1436  WRKWMRGCLSSVSFAVLVNGNAKGWVKASRGLRQGDPLSPFLFTIVADVLSRMLLKAEER  1495

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                +G KV R    +SHL FADD +FF  +     + +K  L +F   SG K+NL KS++
Sbjct  1496  NVLEGFKVGRNRTRVSHLQFADDTIFFSSSREEDMMTLKNVLLVFGHISGLKVNLDKSNI  1555

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGK------HLGLPSIHGRLKKDSF-DNILERIKa  757
             +      +  +QN  + L    +LD         +LGLP + G  K   F D ++ERI  
Sbjct  1556  Y-----GINLEQNHLSRLA--EMLDCKASGWPILYLGLP-LGGNPKTSGFWDPVIERISR  1607

Query  756   rlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLW-GSREGK  580
             RL G     LS  G   ++QS L+ +P Y +    IP+ V   IER+ R FLW G  EGK
Sbjct  1608  RLDGWQKAYLSFGGRITLIQSCLTHMPCYFLSLFKIPASVAAKIERMQRDFLWSGVGEGK  1667

Query  579   NKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDP  400
              + HLV W +V   K+ GGLG   +   N+A L K  WR  ++G+ LW  +  + Y    
Sbjct  1668  -RDHLVNWDVVCKPKSRGGLGFGKISIRNVALLGKWLWRYPREGSALWHQVILSIYGSHS  1726

Query  399   SVWSSWQPKRNSSNA-WKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPL  241
             + W      R S    WK I      F    ++ V NG   RFW D W  ++PL
Sbjct  1727  NGWDVNNIVRWSHRCPWKAIALVYQEFSKFTRFVVGNGDRIRFWDDLWWGEQPL  1780



>ref|XP_009123679.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1072

 Score =   234 bits (597),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/439 (33%), Positives = 223/439 (51%), Gaps = 29/439 (7%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P WI  IMCC+ S     L NG     + P +GLRQGDP+SP +F+LC E LS + +   
Sbjct  322   PIWISWIMCCIESVSYTFLINGSPQGSVKPSRGLRQGDPLSPHIFILCTEVLSALCEKGQ  381

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G+  GV+V R  P ++HL FADD +FF ++ +     + K L  + + SGQ+IN QKS
Sbjct  382   ADGSLPGVRVARGCPAINHLLFADDTMFFCKSKASCVSALMKILSTYEAVSGQRINPQKS  441

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             ++ FS  T    +  +   + I +   +GK+LGLP   GR K+D F  I++RI+ +    
Sbjct  442   AITFSAKTPPEVRARVKEAMAIEAEGGIGKYLGLPENFGRKKRDIFAAIVDRIRQKSHSW  501

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             S++ LS AG  +M++SVL+A+P Y+M    IP  +   I+ L+  F W +   K K   V
Sbjct  502   STKFLSSAGKQIMLKSVLAAMPCYTMSCFKIPLSLCKQIQSLLTRFWWDANPEKKKMCWV  561

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K  GGLG + ++  N A LAK+ WR+ ++   L   +   KY  D S  +  
Sbjct  562   AWSTLALPKYAGGLGFRDVETFNDALLAKIGWRVIKEPQSLLARVLLGKYARDASFLNCS  621

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
              P  ++S+ W+ IL    I R G+ W V NG +   W + WL     F   + P+ P   
Sbjct  622   VPA-SASHGWRSILAGREILRKGLSWMVGNGESINVWSEPWL----SFNSPTQPMGPQPF  676

Query  201   NNL---VANYWIS-NEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG---------DRLV  61
             +++   V++        WD D +   LP++           EDT+L          D L+
Sbjct  677   HSMSLKVSDLLCPLTNNWDLDKIRHHLPQY-----------EDTILQIKTSSVPSLDTLM  725

Query  60    WYKEPNGLFSVSSAYELAL  4
             W  E +G +S  + Y L +
Sbjct  726   WLPESSGSYSTKTGYGLGM  744


 Score =   174 bits (440),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 144/268 (54%), Gaps = 1/268 (0%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W QRSR +W+K GDRNT F+  AT  +R  + +  + D  G ++ ++  + + + D
Sbjct  54    EEQFWRQRSRIQWLKQGDRNTGFFHAATRNRRTINSIPVIEDDQGAVVYEEQEISRVISD  113

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  +FT+  + + T         +  E    + A     +IK A+  +   KA GPDGF
Sbjct  114   YFQKIFTSNGNHSFTQLQGLLTCKVTPEMNQMLTAIPRDSEIKEAMASINGGKAPGPDGF  173

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  F+   W  VG  +   +  FF    L    N+T + LIPK   P+ +  +RPI LCN
Sbjct  174   SATFYQSYWHIVGEDVTRDIRSFFTTNSLQAQQNETHIRLIPKTTGPKSVADYRPIALCN  233

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWM  1365
               YK+I K++  RLK ++  L+   QS+FV GR ITDN L   E L+  RT    +   M
Sbjct  234   THYKIIAKILTRRLKPLLPALISNTQSAFVAGRAITDNVLITHETLHYLRTSDAKKYCSM  293

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             A+K D+ KAYDR+ W F+ + L+ +GF+
Sbjct  294   AVKTDMSKAYDRIEWSFVREVLKLLGFD  321



>ref|XP_010495286.1| PREDICTED: uncharacterized protein LOC104772356 [Camelina sativa]
Length=1158

 Score =   228 bits (580),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/428 (36%), Positives = 221/428 (52%), Gaps = 14/428 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  IM CV S     L NG+   +I P +G+RQGDP+SP LF+LCAE L H+++ + + 
Sbjct  390   WVNWIMSCVRSVTFSVLINGKEHGFIKPERGIRQGDPLSPFLFILCAEALVHVMNKAEQE  449

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+T   P++ HL FADD +F   A+ ++   + +CL L+   SGQ+INLQKSS+
Sbjct  450   GRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKSSI  509

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K  +   ++ I    GI      GK+LGLP      KKD    I +R+ +RL G   
Sbjct  510   TFGKKLDPYMRRVIGLFTGIEQEGGAGKYLGLPECFSGSKKDMLAYITDRLTSRLRGWFE  569

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +TLSL G  V++++V  A+P Y+M    +       I   +  F W + E K K H V W
Sbjct  570   KTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWWNAVEEKQKMHWVSW  629

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GGLG + +   N A LAK AWRL    + L   ++KA+Y F    +     
Sbjct  630   EKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARY-FPSISFMEANL  688

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD----RPLFEEASAPIAPS  208
                 S AW+ IL    +   G+   + +G  T  WLD W+ D    RP  +E    +   
Sbjct  689   GPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKWVFDELPRRPCNKEQMINL---  745

Query  207   SLNNLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
                NL  +  I+N+G W+   L  + P   + K+ +F    DT L DRLVW    NG +S
Sbjct  746   ---NLRVSELITNQGDWNLQALQELFPPCDVIKIRSF--PPDTRLQDRLVWAYTNNGHYS  800

Query  30    VSSAYELA  7
             V S Y L+
Sbjct  801   VKSGYWLS  808


 Score =   180 bits (457),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 196/409 (48%), Gaps = 31/409 (8%)
 Frame = -1

Query  2498  LDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSF  2319
             LDRAL N      FP  +  ++  IGSDH  LL+ +        S RF FN  W +   F
Sbjct  7     LDRALGNEAWFQLFPRVQGEYMERIGSDHRALLLRLAN-DNVSRSGRFIFNKRWISKPDF  65

Query  2318  QACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SL-SMGIR  2142
              A VQS W  +  ++T +++++  ++   R   G    +      R++ V+  L + G +
Sbjct  66    AAVVQSGW--NKGVTTGQTSVMSRIAECRRTISGWKRSQNLNSKVRIQQVREQLDAEGTK  123

Query  2141  SDlvrlerrlrkeleETLYQ-EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSK  1965
                     R  +      Y+ EEL W +RSRE+W++ GDRNT+F+  +   +R Q+++  
Sbjct  124   IHPNFQLMRDLRWELAENYRAEELYWKERSREQWLQGGDRNTKFFHGSVQRRRIQNKILS  183

Query  1964  LVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTP  1785
             L D +G     +G   +    YF  +FT+           G  P + +   A +  P + 
Sbjct  184   LFDENGVEQFSEGSKGEVAVAYFRKMFTSSNPSAIMEALDGMVPRVTDSMNAELIRPVSA  243

Query  1784  EDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILS  1605
              +IK A+F +   K  G DG +  FF + W  VG  +   V +FF  G LP   N T + 
Sbjct  244   LEIKNAVFSIKGEKTPGADGMSSQFFKEYWDVVGPQVVQEVQQFFASGHLPSDWNFTQIC  303

Query  1604  LIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNT  1425
             LIPKVQNP R+T  RPI                         +   Q +FV GR ITDN 
Sbjct  304   LIPKVQNPTRMTNLRPI-------------------------ISYTQGTFVSGRLITDNI  338

Query  1424  LAYQEILNAFRTKKG-RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             L   E+++A +TK G    ++A+K D+ KAYDR+ W F+E+ L  +GF+
Sbjct  339   LLAHELVHALQTKAGCNEEFLAIKTDMSKAYDRVEWNFLEELLIRLGFD  387



>ref|XP_010501912.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104779243 
[Camelina sativa]
Length=1023

 Score =   248 bits (632),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 219/448 (49%), Gaps = 97/448 (22%)
 Frame = -1

Query  2606  DFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPM  2427
             +F +WI  E LID+G+TG+++TW RG +   F   RLDR L   +  L++ +A VTHLP 
Sbjct  14    EFGEWINAESLIDMGYTGNNFTWRRGKEQRFFVVKRLDRVLCCAQARLQWMEASVTHLPF  73

Query  2426  IGSDHSPLLISITTCPQQFCSSR---FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAM  2256
             + SDH+P  + +  CP+     R   F+F  AW  H SF+  + S WRSD+      +A 
Sbjct  74    LASDHTP--VRLQLCPETKRDPRRRLFRFEAAWLIHSSFKELLVSSWRSDVTTPVVLNAR  131

Query  2255  VEALSVWSRDSFGNIPQKKR-RLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQE  2079
              +AL  W+++ FG++ ++K+  LL  L+ V                          L  E
Sbjct  132   RDALKKWNKEVFGDVNRRKQDSLLKELDHV--------------------------LEHE  165

Query  2078  ELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDY  1899
             E +WFQ+S E+WI  GDRNT+F+ ++T ++R ++ +  L   DG  I D           
Sbjct  166   ETLWFQKSLEKWITKGDRNTQFFHISTVIRRRRNCIESLKGDDGRWITDQ----------  215

Query  1898  FLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFT  1719
                                      +E       P    +++ AL  M   KA GPDGF 
Sbjct  216   -------------------------QEVEQLAMQPIGGSEVEVALRSMGQFKAPGPDGFQ  250

Query  1718  PGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNV  1539
             P  + + W  VG S+  FV +FFE   LPPG ND +L                       
Sbjct  251   PISYQQNWEVVGESVMQFVIQFFETWELPPGTNDALL-----------------------  287

Query  1538  VYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMAL  1359
                    VM++RLK ++ KL+GP  +SF+ GR   DN +  QE +++ + KKGR GWM +
Sbjct  288   -------VMVLRLKGLMCKLIGPGHASFIPGRLSLDNIVVVQEAVHSMKRKKGRKGWMLM  340

Query  1358  KVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             K+DLEKAYD + W F+EDTL+  G +  
Sbjct  341   KLDLEKAYDSIRWDFLEDTLQAAGLSEV  368


 Score =   159 bits (403),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 108/171 (63%), Gaps = 0/171 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R IM CVT P +  LWNG+ T+     +GLRQGDP+SP LFVLC ERL H +D +   
Sbjct  369   WVRWIMQCVTGPMMHVLWNGERTEGFKASRGLRQGDPLSPYLFVLCLERLCHHIDKATAR  428

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WK +++ +  P +SH+ FADDL+ F EA   Q   +++ L+ FC  SGQK++L+KS +
Sbjct  429   KEWKPIRLLQGGPFLSHICFADDLILFVEALVAQIRVIRRVLEKFCCASGQKVSLEKSKI  488

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERI  763
             FFS N        I+   GI S  ++GK+L +P +  R+ K++F+ +L R+
Sbjct  489   FFSTNVTRELATRISNESGIRSTTELGKYLEMPILQKRMNKETFNEVLARV  539



>ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica]
 gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica]
Length=1117

 Score =   237 bits (605),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/562 (30%), Positives = 271/562 (48%), Gaps = 27/562 (5%)
 Frame = -1

Query  2927  FDEWIRVEAVGYSGGIW-LFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDM  2751
             F EW+   ++G SGGI  L+ S S+++         ++ ++ +N+   W +S +YG    
Sbjct  45    FKEWVFSPSLGRSGGIAVLWNSQSVSVIDSMVGEFSVSIRIVENIGTDWWLSGIYGPCRQ  104

Query  2750  ALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELI  2571
               R   + +L+  +      W   GDFN V   +E SN+   + S   DFND+I    L 
Sbjct  105   RERNSFWEELADLYGYCGDKWCLGGDFNVVRFSAEKSNEGRVTKS-MRDFNDFIQETNLR  163

Query  2570  DLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISI  2391
             D     +S+TW    +    +  RLDR L +      FP  +   LP I SDH P  I +
Sbjct  164   DPNLLNASFTWSNLRENAVCR--RLDRFLVSGSWEDHFPHYRHKALPRITSDHCP--IEL  219

Query  2390  TTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSFGNI  2211
              T   ++  S F+F   W  H  F+  ++  W  D  L       +      S++ FG++
Sbjct  220   DTSRVKWGPSPFRFENMWLNHPDFKRKIKLWWGEDQILGWEGYKFMT-----SKEVFGDV  274

Query  2210  PQKKRRLLARL------EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSRE  2049
              +  R   ARL      EG +  L   +RS+   L  ++    +    +EE+ W QR + 
Sbjct  275   ERDLREAEARLLVLDQREGTE-GLDHLLRSERDNLLLKIGDLAQ----KEEVKWRQRGKV  329

Query  2048  EWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVD  1869
             +W + GD NT+F+    +  R ++ + KL   D  +I  D  + + V  +F GL+++  +
Sbjct  330   KWAREGDGNTKFFHRVASGARKRNYIEKLEVEDLGVIEVDANIEREVIRFFKGLYSSNKN  389

Query  1868  VN-RTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWP  1692
             V         C    +E DW  +  PF  E+++ A+F+    K+ GPDGF+  FF   W 
Sbjct  390   VGWGVEGLNWCPISQVEADW--LERPFDLEEVQKAVFECGKDKSPGPDGFSMSFFQSCWE  447

Query  1691  TVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVM  1512
              V   L   +  FF+ GI+    N+T + LIPK  N  ++T +RPI L   +YK+I+KV+
Sbjct  448   VVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYRPISLVTSLYKVISKVL  507

Query  1511  MIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYD  1332
             + RL++++   +   Q +FV  RQI D  L   E++   R +K R G +  K+D EKAYD
Sbjct  508   VSRLREVLGNTISQSQGAFVQKRQILDAVLVANEVVEEVRKQK-RKG-LVFKIDFEKAYD  565

Query  1331  RLSWCFIEDTLRDIGFNHTGSG  1266
              + W F++D L   GF     G
Sbjct  566   HVEWNFVDDVLVRKGFGAKWRG  587


 Score =   170 bits (430),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 172/338 (51%), Gaps = 4/338 (1%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+ C+ S     + NG+        +GLRQGDP+SP LF L ++ LS +++ +       
Sbjct  589   IIGCLESVNFSIMINGKPRGKFRASRGLRQGDPLSPFLFTLVSDVLSRIIERAQDVNLVH  648

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+        +SHL FADD +F  +      L + + L LFC  SG KIN  KS +    
Sbjct  649   GIVSGHDQVEVSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCEVSGMKINKAKSCIL-GI  707

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDN-ILERIKarlsg*ssrtl  727
             N +     N+A + G         +LGLP + G  +  +F N ++++++ RL       L
Sbjct  708   NFSTDALNNMAGSWGCEVGCWPMVYLGLP-LGGNPRALNFWNPVMDKVEKRLQKWKRACL  766

Query  726   slag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIV  547
             S  G   ++Q+VLS+IP Y M    +P GV   +E+L+R FLW   E    CHLV+W  V
Sbjct  767   SKGGRLTLIQAVLSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLEDGKNCHLVRWERV  826

Query  546   TNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ-PKR  370
             T SK  GGLGI SL+  N A  AK  WR   + N LW  + K+KY  D + W + Q  K 
Sbjct  827   TKSKEEGGLGIGSLRERNEALRAKWLWRFPLEPNSLWHRIIKSKYGIDSNGWDTKQIDKV  886

Query  369   NSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL  256
             +  N W+ I +  + F    ++ V NG   RFW D WL
Sbjct  887   SCRNPWREISKGYNSFLQCCRFSVGNGEKIRFWEDFWL  924



>ref|XP_009150035.1| PREDICTED: uncharacterized protein LOC103873375 [Brassica rapa]
Length=1285

 Score =   207 bits (526),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/430 (33%), Positives = 218/430 (51%), Gaps = 11/430 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CVTS     L N Q    I+P++GLRQGDP+SP LFVLC E L+H+++ + R+
Sbjct  527   WVDWVMMCVTSVSFAVLINDQPFGLINPQRGLRQGDPLSPFLFVLCTEGLTHLLNVAERN  586

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K +   P +SHL FADD +F  +A+  +A  +++ L  +   +GQ IN +KSS+
Sbjct  587   GLISGMKFSEEGPTISHLLFADDSLFLCKASVSEASVLQRILTFYGEATGQTINREKSSI  646

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F       ++  I  TLGI +     K+LGLP      K D F  + ++   +L     
Sbjct  647   SFGDKVGEESRAAIQHTLGISNQGGASKYLGLPECFSGSKVDLFSYLKDKTHGKLDVWYY  706

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V+++S  S++  ++M    +P  +ID +  ++  F WG+   + K H V W
Sbjct  707   KHLSQAGKEVLIKSSGSSLSTFAMSCFRLPKSIIDKLTSMLAAFWWGAEPHQRKIHWVAW  766

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GGLG + L+  N A LAK AW++    + +     K++Y  D    S+   
Sbjct  767   ERLCLPKDQGGLGFRDLEAFNQAMLAKQAWKVLSQPDSMLARFLKSRYFPDGEFLSAPLG  826

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL--  202
              R  S AW+ +L    +   GI   V NG+ TR W+D W +D P+ E   AP   +    
Sbjct  827   LR-PSYAWRSLLHGRELLTKGIIRRVGNGQKTRVWIDKW-IDDPV-EGMRAPWIKNYFFD  883

Query  201   NNLVANYWISNEGWDWD---MLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFS  31
              NL+A+  I +    W+   + +  +P  +   L     Q   L  D   W    +G FS
Sbjct  884   VNLIASSLIDSSTRLWNPTALCEIFVPGDVQMLLKN---QPAVLKEDFYSWKLTRSGQFS  940

Query  30    VSSAYELALE  1
             V +AY LA E
Sbjct  941   VKTAYNLAFE  950


 Score =   200 bits (508),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/508 (28%), Positives = 237/508 (47%), Gaps = 15/508 (3%)
 Frame = -1

Query  2783  LMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTD  2604
              +S +YG   +  R  ++  L+    N +  W  +GDFN +    E S     S +    
Sbjct  25    FLSCIYGDPIIEGRNEVWERLNRIGTNRKEPWCLIGDFNEILNNEEKSGGPRRSEASFLP  84

Query  2603  FNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMI  2424
             F D +    + +L   G   TW  G     +    LDR+  N E    FP +    L   
Sbjct  85    FADMLKNCGMEELSSRGDKLTW-GGKRWNKWIQCALDRSFGNEEWFKIFPGSNQIFLEKR  143

Query  2423  GSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLD-----LSTNKSA  2259
             GSDH P+ ++     + F   +F+F+  +   +  +  +   W  + +     +S     
Sbjct  144   GSDHRPVWLNFYANHEAF-KGQFRFDKKFLIQHDVKKQISIAWARNCNGRHQSVSQRIRN  202

Query  2258  MVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY-Q  2082
                ALS W R S  N   K R L  RLE +Q       R         + K+     Y +
Sbjct  203   CRNALSRWKRQSVYNSQDKIRLLQERLEWMQ------SRDYPCFFMINIIKKDLIKAYKE  256

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EEL W Q+SR++W+  GDR ++F+  +    R+++ + KL D +G     +G   +   D
Sbjct  257   EELFWKQKSRDKWMIHGDRCSKFFHSSVKTSRSRNLIDKLKDKNGKDQWSEGAKAEVAID  316

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  LF +    + T       P + +     ++   + E+++ A+F + P  A GPDG 
Sbjct  317   YFSTLFRSSNPRSYTPVLESMVPKVSDSMNDVLSRDISKEEVREAIFSIDPDSAPGPDGM  376

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             T  FF + W  VG  + S +   F+   LP   N T + L+PK+ +PE +   RPI LC+
Sbjct  377   TGLFFQRHWDLVGEQITSEIQEVFQTVSLPRDWNFTYICLLPKINDPEFMKDLRPISLCS  436

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF-RTKKGRVGWM  1365
             V+YK ++K+++ RL+  ++ ++  +QS+FV  R I+DN +   E ++A  R        M
Sbjct  437   VLYKSVSKILVRRLQPFLQDIISSNQSAFVRDRLISDNIVIAHEAVHALKRHHPISQEMM  496

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             A+K D+ KAYDR+ W ++   +  +GF+
Sbjct  497   AVKTDMSKAYDRVEWSYLRSLMLALGFS  524



>ref|XP_010472251.1| PREDICTED: uncharacterized protein LOC104751896 [Camelina sativa]
Length=1160

 Score =   215 bits (548),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/432 (33%), Positives = 213/432 (49%), Gaps = 46/432 (11%)
 Frame = -1

Query  2501  RLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISIT---TCPQQFCSSRFKFNMAWTT  2331
             RLDR+  N E    FP AK  +L M+GSDH P+L  +    TC +     RF F+     
Sbjct  31    RLDRSFGNAEWFTLFPRAKTEYLEMMGSDHRPILTRLVGEDTCHR----GRFCFDKRLIN  86

Query  2330  HYSFQACVQSVWR-SDLDLSTNKSAMV----EALSVWSR----DSFGNIPQKKRRL----  2190
                 +  ++  WR   +    + +A +     ALS W R    +S   I Q K+ L    
Sbjct  87    KPETEEIIKKHWRLHSVGAGESVTARLLRCRRALSKWKRLAPTNSHTRITQLKKDLETES  146

Query  2189  ------LARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGD  2028
                     RL+G++  L+   R                   +EE+ W Q+SR++W++ GD
Sbjct  147   TKMFPNFQRLQGIKWDLNKAFR-------------------EEEIYWKQKSRQKWLREGD  187

Query  2027  RNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFC  1848
             RNT F+  +   KR ++RV  L+D  G    ++G       ++F  LFT+       +  
Sbjct  188   RNTTFFHGSVKYKRLKNRVISLLDKHGLEAYEEGSKGSIAVEFFSELFTSSNPTGFEDVL  247

Query  1847  YGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
              G  P + EE    + +P T  +IK A F +    A G DG+T  FF + W T+G  + S
Sbjct  248   EGMEPRVTEEMNLKLTSPITALEIKQAAFKVQGDSAPGIDGWTGTFFKQYWNTIGKEIVS  307

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V +FF+ G +    N T + LIPK  N   +T  RPI LC+V+YK+++ V+  RLK  +
Sbjct  308   EVEQFFQSGTMLQDWNHTQICLIPKKPNANAMTDMRPISLCSVLYKIVSNVLCTRLKRCL  367

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFI  1311
              KLV   Q +FV GR I+DN L   EI++A RT  K     +A+K D+ KAYDR+ W F+
Sbjct  368   PKLVSETQGAFVSGRLISDNILIAHEIIHALRTNSKFNKDMIAIKTDMSKAYDRVEWDFL  427

Query  1310  EDTLRDIGFNHT  1275
             E     +GFN T
Sbjct  428   EHLFVKMGFNST  439


 Score =   191 bits (485),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 130/424 (31%), Positives = 204/424 (48%), Gaps = 11/424 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV S     L NG    ++ P +G+RQGDP+SP LF+LCAE L H++      
Sbjct  440   WIQWIMSCVRSVSYTVLINGSSHGFVKPSRGIRQGDPLSPFLFILCAEALVHLMQRRHEQ  499

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G +     P++ HL FADD +F  +AN  +  E+  CL L+   SGQ IN  KS++
Sbjct  500   QRLTGFQFNESCPSVQHLLFADDSLFICKANKEECEEVLNCLSLYGKASGQVINFAKSTV  559

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F    +  T++ +  TLGI +    G +LGLP      K+     I E+++ RL G  +
Sbjct  560   TFGGKASYDTKELVKTTLGIRNEGGSGSYLGLPECFSGSKQALLAFIGEKLQGRLHGWFA  619

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             ++LSL G  V+++S+  A+P Y+M    +   +   +   +  F W   EG+     V W
Sbjct  620   KSLSLGGKEVLLKSIAMALPVYAMSCFRLSKNLCRKLTSAMTEFWWSHCEGQRNIAWVAW  679

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  +K+ GGLG K L   N A LAK +WR+  +   L    FK++Y    S+      
Sbjct  680   AKLCKAKSEGGLGFKDLSDFNQALLAKQSWRMLNNPTSLVARFFKSRYFRYKSILDCGTG  739

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R  S AW+ ILQ   + + G+   + +G  T  W + W+ +    E   AP       +
Sbjct  740   SR-PSYAWRSILQGRDLLKKGLLKVIGDGSNTLVWQEKWIQE----EHPRAPYRAQIFFD  794

Query  195   L---VANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             +   V++    + G WD   ++ + P    N++    L       DR +W     G ++V
Sbjct  795   VRLKVSDLRDPSTGHWDVSKIENLFPPGDANRILAMKLAVGQ--PDRFIWPYNKAGAYTV  852

Query  27    SSAY  16
              S Y
Sbjct  853   KSGY  856



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score =   222 bits (566),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 220/425 (52%), Gaps = 39/425 (9%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM CVT P +  LWN                                   + S+  
Sbjct  162   WIVWIMQCVTEPSMSLLWN-----------------------------------EHSIAR  186

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +WK + +++  P +SH+ FADDL+ F EA+  Q   +++ L+ FC  SGQK++L+KS +
Sbjct  187   KDWKPISLSQGGPKLSHICFADDLILFAEASVAQIRVIRRVLERFCVASGQKVSLEKSKI  246

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FFS+N +    + I+   GI S  ++GK+LG+P +  R+ KD+F +ILE++  RL+G   
Sbjct  247   FFSENVSRDLGKLISDESGISSTRELGKYLGMPVLQRRINKDTFGDILEKLTTRLAGWKG  306

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LSLAG   + ++VLS+IP ++M +  +P   +D ++++ R FLWGS   + K HL+ W
Sbjct  307   RFLSLAGRVTLTKAVLSSIPVHTMSTIALPKSTLDGLDKVSRSFLWGSSVTQRKQHLISW  366

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               V   ++ GGLGI+  + MN A L+K+ WRL QD + LW  + +  Y        +W  
Sbjct  367   KRVCKPRSEGGLGIRKAQDMNKALLSKVGWRLIQDYHSLWARIMRCNYRVQDVRDGAWTK  426

Query  375   KRN-SSNAWKGI-LQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSL  202
              R+  S+ W+ + L    +   G+ W + +GR   FW+D WL + PL  E      P+  
Sbjct  427   VRSVCSSTWRSVALGMREVVIPGLSWVIGDGREILFWMDKWLTNIPL-AELLVQEPPAGW  485

Query  201   NNLVANYWISNE-GWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVS  25
               + A     N  GWD   +   +  +   +L +FVL + T   DR+ W +  +G F VS
Sbjct  486   KGMRARDLRRNGIGWDMATIAPYISSYNRLQLQSFVLDDITGARDRISWGESQDGRFKVS  545

Query  24    SAYEL  10
             + Y  
Sbjct  546   TTYSF  550


 Score =   182 bits (463),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = -1

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             KA GPDGF P F+   W  VG S+  FV  FF  G LP G ND I+ LI KV  PERITQ
Sbjct  5     KAPGPDGFQPVFYQDCWDIVGDSVSRFVLDFFASGKLPEGTNDAIVVLIAKVLKPERITQ  64

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK  1386
             FRPI LCNV++K ITK +++RLK ++ KL+ P Q+SF+ GR   DN +  QE +++ R K
Sbjct  65    FRPISLCNVLFKTITKTLVMRLKRVISKLIRPAQASFISGRLAADNIVIMQEAVHSMRRK  124

Query  1385  KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
             KGR GWM LK+DLEKAYDR+ W F+EDTLR +
Sbjct  125   KGRKGWMLLKLDLEKAYDRIRWEFLEDTLRAV  156



>ref|XP_010445339.1| PREDICTED: uncharacterized protein LOC104727990 [Camelina sativa]
Length=1030

 Score =   227 bits (578),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/432 (33%), Positives = 228/432 (53%), Gaps = 13/432 (3%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P+W    M C+TS     L NGQ    + P +G+RQGDP+SP +F+LC+E LS + + + 
Sbjct  364   PHWTNIFMQCITSVSYSYLLNGQAKGMVKPSRGIRQGDPLSPYIFILCSEVLSGLCNKAQ  423

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G   G++V + +P ++HL FADD +FF +++     ++K+ L  + + SGQKIN  KS
Sbjct  424   VHGKLHGIRVAKGSPRVNHLLFADDTMFFCKSDKTCVRQLKEILHKYEAASGQKINQDKS  483

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+ FS+ T    ++ +   LGI      GK+LGLP + GR KKD F  I++RIK R    
Sbjct  484   SITFSRKTKNDIKERVKQELGINKTGGQGKYLGLPELFGRKKKDLFTMIVDRIKQRALSW  543

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             SS+ LS  G   +++SVL A+P Y+M    +P+ +   I+  +  F W  +  K K   +
Sbjct  544   SSKFLSSTGKLTLLKSVLGAMPSYTMSCFKLPNSLCSRIQSALTRFWWDEKPDKRKMCWI  603

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +T S  + GLG + L+  N A LAK++WR+    +CL   +   KY    S   S 
Sbjct  604   AWDKMTKSFKDSGLGFRDLQCYNDALLAKISWRILTQPSCLLAKVLTGKYYKTTSFLESP  663

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSS  205
              P  ++S+ W+ I     + +  +   +  G AT  W   WL LD+P      +P+ P  
Sbjct  664   VPN-HASHGWRSICLGRELLKTDLSKLLGTGEATPIWGTPWLSLDQPF-----SPLGPPQ  717

Query  204   LNNL---VANYWIS-NEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGL  37
               +    VA+  ++ ++ W+  ++ R+LP +  N L+    ++     D   W   P+G+
Sbjct  718   KEDQHLRVADLLLTQSKEWNIPLIKRILPFYEENILNPKPSKQGG--SDSWAWLPTPDGI  775

Query  36    FSVSSAYELALE  1
             +S  S Y  AL+
Sbjct  776   YSAKSGYYEALQ  787


 Score =   177 bits (450),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 151/270 (56%), Gaps = 3/270 (1%)
 Frame = -1

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
             +EE IW QRSR+ W+  GD+N  F+  AT  ++  + +S L    G  I ++  ++  + 
Sbjct  95    KEEEIWKQRSRQLWLALGDKNFGFFHAATKSRKAINNISVLESEQGDAIYEEQEIVDTIS  154

Query  1904  DYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
              Y+  LFT+      T       P + E     +    +P ++K A FD+ P K  GPDG
Sbjct  155   SYYQELFTSTARTRSTTVRDALTPCITEAMNEELLKIPSPTEVKNACFDIHPDKVPGPDG  214

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
             F+  F+   W T+   + + +  FF  G LP   N T + LIP + +P+R+  +RPI LC
Sbjct  215   FSASFYQPNWDTLSGKVTTEIQDFFTSGSLPAHSNHTHVRLIPNITSPKRVADYRPIALC  274

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK--KGRVG  1371
             ++ YK+I K++  RL+ +++  +  +QS+FV GR ITDN L   E L+  +    + RV 
Sbjct  275   SIFYKIIAKIISKRLQSILQTCISQNQSAFVPGRAITDNVLITHEALHYLKQSMAQERV-  333

Query  1370  WMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             ++A+K D+ KAY+RL W FIE+ L  +GF+
Sbjct  334   YLAVKTDMSKAYERLEWSFIEEVLTRMGFH  363



>emb|CAN68165.1| hypothetical protein VITISV_008538 [Vitis vinifera]
Length=1765

 Score =   232 bits (592),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/609 (29%), Positives = 295/609 (48%), Gaps = 23/609 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICS--SLGFDEWIRVEAVG  2895
             WN +G  S   RR +K FLR  KP ++ + E K +      + S  +    EW  + A G
Sbjct  117   WNTRGLGSRKKRRVVKDFLRSEKPDIVMIQETKKAECDRRFVGSVWTARNKEWAVLPACG  176

Query  2894  YSGGIW-LFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS  2718
              SGGI  ++ S  ++ E +      ++ +   + S  +  S VYG    ALR+  + +LS
Sbjct  177   ASGGILVIWDSKKLHSEEVVLGSFSVSVKFAVDGSEQFWJSAVYGPNSTALRKDFWVELS  236

Query  2717  *YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW  2538
               F      W   GDFN +   SE       + S   D +D+I   ELID     +S+TW
Sbjct  237   DIFGLSSPCWCVGGDFNVIRRCSEKLGGGRLTPS-MKDLDDFIRENELIDPPLRSASFTW  295

Query  2537  IRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR  2358
                 + P  K  RLDR L + E    FP +    LP   SDH P+++   T P ++  + 
Sbjct  296   SNMQEHPVCK--RLDRFLYSNEWEQLFPQSLQEVLPRWTSDHWPIVLE--TNPFKWGPTP  351

Query  2357  FKFNMAWTTHYSFQACVQSVWRS------DLDLSTNKSAMVEA-LSVWSRDSFGNIPQKK  2199
             F+F   W  H SF+ C    WR       +      K   ++A L  W++++FG++ ++K
Sbjct  352   FRFENMWLHHPSFKECFGRWWREFQGDGWEGHKFMRKLQFLKAKLKEWNKNAFGDLIERK  411

Query  2198  RRLLARLEGVQ*SLSM--GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
             + +L  +     S+    G+  +L+      + ELEE + +EE+ W Q++R +W+K GD 
Sbjct  412   KCILLDIANFD-SMEQEGGLSPELLIQRAVRKGELEELILREEIHWRQKARVKWVKEGDC  470

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             N++ +      +RN+  +  L +  G ++ +   + + +  YF  L+ +      +    
Sbjct  471   NSKXFHKVANGRRNRKFIKVLENERGLVLDNSDSIKEEILRYFEKLYASPS--GESWRVE  528

Query  1844  GC-FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
             G  + P+  E  + + +PFT E+I  A+F M    A GPDGFT   F   W  +   L  
Sbjct  529   GLDWSPISRESASRLESPFTEEEIYKAIFQMDRDXAPGPDGFTIAVFQDCWDVIKEDLVR  588

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
                 F   GI+    N + + L+PK    ++I+ +RPI L   +YK+I KV+  RL+ ++
Sbjct  589   VFDEFHRSGIINQSTNASFIVLLPKKSMAKKISNYRPISLITSLYKIIAKVLAGRLRGIL  648

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
              + +   Q +FV GRQI D  L   EI++  + + G  G +  K+D EKAYD +SW F++
Sbjct  649   HETIHSTQGAFVQGRQILDAVLIANEIVDE-KKRSGEEG-VVFKIDFEKAYDHVSWDFLD  706

Query  1307  DTLRDIGFN  1281
               +   GFN
Sbjct  707   HVMEKKGFN  715


 Score =   171 bits (434),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 211/438 (48%), Gaps = 25/438 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WIR    C++S     L NG    W+   +GLRQGDP+SP LF + A+  S M+  +   
Sbjct  721   WIRX---CLSSVSFAILVNGNAKGWVKXXRGLRQGDPLSPFLFTIVADVXSXMLLRAEER  777

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               ++G +V R    +SHL FADD +FF        L +K  L +F   SG K+NL KS++
Sbjct  778   NVFEGFRVGRNRTRVSHLQFADDTIFFSSTREEDLLTLKSVLXVFGHISGLKVNLDKSNI  837

Query  915   FFSKNTNLGTQ--QNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarlsg  745
             +     NLG      +A  L   +      +LGLP + G  K  SF D ++ERI +RL G
Sbjct  838   Y---GINLGQDHLHRLAELLDCKASGWPILYLGLP-LGGNPKSGSFWDPVIERISSRLDG  893

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLW-GSREGKNKCH  568
                  LS  G   ++QS L+ +P Y +    IP+ V   IERL R FLW G  EGK + H
Sbjct  894   WQKAYLSFGGRITLIQSCLTHMPCYFLSLFKIPASVAGRIERLQRDFLWSGVGEGK-RDH  952

Query  567   LVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWS  388
             LV W +V  SK  GGLG+  +   N A L K  WR  ++G+ LW  +  + Y    + W 
Sbjct  953   LVSWBVVCKSKMKGGLGLGRISLRNSALLGKWLWRYPREGSALWHQVILSIYGSHSNGWD  1012

Query  387   SWQPKRNSSNA-WKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPL---FEEASAP  220
             +    R S    WK I Q    F    ++ V +G   RFW D W  D+ L   F      
Sbjct  1013  ANTXVRWSHRCPWKAIAQVFQDFSKFTRFIVGDGDRIRFWEDLWWGDQSLGVRFPRLLRV  1072

Query  219   IAPSSLNNLVANYWISNEGWDWDM-LDRVLPEHILNKLSTFVLQEDTL-----LGDRLVW  58
             +     N L+++   S   + W+    R L +  + K+ + +   D +     + D+  W
Sbjct  1073  VMDK--NILISSILGSTRPFSWNFNFRRNLSDSEIEKVESLMQSLDHIHLSPSVPDKRSW  1130

Query  57    YKEPNGLFSVSSAYELAL  4
                 +GLF+V S + LAL
Sbjct  1131  SLSSSGLFTVKSFF-LAL  1147


 Score = 69.3 bits (168),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 71/154 (46%), Gaps = 3/154 (2%)
 Frame = -1

Query  1745  KASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQ  1566
             KA   D F+  F+  +   V   + SF+  F E        N T L  IPK    + +  
Sbjct  1328  KAPEFDEFSMAFWQFSCDFVKDEMMSFIKDFHEHDNFVKSLNATFLVFIPKKGGAKDLRY  1387

Query  1565  FRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK  1386
             FR I L   +YK + KV+  RLK +  K+V   Q +FV GRQI D  L   E ++     
Sbjct  1388  FRLISLMGGLYKWLAKVLANRLKKVEGKVVTKAQGAFVEGRQILDAVLIANEAIDLILEN  1447

Query  1385  KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
                   +   +D+EKAY R+ W  +   ++ +GF
Sbjct  1448  NEYD--ILCTLDVEKAYGRMDWSILV-IMQKMGF  1478



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score =   240 bits (613),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/525 (32%), Positives = 265/525 (50%), Gaps = 26/525 (5%)
 Frame = -1

Query  2810  VYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSE  2646
             ++  +S PWL      S VY       RR L+  L       Q  WL  GDFNS+    E
Sbjct  934   LHVKLSLPWLPHPVFTSFVYAKCTRIERRELWTSLRIISDGMQAPWLVGGDFNSIVSCDE  993

Query  2645  VSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*S  2466
               N          D +  +F   L+D GF G+S+TW     T +    RLDR + N E +
Sbjct  994   RLNGAIPHDGSMEDLSSTLFDCGLLDAGFEGNSFTW-----TNNRMFQRLDRVVYNQEWA  1048

Query  2465  LRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSD  2286
               F   +V HL   GSDH PLLIS +   Q+  ++ F+F  AWT H+ F + V+  W + 
Sbjct  1049  EFFSSTRVQHLNRDGSDHCPLLISCSNTNQRGPAT-FRFLHAWTKHHDFISFVEKSWNTP  1107

Query  2285  LDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLS--MGIRSDlv  2130
             +         T +  +   L  W++  FG+I +  R  LA +E  Q  L+      +   
Sbjct  1108  IHAEGLNAFWTKQQRLKRDLKWWNKHIFGDIFKILR--LAEVEAEQRELNFQQNPSAANR  1165

Query  2129  rlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDAD  1950
              L  +   +L   L  EEL W Q+S  +W+  G+RNT+F+ +    KR ++ + ++ D +
Sbjct  1166  ELMHKAYAKLNRQLSIEELFWQQKSGVKWLVEGERNTKFFHMRMRKKRMRNHIFRIQDQE  1225

Query  1949  GHLICDDGLLLKHVYDYFLGLFTTE-VDVNRTNFCYGCFPPLLEE-DWASVNAPFTPEDI  1776
             G+++ +  L+     ++F  L   E  D++R  F     P ++   D   + A  + +++
Sbjct  1226  GNVLEEPHLIQNSGVEFFQNLLKAEQCDISR--FDPSITPRIISTTDNEFLCATPSLQEV  1283

Query  1775  KTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIP  1596
             K A+F++     +GPDGF+  F+   W  +   LF  V  FF+   LP G   T L L+P
Sbjct  1284  KEAVFNINKDSVAGPDGFSSLFYQHCWDIIKQDLFEAVLDFFKGSPLPRGITSTTLVLLP  1343

Query  1595  KVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAY  1416
             K QN  + ++FRPI LC V+ K++TK++  RL  ++  ++  +QS FV+GR I+DN L  
Sbjct  1344  KTQNVSQWSEFRPISLCTVLNKIVTKLLANRLSKILPSIISENQSGFVNGRLISDNILLA  1403

Query  1415  QEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             QE+++     + R G + LK+D+ KAYDRL+W F+   +   GFN
Sbjct  1404  QELVDKINA-RSRGGNVVLKLDMAKAYDRLNWEFLYLMMEQFGFN  1447


 Score =   162 bits (411),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 204/423 (48%), Gaps = 14/423 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C+++     L NG L  +    +GLRQGD ISP LF+L AE LS  ++     
Sbjct  1450  WINMIKACISNCWFSLLINGSLVGYFKSERGLRQGDSISPSLFILAAEYLSRGLNQLFSR  1509

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              N     ++  + ++SHL FADD+V F         ++   L  +   SGQ++N QKS  
Sbjct  1510  YNSLHY-LSGCSMSVSHLAFADDIVIFTNGCHSALQKILVFLQEYEQVSGQQVNHQKSCF  1568

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               +    L  +Q IA   G         +LG P   G  K   FD+++ +I+ R+SG  +
Sbjct  1569  ITANGCPLSRRQIIAQVTGFQHKTLPVTYLGAPLHKGPKKVFLFDSLISKIRDRISGWEN  1628

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWG-SREGKNKCHLVK  559
             + LS      +++SVLS++P Y ++    P+ VI+ IERL   FLWG S EGK + H   
Sbjct  1629  KILSPGSRITLLRSVLSSLPMYLLQVLKPPAIVIEKIERLFNSFLWGDSNEGK-RMHWAA  1687

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  +    + GGL I++LK +  AF  KL WR     + LWT   K KY     +    Q
Sbjct  1688  WNKINFPCSEGGLDIRNLKDVFDAFTLKLWWRF-YTCDSLWTLFLKTKYCLG-RIPHYVQ  1745

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             PK +SS+ WK I     +     +W +  G    FW D W+ D+PL         PS  N
Sbjct  1746  PKIHSSSIWKRITGGRDVTIQNTRWKIGRGELF-FWHDCWMGDQPLVIS-----FPSFRN  1799

Query  198   NL-VANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
             ++   + +   + WD D L   LP +++ ++   ++  D    D   W    NG FS  S
Sbjct  1800  DMSFVHKFYKGDSWDVDKLRLFLPVNLIYEI--LLIPFDRTQQDVAYWTLTSNGEFSTKS  1857

Query  21    AYE  13
             A+E
Sbjct  1858  AWE  1860


 Score = 63.9 bits (154),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 15/175 (9%)
 Frame = -3

Query  4338  LQRLQGMWK---LEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRP  4168
             LQ ++  +K   L   +E+  L +   +       D++ +     W ++   +   +W P
Sbjct  113   LQEVRSAFKGIGLSGAYEIKWLDYKHVLIHLSNDQDFNRIWTRQQWFIVGQKMRIFKWSP  172

Query  4167  NFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVC  3988
              F+    +   +  W+ FP+L    ++   L  I K IG+P+ +D  T   S+   ARVC
Sbjct  173   EFEAE-KESPVVPVWISFPNLKAHLYEKSALLLIAKTIGKPLFVDEATAKGSRPSVARVC  231

Query  3987  VQLDITKPLL-----------SNFVINGTEWPKEYEGIHQICFKCSIYGHRMETC  3856
             V+ D  +P +           +  V NG     E+  +   C  C   GH   TC
Sbjct  232   VEYDCREPPIDQVWIVTQKRETGMVTNGYAQKVEFSQMPDYCEHCCHVGHNETTC  286



>emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera]
Length=1201

 Score =   212 bits (540),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 170/596 (29%), Positives = 271/596 (45%), Gaps = 23/596 (4%)
 Frame = -1

Query  3029  TLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDE---WIRVEAVGYSGGIWLFCSVS  2859
              +K  +R HKP L+CL E K+ +  ++ +  S+G      W+ ++A G +GG+ +     
Sbjct  2     VIKSMVRKHKPDLVCLQETKM-KEMSDRVVKSVGIGRNLGWVSLDARGXAGGVLVMWDKR  60

Query  2858  INIEILYTHPQFIAFQVYDNVSAP--WLMSVVYGCLDMALRRHLFADLS*YFFNPQGTWL  2685
             +   + +    F     + N      W+ S +YG      RR L+ +L+         W 
Sbjct  61    VLEGLEFEVGSFSISCRFRNCEEGFVWVFSGLYGPSKGRERRELWEELAAIKGLWNDPWC  120

Query  2684  AMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKG  2505
                DFN V   +E SN    S +   +F+ +I   EL+D    G ++TWI G +  + K 
Sbjct  121   IAXDFNVVRFPAETSNGRQMSTA-MREFSSFIDEFELVDPXLGGGAFTWIGG-EGGALK-  177

Query  2504  ARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHY  2325
             A LDR L + +   R   A    L    SDH P+L+      +    S F+F   W    
Sbjct  178   AXLDRFLFSGDWEERVTGAMQCLLTRPVSDHCPILLDCGGVRKG--KSPFRFENMWLRVE  235

Query  2324  SFQACVQSVWRS-------DLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ  2166
              F   V+  W+S          ++    A+   L +W+++S G++  KK     +L+   
Sbjct  236   GFTDKVKEWWQSYIFRGSPSFVIAKKLQALKHDLKLWNKESLGDVSVKKNAAXEKLKYWD  295

Query  2165  *SLSMG-IRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVK  1989
                S+G +  +  R +   R E       EE+ W Q+SR  W+K GD NT+F+      +
Sbjct  296   NLESLGSLSEEDRRSQGAARDEFNHCAILEEISWRQKSRALWLKEGDSNTKFFHRMANAR  355

Query  1988  RNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWA  1809
             R  + +S L    G  +  +  L + +  YF  +F   + V R     G F  L   D  
Sbjct  356   RRGNFISSLT-VRGIRLSKEEELKEGIGSYFKSMFEDPI-VRRPEVESGLFNTLDSLDND  413

Query  1808  SVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPP  1629
              +   F+ E++  AL D+   KA GPDGFT  F+    P VG  +           ++  
Sbjct  414   ILERQFSNEEVLRALSDLGGDKAPGPDGFTLAFWKTCXPVVGGEVMQVFEELHSQNVIFR  473

Query  1628  GCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVH  1449
               N T L LIPK +    +  +RPI L   +YK+I KV+  RLK ++ KLV   Q++FV 
Sbjct  474   SHNATFLVLIPKKEGXSDVQDYRPISLVGSLYKIIAKVLANRLKGVMGKLVSNSQNAFVE  533

Query  1448  GRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             GRQI D  L   E +++ +   G    +  K+D+EKAYD ++W F+   L  +GF 
Sbjct  534   GRQILDAVLVANEAIDSRKRSVGTG--LVCKLDIEKAYDHVNWRFLMSVLEKMGFG  587


 Score =   190 bits (482),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/443 (33%), Positives = 213/443 (48%), Gaps = 32/443 (7%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W + I CC+++ R+  L NG  TD+ S  +GLRQGDP+SP LFVL  E LS ++  + 
Sbjct  588   PKWRKWIFCCISTVRMAVLVNGTPTDFFSTFRGLRQGDPLSPYLFVLIMEALSSLISRAE  647

Query  1101  RSGNWKGVKVTRI---APNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINL  931
              +G  +G K T       ++SHL FADD + F E +  Q +  K  +  F   SG KINL
Sbjct  648   ENGFIRGFKATGRRGEGVSVSHLLFADDTLLFCEDDRDQLIFWKWVVICFEVVSGLKINL  707

Query  930   QKSSLFFSKNTNLGTQQNI---AATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIK  760
             QKS +       +G  + +   AA  G         +LGLP          +D + ER K
Sbjct  708   QKSEII-----PIGGVEEVDRAAAVFGCKVGNLPTNYLGLPLGASHKSCRVWDGVEERFK  762

Query  759   arlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGK  580
              +L+    + LS  G   +++S LS +P Y M   +IP  V   +E++ R FLWG  E +
Sbjct  763   RKLAMWKKQYLSKGGRLTLIKSTLSNLPIYFMSLFVIPRKVRLRLEKIQREFLWGDMEER  822

Query  579   NKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDP  400
              K HLV+W +      +GGLG++ LK  N A L K  WR   +   LW  +   K+    
Sbjct  823   RKIHLVRWEVTCKDMRHGGLGLRYLKDFNHALLGKWLWRFPIERESLWRRVIVGKFGEVQ  882

Query  399   SVWSSWQPKRN-SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASA  223
               W++ + + +  +  WK I +    F    + H+ NGR TRFW D W+ D  L +    
Sbjct  883   GGWTTREVRESYGTGLWKDIRKGWEEFFLRTRIHIGNGRRTRFWWDMWVGDSKLKDLFPL  942

Query  222   PIAPSSLNN-LVANYWISNE----GW---------DWDMLDRVLPEHILNKLSTFVLQED  85
                 ++ N+ +VA+ W   E    GW         DW++ +       L  +S   +QE 
Sbjct  943   LFRIAANNSAIVADLWGRQEGGGGGWEVHFRRPFQDWELEE---VNRFLGYISAVRVQEG  999

Query  84    TLLGDRLVWYKEPNGLFSVSSAY  16
                 D LVW  E  G F V+S Y
Sbjct  1000  E---DFLVWKIERKGTFKVNSYY  1019



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score =   236 bits (601),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/538 (30%), Positives = 263/538 (49%), Gaps = 24/538 (4%)
 Frame = -1

Query  2858  INIEILYTHPQFIAFQVYDNVSAPWL-----MSVVYGCLDMALRRHLFADLS*YFFNPQG  2694
             ++ ++++ HPQ +  ++    ++PWL     ++ VY     + R  L+  L     + + 
Sbjct  1128  LHSDVIFDHPQCLHVRL----TSPWLEFPIFVTFVYAKCTRSERTLLWDCLRRLAADIEV  1183

Query  2693  TWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPS  2514
              WL  GDFN +  + E             DF   +    L+D GF G+ +TW     T +
Sbjct  1184  PWLVGGDFNIILKREERLYGSAPHEGAMEDFASTLLDCGLLDGGFEGNPFTW-----TNN  1238

Query  2513  FKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWT  2334
                 RLDR + N     +FP  ++ HL   GSDH PLLIS     ++  SS F+F  AW 
Sbjct  1239  RMFQRLDRIVYNHHWINKFPITRIQHLNRDGSDHCPLLISCFNSSEKAPSS-FRFQHAWV  1297

Query  2333  THYSFQACVQSVWRSDLDLS------TNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEG  2172
              H+ F+  V+S W   ++ S      + +  + + L  W++  FG+I  K +    R+E 
Sbjct  1298  LHHDFKTSVESNWNLPINGSGLQAFWSKQHRLKQHLKWWNKVMFGDIFSKLKEAEKRVEE  1357

Query  2171  VQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTV  1992
              +         + +    +   +L + L  EE+ W Q+S  +W+  G+RNT+F+      
Sbjct  1358  CEILHQNEQTVESIIKLNKSYAQLNKQLNIEEIFWKQKSGVKWVVEGERNTKFFHTRMQK  1417

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             KR +S + K+ + DG  I D   L +    YF  L   E   + + F     P ++    
Sbjct  1418  KRIRSHIFKVQEPDGRWIEDQEQLKQSAIKYFSSLLKFE-PCDDSRFQRSLIPSIISNSE  1476

Query  1811  ASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGIL  1635
               +  A    +++K A+F + P  A+GPDGF+  F+ + W  +   L   V  FF    +
Sbjct  1477  NELLCAEPNLQEVKDAVFGIDPESAAGPDGFSSYFYQQCWNIIAHDLLDAVRDFFHGANI  1536

Query  1634  PPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSF  1455
             P G   T L L+PK  +  + + FRPI LC V+ K+ITK++  RL  ++  ++  +QS F
Sbjct  1537  PRGVTSTTLILLPKKPSASKWSDFRPISLCTVMNKIITKLLSNRLAKILPSIITENQSGF  1596

Query  1454  VHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             V GR I+DN L  QE++    T K R G +ALK+D+ KAYDRL W F+   L+  GFN
Sbjct  1597  VGGRLISDNILLAQELIGKLNT-KSRGGNLALKLDMMKAYDRLDWSFLIKVLQHFGFN  1653


 Score =   166 bits (419),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 127/423 (30%), Positives = 203/423 (48%), Gaps = 12/423 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C+++     L NG+   +    +GLRQGDPISP LF++ AE LS  +++    
Sbjct  1656  WIGMIQKCISNCWFSLLLNGRTEGYFKFERGLRQGDPISPQLFLIAAEYLSRGLNALYE-  1714

Query  1095  GNWKGVKV-TRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
               +  +   T ++  +SHL FADD++ F   +      +   L  +   S Q+IN QKS 
Sbjct  1715  -QYPSLHYSTGVSIPVSHLAFADDVLIFTNGSKSALQRILAFLQEYEEISRQRINAQKSC  1773

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                  N +   +Q IA T G    L    +LG P   G  K   F++++ +I+ R++G  
Sbjct  1774  FVTHTNVSSSRRQIIAQTTGFNHQLLPITYLGAPLYKGHKKVILFNDLVAKIEERITGWE  1833

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             ++ LS  G   +++SVL+++P Y  +    P  V++ I R+   FLWG      K H   
Sbjct  1834  NKILSPGGRITLLKSVLTSLPIYLFQVLKPPVCVLERINRIFNSFLWGGSAASKKIHWTS  1893

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  ++     GGL I+SL  +  AF  KL WR  +  + LWT   + KY     +    Q
Sbjct  1894  WAKISLPVKEGGLDIRSLAEVFEAFSMKLWWRF-RTTDSLWTRFMRMKY-CRGQLPMHTQ  1951

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
             PK + S  WK ++ +  I    ++W V  G    FW D W+ + PL           SL+
Sbjct  1952  PKLHDSQTWKRMVASSAITEQNMRWRVGQGNLF-FWHDCWMGETPLISSNHE----FSLS  2006

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              +    +  N  WD + L  VL + ++++++   +  D +  D   W   PNG FS  SA
Sbjct  2007  MVQVCDFFMNNSWDIEKLKTVLQQEVVDEIAKIPI--DAMSKDEAYWAPTPNGEFSTKSA  2064

Query  18    YEL  10
             ++L
Sbjct  2065  WQL  2067


 Score = 62.4 bits (150),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/199 (23%), Positives = 79/199 (40%), Gaps = 17/199 (9%)
 Frame = -3

Query  4311  LEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKL  4132
             L   +E+  L +   +       D + V     W + +  +   +W P F+P   +   +
Sbjct  160   LAGAYEVRWLDYKHILIHLTNEHDCNRVWTKQVWFIANQKMRVFKWTPEFEPE-KESAMV  218

Query  4131  LAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGKFARVCVQLDITKPLLSN  3952
               W+ FP+L    F+   L  I K +G+P+ +D  T   S+   ARVC++ D  KP +  
Sbjct  219   PVWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEYDCRKPPIDQ  278

Query  3951  F-----------VINGTEWPKEYEGIHQICFKCSIYGHRMETCGLSVPIPAASVDGTAGT  3805
                         V +G     E+  +   C  C   GH+   C     I   + D   G+
Sbjct  279   VWIVVQNRETGTVTSGYPQKVEFSQMPAYCDHCCHVGHKEIDC-----IVLGNKDKPLGS  333

Query  3804  SSTTGIDIPLPKPKEKYGA  3748
             S +  + +   + K+ YG 
Sbjct  334   SKSQFLRVLEAEKKKGYGG  352



>ref|XP_010667308.1| PREDICTED: uncharacterized protein LOC104884364 [Beta vulgaris 
subsp. vulgaris]
Length=1286

 Score =   213 bits (543),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 216/423 (51%), Gaps = 5/423 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLS-HMVDSSVR  1099
             WI  +  C+++     L NG   D  +P +G+RQGDP+SP +F+LCAE L+  +  +S  
Sbjct  513   WIDWLKECISTVSFSVLVNGIPGDIFTPSRGIRQGDPLSPYIFILCAELLARQLFCASTE  572

Query  1098  SGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
                  GVK+      +  L FADD++ F +A+     E++  LD +C  SGQ +N  KS+
Sbjct  573   GSRLVGVKLGHSGVKIPFLTFADDIMIFAKASVESCREIRGILDTYCRMSGQLVNYNKSA  632

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                S NT+       A  L +     +GK+LG P I  ++  ++F  I E+++A+LS   
Sbjct  633   YQCSPNTDPILASAFAQVLQMGEASSLGKYLGCPIIDSKVTNNTFGEIQEKVQAQLSKWK  692

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             + +LS AG  +++QS L+    Y M+   +P+ ++ S+++  R F W         +L+ 
Sbjct  693   ANSLSQAGRTILIQSNLATKANYQMQCFSLPTHILHSLDKSYRNFFWNKSPESKSPNLIG  752

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  V  SK  GGLG++  K MN+A   KL W++      LW +L   KY  D S++    
Sbjct  753   WEKVCKSKREGGLGLRKAKVMNMALQFKLLWKILVSQGNLWVDLVSKKYLKDESLFDH-N  811

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
              K  +S  W+ ++Q    F+ G++W V NG    FW D+W    PL   +  P+   S +
Sbjct  812   VKATASWQWRKLMQFRKTFKKGLRWVVGNGEKISFWFDNWAFQYPL--SSICPVIRGSES  869

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
              +VA++   +  WD+  L   +PE +   +    +       D+LVW   P+G +SV S 
Sbjct  870   LVVAHFIDQDSHWDYRRLLDFVPEEVGTSIKGIFIPRQG-PEDKLVWALSPDGCYSVKSG  928

Query  18    YEL  10
              EL
Sbjct  929   VEL  931


 Score =   188 bits (477),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 153/272 (56%), Gaps = 10/272 (4%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             +E  W  +++   +K  D N+++Y    +++RN++ VS ++D  G  I +     K V  
Sbjct  242   QETHWRIKAKATHLKFSDSNSKYYHACASIRRNRNFVSSIIDDRGISISNP----KQVEL  297

Query  1901  YFLGLFTTEVDVNRTNF------CYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKA  1740
              F   F +    N +         +   P + +E+ A + A  + E+++ A+F++ P KA
Sbjct  298   CFTSAFASRFSSNPSCIFDEELDLHLLSPIISDEENARLCAEVSFEEVREAVFELGPDKA  357

Query  1739  SGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFR  1560
              GPDG+ P FF K W  VG S+F  V  FF  G L    N T ++LIPKV+ P     FR
Sbjct  358   PGPDGYPPFFFQKYWSLVGNSVFKAVRAFFHLGKLLKEVNHTFVTLIPKVEAPSSPNHFR  417

Query  1559  PIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG  1380
             PI LC+ +YK+I K+M  RLK ++ K++ P Q +FV  R I DN L   E+ ++FR K G
Sbjct  418   PISLCSTIYKVIAKIMASRLKMVLGKIIHPLQGAFVPERLIQDNILLAHEVFHSFRKKSG  477

Query  1379  RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
               GW+A+K+D+EKAYDRL W FI    + +GF
Sbjct  478   SSGWLAIKLDMEKAYDRLEWNFIFAVFKKLGF  509



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score =   208 bits (529),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 134/423 (32%), Positives = 212/423 (50%), Gaps = 6/423 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  I  C++S     L NG+    I+P +G+RQGDP+SP LF++  E L   +  + R 
Sbjct  469   WIAWIHLCISSVSYNVLINGEPKGNITPSRGIRQGDPLSPFLFIILTEALISQIQGAERE  528

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G+K+ R +P +SHL FADD +FF +A++ Q  E+ K ++ +   SGQ++N+ KSS+
Sbjct  529   GRITGLKIARDSPPISHLLFADDSLFFCKADTQQCRELMKIIEEYGRASGQQLNVAKSSI  588

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             FF        +  +   LGI     MG +LGLP      K+ +F  I ER+ +RL+  S+
Sbjct  589   FFGSKVPPELKTELKEALGITREGGMGVYLGLPEKICGSKRQAFAFIQERLMSRLNSWSA  648

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  V+++SV  A+P Y M   L+P  +I  +   I  F W +++     H V W
Sbjct  649   KLLSKGGKEVLIKSVAQAMPSYVMSCFLLPQDIIKKLTSAIARFWWSTKQNNRGLHWVAW  708

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +      GGLG + LK+ NLA LAK  WRL Q    L   + K +Y F  S     + 
Sbjct  709   NKICLPTEKGGLGFRDLKNFNLALLAKQLWRLVQYPTSLLAKVLKERY-FRNSNPIDVEK  767

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
                 S  W+ I+ A  + ++G++  + +G  TR W + W+   P        +AP    N
Sbjct  768   ASQPSYVWRSIMAAKPLLKSGLRKSIGSGYNTRVWDEPWIPSTP--PRPPTGVAPIQKPN  825

Query  195   LVANYWISNE--GWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
             L+    I  E   W+ + L  V+    +  +S+  +   +   D   W    +G +SV +
Sbjct  826   LLVYELIDRETKSWNVEALKAVIAPEDIPLISSLRISR-SFKVDSFCWIHTKSGAYSVKT  884

Query  21    AYE  13
              Y+
Sbjct  885   GYD  887


 Score =   193 bits (491),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/512 (29%), Positives = 224/512 (44%), Gaps = 72/512 (14%)
 Frame = -1

Query  2783  LMSVVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTD  2604
              ++ VYG   +  R +++  L+       G WL +GDFN +T   E         S    
Sbjct  14    FITFVYGDPVVECRENVWERLTRMSLTRNGAWLMLGDFNDITGNHEKKGGRRRPDSSFMP  73

Query  2603  FNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMI  2424
             F   +    +ID    G+ ++W+ G  +      +LDRA+ N +    +    V +L + 
Sbjct  74    FKTMLANCGMIDFPSKGNPFSWV-GNRSSGKVQCKLDRAVGNEDWHHIYSHTNVEYLRLW  132

Query  2423  GSDHSPLLISITTCPQQFCSSR------FKFNMAWTTHYSFQACVQSVWRSD-----LDL  2277
             GSDH P+L        +F S R      FKF+  W     F+  +   W         DL
Sbjct  133   GSDHRPILT-------RFLSKRGKGRRGFKFDKRWIDRDGFRETILKGWSDPGNLHPPDL  185

Query  2276  STNKSAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkele  2097
                 +   +A++ W R +  N   +   L  +LE  Q  L   I +D +   +       
Sbjct  186   HERIAMCRKAIAQWKRANPLNFVARIEELKEKLEKAQ--LDDTISNDEILQLKWDLCS--  241

Query  2096  ETLYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLL  1917
                  EEL W Q+SR  W+K GDRNT+F+   T  +R ++R++KL +  G     +  + 
Sbjct  242   -AFRDEELYWKQKSRANWLKEGDRNTKFFHATTKQRRARNRLTKLKNPRGGWAEKEEDIE  300

Query  1916  KHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKAS  1737
             K   +YF  LFTT                              P +   AL +       
Sbjct  301   KVAEEYFQVLFTTS----------------------------NPGNFDEALRNF------  326

Query  1736  GPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRP  1557
                G T G            +F  V  FF    L P  N T + LIPK + P  +T+FRP
Sbjct  327   --GGITAG-----------EIFRMVREFFMSETLDPRLNQTNICLIPKTERPCEMTEFRP  373

Query  1556  IGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-  1380
             I LCNV YK+++K++  RLK  +  L+   QS+FV  R ITDN L  QE+ +A RT    
Sbjct  374   ISLCNVSYKVVSKILSNRLKRHLPGLISETQSAFVAKRLITDNILVAQEVFHALRTNPSC  433

Query  1379  RVGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             +  ++A+K D+ KAYDR+ W F+E  +R +GF
Sbjct  434   KSKFVAIKTDMSKAYDRVEWSFLEALMRKMGF  465



>emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   226 bits (575),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/606 (28%), Positives = 292/606 (48%), Gaps = 27/606 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDE--WIRVEAVG  2895
             WN +G  +   + +L+  +  H P  I L E K+       I S    D+  W+ + ++G
Sbjct  6     WNIRGLNARVKKSSLRKLISRHDPKFIFLQETKMESLNPKTIRSIWNSDDIDWLFIPSIG  65

Query  2894  YSGGIWLFCSVSINIEILYTHP---QFIAF--QVYDNVSAPWLMSVVYGCLDMALRRHLF  2730
              SGG  L     I+   L +H     +IA   ++        L++V   C  ++ R  ++
Sbjct  66    NSGG--LLSMWKIDYFSLTSHKSENNWIALNGKIPSKNFQGVLVNVYNPCCRVS-RSKVW  122

Query  2729  ADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
               +S Y+   Q   L +GDFN V   S+  +  +  +    DF ++I    L+++  +  
Sbjct  123   TSISDYWAESQSPMLMVGDFNEVLDPSDRGSGISSQLG-VLDFKNFIQQTHLMEISASDG  181

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQF  2370
              +TW  G        ++LDR L N E    FP  +V+ L    SDH PLL+        +
Sbjct  182   WFTWFSGQAK-----SKLDRLLVNPEWVSLFPSLQVSILRRNLSDHCPLLVKSDEL--NW  234

Query  2369  CSSRFKFNMAWTTHYSFQACVQSVWRSDL--DLSTNKSAMVEALSVWSRDSFGNIPQKKR  2196
                 F+F   W +H      ++ VW S    +L+       + L +W+   FG+I +   
Sbjct  235   GPRPFRFQNCWLSHPGCLQIIKDVWASHTSGNLTDKLKETKKRLKIWNSSEFGHIDRNIE  294

Query  2195  RLLARLEGVQ*SLSMG--IRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRN  2022
              L  R+  +   +S G  ++ + +   R  + EL   L ++E  W Q SR +WIK GD+N
Sbjct  295   ELEDRIHNLD-LISNGRDLQLEELAERRSSQMELWVWLRRKEAFWAQNSRAKWIKEGDKN  353

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYG  1842
             T+++    + ++ ++ +  L+  +G ++ D   +      +F  +F  +   +R  F   
Sbjct  354   TKYFHTLASTRKKKNTIPALITNNG-VVSDPAGIHHEAVSFFKSIFKEDFS-SRPVFNGL  411

Query  1841  CFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFV  1662
              F  L  E  + +  PF+ +++  A+    P KA GPDG+   F   +W  +   +++ V
Sbjct  412   QFRSLSCEQVSQLTEPFSHKEVDEAVESCDPQKAPGPDGYNFRFIKDSWDIIKLDVYNIV  471

Query  1661  HRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRK  1482
               F+  G LP G N   ++LI K + PE +  FRPI +   +YK+I K++  RL+ ++  
Sbjct  472   ENFWNSGSLPKGSNVAFIALIAKREVPEGLNDFRPISMVGCIYKIIAKLLARRLQKVMDS  531

Query  1481  LVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDT  1302
             L+GP+QSSF+ GRQI D  L   E+++  R KK ++    LK+D  KA+D ++W F++ T
Sbjct  532   LIGPYQSSFIAGRQILDGALIAGELIDTCRRKKVQLS--ILKLDFHKAFDSVAWSFLDWT  589

Query  1301  LRDIGF  1284
             L  +GF
Sbjct  590   LDKMGF  595


 Score =   175 bits (444),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/439 (33%), Positives = 207/439 (47%), Gaps = 22/439 (5%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W   I  C+TS     L NG  T      +GLRQGDP+SP LF L  E LS ++  + 
Sbjct  597   PRWRMWISSCITSAAASILINGSPTAPFKLHRGLRQGDPLSPFLFDLVVETLSLVIQKAS  656

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G W+GV+VT+    ++HL +ADD + F   N    L +KK L LF   SG ++N  KS
Sbjct  657   HLGLWEGVEVTKNGEKITHLQYADDTIIFCPPNLDYLLNIKKTLILFQLASGLQVNFHKS  716

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKK-DSFDNILERIKarlsg  745
             S+       +  Q+   A L     L    +LGLP I G + +   +D I+++I+ +L+ 
Sbjct  717   SIMGIHVDEIWLQEAANALLCKVGRLPF-TYLGLP-IGGNISRLAHWDPIIKKIEGKLAS  774

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL  565
                R LS+AG   ++++ +S++P Y M     P GVI++I +L R FLW     K+   L
Sbjct  775   WKGRMLSIAGRITLIKASISSLPLYYMSLFPAPRGVIEAINKLQRNFLWSGELRKSSLAL  834

Query  564   VKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS  385
             V W  V   K +GGL   +L + N++ L K  WRLS D   LW  + K KY +  +    
Sbjct  835   VAWNQVVLPKESGGLNCGNLLNRNISLLFKWIWRLSHDPESLWQKVIKEKYGYSHTTTVH  894

Query  384   WQPKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRP------  244
                    S  W+ I  ++          +  ++  V NG  T FWLD+WL D P      
Sbjct  895   DLCIPKGSGPWRFICASILNHPSARSFVKTKLRKAVGNGVKTLFWLDTWLGDSPLKLRFP  954

Query  243   -LFEEASAPIAP-SSLNNLVANYWISNEGWDWDMLDRVLP--EHILNKLSTFVLQEDTLL  76
              LF     P+A  +S  +     W+ N  W      R     E +   L +  L   T  
Sbjct  955   RLFTIVDNPMAYIASCGSWCGREWVWNFSWSRVFRPRDAEEWEELQGLLGSVCLSPST--  1012

Query  75    GDRLVWYKEPNGLFSVSSA  19
              DRL+W    +G FSV S 
Sbjct  1013  DDRLIWTPHKSGAFSVKSC  1031



>ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
 gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
Length=1499

 Score =   236 bits (602),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/611 (29%), Positives = 276/611 (45%), Gaps = 60/611 (10%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLG--FDEWIRVEAVG  2895
             WN +G  S   R  +K  LR  KP ++ L E K        +    G  F EW+   ++G
Sbjct  328   WNIRGLGSRRKRLLVKEQLRRLKPDIVILLETKKEIVDRQLVAGVWGSRFKEWVFSPSLG  387

Query  2894  YSGGIW-LFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS  2718
              SGGI  L+ S S+++         ++ ++ +N+   W +S +YG      R   + +L+
Sbjct  388   RSGGIAVLWNSQSVSVIDSMVGEFSVSIRIEENIGTDWWLSGIYGPCRQRERNSFWEELA  447

Query  2717  *YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW  2538
               +      W   GDFN V   +E SN+   + S   DFND+I    L D     +S+TW
Sbjct  448   DLYGYCGDMWCLGGDFNVVRFSAEKSNEGRVTKS-MRDFNDFIQETNLRDPILLNASFTW  506

Query  2537  IRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR  2358
                 +    +  RLDR L +      FP  +   LP I SDH P  I + T   ++  S 
Sbjct  507   SNLRENAVCR--RLDRFLVSGSWEEHFPHYRHKALPRITSDHCP--IELDTSRVKWGPSP  562

Query  2357  FKFNMAWTTHYSFQACVQSVWRSD-------LDLSTNKSAMVEALSVWSRDSFGNIPQKK  2199
             F+F   W  H  F+  ++  W  D           T    +   L VWS++ FG++ +  
Sbjct  563   FRFENMWLNHPDFKRKIKLWWGEDQIPGWEGYKFMTRLKMLKSKLKVWSKEEFGDVERDL  622

Query  2198  RRLLARL------EGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIK  2037
             R   ARL      EG +  L   +RS+   L  ++    +    +EE+ W QR + +W +
Sbjct  623   REAEARLLVLDQREGTE-GLDHLLRSERDNLLLKIGDLAQ----KEEVKWRQRGKVKWAR  677

Query  2036  SGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRT  1857
              GD NT+F+       R ++ + KL   D  +I  D  + + V  +F GL+++  +    
Sbjct  678   DGDGNTKFFHRVANGARKRNYIEKLEVEDLGVIEVDANIEREVIRFFKGLYSSNKN----  733

Query  1856  NFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTS  1677
                                          A+FD    K+ GPDGF+  FF   W  V   
Sbjct  734   ----------------------------KAVFDCGKDKSPGPDGFSMSFFQSCWEVVKGD  765

Query  1676  LFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLK  1497
             L   +  FF+ GI+    N+T + LIPK  N  ++T +RPI L   +YK+I+KV+   L+
Sbjct  766   LMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASSLR  825

Query  1496  DMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWC  1317
             +++   +   Q +FV  RQI D  L   E++   R +K R G +  K+D EKAYD + W 
Sbjct  826   EVLGNTISQSQGAFVQKRQILDAVLVANEVVEEVRKQK-RKG-LVFKIDFEKAYDHVEWN  883

Query  1316  FIEDTLRDIGF  1284
             F++D +   GF
Sbjct  884   FVDDVMARKGF  894


 Score =   164 bits (414),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 138/424 (33%), Positives = 201/424 (47%), Gaps = 24/424 (6%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+ C+ S     + NG+        +GLRQGDP+SP LF L ++ LS +++ +       
Sbjct  902   IIGCLESVNFSIMINGKPRGKFRASRGLRQGDPLSPFLFTLVSDVLSRLIERAQDVNLVH  961

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+        +SHL FADD +F  +      L + + L LFC  SG KIN  KS +    
Sbjct  962   GIVSGHDQVEVSHLQFADDTIFLLDGKEEYWLNLLQLLKLFCDVSGMKINKAKSCIL-GI  1020

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDN-ILERIKarlsg*ssrtl  727
             N +     N+A + G         +LGLP + G  +  +F N ++E+++ RL       L
Sbjct  1021  NFSTDVLNNMAGSWGCEVGCWPMVYLGLP-LGGNPRALNFWNPVMEKVEKRLQKWKRACL  1079

Query  726   slag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIV  547
             S  G   ++Q+VLS+IP Y M    +P GV   +E+L+R FLW   +   KCHLV+W  V
Sbjct  1080  SKGGRLTLIQAVLSSIPSYYMSLFKMPIGVAAKVEQLMRNFLWEGLDEGKKCHLVRWERV  1139

Query  546   TNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRN  367
             T SK  GGLGI SL+    A  AK  WR   + N LW  + K+KY  D           +
Sbjct  1140  TKSKEEGGLGIGSLRERIEALRAKWLWRFPLETNSLWHRIIKSKYGID-----------S  1188

Query  366   SSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD---RPLFEEASAPIAPSSLN-  199
             + N W+ I +  + F    ++ V NG   RFW D WL +   + LF   S+     + + 
Sbjct  1189  NGNPWREISKGYNSFLQCCRFSVGNGEKIRFWEDLWLKEGILKDLFPRLSSLSRRKNQSI  1248

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTF--VLQEDTLLG---DRLVWYKEPNGLF  34
                AN  +    WD+D   R L E  + ++     +L    L G   DR  W  E  G F
Sbjct  1249  ACFANNHVLPLNWDFD-FRRNLSEAEIAEVVILLDILGNVRLYGSRPDRRSWEVEEQGSF  1307

Query  33    SVSS  22
             S  S
Sbjct  1308  SCKS  1311



>ref|XP_009102231.1| PREDICTED: uncharacterized protein LOC103828378 [Brassica rapa]
Length=1036

 Score =   214 bits (546),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 215/422 (51%), Gaps = 11/422 (3%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             IM CV S     L NG+  + + P +GLRQGDP+SP LF+LC+E LS +   +  SG   
Sbjct  301   IMQCVQSVSYSFLINGEPREKVLPERGLRQGDPLSPYLFILCSEVLSGLCRKAQDSGLLP  360

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
             G+KV R +P ++HL FADD +FF +++ +    +   L  +   SGQ INL KS++ FS 
Sbjct  361   GLKVARNSPAINHLLFADDTMFFSKSDPLSCSSLLDILRKYEIASGQCINLLKSAIMFSS  420

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
              T    +  +   LGI +   +GK+LGLP    R K+D F  I++RI+ R    S++ L+
Sbjct  421   KTPAAIRSRVKQDLGIAAEGGIGKYLGLPEHFSRRKRDIFAGIIDRIRQRSHSWSTKFLN  480

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              AG  V++++VL A+P Y+M    +P  +   I  ++  F W  +    K   V W  +T
Sbjct  481   GAGKQVLLKAVLMAMPAYAMSCFKLPLSLCKQILSILTRFWWDMKPEIRKMCWVSWQTLT  540

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNS  364
              +KA+GGLG + +   N A L KLAWR+  +   L   +   KY    S      P  + 
Sbjct  541   RAKADGGLGFRDIALFNDALLGKLAWRIMTNPESLLGRILLGKYCHSASFLDVTIPS-SP  599

Query  363   SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAP---SSLNNL  193
             S+ W+GI+    + + G  W + +G +   W   WL      +E  API P    S N +
Sbjct  600   SHGWRGIMAGREVVKKGFGWLIGSGSSIPVWAAPWL----SLKEPMAPIGPRPYQSENLM  655

Query  192   VANYWI-SNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAY  16
             VA+  I     W+  ++   LP++    L   ++  D  L D  VW     G +S  S Y
Sbjct  656   VADLIIPETRDWNLPLIRTTLPQY--EDLIRELIPGDLSLQDERVWLYTNTGEYSTRSGY  713

Query  15    EL  10
             +L
Sbjct  714   KL  715


 Score =   185 bits (470),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 154/271 (57%), Gaps = 1/271 (0%)
 Frame = -1

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
             +EE  W QRSR +W++ GDRNT F+   T  +   +++S + +  G  +  D  + +   
Sbjct  26    EEESFWRQRSRIQWLQHGDRNTGFFHAVTRGRNAMNKMSVIENEAGEAVYGDDKISQAFA  85

Query  1904  DYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
             +++  +FT+    + +       P + EE  +S+ A  T ++IKTA+F +   KA GPDG
Sbjct  86    EFYRKVFTSSPRSDLSFISEVITPVISEEMNSSLIARPTDDEIKTAVFSIHKDKAPGPDG  145

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
             F+  F+H  W  +G  + S +  FF+   L P  N+T + LI K +  +++  +RPI LC
Sbjct  146   FSASFYHSFWDIIGNDVCSDIRSFFDASCLNPRFNETHVRLIAKSKGAKKVADYRPIALC  205

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-  1368
             +  YK+I K++  RLK M+  L+ P QS+FV GR I+DN L   E+L+  RT K +    
Sbjct  206   STHYKIIAKLLTKRLKPMLPALISPQQSAFVAGRAISDNVLITHEMLHYLRTSKAKKSCS  265

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             MA+K D+ KAYDR+ W F++  L   GF+  
Sbjct  266   MAIKTDMSKAYDRIEWDFLDHVLHCFGFHQV  296



>ref|XP_010474119.1| PREDICTED: uncharacterized protein LOC104753583 [Camelina sativa]
Length=1162

 Score =   211 bits (537),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 139/423 (33%), Positives = 217/423 (51%), Gaps = 7/423 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI+ IM CV++     L N Q    + P++G+RQGDP+SP LF++C+E LS +   +  +
Sbjct  457   WIKWIMQCVSTVSYSFLINDQAKGLVLPQRGIRQGDPLSPYLFIICSEVLSRLCLKAQSN  516

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G   G +V + +P ++HL FADD +FF  A+      +K+ L  +   S QKIN  KSS+
Sbjct  517   GQLVGARVAKGSPRVNHLLFADDTMFFIRADPASCHTLKRILHKYEVASCQKINQAKSSI  576

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    ++     L I      GK+LGLP + GR KKD F +I++RIK +    SS
Sbjct  577   TFSSKTPRDMKEQAKHILDIHKEGGQGKYLGLPELFGRKKKDLFASIVDRIKQKAISWSS  636

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R L  AG   M++SVLS +P Y+M   L+P  +   I+  +  F W +   K K   + W
Sbjct  637   RFLLTAGKLTMLKSVLSVMPTYTMSCFLLPGSLCKRIQSALTRFWWDTSSEKKKMSWIAW  696

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +T    +GGLGI+ + H N A LAKL+WRL    + L++ +   KY  + S      P
Sbjct  697   TKITKPVKHGGLGIRDVTHFNKALLAKLSWRLLTKPHTLFSKVLLGKYCQNASFLECKAP  756

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
               ++S+ W+ I +   + +  +   V +G +   W   WL +  PL      P   +S N
Sbjct  757   S-SASHGWQSICKGRDLLKENLGMIVGSGASIPLWRTPWLSVSTPL--SPMGPPTEASQN  813

Query  198   NLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
              +VA+  + N G W+ +++  +LP  I  +    +    T + D   W    +G +S  S
Sbjct  814   LMVADLLLRNSGLWNVELIRSILP--IYERDILILKPSATEVVDFWAWLPSKDGSYSSKS  871

Query  21    AYE  13
              Y 
Sbjct  872   GYH  874


 Score =   188 bits (478),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 128/450 (28%), Positives = 223/450 (50%), Gaps = 14/450 (3%)
 Frame = -1

Query  2609  TDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLP  2430
             TD   ++ + +L DL  +G+  +W RG         RLDR++ N +  + +P  +  +L 
Sbjct  16    TDLRSFMSVCDLYDLKHSGNFLSW-RGKRHSHVVRCRLDRSMVNSDWVMAYPSGRSEYLW  74

Query  2429  MIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVE  2250
               GSD+ PL+ S     +    S F+++  +  +      +   W        +    + 
Sbjct  75    FEGSDYRPLVTSFDPIKKHH-KSLFRYDRRFKDNPEVCNIILKAWNLQPGAPVDHRLHLC  133

Query  2249  ALSV--WSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEE  2076
              L++  WS+    N  ++   L  +LE      +M            L + L     +EE
Sbjct  134   RLAIIQWSKTQMLNSKKEILSLSEQLEE-----AMCDDEASQSTIDGLNQSLLSAYKREE  188

Query  2075  LIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYF  1896
               W QRSR+ W+   D+NT ++  AT  +R  + +S +  + G  + ++  + + + +YF
Sbjct  189   EYWKQRSRQLWLTLRDKNTGYFHAATKNRRAINNISVIESSLGAKMYEEKEITEVISNYF  248

Query  1895  LGLFTTEVDVNRTNFCYGCFPPLL--EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
               +FT+  + +R +       P +  E + A ++ P   E IK A F++   KA  PDGF
Sbjct  249   QDIFTSH-EGDRQSAIQEALTPCVTPEMNEALIDIPSATE-IKQACFNIHADKAPDPDGF  306

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             +  FF   W  +G  + + VH FF  G LP   N T + LIPK+   ++++ +RPI LC+
Sbjct  307   SASFFQSNWNNIGDMVIAEVHSFFISGSLPQKINHTHIRLIPKIPTAQKVSDYRPIALCS  366

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWM  1365
             V YK+I K++  RL+ ++   +  +QS+FV  R I++N L   E+L+  +T    +  +M
Sbjct  367   VYYKIIAKLLAKRLQPVLHTCISENQSAFVPQRAISNNVLITHEVLHYLKTSGAVKRCFM  426

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
             A+K D+ KAYDRL W FI+  L  +GF+ T
Sbjct  427   AVKTDMSKAYDRLEWDFIKVALDQMGFHQT  456



>ref|XP_009107566.1| PREDICTED: uncharacterized protein LOC103833219 [Brassica rapa]
Length=1182

 Score =   206 bits (525),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 217/434 (50%), Gaps = 21/434 (5%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ +M CVT+     L N Q    I P++GLRQGDP+SP LFVLC E L H++ ++ R 
Sbjct  406   WVQWVMKCVTTVTYSVLINDQPHGMIEPQRGLRQGDPLSPFLFVLCTEGLPHLLSNAERR  465

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
              +  G+K     P++ HL FADD +F  +AN  Q+  +   L  + + +GQ IN QKSS+
Sbjct  466   QSISGMKFGVRGPSIHHLLFADDCLFSCKANEEQSNVLMNILGRYGAATGQVINPQKSSI  525

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F K+        +   LGI +     K+LGLP      K   F  + E++  R+SG  +
Sbjct  526   MFGKSVRKENNIRVKHILGIEAEGGEAKYLGLPECFNGSKVKLFSYLKEKMGRRISGWHA  585

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             RTLS AG  VM+++V SA+P  +M    IP  V  S+   +  F W + E K K H + W
Sbjct  586   RTLSQAGKEVMIKAVASALPVSAMSVFKIPKTVTTSLSSALANFWWSAVEHKRKIHWISW  645

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G K L+  N A LAK AWRL    +CL + + K KY F+ + +   Q 
Sbjct  646   EKMCLPKDLGGMGFKDLESFNKALLAKQAWRLINLESCLMSQVLKGKY-FEGTCFVKAQL  704

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLD-----RPLFEEA---SAP  220
              +  S AW+ +L+   +   G+K  V NG   + W D WL D     RP   +    +  
Sbjct  705   GKRPSYAWRSVLEGKDLLVQGLKVAVGNGSLLKVWTDPWLEDDNGICRPPLRKQRFFNVE  764

Query  219   IAPSSLNNLVANYWISNEGWDWDMLDRVLPEH--ILNKLSTFVLQEDTLLGDRLVWYKEP  46
             +  S L N     W   +     + +  +P    IL K    + + D+      VW    
Sbjct  765   LQVSELINYHTRRWSRRK-----LSELFVPRDMMILEKNQPVISEHDS-----WVWRHTK  814

Query  45    NGLFSVSSAYELAL  4
             +GL+SV S YELA 
Sbjct  815   SGLYSVKSGYELAF  828


 Score =   192 bits (489),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 123/434 (28%), Positives = 211/434 (49%), Gaps = 37/434 (9%)
 Frame = -1

Query  2579  ELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLL  2400
             +L++L   G+ +TW  GL + S+   RLDR   N     +FP A  + L   GSDH P+L
Sbjct  6     KLVELQSHGNGFTW-SGLRSNSWVHTRLDRCFGNTAWFKKFPCANQSFLDKRGSDHRPVL  64

Query  2399  ISITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSVWSRDSF  2220
             I +      +    F+F+         +A V++ W   LD ++  +++   L    R S 
Sbjct  65    IHLIDSQHSY-KGWFRFDRRLLEVDGVKANVENAW--CLDGTSGNASLSNRLKA-CRRSL  120

Query  2219  GNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWI  2040
               + +++  + A+ +                               EEL W+Q+S+++W+
Sbjct  121   SGLKKQQELVKAQRD-------------------------------EELYWWQKSKDKWL  149

Query  2039  KSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNR  1860
               GD+N+RF+  +    R ++ + KL++  G  +  +    K   D++  LF +      
Sbjct  150   ARGDKNSRFFHTSVRASRARNSLDKLLNPQGVEVYSEADKGKVAVDFYTNLFRSSNPAPF  209

Query  1859  TNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGT  1680
             + +     P +       +  P +  +I+ A+F + P KA GPDG +  FF   W TV  
Sbjct  210   SEWFQDLQPRVSTLMNGELTRPVSAAEIRDAVFSINPSKAPGPDGMSALFFQSFWTTVEA  269

Query  1679  SLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRL  1500
              +   V RFF  G+LP   N T L LIPK   P+ ++  RPI LC+V+YK+I+K+M+ RL
Sbjct  270   QVVREVQRFFHFGVLPKEWNYTHLCLIPKTPEPKTVSDLRPISLCSVIYKVISKIMVSRL  329

Query  1499  KDMVRKLVGPHQSSFVHGRQITDN-TLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLS  1323
             +  +  L+ P QS+FV  R ++DN T+A++ + +           M +K D+ KAYDR+ 
Sbjct  330   RPWMPGLISPTQSAFVAERLMSDNITIAHEMVHSLGVVDTPASEQMVVKTDMSKAYDRVE  389

Query  1322  WCFIEDTLRDIGFN  1281
             W ++   L  +GF+
Sbjct  390   WGYLRSVLLALGFD  403



>emb|CCA66140.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score =   234 bits (597),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 168/605 (28%), Positives = 295/605 (49%), Gaps = 25/605 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFD--EWIRVEAVG  2895
             WN +G  S + R +L+  +  H+P+ + + E K+       + S    D  EWI   + G
Sbjct  6     WNVRGLGSRAKRSSLRKHITKHEPTFVFIQETKMEEMPEKIMRSIWKSDNVEWIISPSQG  65

Query  2894  YSGGI---WLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
              SGGI   W     +    I+  H   I   +  +     L++V   CL  ++R  ++ +
Sbjct  66    NSGGILSIWNTSFFAKKSSIIKRHWIAIKGSLVSHNFDCILINVYNSCL-ASIRAEVWTE  124

Query  2723  LS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSY  2544
             +  ++       L +GDFN V   SE       S S  T F D++   +L+++  +   +
Sbjct  125   IRDFWKECALPSLIIGDFNEVLNSSE-RRSLIASQSEMTKFRDFVQNLQLLEIPSSSGGF  183

Query  2543  TWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCS  2364
             TW RG ++ S     LDR   N E  + FP  K++ L    SDH PLL+      + +  
Sbjct  184   TWFRG-NSKSL----LDRLFINPEWLILFPGLKLSLLMRGLSDHCPLLVH--NEDKNWGP  236

Query  2363  SRFKFNMAWTTHYSFQACVQSVWRSDLDLST--NKSAMVEALSVWSRDSFGNIPQ---KK  2199
               F+F   W +  +    V+ VW++   +S      A+ + L VW+++ +GNI     K 
Sbjct  237   KPFRFQNCWLSDPNCLKIVKEVWQASSGVSAVGKLKAVRKRLKVWNQEEYGNIDNRISKM  296

Query  2198  RRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNT  2019
               L+ + + +  S    +  D +  +++ + EL + + + E+ W Q +R  W+K GDRNT
Sbjct  297   ENLIQQYDEI--SNQRILTEDELEEKQKAQVELWKWMKRREVYWAQNARISWLKEGDRNT  354

Query  2018  RFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
             RF+    + KR ++ +   ++  G    D  ++ +    +F  +F  E + NR  F    
Sbjct  355   RFFHTIASNKRRKNSII-CIEVKGKESGDPQIIKREAVSHFKKIFA-ENNYNRPTFKGLS  412

Query  1838  FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
             F  + ++  + +  PF+ ++I  A+      KA GPDGF   F    W TV + +++ V 
Sbjct  413   FRQITDDQASDLTQPFSNKEIDEAVSSCAADKAPGPDGFNFRFIKSAWETVKSDIYAMVR  472

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
             +F +   LP GCN   ++LI K+ NP+    +RPI +   +YK+I K++  RL+ ++  L
Sbjct  473   KFHDSSTLPQGCNIAYITLIQKIDNPKNFNDYRPISMVGCIYKIIAKLLARRLQGVINSL  532

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             +GP Q S++ GR I D  L   E+++    K+  +    LK+D  KAYD +SW F+E  L
Sbjct  533   IGPLQFSYIEGRSILDGALIASELID--HCKRKSIEAALLKLDFHKAYDSISWSFLEWVL  590

Query  1298  RDIGF  1284
             +++ F
Sbjct  591   KEMNF  595


 Score =   164 bits (416),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 141/442 (32%), Positives = 214/442 (48%), Gaps = 34/442 (8%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + IM CV++  +  L NG        ++GLRQGDP+S  LFVL AE L+ ++  +   
Sbjct  599   WCKWIMNCVSTAAVSILVNGSPCAPFKLQRGLRQGDPLSSFLFVLIAESLNQIIMKATSQ  658

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
               WKGV+V +    ++HL +ADD + F +AN      +KK L LF   SG +IN  KSSL
Sbjct  659   NLWKGVEVGQGEIIVTHLQYADDTLIFCDANIESLKNVKKALILFQLASGLQINFHKSSL  718

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarlsg*s  739
                 NT+ G  +  A  L          +LG+P I G+  +    D I+ +I  RL+   
Sbjct  719   -IGLNTSSGWIKVAAEALLCKIGEIPFTYLGVP-IGGQCSRIQLWDPIIAKISRRLATWK  776

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
              + LS+ G   +++S L ++P Y M    +P  V++ I  L R FLW   +GKN   LV 
Sbjct  777   CKMLSIGGRLTLIKSSLISLPVYFMSIYPMPQDVVNKIIGLARQFLWAGSDGKNAMPLVA  836

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W ++   K+ GG+GI ++KH N A L K  WRL  + + LW  + +AKY +  ++  S  
Sbjct  837   WSVLQLPKSLGGMGIGNIKHKNQALLFKWIWRLFDEPSQLWCKIIRAKYKYPNTLTISDI  896

Query  378   PKRNSSNAWKGILQALHIFRN---------GIKWHVRNGRATRFWLDSWL-------LDR  247
                N+   W+ I  +    RN         G++ +V+NG  + FW D W+       L  
Sbjct  897   KIPNAGGPWRSICASY--LRNQDVKDMAIKGVRKNVKNGHDSLFWHDVWIGEATLKSLFP  954

Query  246   PLFEEASAPIAPSSLNNLVANYWI-SNEGWDWDMLDRVL--PEHILNKLSTFVLQEDTLL  76
              LF  A +P      N  VA+Y       W W    R +  P+ ++ K     L +   +
Sbjct  955   RLFTIAMSP------NGSVASYGFWDGLAWVWSFSWRRMLRPQDLIEKTHLDSLLQQAHV  1008

Query  75    G----DRLVWYKEPNGLFSVSS  22
                  D+L+W    +G FS  S
Sbjct  1009  AYEKKDQLIWAYSSSGKFSTKS  1030



>ref|XP_009353199.1| PREDICTED: uncharacterized protein LOC103944460 [Pyrus x bretschneideri]
Length=1429

 Score =   201 bits (512),  Expect(2) = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/550 (28%), Positives = 261/550 (47%), Gaps = 52/550 (9%)
 Frame = -1

Query  2933  LGFDEWIRVEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLD  2754
             LG+     V  +G SGG+ L+   ++ + I+++    I   +       W    VYG   
Sbjct  13    LGYLHGFDVSPIGISGGLSLWWEDNLEVNIIFSSKHIIDAVMRIKGQMQW---SVYGT-S  68

Query  2753  MALRRHLFADLS*YFFNPQGT-WLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEE  2577
               + ++LF D     F P    W+  GDFN      E S       +R     +++   +
Sbjct  69    YRVEKNLFWDWMVNHFTPTDIPWICGGDFNEFLWDYEKSGGVEVLYNRPRFLEEFLSSSQ  128

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             L+DLGF G  +TW RGL    +   RLDR ++N +    +P+++V H  ++ SDH P+++
Sbjct  129   LMDLGFNGPIFTW-RGLRKGDWVEERLDRVMANEKWQQLWPNSQVMHETVLASDHCPIVL  187

Query  2396  SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVW-RSDLDLSTNK--SAMVEA---LSVW  2235
             S T+  Q+     F+F   W +    +  V+  W R       N+   ++ E    LS W
Sbjct  188   SSTSDGQK-GRKMFRFEAFWVSEEECKKLVEMCWDRRHHGSPVNRWVRSLNECRYRLSRW  246

Query  2234  SRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRS  2055
             +R  F     +   LL++L+ +Q     G   D +R   R   EL     QEE  W QRS
Sbjct  247   NRTKFMGRGSRIHDLLSQLDSLQ--RDWGPNYDEIREISRQIDELR---LQEESYWCQRS  301

Query  2054  REEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTE  1875
             R +W++ GD NT+F+  +T  +R ++++ KL D +G+ + +   +   V ++F  +F++ 
Sbjct  302   RVKWLREGDANTQFFHSSTLQRRRRNKIVKLRDENGNWVENPTQVRHLVDNHFSSVFSSA  361

Query  1874  VDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTW  1695
              D N  +      P +  E   ++ AP T ++IK A  +M   KA GPDGF   F+   W
Sbjct  362   EDRNWGSLLDCINPSVSTEMNEALTAPVTEKEIKEAAGNMGGLKAPGPDGFQGIFYQTYW  421

Query  1694  PTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKV  1515
               V   + +                                  FRPI LCN  YK+++K+
Sbjct  422   EIVKEDVSAL---------------------------------FRPISLCNYSYKILSKI  448

Query  1514  MMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGW-MALKVDLEKA  1338
             +  RLK ++ K++ P Q++FV GRQI D      E+ +  + +K +  + M +K+D++KA
Sbjct  449   LANRLKVLLPKIISPSQNAFVAGRQIQDCIGIAHEMFHYLKGRKTKNRFEMGIKLDMQKA  508

Query  1337  YDRLSWCFIE  1308
             YDR+ W F++
Sbjct  509   YDRVEWDFLD  518


 Score =   197 bits (500),  Expect(2) = 8e-101, Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 192/400 (48%), Gaps = 41/400 (10%)
 Frame = -3

Query  1200  ISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLV  1021
              +P +GLRQGDP+SP LF+L  E LS ++  +V  G  +GVK+    P +SHLFF DD +
Sbjct  524   FAPSRGLRQGDPLSPYLFILVGEVLSKLLQGAVDQGRLEGVKIGGSGPVISHLFFTDDTL  583

Query  1020  FFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLD  841
              F  A+      +K  LD FC  SGQK+NL+KSS+FF  N        +   LG+  V +
Sbjct  584   LFLRADVKNCRNLKHLLDKFCVASGQKVNLEKSSVFFGANVPKVNADQMGNALGMAVVSN  643

Query  840   MGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMK  661
              G +LG+P+I GR KK     +  R+  +L G    TLS A   V++++V+ AIP Y M 
Sbjct  644   PGTYLGVPAIWGRSKKRGLAYVKGRVMEKLQGWKQSTLSRADKEVLIKAVIQAIPAYPMC  703

Query  660   STLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFL  481
                 P+ +   ++ L+ GF WG +EG  K H V   ++   K  GGLG ++    N A L
Sbjct  704   IFKFPAAICQELDVLVAGFWWGCKEGAQKIHWVSKEVLGLPKDLGGLGFRNFMEFNDALL  763

Query  480   AKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWH  301
             AK  WRL  + + LW  + KA+Y    S+W +   K+    +W                 
Sbjct  764   AKQCWRLITEPDSLWARVIKAQYFPHCSIWDA---KKGGRASWDR---------------  805

Query  300   VRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLVANYWISNEGWDWDMLDRVLPEHI  121
                      WL S  L  P+     A      ++ L+ +    +E W+   L   +    
Sbjct  806   ---------WLPSLPLGHPVLVGQVAVTPSLRVSALICS---ESERWNLSFLQPFISREA  853

Query  120   LNKLSTFVLQEDTLLG-----DRLVWYKEPNGLFSVSSAY  16
             L  +      E+T LG     DRL+W    NG +SV S Y
Sbjct  854   LKAI------EETPLGDLSRNDRLIWALSKNGTYSVKSGY  887



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score =   214 bits (544),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 135/420 (32%), Positives = 206/420 (49%), Gaps = 68/420 (16%)
 Frame = -3

Query  1263  IMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSGNWK  1084
             I+ CV  P +  LWNG+ T   +P +GLRQGDP+SP LFV+C ERL H+++ SV S  WK
Sbjct  525   ILQCVVGPSMTVLWNGEKTIPFTPSRGLRQGDPLSPYLFVMCLERLCHLIEISVNSKEWK  584

Query  1083  GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLFFSK  904
              + ++R  P +SH+ FADDL+ F EA + Q   ++K ++ FC  SGQK            
Sbjct  585   PISLSRGGPKLSHICFADDLILFAEAYAAQIRIIRKVMESFCVASGQK------------  632

Query  903   NTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssrtls  724
                                 D+GK+LG+P +H R+KK++F  ++ER+ +RLSG   R LS
Sbjct  633   --------------------DLGKYLGMPILHKRIKKETFRQVIERVNSRLSGWKGRFLS  672

Query  723   lag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWGIVT  544
              A    + ++VLS+IP ++M +  +P   ++ ++++ + FLWGS   K K HLV W    
Sbjct  673   FAERLTLTKAVLSSIPVHAMSTISLPKHTLNKLDQISKSFLWGSTLAKRKQHLVAW----  728

Query  543   NSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDF-DPSVWSSWQPKRN  367
                                             + +W  +F++KY   DP   S    K +
Sbjct  729   ------------------------------SRSSMWARVFRSKYRVGDPHDKSWLVVKSH  758

Query  366   SSNAWKGILQAL-HIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNLV  190
              S+ W+ +   L  +   G+ W + +GR  RFWLD WL ++PL +           N   
Sbjct  759   WSSTWRSVSIGLREVVMPGLSWIIGDGREIRFWLDKWLANKPLIDMLVGEPPVGYENVRA  818

Query  189   ANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYEL  10
                W +  GW   ++ R L +    +L   V+   T   DRL W    +G FSV SAY +
Sbjct  819   CEAWRNGMGWSDSLILRYLTDCAKLQLRAVVIDNVTGASDRLSWGGSLDGRFSVQSAYAV  878


 Score =   184 bits (466),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 0/176 (0%)
 Frame = -1

Query  1808  SVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPP  1629
             ++N PF   +++ ++  M   KA GPDGF P F+   W  VGTS+  FV  FFE G+LP 
Sbjct  343   ALNRPFLATEVEFSIRCMGKYKAPGPDGFQPIFYQHCWDMVGTSVTRFVLDFFETGVLPR  402

Query  1628  GCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVH  1449
               ND ++ LI KV  PE + QFRPI LCNV++K+ITK+M++RLK ++ KL+GP Q+SF+ 
Sbjct  403   ELNDALVVLIAKVVKPENMAQFRPISLCNVLFKIITKMMVLRLKTVMPKLIGPAQASFIP  462

Query  1448  GRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
              R  TDN +  QE +++ R K GR GWM LK+DLEKAYDR+ W F+EDTL+  G +
Sbjct  463   VRLSTDNIVIVQEAVHSMRRKNGRKGWMLLKLDLEKAYDRVRWDFLEDTLKVAGLS  518


 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 116/237 (49%), Gaps = 5/237 (2%)
 Frame = -1

Query  2774  VVYGCLDMALRRHLFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFND  2595
             VVY    +  R  L+  LS      +   +  GDFN++    E +            F +
Sbjct  85    VVYAAPTVGRRSGLWEVLSQSIHGVEEPVIMGGDFNTIVRLDERTGGNGRLSPDSLSFGE  144

Query  2594  WIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSD  2415
             WI    LID+GF G+ Y W RG    +F    LDR L   +  L++ +A V+HLP + SD
Sbjct  145   WINANSLIDMGFKGNRYNWRRGRVAETFIAKLLDRILCCPQARLKWQEAVVSHLPFMASD  204

Query  2414  HSPLLISITTCPQQFCSSR---FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEAL  2244
             H+PL + +  CP+   + +   F+F  AW +H  F+  V + W  +L        +   L
Sbjct  205   HAPLYLQL--CPEVKGNPQRRPFRFEAAWLSHRGFKELVSTSWNGELVTPEALQRLTTIL  262

Query  2243  SVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEEL  2073
               W+R+ FG+I ++K  L+  ++ +Q  L +    DL+  E +L KEL+  L QEE+
Sbjct  263   QKWNREVFGDINRRKDTLIHDIKVLQDQLDLNQTDDLLSEEDKLMKELDVVLEQEEV  319



>ref|XP_010513219.1| PREDICTED: uncharacterized protein LOC104789182 [Camelina sativa]
Length=1754

 Score =   275 bits (703),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/601 (31%), Positives = 294/601 (49%), Gaps = 25/601 (4%)
 Frame = -1

Query  3047  SPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYSGGIWLFC  2868
             +P+ RR L+     H P ++ L E K  R+    +   LG+ +   VE VG SGG+ L  
Sbjct  453   TPTVRR-LREIRGQHFPEVLFLCETKKRRSYLENVVGHLGYFDLHTVEPVGLSGGLALMW  511

Query  2867  SVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YFFNPQGTW  2688
               S+ + +L +  + I  +V       + ++ +YG    + R  L+  LS         W
Sbjct  512   KESVTVRVLESDRRMIDARVTWQ-GKEFFLTCIYGEPAQSERGELWERLSRMGEYRGQAW  570

Query  2687  LAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFK  2508
             +  GDFN +   SE         S C +F   +    L ++   G  ++W  G       
Sbjct  571   MMTGDFNELVDPSEKIGGPERKDSSCEEFRQMLNACGLWEVKHLGYQFSWY-GNRNDELV  629

Query  2507  GARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNMAWTTH  2328
               RLDR ++N     +FP A+ ++L  I SDHSPL+  +     +  +S FK++  W   
Sbjct  630   QCRLDRTVANQAWMEQFPRAQASYLQKICSDHSPLVTCLLGERWKHWAS-FKYDKRWIQR  688

Query  2327  YSFQACVQSVWRSDLDLSTNKSAMVEAL-------SVWSRDSFGNIPQKKRRLLARLEGV  2169
               F+  V   WR+  +    +S+M+E +       S+W R         K     R++ +
Sbjct  689   EGFKDTVAQFWRTSGN--EQESSMMEKIAGCRKEISIWKRHV-------KPSSALRIQEL  739

Query  2168  Q*SLSMGIRSDlvrlerrlrkeleETL--YQEELIWFQRSREEWIKSGDRNTRFYQVATT  1995
             Q  +    R      +     + E  +  YQEE  W Q+SR  W+  GDRNT+F+  AT 
Sbjct  740   QFKIDAATRQIPFNPQLLKDLKKELNIEYYQEEQFWSQKSRMTWVHEGDRNTKFFHAATK  799

Query  1994  VKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEED  1815
              +R Q+R+ KLVD +G     D  L K    YF  LFT+E DV       G   P +++ 
Sbjct  800   TRRAQNRIQKLVDEEGFEWYTDVDLGKVAEAYFRKLFTSE-DVGYQLQEMGEVRPTVDDQ  858

Query  1814  W-ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGI  1638
               A + AP + E++K A+F++ P K  GPDG     + + W  +G  L   V +FF  G 
Sbjct  859   MNAGLLAPVSKEEVKKAVFNINPTKCPGPDGMIGYLYQQFWEVMGYQLTGMVQKFFSTGH  918

Query  1637  LPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSS  1458
             +    N T + LIPK Q  +R+  FRPI LCNV+YK+I KV+  R+K ++  ++   Q++
Sbjct  919   MEEDMNRTNICLIPKKQRADRLVDFRPISLCNVIYKIIGKVVANRMKKVLPHIISETQAA  978

Query  1457  FVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFN  1281
             F+ GR I+DN L   E+++A  T  K    ++A+K D+ KAYDR+ W F+E T+  +GF+
Sbjct  979   FIQGRLISDNILVAHEMIHALNTNAKCSEEYIAVKTDISKAYDRVEWGFLEKTMLTLGFD  1038

Query  1280  H  1278
              
Sbjct  1039  E  1039


 Score =   121 bits (304),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 110/432 (25%), Positives = 179/432 (41%), Gaps = 70/432 (16%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  +M CV + R   L N      I P +GLRQGDPISP LFV+C E L   +D +  S
Sbjct  1041  WINLVMECVKTVRYQVLINRSPQGEIKPSRGLRQGDPISPYLFVICTEML---IDDAA-S  1096

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             GN KG  + RI                   N  +  ++ + ++ +   SG ++N QKSS+
Sbjct  1097  GN-KGTDL-RIE------------------NDEELDQLIRIVEEYSLASGPRVNYQKSSI  1136

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +      ++ I   LGI      G +LGLP     LK +S   + +R+K ++S   +
Sbjct  1137  TFGRGIPEERRRAIKQRLGIEQEGGQGMYLGLPESFKGLKIESLHYLRDRLKTKVSSWQT  1196

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  VM++S+  A+P ++M    +P  +   +  ++  F W ++      H   W
Sbjct  1197  NYLSPRGKEVMLKSIALALPSFTMSCFKLPVTICHQLAGIMAEFWWKNKRESRGMHWKAW  1256

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               ++  K  GGLG K ++  NLA L K  WR+                            
Sbjct  1257  EHLSKPKEEGGLGFKDIEAFNLAMLGKQLWRM----------------------------  1288

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEA-SAPIAPSSLN  199
                       I +   +   GI+  + +G     W   WLL +P         I P S  
Sbjct  1289  ----------ITRPTSLLGQGIRAVIGSGETVDIWSHQWLLAKPAKGVTLMNQIPPESRR  1338

Query  198   NLVANYWISN------EGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGL  37
                   ++ +        W+ ++L  + PE+I N+   ++        D+  W    +G 
Sbjct  1339  FASRLRYVKDLLEANGREWNRELLSTLFPENI-NEQILWIRVGGQGTMDKFAWDYSKDGH  1397

Query  36    FSVSSAYELALE  1
             ++V S Y + +E
Sbjct  1398  YTVKSGYRVIME  1409


 Score = 55.1 bits (131),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/187 (24%), Positives = 80/187 (43%), Gaps = 8/187 (4%)
 Frame = -3

Query  4386  SLILRVLGRSV-SYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPW  4210
             S+I+R L  +      L++ L  +W +E   +   +  D     FET +D   V Y GPW
Sbjct  44    SIIVRCLNPAAHKVGGLVKALPPIWGMEDRVKGRGVGEDRVQFIFETESDLYHVLYRGPW  103

Query  4209  MVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDL  4030
              V    +   +W+P   P    + ++L W+R   +PI       ++ I   +G+   ++L
Sbjct  104   FVNGWIVTLDQWKPTPGPEF--LQRILFWIRIKGIPIHLLKRQTVESIVGPMGKVEAVEL  161

Query  4029  TTGMASKGKFARVCVQLDITKPL----LSNFVINGTEWPK-EYEGIHQICFKCSIYGHRM  3865
                 +   ++ RV V ++  +PL    ++ F        +  YE + ++CF C    H  
Sbjct  162   HAKNSQSLEYVRVRVWVNAEEPLQFLKVAKFKTGEIAHVELVYEKLLKVCFLCKRLTHDQ  221

Query  3864  ETCGLSV  3844
               C   V
Sbjct  222   SVCPFQV  228



>ref|XP_009146764.1| PREDICTED: uncharacterized protein LOC103870391 [Brassica rapa]
Length=985

 Score =   231 bits (590),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/421 (35%), Positives = 219/421 (52%), Gaps = 6/421 (1%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C+TS     L N  +   + P +G+RQGDPISP LF+LC E LS +   +   
Sbjct  233   WINWIMQCITSVSYSYLINDSVYGLVKPHRGIRQGDPISPYLFILCGEVLSGLCRKAELE  292

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ +GV+V R  P ++HL FADD + F  + S   L + + L  + S SGQK+N+ KS++
Sbjct  293   GSMRGVRVARGCPRVNHLLFADDTMIFCNSTSESCLALLRILRDYESVSGQKVNIAKSAI  352

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS  T    +Q     LGI     MGK+LGLP   GR KKD F +I++RI+ R +  S+
Sbjct  353   NFSSKTPPEVKQAAKDLLGIQKEGGMGKYLGLPEHFGRKKKDLFTSIVDRIRQRAANWST  412

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG   M+++VL+AIP Y+M   ++P  + + I+  +  F W     K     V W
Sbjct  413   RFLSRAGKLTMLKAVLTAIPTYAMSCFILPQSLCNRIQSSLTRFWWDKSPDKKNMCWVAW  472

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
             G +T  K  GGLG++ ++  N A LAK+AWR+    +CL   +   KY    S      P
Sbjct  473   GKLTRPKKAGGLGLRDIQRFNQALLAKVAWRILTSPHCLLARVLTGKYCHKKSFLDVQTP  532

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL-LDRPLFEEASAPIAPSSLN  199
                 S+ W+ IL    + +  +   + NG+ TR W D W+ L  PL  +   P+  + L+
Sbjct  533   AV-CSHGWRSILHGRDLLQEHLGRAIGNGQNTRLWKDPWISLQAPL--KPYGPVQEAGLD  589

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSA  19
               V++    +  W+ D +D+ LP+    K    +        D  VW    +G++S  S 
Sbjct  590   LRVSDLLTDDLQWNKDKIDKFLPD--FTKQIQCLKPSKEGAEDIYVWLPLESGVYSTKSG  647

Query  18    Y  16
             Y
Sbjct  648   Y  648


 Score =   164 bits (416),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 133/231 (58%), Gaps = 2/231 (1%)
 Frame = -1

Query  1964  LVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASV-NAPFT  1788
             + + DG  + ++  +   V  Y+  LFT       ++       P + ++W  +     +
Sbjct  1     MENKDGIPVYEEDQISALVCSYYDNLFTANQRGEISSTISQALKPCVTQEWNELLTRDPS  60

Query  1787  PEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTIL  1608
             P +IK ALF +   KA GPDGF+  FFH  W T+G S+ + +  FF  G+L P  N T +
Sbjct  61    PAEIKEALFAIHADKAPGPDGFSASFFHSNWETIGQSIITEIQEFFSTGVLSPTLNVTHV  120

Query  1607  SLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDN  1428
              LIPK    +R+ ++RPI LCNV YK+I+K++ +RLK ++  ++  +QS+F+ GR ITDN
Sbjct  121   RLIPKTLGAKRVDEYRPIALCNVYYKVISKLLSLRLKPILCSIISENQSAFIPGRAITDN  180

Query  1427  TLAYQEILNAFRTKKGRVGW-MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              L   E+L   +T + +    MA+K+D+ KAYDR+ W FI   ++ +GF+ 
Sbjct  181   VLITHEVLQFLKTSQAKKQCAMAVKMDMSKAYDRVEWEFIAQVMKRLGFHE  231



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score =   213 bits (542),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 221/427 (52%), Gaps = 10/427 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ IM CVT+     L NGQ   +ISP++GLRQGDPISP LFVLC E L+HM++ +   
Sbjct  440   WVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPISPFLFVLCTEGLTHMMNQASLR  499

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ KG++     P + HLFFADD +F  +A   Q    +     +   +GQ INL KSSL
Sbjct  500   GDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQDIFLKYGEATGQVINLSKSSL  559

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F KNT    +  I + LGI S    G +LGLP      K +    I +++K R+SG  S
Sbjct  560   TFGKNTCPSLKAQIKSKLGIYSEGGAGSYLGLPECFSGSKVEMLAYIQDKMKGRMSGWYS  619

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  V+++SV  A+P Y+M    +P    ++++  +  F W + E K+K H + W
Sbjct  620   RFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWWQASEDKSKIHWLSW  679

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GG+G K ++  N A LAK AWR+  + + L T   +++Y  + S  S+   
Sbjct  680   DKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSLLTRFLQSRYFSNGSFLSATLG  739

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R  S AW+ IL    +   G++  V NG +   W   WL+D    E    P+  + L +
Sbjct  740   SR-PSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWLIDG---ERLRIPLMKNILVD  795

Query  195   L---VANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             L   V++  I N   WD   L+ +  +  +  +    ++      D L W    +G +SV
Sbjct  796   LNLKVSDLMIPNSDLWDHQKLENLFYDQDIEII--LKIKPAVSSPDFLCWNHTRSGEYSV  853

Query  27    SSAYELA  7
              S Y  A
Sbjct  854   KSGYWFA  860


 Score =   182 bits (463),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 131/440 (30%), Positives = 214/440 (49%), Gaps = 15/440 (3%)
 Frame = -1

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             +I+L  +G+ +TW  G     +  +RLDRA  N +   +FP +    L   GSDH P+LI
Sbjct  7     MIELPSSGNPFTW-SGKRGNLWIQSRLDRAFGNQKWFDQFPASNQAFLDKRGSDHRPVLI  65

Query  2396  SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSA-----MVEALSVWS  2232
              + +    +  S FKF+  +         +   W S    S    A       +ALS W 
Sbjct  66    KLISSQDSYRGS-FKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRWK  124

Query  2231  RDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSR  2052
             + +  N   +  ++   LE  Q S++             L K L +   +EE  W Q+ +
Sbjct  125   KKNVSNSKLRITKIQVELEQEQSSMNPSF-----PRMENLTKSLVKAYKEEENFWKQKCK  179

Query  2051  EEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV  1872
             ++WI  GD NT+ +  A  V R+++ + KL D++G     +    +   +YF  LF +  
Sbjct  180   DDWILHGDGNTKIFHAAVQVARSKNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKSTN  239

Query  1871  DVNRTNFCYGCFPPLLEEDWASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTW  1695
              V+ ++      P  +  +   +     T E++K A+F + P  A G DG +  FF K W
Sbjct  240   SVDYSDLLRD-LPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298

Query  1694  PTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKV  1515
               VG  L   V  FFE G +P   N T + LIPK      ++  RPI LC V+YK I+K+
Sbjct  299   EIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTISKI  358

Query  1514  MMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKA  1338
             +  RL+  + ++V P QS+FV  R I+DN +   E +++ RT +     +MA K D+ KA
Sbjct  359   LASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDMSKA  418

Query  1337  YDRLSWCFIEDTLRDIGFNH  1278
             +DR+ W +++  L  +GF++
Sbjct  419   FDRVEWHYLQALLLSLGFDN  438



>ref|XP_008366684.1| PREDICTED: uncharacterized protein LOC103430323 [Malus domestica]
Length=1380

 Score =   254 bits (649),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/606 (28%), Positives = 279/606 (46%), Gaps = 17/606 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKIS-RAQANEICSSLGFDEWIRVEAVGY  2892
             WN +G  +   R  L      H P L+C+ EP ++  +  +   +SLG            
Sbjct  6     WNIRGIGNSDTRTELSNVCHSHHPDLVCISEPMVTFDSIPSAYWNSLGLSLLTINNRDDL  65

Query  2891  SGGIW-LFCSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLFADLS  2718
                IW L+ +   +  ++ +  Q + FQ  ++ V +    ++VY      LRR L+ DL 
Sbjct  66    LPNIWVLYSTXYCSPTVISSSGQQVTFQTSFEGVLSQ--FTIVYAATTSTLRRVLWCDLL  123

Query  2717  *YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTW  2538
                 N    W+A+GDFN++    E       + + C DF     + +   +  TG+ YTW
Sbjct  124   NIRSNTTMPWMAIGDFNAILGAHEQMGGHLPARTSCEDFRSTTELCDFTHMDTTGAFYTW  183

Query  2537  IRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR  2358
               G +   +   RLDR+L +      +P      LP + SDH+ L+ S +          
Sbjct  184   TXGXNVRGYMERRLDRSLCDTRWLHSWPYTSCCALPRVVSDHNCLVFSASAIXLG-GXRP  242

Query  2357  FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALS-------VWSRDSFGNIPQKK  2199
             F+F   WT H  F   V   W+S +        M+E L        VW+ + FG++ +  
Sbjct  243   FRFQSMWTLHSEFSGLVAKCWQSTVVYGCPMFVMLEKLKALKRCLRVWNSNVFGDVHRNV  302

Query  2198  RRLLARLEGVQ*SLSM-GIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRN  2022
                  RL  +Q S+S  G   +    E   +  + + L  +E  W  R+R +W+  GDRN
Sbjct  303   TFAKERLXNIQNSISSDGNSQEKFNEEVVAKTAVLDALQMQEAFWHDRARVKWLTEGDRN  362

Query  2021  TRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYG  1842
             T F+      + + SR+  L+D    L     ++  HV +++  L+ +           G
Sbjct  363   TAFFHAYARGRHSSSRIVNLLDGXNXLSSHTAIV-DHVVNFYQSLYNSSFTPTGIXDVCG  421

Query  1841  CFPPLL-EEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSF  1665
               PP++ EE+  S++   + ++I++ +F M P  A GPDGF   F+   W  VG  + +F
Sbjct  422   VIPPMVSEEENLSLSCLPSADEIRSVVFSMDPSSAXGPDGFPGSFYQSCWDIVGXXVIAF  481

Query  1664  VHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVR  1485
             V  FF+ G L P  N   + LIPKV+    I Q+RPI L N ++K+I K++  RL  +  
Sbjct  482   VQDFFKRGWLYPNANCNFVVLIPKVEGVATIAQYRPIALANFLFKIIXKILXDRLXPIAT  541

Query  1484  KLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIED  1305
             +++ P Q+ F+ GR+I+D      E  N F  KK   G   +KVD+ KA+D L+W F+  
Sbjct  542   RIISPQQTXFLKGRRISDCIGLVSEXFN-FMDKKAFGGNXGIKVDIAKAFDTLNWDFLLX  600

Query  1304  TLRDIG  1287
              L   G
Sbjct  601   VLSSFG  606


 Score =   140 bits (354),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 124/438 (28%), Positives = 189/438 (43%), Gaps = 43/438 (10%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R ++    S  L  L NG    + S  +G+RQGD  SPL F L  E LS  +     +
Sbjct  614   WVRVLL---QSAXLSILVNGTPHGFFSCSRGVRQGDXXSPLXFCLAXEALSRXLSXLFST  670

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                  +   R     +H+ +ADDL  F   N      ++  LD +   SGQ +N  KS+ 
Sbjct  671   XXITXISAPRGCCPPTHVLYADDLFIFCRGNVRSLCSLRNFLDKYGCASGQLVNASKST-  729

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
             F+   ++   + +++  LG    +    +LG+P   G+ K+  F  ++++ KARLSG   
Sbjct  730   FYLXXSSXHXKAHVSRHLGFXLGVVPFTYLGVPIFRGKPKRIHFQALVDKAKARLSGWKG  789

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             +  S+AG   +VQSV  ++  +S     +PS  +  +    R F+W       K   V W
Sbjct  790   KLXSMAGRFQLVQSVYQSLXLHSFSVYQLPSCXLKHLSACARNFIWSGDLSSRKLVTVDW  849

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
              +V   K  GGLG++ L  +NL  L    W   Q  + LW +    ++           P
Sbjct  850   SMVXGPKKEGGLGLRDLAXLNLTALLSFGWDALQSYS-LWGSFAXQRFPL--------SP  900

Query  375   KRNS-----SNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRP-----LFEEAS  226
              RN      S+ W G+ +AL I  N  +W + +GR   FW D W LD P     LF   S
Sbjct  901   YRNQNIYLRSSXWHGLKRALPILNNNSRWIIGDGRXVSFWFDKW-LDEPIISXSLFSVIS  959

Query  225   APIAPSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQ------EDTLLGDRL  64
               + P   + + A  W              LP++  N   + V Q            D+L
Sbjct  960   PKVLPRVSDVIEAQSW-------------SLPDYFSNLFPSIVQQILRLPLPLNXXXDKL  1006

Query  63    VWYKEPNGLFSVSSAYEL  10
             +W   P G FS SS Y L
Sbjct  1007  IWEPSPTGKFSFSSGYHL  1024



>gb|ABA91837.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1301

 Score =   244 bits (622),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 176/612 (29%), Positives = 284/612 (46%), Gaps = 20/612 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  +    R L    +   P ++ L   K+   +       LG    +  +  G S
Sbjct  430   WNCRGLGNGPTVRGLLNLQKEDDPDILFLSNTKMDTNKLQCFRWKLGMPNLVVKDCQGKS  489

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ +F    IN+ +      F+   V ++    W  + VYG      +   +  L    
Sbjct  490   GGLAVFWKKEINLRLRTVSRLFMDVDVMEDDGFWWRFTGVYGEPRSDKKDLTWKALRTLN  549

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
                   WL +GDFN V    E       + S    F   +    L +LGFTG  +TW   
Sbjct  550   ATKGELWLCVGDFNEVLFSWEKERGHAKAQSCMDRFRQTLDCCSLSNLGFTGDPFTWRNN  609

Query  2528  -LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR--  2358
                   +   RLDRA+++ +   RFP  +V       SDH P++++ T+    +   R  
Sbjct  610   WCVRDGYIRERLDRAVADSDWCCRFPSFRVRKGDPRHSDHHPVIVT-TSNEVIWNGGRSK  668

Query  2357  --FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSV-------WSRDSFGNIPQ  2205
               F+F   W         V++ W+  L +      +++A+         WS++  G++ +
Sbjct  669   PGFRFEAGWAREEHCAPIVENAWK--LSVGPRGGKVMDAIREVAANLWDWSKNFLGDLEK  726

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
             + ++    LE  + S    I S     E  L+  L++   Q EL W QR+ + W++ GDR
Sbjct  727   RIKKAKQALEAHRRS---PISSSTASREAVLKYRLDKLEEQRELYWRQRANQHWLEKGDR  783

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             NT+F+    + ++ ++++ KL   DG +I D+   L  + +++  LFT  V +N      
Sbjct  784   NTKFFHECASERKKRNKIKKLRRDDGEVITDEAGSLSLISEFYKQLFTAGVPLNLDELLQ  843

Query  1844  GCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKAS-GPDGFTPGFFHKTWPTVGTSLFS  1668
                  +       +    T E+IK AL  +   KA  G DG    F+ + W  VG  +  
Sbjct  844   NVPKRVTSTMNDELMKGVTTEEIKKALDSIGDLKAPPGSDGMPALFYKQFWECVGDDIVH  903

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V  F   G +P   NDT++ LIPKV NPERI   RPI LCNVVYK+ +KV+  RLK ++
Sbjct  904   EVKDFLGGGEMPDSWNDTVVVLIPKVPNPERIKDLRPISLCNVVYKIASKVLANRLKPLL  963

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFI  1311
              +++ P Q +FV  R ITDN L   E+ +  +TK +G VG+ A+K  + KAYDR+ W F+
Sbjct  964   SEIISPIQIAFVPQRMITDNILLAYELTHFLKTKRRGSVGFAAVKQGMSKAYDRVEWGFL  1023

Query  1310  EDTLRDIGFNHT  1275
             E  +  +GF+  
Sbjct  1024  EKMMLKLGFDRN  1035


 Score =   151 bits (381),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 139/252 (55%), Gaps = 0/252 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CVTS       NG+ T+ I+P  GLRQGDPISP LF +CAE  S +++++   
Sbjct  1036  WVFIVMKCVTSVTYRIKVNGEFTEQINPTGGLRQGDPISPYLFFICAEGFSTLLNAAEER  1095

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+   +KV + AP+++HL FADD +   + +   A  ++  L L+  CSG+ IN +KSS+
Sbjct  1096  GDLSVIKVCQNAPSINHLLFADDSLLLLKTDEGSAACLQNVLSLYERCSGETINKEKSSI  1155

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+N     +Q     L I       K+LGLP   GR K  +   + ER+  ++ G   
Sbjct  1156  MFSRNIKEVNKQIFMGALDIGVGAWNEKYLGLPVYMGRSKAKTSSYLKERVWKKIQGWKE  1215

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V  AIP ++M    +  G+ D I  LI  F W  +E +NK H + W
Sbjct  1216  KLLSRAGKDVLIKAVAQAIPAFAMSCFNLTKGLCDEITSLICRFFWAQQERENKMHWIAW  1275

Query  555   GIVTNSKANGGL  520
               + + K  GG 
Sbjct  1276  EHLCSRKEKGGF  1287



>ref|XP_007207773.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
 gb|EMJ08972.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
Length=1060

 Score =   223 bits (569),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 224/425 (53%), Gaps = 8/425 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M C+++     LW G     I P++GLRQG P+SP LF++C E  S ++  + R 
Sbjct  305   WVSKVMDCISTTTFSVLWKGTPVGHIMPQRGLRQGCPLSPYLFLICTEGFSCLLRGAERR  364

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+  GV+V R AP+++HL FADD + F +A +   + ++     +   +GQ+IN  KS+L
Sbjct  365   GDLVGVQVARGAPSVTHLLFADDSILFMKATNKDCMALETLFQTYEEVTGQQINYSKSAL  424

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
               S N        I   L +P V     +LGLP+I G+ +K  F ++ +++   +SG   
Sbjct  425   SLSPNATRADFDMIEGVLNVPVVRCHENYLGLPTIAGKGRKQLFQHLKDKLWKHISGWKE  484

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  +++++VL AIP YSM    IP G+   +  ++  F W   + K   H VKW
Sbjct  485   KLLSRAGKEILIKAVLQAIPTYSMSCFRIPKGLCKELNGIMARFWWAKAKDKRGIHWVKW  544

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSV-WSSWQ  379
              ++  SK  GGLG + L+  N A LAK  WR+ +    L   +F+A+Y   PSV +   +
Sbjct  545   ELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRARY--HPSVPFLEAE  602

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
                N S  W+ +     +   G++W V +G + + + D WL     F+  S P  P  L+
Sbjct  603   VGTNPSFIWRSLQWGKELLNKGLRWRVGSGVSIQVYTDKWLPAPSCFKIMSPPQLP--LS  660

Query  198   NLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLG-DRLVWYKEPNGLFSVSS  22
               V + + S+  W+  +L  +  +  ++ +    L   +L G D L+W+ E NG++SV S
Sbjct  661   TRVCDLFTSSGQWNVPLLKDIFWDQEVDAILQIPLA--SLAGHDCLIWHYERNGMYSVKS  718

Query  21    AYELA  7
              Y LA
Sbjct  719   GYRLA  723


 Score =   171 bits (434),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 145/273 (53%), Gaps = 1/273 (0%)
 Frame = -1

Query  2090  LYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKH  1911
             L ++E++W QRSR  W+K GD+NT F+    + +  ++RV  + DA+     ++  +   
Sbjct  32    LEKQEIMWRQRSRVAWLKEGDKNTHFFHGRASSRSKRNRVCGIFDANQAWQTEEQRIGDL  91

Query  1910  VYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGP  1731
               DYF  LF++              P +     A +   FT E+++  LF M P KA G 
Sbjct  92    FCDYFKTLFSSSGGQQMERILNEVRPVITSAMNAQLLQAFTREELEHTLFQMFPTKAPGH  151

Query  1730  DGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIG  1551
             DG    FF K W  VG  +     +           N T+++LIPKV+ P  +++FRPI 
Sbjct  152   DGMPALFFQKYWHIVGDKVAKKCLQILNGEGSVREFNHTLIALIPKVKMPTIVSEFRPIS  211

Query  1550  LCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFR-TKKGRV  1374
             LC  VYK+I K +  RLK ++  ++   QS+FV  R I DN +A  EI+N  +  KKGR 
Sbjct  212   LCTTVYKMIAKTIANRLKTVLSHVITETQSAFVPNRMILDNVMAAFEIMNTIKGVKKGRD  271

Query  1373  GWMALKVDLEKAYDRLSWCFIEDTLRDIGFNHT  1275
               MALK+D+ KAYDR+ W F+   +  +GF+ T
Sbjct  272   VQMALKLDMAKAYDRVEWVFLRAMMLKLGFSAT  304



>gb|AAX95129.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|AAX95232.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1324

 Score =   243 bits (621),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/612 (29%), Positives = 284/612 (46%), Gaps = 20/612 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNC+G  +    R L    +   P ++ L   K+   +       LG    +  +  G S
Sbjct  453   WNCRGLGNGPTVRGLLNLQKEDDPDILFLSNTKMDTNKLQCFRWKLGMPNLVVKDCQGKS  512

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADLS*YF  2709
             GG+ +F    IN+ +      F+   V ++    W  + VYG      +   +  L    
Sbjct  513   GGLAVFWKKEINLRLRTVSRLFMDVDVMEDDGFWWRFTGVYGEPRSDKKDLTWKALRTLN  572

Query  2708  FNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRG  2529
                   WL +GDFN V    E       + S    F   +    L +LGFTG  +TW   
Sbjct  573   ATKGELWLCVGDFNEVLFSWEKERGHAKAQSCMDRFRQTLDCCSLSNLGFTGDPFTWRNN  632

Query  2528  -LDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSR--  2358
                   +   RLDRA+++ +   RFP  +V       SDH P++++ T+    +   R  
Sbjct  633   WCVRDGYIRERLDRAVADSDWCCRFPSFRVRKGDPRHSDHHPVIVT-TSNEVIWNGGRSK  691

Query  2357  --FKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSAMVEALSV-------WSRDSFGNIPQ  2205
               F+F   W         V++ W+  L +      +++A+         WS++  G++ +
Sbjct  692   PGFRFEAGWAREEHCAPIVENAWK--LSVGPRGGKVMDAIREVAANLWDWSKNFLGDLEK  749

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
             + ++    LE  + S    I S     E  L+  L++   Q EL W QR+ + W++ GDR
Sbjct  750   RIKKAKQALEAHRRS---PISSSTASREAVLKYRLDKLEEQRELYWRQRANQHWLEKGDR  806

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             NT+F+    + ++ ++++ KL   DG +I D+   L  + +++  LFT  V +N      
Sbjct  807   NTKFFHECASERKKRNKIKKLRRDDGEVITDEAGSLSLISEFYKQLFTAGVPLNLDELLQ  866

Query  1844  GCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKAS-GPDGFTPGFFHKTWPTVGTSLFS  1668
                  +       +    T E+IK AL  +   KA  G DG    F+ + W  VG  +  
Sbjct  867   NVPKRVTSTMNDELMKGVTTEEIKKALDSIGDLKAPPGSDGMPALFYKQFWECVGDDIVH  926

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              V  F   G +P   NDT++ LIPKV NPERI   RPI LCNVVYK+ +KV+  RLK ++
Sbjct  927   EVKDFLGGGEMPDSWNDTVVVLIPKVPNPERIKDLRPISLCNVVYKIASKVLANRLKPLL  986

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTK-KGRVGWMALKVDLEKAYDRLSWCFI  1311
              +++ P Q +FV  R ITDN L   E+ +  +TK +G VG+ A+K  + KAYDR+ W F+
Sbjct  987   SEIISPIQIAFVPQRMITDNILLAYELTHFLKTKRRGSVGFAAVKQGMSKAYDRVEWGFL  1046

Query  1310  EDTLRDIGFNHT  1275
             E  +  +GF+  
Sbjct  1047  EKMMLKLGFDRN  1058


 Score =   151 bits (381),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 139/252 (55%), Gaps = 0/252 (0%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+  +M CVTS       NG+ T+ I+P  GLRQGDPISP LF +CAE  S +++++   
Sbjct  1059  WVFIVMKCVTSVTYRIKVNGEFTEQINPTGGLRQGDPISPYLFFICAEGFSTLLNAAEER  1118

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+   +KV + AP+++HL FADD +   + +   A  ++  L L+  CSG+ IN +KSS+
Sbjct  1119  GDLSVIKVCQNAPSINHLLFADDSLLLLKTDEGSAACLQNVLSLYERCSGETINKEKSSI  1178

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              FS+N     +Q     L I       K+LGLP   GR K  +   + ER+  ++ G   
Sbjct  1179  MFSRNIKEVNKQIFMGALDIGVGAWNEKYLGLPVYMGRSKAKTSSYLKERVWKKIQGWKE  1238

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS AG  V++++V  AIP ++M    +  G+ D I  LI  F W  +E +NK H + W
Sbjct  1239  KLLSRAGKDVLIKAVAQAIPAFAMSCFNLTKGLCDEITSLICRFFWAQQERENKMHWIAW  1298

Query  555   GIVTNSKANGGL  520
               + + K  GG 
Sbjct  1299  EHLCSRKEKGGF  1310



>gb|EEC83406.1| hypothetical protein OsI_28856 [Oryza sativa Indica Group]
Length=1143

 Score =   218 bits (555),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 134/450 (30%), Positives = 224/450 (50%), Gaps = 34/450 (8%)
 Frame = -1

Query  2603  FNDWIFMEELIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMI  2424
             F D +   EL DLGFT   +T+    D                     + + KV HL   
Sbjct  109   FRDVLHDCELHDLGFTDLPHTYDNKRDG--------------------WHNVKVVHLVSP  148

Query  2423  GSDHSPLLISITTCPQQFCSSRF-KFNMAWTTHYSFQACVQSVW-----RSDL-DLSTNK  2265
              SDH+P+L+ ++         +F  + + W         +   W     +++L D++   
Sbjct  149   CSDHAPILLKLSVEENVQVRQKFLHYEIVWEREPEAAQVIDEAWSNAGEKTNLGDINKAL  208

Query  2264  SAMVEALSVWSRDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY  2085
               ++ A   WS     N+ ++  +   +L  +  S +  I+       R+    + E LY
Sbjct  209   GKVMSAFKSWSNTKVKNVCRELEKARKKLVELMQSNADRIQ------IRQATDHMNEMLY  262

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
             +EE++W QRSR  W+K GDRNTRF+      +  +++++KL DA+G +     +L     
Sbjct  263   REEMLWLQRSRVNWLKEGDRNTRFFHSRAVWRAKKNKITKLRDAEGTVQKSTTVLEDMAT  322

Query  1904  DYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
             +YF  ++T + +++           + EE  A + A F  E+I  ALF + P K+  PDG
Sbjct  323   EYFEKVYTADPNLDPECVTRLIQEKVTEEMNAKLCADFNDEEIAQALFQIGPLKSPDPDG  382

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
             F   F+ + W T+   +   V  FF+ G++P G N+T + LIPK++ P  +  +RPI LC
Sbjct  383   FPARFYQRNWGTLKADIVGAVRDFFQTGLMPEGVNNTAIVLIPKIEQPLELKDYRPISLC  442

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKK-GRVGW  1368
             NVVYK+++K ++ RL+ ++ ++V   QS+F+ GR ITDN L   E  +A +  K      
Sbjct  443   NVVYKVVSKCLVNRLRPVLDEVVSEEQSAFIQGRMITDNALLAFECFHAIQKNKVANKAA  502

Query  1367  MALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
                K+DL KAYDR+ W F+E  ++ +GF H
Sbjct  503   CVYKLDLSKAYDRVDWRFLEMAMKRLGFAH  532


 Score =   176 bits (447),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 113/341 (33%), Positives = 169/341 (50%), Gaps = 34/341 (10%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R I+ CVTS R    +NG L    +P +GLRQGDP+S  LF+  A+ LS ++   V  
Sbjct  534   WVRWIISCVTSVRYSIKFNGTLLHSFAPSRGLRQGDPLSLFLFLFVADGLSLLLKGKVEQ  593

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                  +K  R AP++SHL FADD + F +A   QA  + + L  +               
Sbjct  594   NILTPIKFCRNAPSISHLMFADDTLLFFKAEVRQAEVVNEVLQCYAR-------------  640

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                     GT+++              K+LG P+  GR+ K  F  +  +I  R+     
Sbjct  641   --------GTEKDKFE----------DKYLGFPTPEGRMHKGRFQTLQAKICKRVIQWGE  682

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
               LS  G  +++++V+ AIP Y M    +P  + + + RL R F WG+  G+ K H   W
Sbjct  683   NYLSSGGKEILIKAVIQAIPVYVMGIFKLPDSICEDLTRLTRNFWWGADNGQRKTHWRAW  742

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPS-VWSSWQ  379
               +T  K N GLG K ++  N A LA+ AWRL +  + L   + KAKY    S + +++ 
Sbjct  743   ESLTKPKRNCGLGFKDIRLFNQALLARQAWRLIEFSDSLCAKVLKAKYFPHGSLIDTTFG  802

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL  256
             P  N+S AW+G+   + I + GI W + NG A R W D WL
Sbjct  803   P--NASPAWQGMEHGIDILKKGIIWRIGNGNAVRIWRDPWL  841



>ref|XP_010058631.1| PREDICTED: uncharacterized protein LOC104446483 [Eucalyptus grandis]
Length=1755

 Score =   235 bits (599),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/608 (29%), Positives = 291/608 (48%), Gaps = 45/608 (7%)
 Frame = -1

Query  3026  LKYFLRLHKPSLICLFEPKISRAQANEICSSL--GFDEWIRVEAVGYSGGIWL-------  2874
             ++ F+R ++   I + E KIS A  + + +SL  G+  W    +  + G IW+       
Sbjct  567   IRNFVRTNRLCCIGILETKISPAAYSPVSASLIPGW-SWSTNYSHSFRGRIWVGWNPLAA  625

Query  2873  -FCSVSINIEILYTHPQ-FIAFQVYDNVSAPWLMSVVYGCLDMALRRHLFADL-S*YFFN  2703
              FC+ +   + ++   + FI+   ++       +SVVY      LRR L+ DL S     
Sbjct  626   SFCTSACTAQAIHGRLECFISGVAFN-------LSVVYAEHSFVLRRPLWNDLISTSSIC  678

Query  2702  PQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLD  2523
                 W+  GDFN++   S+ +++  + +    DF D +    L DL F G+ +TW     
Sbjct  679   LDIPWIVAGDFNAIRYASDRADRSNYWIPAFEDFGDCLIQAGLDDLHFVGNRFTW-SASS  737

Query  2522  TPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFKFNM  2343
              P+ +  ++DR L+N   +  F  ++   L    SDHSP+++ I   P       FKF  
Sbjct  738   GPNRRQRKIDRVLTNAAWNTAFSYSEANFLAPGVSDHSPMVVRILPTP--ISRKPFKFFN  795

Query  2342  AWTTHYSFQACVQSVWRSDLD------LSTNKSAMVEALSVWSRDSFGNIPQKKRRLLAR  2181
              W +H +F   V+ +W   +       L +   ++   L + +++++ +I  +       
Sbjct  796   YWMSHPNFFELVRQIWELRMSGTPMFVLYSKLRSLKRRLKLLNKEAYSDISARTSEARRL  855

Query  2180  LEGVQ*SLSMGIRSDlvrlerrlrkeleETL-YQEELIWFQRSREEWIKSGDRNTRFYQV  2004
             L   Q ++ +   +  +    +    +   L  +EE  + Q+SR  W+K GD NT+F+  
Sbjct  856   LLEAQNAIQLDPHNQALADAEKNHLHIFSDLRLKEESFYRQKSRIRWLKEGDLNTKFFH-  914

Query  2003  ATTVKRNQSRVSKLVDADG-HLICDDGLLLKHVYDYFLGLFTTE-------VDVNRTNFC  1848
               +VKR   R   L  +DG ++I D+  + +   D+F  L +         V+  R N  
Sbjct  915   -HSVKRGHLRNRVLSISDGSNVITDEAEVQRLFVDHFQNLLSASTPSAIPSVEEIRANLA  973

Query  1847  YGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFS  1668
                   L +    +++ PFT E+IK+ LF +   KA GPDGF   FF ++W  VG S+  
Sbjct  974   ST----LDDNHIQAISQPFTDEEIKSTLFSLASGKAPGPDGFNVDFFKRSWDIVGPSVLL  1029

Query  1667  FVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMV  1488
              +  FF  G L    N TIL+LIPK  N   +  FRPI  CN VYK ITK++  RL  ++
Sbjct  1030  AIRDFFSTGQLLREINSTILTLIPKTPNASMVNDFRPIACCNTVYKCITKLLANRLASIL  1089

Query  1487  RKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIE  1308
               ++   QS+FV GR+I+DN +  QE+   F   +       +KVD  KAYD + W FIE
Sbjct  1090  PSIISVSQSAFVKGRRISDNIMLAQELFAHFH-HEPYFPKNIIKVDFSKAYDSVDWKFIE  1148

Query  1307  DTLRDIGF  1284
              +L+  GF
Sbjct  1149  LSLQAFGF  1156


 Score =   159 bits (402),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 131/446 (29%), Positives = 212/446 (48%), Gaps = 56/446 (13%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             +I  IM C+ +P+     NG L  +    +G+RQGDPISP +F L  E  + ++++    
Sbjct  1160  FIDRIMTCIRTPKFSIALNGDLHGFFPSGRGIRQGDPISPYIFTLVMEVFTGIINARTSK  1219

Query  1095  GNWK---GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQK  925
               ++     K T+    +SHLFFADD++ F EAN      +   ++ F + SG   NL K
Sbjct  1220  PGFRFFWRCKPTK----LSHLFFADDVLLFSEANMPSLSHLMDGVNTFAAWSGLIPNLNK  1275

Query  924   SSLFFSKNTNLGTQQNIAATLGIPSVLDMGK----HLGLPSIHGRLKKDSFDNILERIKa  757
             S +F S     G  +++ +T+   S  ++G     +LG+P I  RL K+   ++++ I  
Sbjct  1276  SEIFIS-----GGPESLKSTMVNASGFNLGSLPFWYLGVPIISSRLGKEDCVSLVDAIMK  1330

Query  756   rlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKN  577
             R+   ++R LS AG   +++SVL +I  Y     ++PS V++ IE++ R FLW      +
Sbjct  1331  RVQSWTNRFLSTAGRLQLIKSVLHSIQVYWSSVFILPSAVLNRIEQIFRQFLWRGPNLGS  1390

Query  576   KCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPS  397
                 V W  V   KA GGLGI+SL+  N+A + K  W L  D   LWT    + +  D +
Sbjct  1391  GGARVSWEQVCLPKAEGGLGIRSLRVSNIAAMTKHLWLLFSDKESLWTKWIHSIFLKDKN  1450

Query  396   VWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPI  217
              W + +P    S +WK +     + +    W++ NG +  FW D+W            P 
Sbjct  1451  FWIAPRPTV-CSWSWKKLFGLRDLIQRYFVWNIGNGLSASFWFDTW-----------HPR  1498

Query  216   APSSLNNLVANYWISNEGWDWDMLDRVLPEH-----------ILNKLSTFVLQEDTLL--  76
              P   NNL +         D D+ D  +P +           I + ++  +   D  L  
Sbjct  1499  GP--FNNLFS---------DRDIYDSRIPRNASVAKGIAALSIPSNIAAVIGTWDDPLPT  1547

Query  75    ----GDRLVWYKEPNGLFSVSSAYEL  10
                  DRLVW    +G FS +SA+ +
Sbjct  1548  LNNHADRLVWIGHSSGQFSTASAWSM  1573


 Score = 74.3 bits (181),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/251 (25%), Positives = 105/251 (42%), Gaps = 24/251 (10%)
 Frame = -3

Query  4422  EEKIRLRRP-WRRSLILRVLGRSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETL  4246
             EE +    P W   L+   +G+ + +      L+  W      E+IA    F+       
Sbjct  171   EEILESTHPKWEECLVGYYIGKRLPFQLTEDALKNAWGHHL-VEVIAADLGFYFFHIPDS  229

Query  4245  TDYDAVKYGGPWMVLDDYLVTQEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKI  4066
                  V  GGP  V    L+ Q+W P  + +    + +  W+R  ++P+  +    +  +
Sbjct  230   EFRRKVLDGGPITVAKIPLILQQWHPMLELKKLVHNTVPIWIRLRNIPVALWSAAGISFL  289

Query  4065  GKVIGRPVKIDLTTGMASKGKFARVCVQLDITK--PLLSNFVINGT--EWPKEYEGIHQI  3898
                IG+P+ +D  T   +   FARVC+++D +   P +  F++ G       +YE I  +
Sbjct  290   ASGIGKPLFVDNRTEQMAMVAFARVCIEIDTSNSFPEVIEFMMKGELRSVSVQYEWIPTL  349

Query  3897  CFKCSIYGHRMETCGLSVPIPAASVDGTAGTSSTTGIDIPLPKPKEKYGAWMLVTRRDRR  3718
             C  CS +GHR        P+P++S       S       P P+P E    W    R  R 
Sbjct  350   CPTCSSFGHR-------CPVPSSSGPSKVAPSVPKA---PAPRPNE----W----REVRG  391

Query  3717  NQNRATPHPGS  3685
              +N+ TP P +
Sbjct  392   KRNKHTPVPAN  402



>ref|XP_009126341.1| PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]
Length=1160

 Score =   214 bits (545),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 222/427 (52%), Gaps = 10/427 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ IM CVT+     L NGQ   +ISP++GLRQGDPISP LFVLC E L+HM++ +   
Sbjct  440   WVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPISPFLFVLCTEGLTHMMNQASLR  499

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G+ KG++     P + HLFFADD +F  +A   Q    +  L  +   +GQ INL KSSL
Sbjct  500   GDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQDILLKYGEATGQVINLSKSSL  559

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F KNT    +  I + LGI S    G +LGLP      K +    I +++K R+SG  S
Sbjct  560   TFGKNTCPSLKAQIKSKLGICSEGGAGSYLGLPECFSGSKVEMLAYIQDKMKGRMSGWYS  619

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS AG  V+++SV  A+P Y+M    +P    ++++  +  F W + E K+K H + W
Sbjct  620   RFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWWQASEDKSKIHWLSW  679

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +  SK  GG+G K ++  N A LAK AWR+  + + L T   +++Y  + S  S+   
Sbjct  680   DKLCISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSLLTRFLQSRYFSNGSFLSATLG  739

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
              R  S AW+ IL    +   G++  V NG +   W   WL+D    E    P+  + L +
Sbjct  740   SR-PSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWLIDG---ERLRIPLMKNILVD  795

Query  195   L---VANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSV  28
             L   V++  I N   WD   L+ +  +  +  +    ++      D L W    +G +SV
Sbjct  796   LNLKVSDLMIPNSDLWDHQKLENLFYDQDIEII--LKIKPAVSSPDFLCWNHTRSGEYSV  853

Query  27    SSAYELA  7
              S Y  A
Sbjct  854   KSGYWFA  860


 Score =   179 bits (455),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 131/440 (30%), Positives = 213/440 (48%), Gaps = 15/440 (3%)
 Frame = -1

Query  2576  LIDLGFTGSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLI  2397
             +I+L  +G+ +TW  G     +  +RLDRA  N +   +FP +    L   GSDH P+LI
Sbjct  7     MIELPSSGNPFTW-SGKRGNLWIQSRLDRAFGNQKWFDQFPASNQAFLDKRGSDHRPVLI  65

Query  2396  SITTCPQQFCSSRFKFNMAWTTHYSFQACVQSVWRSDLDLSTNKSA-----MVEALSVWS  2232
              + +    +  S FKF+  +         +   W S    S    A       +ALS W 
Sbjct  66    KLISSQDSYRGS-FKFDKRFFQKPLVFETINQAWNSSSPNSNINIASRIRFCRQALSRWK  124

Query  2231  RDSFGNIPQKKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSR  2052
             + +  N   +  ++   LE  Q S++             L K L +   +EE  W Q+ +
Sbjct  125   KKNVSNSKLRITKIQVELEQEQSSMNPSF-----PRMENLTKSLVKAYKEEENFWKQKCK  179

Query  2051  EEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEV  1872
             ++WI  G  NT+ +  A  V R+++ + KL D++G     +    +   +YF  LF +  
Sbjct  180   DDWILYGGGNTKNFHAAVQVARSRNEIVKLQDSNGIFQRSEASKGQVAINYFSDLFKSTN  239

Query  1871  DVNRTNFCYGCFPPLLEEDWASV-NAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTW  1695
              V+ ++      P  +  +   +     T E++K A+F + P  A G DG +  FF K W
Sbjct  240   SVDYSDLLRD-LPVRVSNNMNMILTRKITKEEVKEAVFSIKPDSAPGADGMSGFFFQKYW  298

Query  1694  PTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKV  1515
               VG  L   V  FFE G +P   N T + LIPK      ++  RPI LC V+YK I+K+
Sbjct  299   EIVGDQLTKEVLLFFETGDMPSDWNYTQICLIPKKTTASVMSDLRPISLCTVMYKTISKI  358

Query  1514  MMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKG-RVGWMALKVDLEKA  1338
             +  RL+  + ++V P QS+FV  R I+DN +   E +++ RT +     +MA K D+ KA
Sbjct  359   LASRLQCFLPEIVSPTQSAFVSDRLISDNIILAHEAVHSLRTHEVISKSYMAAKTDMSKA  418

Query  1337  YDRLSWCFIEDTLRDIGFNH  1278
             +DR+ W +I+  L  +GF++
Sbjct  419   FDRVEWHYIQALLLSLGFDN  438



>emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1379

 Score =   219 bits (559),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/605 (28%), Positives = 293/605 (48%), Gaps = 25/605 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFD---EWIRVEAV  2898
             WN +G  +   R  ++  ++ H P  + + E K+    + EI  ++      EW    +V
Sbjct  6     WNIRGLTARVKRSAIRKLIQKHTPDFVFVQETKM-EGISLEIVKTMWKSQDVEWTWYPSV  64

Query  2897  GYSGG-IWLFCSVSINIEILYTHPQFIAFQ-VYDNVSAPWLMSVVYGCLDMALRRHLFAD  2724
             G SGG I ++   + +++    +  +IA    +  ++   ++  VY    +  R  ++ +
Sbjct  65    GNSGGLISMWNKSAFSMKSSSVNQHWIAISGSFSRINFECILFNVYNPNTVGARASVWEE  124

Query  2723  L-S*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSS  2547
             + + +  NP  + L +GDFN  T + +      FS     +F +++ + EL+++  +   
Sbjct  125   IVTFHKTNPLPS-LLIGDFNE-TLEPDDRGSLLFSNIGTDNFKNFLQVMELLEVSPSNKG  182

Query  2546  YTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFC  2367
             +TW RG        + LDR L N E    FP  +++ L    SDH PLL +I T  Q + 
Sbjct  183   FTWFRGRSK-----SVLDRLLLNPEWINEFPSMRLSLLQRGLSDHCPLLTNIHT--QNWG  235

Query  2366  SSRFKFNMAWTTHYSFQACVQSVWRSDLDLST-NKSAMVEA-LSVWSRDSFGNIPQKKRR  2193
                F+F   W T       V   W    ++   +K   V+  L  W+RD FG+I    + 
Sbjct  236   PKPFRFQNCWLTDPHCLEIVNKTWLESTNMPMIDKLRRVKIRLKAWNRDEFGHIDTNIKI  295

Query  2192  LLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLY--QEELIWFQRSREEWIKSGDRNT  2019
             +   ++    ++S     D   +ERR   + +  ++  ++EL W Q SR  W+K GDRNT
Sbjct  296   MEDEIQKFD-TISNERELDEQEIERRKEAQSDLWMWMKRKELYWAQNSRILWLKHGDRNT  354

Query  2018  RFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGC  1839
             +F+ +  + K+ ++ ++  +  +G  I     + +    +F  +FT E    R       
Sbjct  355   KFFHMVASNKKRRNFIAS-IKVNGRRIEKPNQIKEEAVTFFKEIFTEEF-TERPTLEGLQ  412

Query  1838  FPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVH  1659
             F  L +    S+  PF+ E+I  A+      KA GPDGF   F    W T+   +++ V 
Sbjct  413   FNQLSQNQADSLIQPFSDEEIDYAVNSCASDKAPGPDGFNFKFIKNAWETIKEDVYTLVR  472

Query  1658  RFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKL  1479
              F+    LP G N T ++LIPK+ NPE    FRPI +   VYK+I K+M  R++ ++  L
Sbjct  473   EFWATSKLPKGSNSTFITLIPKIDNPENFKDFRPISMVGCVYKIIAKLMAKRIQRVMSSL  532

Query  1478  VGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTL  1299
             +GP QSS+V GRQI D  L   E+++  + KK     + LK+D  KAYD +SW F++ TL
Sbjct  533   IGPLQSSYVEGRQILDGALVASEVIDLCKRKKMEA--ILLKLDFHKAYDSVSWSFLQWTL  590

Query  1298  RDIGF  1284
               + F
Sbjct  591   AQMKF  595


 Score =   174 bits (441),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/440 (31%), Positives = 206/440 (47%), Gaps = 26/440 (6%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P W + +M CV S     L NG  +      +GLRQGDP+SP LFV+  E L+ ++  + 
Sbjct  597   PQWCKWVMACVASASASILINGSPSRPFKLHRGLRQGDPLSPFLFVIIGEALNQLIIKAT  656

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
             R   W+G++ +R  P +SHL +ADD + F + ++     +K  L LF   SG ++N  KS
Sbjct  657   RLNLWRGIETSRDGPMISHLQYADDTLVFSDTSTDSLKSIKSTLILFQLVSGLQVNFHKS  716

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSF-DNILERIKarlsg  745
             SL    N +     N A  L          +LGLP I G   +  F   ++E++  +L+ 
Sbjct  717   SL-IGLNISDARANNAANLLQCKVGSIPFTYLGLP-IGGNPSRIQFWKPVIEKLCEKLAM  774

Query  744   *ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHL  565
               S+ LS+ G   +++S L+++P Y M    IP GV++ I  + R FLW     K     
Sbjct  775   WKSKMLSIGGRLTLIKSSLASLPLYFMSLFPIPKGVVEKINMITRRFLWSGCAEKKTLPP  834

Query  564   VKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSS  385
             V W +V   K+ GGL I ++ H NLA L K  WR  Q+ N LW  + K+KY++   +  S
Sbjct  835   VSWKVVQLPKSRGGLNIGNVMHKNLAMLFKWIWRFFQEPNNLWCKVIKSKYNYAAPLTIS  894

Query  384   WQPKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRP------  244
                   S   W  I  A+        + + G++  + NG  T FWLD W+   P      
Sbjct  895   SLTIPKSGGPWSKICTAILNDQAAKSVMKIGLRKIIGNGGNTLFWLDPWISSHPLKILYP  954

Query  243   -LFEEASAPIAPSSLNNLVANY-WISNEGWDWDMLDRVLPEHILNKLSTFVLQEDT----  82
              LF  A  P A  + +     Y W+    W +     + P   + K +   L +      
Sbjct  955   RLFSIAIHPNASVAAHGFWEGYFWV----WSFSWRRNLRPRDKIEKANMDALLKSVCPSL  1010

Query  81    LLGDRLVWYKEPNGLFSVSS  22
             L  D+L W  + +G FS  S
Sbjct  1011  LCEDKLAWTHDKSGKFSTKS  1030



>emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1380

 Score =   221 bits (562),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/602 (27%), Positives = 284/602 (47%), Gaps = 20/602 (3%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDE--WIRVEAVG  2895
             WN +G  +   R  L+  + +H P  I + E K+       I S    +E  W    A G
Sbjct  7     WNIRGLGARIKRSALRKMISIHNPLFITIQETKLGEIDPKLIRSIWNSNEVAWTFSPADG  66

Query  2894  YSGGIW-LFCSVSINIEILYTHPQFIAFQ-VYDNVSAPWLMSVVYGCLDMALRRHLFADL  2721
              +GGI  L+    I +   +    +IA +    +++    +  +Y    +  R  ++ ++
Sbjct  67    NAGGILTLWSKTFITVSSSHVSKNWIAVRGTISHLNWDCSLISIYNPCSVEERAVVWGEI  126

Query  2720  S*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYT  2541
               ++   +   L +GDFN  T  S        S S   DF  ++   +L ++  T   +T
Sbjct  127   LEFWTTSKLPCLIIGDFNE-TLASNDRGSLAISQSGSNDFRQFVQSLQLTEIP-TTERFT  184

Query  2540  WIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSS  2361
             W RG        ++LDR   N E    +P  K++ L    SDH PLL++ +   + +   
Sbjct  185   WFRGNSK-----SKLDRCFVNPEWLTHYPTLKLSLLNRGLSDHCPLLLNSSV--RNWGPK  237

Query  2360  RFKFNMAWTTHYSFQACVQSVWR--SDLDLSTNKSAMVEALSVWSRDSFGNIPQKKRRLL  2187
              FKF   W +       V+  W+  S + L      + + L  W+   FGNI    ++L 
Sbjct  238   PFKFQNCWLSDPRCMRLVKDTWQKSSPMGLVQKLKTVKKDLKDWNEKVFGNIEANIKQLE  297

Query  2186  ARLEGV-Q*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDRNTRFY  2010
               +  + + S    + S  +  +++ + +L   +  +E  W Q+SR +W+K GDRNT+F+
Sbjct  298   HEINQLDKISNERDLDSFELEKKKKAQVDLWSWMKTKESYWSQQSRIKWLKQGDRNTKFF  357

Query  2009  QVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPP  1830
              V  +++++++ ++  ++ +G  I +   +      YF   F  E   NR       F  
Sbjct  358   HVVASIRKHRNSITS-IEVNGDKISEPEKIKLEAMKYFRKAFKEE-SYNRPLLEGLDFKH  415

Query  1829  LLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFF  1650
             L E   A + APF+ E+I  A+      KA GPDGF   F  K W  +   ++  V  F+
Sbjct  416   LTEAQSADLIAPFSHEEIDKAVASCSSDKAPGPDGFNFTFIKKAWDVIKEEIYETVQEFW  475

Query  1649  EDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGP  1470
                 LP GCN   ++LIPK  +P+    FRPI +   VYK++ K++ +RL+ ++  LVGP
Sbjct  476   NSSRLPKGCNMAFIALIPKTDSPKGFQDFRPISMVGCVYKIVAKLLTMRLQKVMNSLVGP  535

Query  1469  HQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDI  1290
              QSSF+ GR I D+ L   E++++   K+ +     LK+D  KA+D +SW F++ TL  +
Sbjct  536   AQSSFIEGRHILDSALIAGELIDS--CKRWKTSSSLLKIDFHKAFDSVSWAFLDWTLEKM  593

Query  1289  GF  1284
              F
Sbjct  594   NF  595


 Score =   172 bits (435),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 177/353 (50%), Gaps = 10/353 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W + I  CVT+     L NG  +     +KGLRQGDP+SP LFVL  E L+ +++ ++  
Sbjct  599   WRQWIQTCVTTASSSVLINGSPSPPFKLQKGLRQGDPLSPFLFVLVVETLNLLINKAISL  658

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G W+GV+V++    +SHL +ADD + F          +KK L LF   SG +IN  KSSL
Sbjct  659   GFWEGVEVSKGGLKLSHLQYADDTLIFCAPRIDYLQNIKKVLILFHLASGLQINFHKSSL  718

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
                  +N   +   A+ L     L    +LGLP      +  +++ ILERI  +L     
Sbjct  719   IGINVSNQWMKDATASLLCKGGSLPFN-YLGLPIGGDSSRIKTWEPILERISKKLDSWKG  777

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             R LS+ G   +++S +S++P Y M    IP  VI+ I +L R FLW    GK     V W
Sbjct  778   RLLSIGGRVTLIKSSISSLPLYFMSLFPIPRSVIEQINKLQRHFLWSGDRGKRALSQVAW  837

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDF-DPSVWSSWQ  379
              ++   KA GGLGI ++ H NLA L K  W+   D + LW  L   KY +  P       
Sbjct  838   KVIELPKAFGGLGIGNIFHRNLALLFKWIWKFFNDTSPLWRELIWHKYKYKQPLTIRDLD  897

Query  378   PKRNSSNAWKGILQAL-------HIFRNGIKWHVRNGRATRFWLDSWLLDRPL  241
             P R     W+ I+ A+        I  NG++  V +G  T FW D WL  +PL
Sbjct  898   PPRQ-GGPWQKIVSAIIKSPTAKAIAINGVRSLVGDGALTLFWHDQWLGPKPL  949



>ref|XP_010674616.1| PREDICTED: uncharacterized protein LOC104890737 [Beta vulgaris 
subsp. vulgaris]
Length=1149

 Score =   216 bits (549),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 226/420 (54%), Gaps = 3/420 (1%)
 Frame = -3

Query  1272  IRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRSG  1093
             +  IM  +T+P +  LWNG++T    P +G+RQGDP+SP +FVLC ERLS ++   +   
Sbjct  392   VATIMSVITTPSISVLWNGEITQEFKPSRGIRQGDPLSPYIFVLCMERLSLLIQQKLDLK  451

Query  1092  NWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSLF  913
              WK + +T+    +SHLF+ADD+  FG+A+      M + L+ F   SG  +N  KS++ 
Sbjct  452   LWKPLMITK-DIGLSHLFYADDVFSFGQASCANLDLMMEVLNDFGMQSGLFLNRLKSTII  510

Query  912   FSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ssr  733
               K  +   +Q++++  G+    D GK+LG+     +LK+  + ++L++   R+ G  ++
Sbjct  511   VPKKLDHNVRQSLSSFSGLAISSDFGKYLGVHISPNKLKRSDYLDLLDKTTDRIRGWQAK  570

Query  732   tlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKWG  553
              L++AG   +++SVL++ P Y M++ ++P GV++ I++ ++ FLW     ++      W 
Sbjct  571   LLNMAGRCTLIKSVLNSYPLYVMQTNILPIGVLNDIQKNVKRFLWNKVGQRHYISRTSWD  630

Query  552   IVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQPK  373
              V      GGLGI+ L+H NL F+AKL W      + LW  + K+K +   S +    P 
Sbjct  631   QVCKPMIEGGLGIRDLRHWNLCFMAKLGWTFLTQPSKLWVRILKSK-NCKGSNFMDVIPN  689

Query  372   RNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNNL  193
              + S  W+ IL+   + R G+  +V NG     W   W+   PL++     I P  + + 
Sbjct  690   VSHSTIWRDILKGRDMLRQGLILNVGNGEDISLWFHHWVGKEPLYKLKDLVI-PEDIAHW  748

Query  192   VANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSSAYE  13
                + I N+ W+   +  +LP+ I++++    L +   + D L W    +G FS+ +AY 
Sbjct  749   RVAHIIHNKEWNITHIANLLPQEIVDEICAIPLTKFDEVKDGLRWLFTTDGEFSIKTAYR  808


 Score =   176 bits (446),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 103/307 (34%), Positives = 167/307 (54%), Gaps = 2/307 (1%)
 Frame = -1

Query  2204  KKRRLLARLEGVQ*SLSMGIRSDlvrlerrlrkeleETLYQEELIWFQRSREEWIKSGDR  2025
             +K R+ ARL G+Q  L+    S L+ LE++L  +L      E+ IW Q++  +W ++GD 
Sbjct  81    QKNRIYARLNGIQKVLAFRNSSFLLNLEKQLLNDLNHIHLVEKRIWAQKAGFDWRRNGDL  140

Query  2024  NTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCY  1845
             NTR++ V   +K+++ +   L + +G    DD +L       F  + +T    +  N  +
Sbjct  141   NTRYFHVIAKIKKSKGKFHALQNLNGDWEFDDRVLKDLARLTFRNILSTNHSFSLLNCSF  200

Query  1844  GCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSF  1665
                  L  E+  S+ +P + E++   +  M P K+ GPD   P F+ + W  +  S+  F
Sbjct  201   NPLMTLSTEEALSLASPVSIEELNIVVKSMYPIKSPGPDDIQPIFYQQCWADLHHSITDF  260

Query  1664  VHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVR  1485
             V++   +G +P   N + + LIPK   P  I  FRPIGLCN + K++TK + +RL+  + 
Sbjct  261   VNKCLTNGFIPENINKSFICLIPKKTAPITINDFRPIGLCNTILKILTKTIAMRLRPFMV  320

Query  1484  KLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIED  1305
              L  P Q+SFV GR I +N +  +E+ +  +  K +   MALK+DL KA+D L W FI +
Sbjct  321   NLTSPLQTSFVKGRTIDENIIILKEVAHLVKRIKRKKSIMALKIDLTKAFDCLEWSFIRE  380

Query  1304  TLRDIGF  1284
             TL  IGF
Sbjct  381   TL--IGF  385


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 41/78 (53%), Gaps = 0/78 (0%)
 Frame = -1

Query  2687  LAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIRGLDTPSFK  2508
             + +GD N V  Q+E S  + F  S+C   N ++    L+DLGF G+ +TW    +  +  
Sbjct  1     MVVGDLNEVRSQTEKSGGKAFRSSQCNALNSFMDAACLVDLGFDGNPFTWTNAREGAALI  60

Query  2507  GARLDRALSNVE*SLRFP  2454
               RLDRAL+N      FP
Sbjct  61    RERLDRALANHTWISEFP  78



>gb|AAM01179.2|AC113336_31 Putative retroelement [Oryza sativa Japonica Group]
Length=1888

 Score =   226 bits (576),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 223/434 (51%), Gaps = 25/434 (6%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W++ IM C+T  R     NG L +  +P +GLRQGDP+SP LF+  A+ LS +++  V  
Sbjct  1173  WVKWIMACITLVRYAVKLNGTLLNTFAPSRGLRQGDPLSPFLFLFVADGLSFLLEEKVDQ  1232

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
             G    + + R AP + HL FADD   F +A + QA+ MK+ L+ + SC+GQ IN  K S+
Sbjct  1233  GAMNPIHICRHAPAVLHLLFADDTPLFFKAANDQAVVMKEVLETYASCTGQLINPSKCSI  1292

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F +++    Q  I  TL I +  +  K+LG P+  GR+ K  F ++ ER+  R+     
Sbjct  1293  MFGQSSPTAVQNQIKQTLQISNSFE-DKYLGFPTPEGRMTKGKFQSLQERLWKRIMLWGE  1351

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  +++++VL A+P Y M    +P  V + + +L+R F WG+ +G  + H   W
Sbjct  1352  KFLSTGGKEILIKAVLQAMPVYVMGLFKLPESVCEELTKLVRNFWWGAEKGMRRTHWKSW  1411

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               +   K  GG+G +  +  N A LA+ AWRL    + L   + KA Y  + S+  +   
Sbjct  1412  DCLIAQKLKGGMGFRDFRLFNQALLARQAWRLLDRPDSLCARILKAIYYPNGSLIDT-SF  1470

Query  375   KRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLNN  196
               N+S  W+ I   L + + GI W + NG++ R W D W+         S    P S   
Sbjct  1471  GGNASPGWRAIEYGLELLKKGIIWRIGNGKSVRLWRDPWI-------PRSYSRRPISAKR  1523

Query  195   LVANYWISN-----EGWDWDMLDR-VLP---EHILN-KLSTFVLQEDTLLGDRLVWYKEP  46
                  W+S+       WD D + +  LP   E ILN +LS+       L  D + W+ + 
Sbjct  1524  NCRLRWVSDLIDQSGSWDTDKISQHFLPMDAEAILNIRLSS------RLEDDFIAWHPDK  1577

Query  45    NGLFSVSSAYELAL  4
              G FSV SAY LA+
Sbjct  1578  LGRFSVRSAYHLAV  1591


 Score =   166 bits (419),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 134/239 (56%), Gaps = 1/239 (0%)
 Frame = -1

Query  1991  KRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLGLFTTEVDVNRTNFCYGCFPPLLEEDW  1812
             +  +++++KL D+D  +      L +   +YF  LFT +  ++ +       P + +   
Sbjct  933   RAKKNKITKLRDSDDTVHSTTKELERMATEYFQRLFTADPSIDHSRVTSLMKPKVTDAMN  992

Query  1811  ASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILP  1632
               +   F+ E+I  ALF + P KA GPDGF   F+ + W  +   +   V  FF  G +P
Sbjct  993   EELCKTFSEEEIANALFQIGPLKAPGPDGFPGRFYQRNWAILKDDIVRAVQEFFSLGTMP  1052

Query  1631  PGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFV  1452
              G N+T + LIPK + P+ +  FRPI LCNVVYK+++K ++ RL+ ++  LV  +QS+FV
Sbjct  1053  SGVNETAIVLIPKTEQPQELKDFRPISLCNVVYKIVSKCLVNRLRPILDDLVSQNQSAFV  1112

Query  1451  HGRQITDNTL-AYQEILNAFRTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIGFNH  1278
              GR ITDN L A++   +  R K     + A K+DL KAYDR+ W F+E  +  +GF H
Sbjct  1113  PGRLITDNALIAFEYFHHIQRNKNPENAYSAYKLDLSKAYDRVDWEFLEQAMVKLGFAH  1171


 Score = 67.8 bits (164),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 8/178 (4%)
 Frame = -3

Query  4362  RSVSYSFLLQRLQGMWKLEAGFELIALTHDFFIAKFETLTDYDAVKYGGPWMVLDDYLVT  4183
             R+ +   L   ++  W+L A     +L  + FI  F    DYD V  GGPW+   D L+ 
Sbjct  255   RTPNQVALFDDMRRAWRLRADISYKSLRDNMFIITFSAEGDYDFVIKGGPWIHRGDALLV  314

Query  4182  QEWRPNFDPRINKMDKLLAWLRFPSLPIEYFDDDFLKKIGKVIGRPVKIDLTTGMASKGK  4003
               +     P    +D +  W+R   LP+        +  G  +G+  ++D+     +K  
Sbjct  315   ASFDGITCPSNVPLDVVPIWVRIYDLPLVLMTKVRGEMFGSKLGKVREVDVGDDGRNKHD  374

Query  4002  FARVCVQLDITKPLLSNFVINGTEWPKE--------YEGIHQICFKCSIYGHRMETCG  3853
             F  + V L + +PL S   I  T   KE        YE +   CF C   GH    C 
Sbjct  375   FFHIRVDLPVKRPLKSQIAIRMTVQGKEVLRRFDLHYERVPHFCFICGFIGHSDRDCN  432


 Score = 65.5 bits (158),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 75/145 (52%), Gaps = 1/145 (1%)
 Frame = -1

Query  2909  VEAVGYSGGIWLFCSVSINIEILYTHPQFIAFQVYDNVSAP-WLMSVVYGCLDMALRRHL  2733
             V + G SGG+ LF   SI++EI+  + ++I   V  +V+AP W  + VYG   +  R  +
Sbjct  714   VNSDGMSGGLALFWHESIHVEIISMNERYIDAYVRLSVNAPVWHATFVYGEPRVENRHRM  773

Query  2732  FADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTG  2553
             +A L+         WL +GDFN    Q E  + +  S  +   F D +   +L DLGF+G
Sbjct  774   WALLNSIKQVSDLPWLVVGDFNETLWQFEHFSLKQRSELQMQAFRDVVQRCDLHDLGFSG  833

Query  2552  SSYTWIRGLDTPSFKGARLDRALSN  2478
               YT+    +  S    RLDRAL++
Sbjct  834   VPYTYDNRREGRSNVKVRLDRALAD  858



>ref|XP_010687808.1| PREDICTED: uncharacterized protein LOC104901884 [Beta vulgaris 
subsp. vulgaris]
Length=1208

 Score =   202 bits (515),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 125/424 (29%), Positives = 220/424 (52%), Gaps = 10/424 (2%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             W+R    C+T+     L NG   +   P++G+RQGDP+SP +F+LCAE L+  +  +   
Sbjct  489   WLRQ---CITTVSFSVLVNGIPGETFVPQRGIRQGDPLSPYIFILCAEILARQLQHASLM  545

Query  1095  GNWK-GVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
             G+   GV +      +  L FADD + F +A+    + +K  LD +C+ SGQ IN  KS+
Sbjct  546   GSRSLGVTLGHSGVRIPFLTFADDTMIFAKASEESCITIKAILDKYCNMSGQLINFHKSA  605

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                ++N +     N A  L +     +GK+LG P I  ++   +F  + E++ ++L+   
Sbjct  606   YQCTQNVSDNVSANFAEILQMDKSFSLGKYLGCPIIDSKVTNATFAELQEKVCSQLTKWK  665

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             + +LS AG  ++VQS L+    Y M+S  +P  ++ S+++    F W         +L+ 
Sbjct  666   ANSLSQAGRTILVQSNLATKANYQMQSFSLPPAILSSLDKCYINFFWNKASDAKSPNLIG  725

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQ  379
             W  + + K  GGLG++  K  N A   KL W++ +  + LW  L   KY  D  ++ +++
Sbjct  726   WDKICSPKKFGGLGLRKAKANNNALQFKLLWKILESPDNLWVQLVTRKYLKDVDLF-NYK  784

Query  378   PKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAPIAPSSLN  199
              K N S  W+ ++     F+ G++W V NG    FW D+W+ +  L E+   P    +L 
Sbjct  785   VKANVSWQWRRLMSLRSTFKKGLRWIVGNGDQVSFWFDNWIFNTALDEKCLVPRGSEALK  844

Query  198   NLVANYWISNEG-WDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNGLFSVSS  22
                 +++I+ +G W+  +L + +P  I   ++ + L  + L  D+ +W   P+G++SV S
Sbjct  845   ---VSFFINQDGHWNVALLRQYVPAEIATLIANYFLPSN-LCHDKRIWGLTPHGIYSVKS  900

Query  21    AYEL  10
               EL
Sbjct  901   GVEL  904


 Score =   188 bits (478),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 153/271 (56%), Gaps = 2/271 (1%)
 Frame = -1

Query  2090  LYQEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKH  1911
             L+ ++  W   ++   IK  D NT++Y    T++RN++ +S + D  G  I     + + 
Sbjct  212   LHFQDTHWKVIAKSNHIKLSDANTKYYHSCATIRRNRNILSSISDQQGVAISHPLKIEEC  271

Query  1910  VYDYFLGLFTTEVDVN-RTNFCYGCFPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKAS  1737
               + F   FT+        N  +     ++ + D A +    T E++K A FD+ P KA 
Sbjct  272   FTEAFKQRFTSNESCGFDANVDFDLLTEIISDNDNAYLCRDVTYEEVKEATFDLAPDKAP  331

Query  1736  GPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRP  1557
             GPDG++P FF K W  VG S+F  +  FF  G +    N T ++LIPK+ NP     FRP
Sbjct  332   GPDGYSPFFFQKYWSLVGNSVFRAIKAFFHSGKILKEINHTFITLIPKIDNPSNPNHFRP  391

Query  1556  IGLCNVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGR  1377
             I LC+ +YK+I K++  RLK ++ K++ P Q +FV  R I DN L   E+ ++F+ KKG 
Sbjct  392   ISLCSTIYKIIAKILANRLKVVLGKIIHPLQGAFVPERLIQDNVLLAHEVFHSFKNKKGA  451

Query  1376  VGWMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              GW+A+K+D+EKAYDRL W +I  TL  +GF
Sbjct  452   SGWLAIKLDMEKAYDRLEWKYIFITLEKLGF  482


 Score = 80.1 bits (196),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 100/201 (50%), Gaps = 10/201 (5%)
 Frame = -1

Query  2900  VGYSGGIWLF----CSVSINIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRH  2736
             +G +GGIWLF     S    + ++  + +FIA  +   ++   ++   +Y   + AL++ 
Sbjct  1     MGLAGGIWLFWKDNASNPFTLSVIAKNDRFIACNIKLLSMECSFVAIFIYAPPNYALKQE  60

Query  2735  LFADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFT  2556
              + +L  Y       ++ +GDFN ++ Q++     TF  SR T  N  +   E I+L F 
Sbjct  61    FWNELIEYIKTLTDPYVILGDFNELSSQNDKKGGATFHFSRLTYMNMLVNSLECIELPFA  120

Query  2555  GSSYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLIS--ITTC  2382
             G  +TW + ++ P+    RLD+ + +++    FPDAK+ +     SDH  + ++  +  C
Sbjct  121   GGRFTWRQKINGPNNILERLDKGVVSLDWLSAFPDAKLFNHIFSSSDHCQVSLNFKVNKC  180

Query  2381  PQQFCSSRFKFNMAWTTHYSF  2319
              +   +  FKFN  WTT   F
Sbjct  181   RK---APPFKFNKLWTTRKDF  198



>ref|XP_010681283.1| PREDICTED: uncharacterized protein LOC104896266 [Beta vulgaris 
subsp. vulgaris]
Length=1144

 Score =   204 bits (519),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 131/431 (30%), Positives = 218/431 (51%), Gaps = 19/431 (4%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSS-VR  1099
             W+  I  C+++P    L NG      +P +G+RQGDP+SP LF+L AE L+  + ++ + 
Sbjct  562   WVDWIRSCISTPSFSVLVNGIPGKRFTPSRGIRQGDPLSPYLFILYAELLARQLSAANLH  621

Query  1098  SGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSS  919
                  GV + +    +  L FADD + F +A+    + +K+ LD +CS SGQ +N  KS+
Sbjct  622   RDKLVGVPIGKSGIRIPFLTFADDTMIFAKASEASCVVIKQILDSYCSMSGQLVNYHKSA  681

Query  918   LFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*s  739
                S N  + T+ + A  LG+  V ++G++LG P I  R+ K++F  +  R+ ++L    
Sbjct  682   FQCSPNVPISTKASFAGLLGMNEVSNLGEYLGCPIIDSRVTKETFGVVCNRVASQLPKWK  741

Query  738   srtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVK  559
             + +LS AG  V+VQ+ L+    Y M+S  +P  ++ ++++  R F W         +L+ 
Sbjct  742   ANSLSQAGRTVLVQANLATKANYQMQSFFLPLPILTALDKSYRNFFWNKDPLNKTANLIG  801

Query  558   WGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKY-------DFDP  400
             W  +   KA GGLGI+  K  N+A   KL W+L +  + LW  L K KY           
Sbjct  802   WDRICLPKAFGGLGIRKAKVNNVALQIKLIWQLLKSNSSLWVRLVKKKYVKSHDVLTHRV  861

Query  399   SVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFEEASAP  220
             S  +SWQ        W+ ++    +F+ G++W + NG    FW D+W+   P+ +  S  
Sbjct  862   SAVASWQ--------WRKLMSLRPLFKKGLRWQIGNGFDISFWDDNWVFQYPISQIVSPM  913

Query  219   IAPSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNG  40
                 SL   V + +     WD   LD+++P H+ +++    L   +   D LVW    +G
Sbjct  914   PGTESLR--VRDVFNEFGCWDRVFLDQLVPSHVGDQIVALYL-PSSPQKDSLVWGLTADG  970

Query  39    LFSVSSAYELA  7
              +SV     LA
Sbjct  971   QYSVKIGAMLA  981


 Score =   186 bits (471),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 94/264 (36%), Positives = 150/264 (57%), Gaps = 2/264 (1%)
 Frame = -1

Query  2069  WFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYDYFLG  1890
             W Q+S+ +++  GD NT +Y    T++R+++++     A   +I     +   + + F  
Sbjct  295   WKQKSKTKYLHLGDANTNYYHTHATIRRSRNQIKSFKSALDQIITTPNEISNVITNEFEQ  354

Query  1889  LFTTEVDVN-RTNFCYGCFPPLLEE-DWASVNAPFTPEDIKTALFDMVPCKASGPDGFTP  1716
              F +    +      +    P++   D   + A  + ++IK+A+F++ P K+ GPDG+ P
Sbjct  355   RFVSNPACSFNEEVDFQLLAPIISATDNEMLVAEVSADEIKSAVFELAPDKSPGPDGYPP  414

Query  1715  GFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVV  1536
              FF K W  VG S+   V  FF  G L    N T L+LIPKV NP     FRPI LC+ +
Sbjct  415   FFFQKYWTLVGNSVIRAVRAFFHSGHLLKEINHTFLALIPKVDNPSSTNHFRPISLCSTI  474

Query  1535  YKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVGWMALK  1356
             YK+++K++  RLK ++ K++ P Q +FV  R I DN L   E+ ++F  K G  GW+A+K
Sbjct  475   YKVVSKILTNRLKSVLGKIIHPLQGAFVPDRFIQDNILIAHEVFHSFHKKSGVDGWLAIK  534

Query  1355  VDLEKAYDRLSWCFIEDTLRDIGF  1284
             +D+EKAYDRL W FI  +L+ +GF
Sbjct  535   LDMEKAYDRLEWNFILVSLKKLGF  558


 Score = 74.7 bits (182),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 107/234 (46%), Gaps = 9/234 (4%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPS--LICLFEPKISRAQANEICSSLGFDEWIRVEAVG  2895
             WN +GA   +    +K F   +K S  ++C  + K   +QA  I    GF  +  V  +G
Sbjct  6     WNIRGALKKNACSEIKDFCASNKISIFMVCEVKSKAPLSQATTI--QCGFPNFDFVPTMG  63

Query  2894  YSGGIWLF---CSVS-INIEILYTHPQFIAFQV-YDNVSAPWLMSVVYGCLDMALRRHLF  2730
              +GG+WLF   C  S  N+ +L    +F+A  +   N +  + +  VY       +   +
Sbjct  64    LAGGLWLFWKDCLQSPFNLSMLIKGSRFMAVSISMLNENLQFAIIFVYAPPQNNHKSEFW  123

Query  2729  ADLS*YFFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGS  2550
              ++  +  +    ++ +GDFN + C+ +     +F  S   + N  +     ++L F GS
Sbjct  124   EEIILFANSLSTPFIIIGDFNDIGCEQDKVGGASFVSSCVANMNHLLASLPYVELPFQGS  183

Query  2549  SYTWIRGLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISIT  2388
              +TW +    P+    RLDR + + E    FP AK+ H P   SDH  + + ++
Sbjct  184   RFTWRKKRAGPNNILERLDRGVVSPEWLSWFPQAKLVHHPFTSSDHCHVTLDLS  237



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score =   239 bits (609),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 230/432 (53%), Gaps = 16/432 (4%)
 Frame = -3

Query  1281  PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSV  1102
             P +   +M C+++     L NG  T +I P++GLRQGDP+SP LF++C E  S ++   +
Sbjct  531   PMFCNRVMECISTVSFSILVNGAPTGYIQPQRGLRQGDPLSPFLFLICTEGFSSLIRKGM  590

Query  1101  RSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKS  922
               G   G K T     ++HLFFADD V FG A   +A  +   L+ + S SGQ+INL KS
Sbjct  591   ERGILHGYKFTTNGIPLTHLFFADDSVLFGNATVEEAQGVADILNTYASGSGQEINLSKS  650

Query  921   SLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*  742
             S+FF  +T+  T++ I  TLGIP     GK+LGL +  G  KK  F  I ++I+ARL+G 
Sbjct  651   SIFFGTSTSKRTKKRIGNTLGIPYKDGFGKYLGLQADFGHSKKAVFAEIRDKIEARLAGW  710

Query  741   ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLV  562
             S + LS AG  VM+++V  A+P Y+M    +P GV   +E+ +R + W     K  CH  
Sbjct  711   SEQFLSQAGKEVMIKAVAMALPNYAMSCFKLPIGVCRDVEKAVRSYWWRGNTQKRGCHWT  770

Query  561   KWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSW  382
              W  +   K+ GG+G K ++  NLAFLAK+ WRL Q+   L   + K KY +    +   
Sbjct  771   SWDRLMKQKSAGGMGFKDIQCFNLAFLAKIGWRLIQNPTSLLATVLKDKY-YPGKCFKDA  829

Query  381   QPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWL------LDRPLFEEASAP  220
                RN+S  WKGI +   + ++G++W V +G +     D WL      L +PL       
Sbjct  830   GKGRNTSWGWKGIFEGHMVLQHGVRWRVGDGESINIQKDPWLPTPTTFLAKPL-----DS  884

Query  219   IAPSSLNNLVANYWISNEGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRLVWYKEPNG  40
             +  + + +L+      ++ W  +++          K+ +  L +   + DRLVW+   NG
Sbjct  885   LEETKVRDLIDPI---SKSWKEEVILAGFNRDEARKILSIPLSKSGCI-DRLVWHYTVNG  940

Query  39    LFSVSSAYELAL  4
              +SV + Y + +
Sbjct  941   DYSVKTGYGVVM  952


 Score =   151 bits (381),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 115/181 (64%), Gaps = 3/181 (2%)
 Frame = -1

Query  1820  EDWASVNAPFTPEDIKTALFDMVPCKASGPDGFTPGFFHKTWPTVGTSLFSFVHRFFEDG  1641
             ED   + AP T E+IK A F +   +A GPDGF+  F+   W TVG  +   +  F+  G
Sbjct  350   EDNRDLVAPITDEEIKEATFQIPSERALGPDGFSGCFYKDHWTTVGEDVVKAIKAFWHSG  409

Query  1640  ILPPGCNDTILSLIPKVQNPERITQFRPIGLCNVVYKLITKVMMIRLKDMVRKLVGPHQS  1461
              +    N T L LIPKV+ P+ ++QFRPI LCNV+YK++ KV+  RLK ++ K++G +QS
Sbjct  410   NMLRKLNHTNLVLIPKVKCPKNMSQFRPIALCNVIYKILAKVITNRLKKIMPKVIGENQS  469

Query  1460  SFVHGRQITDNTLAYQEILNAF--RTKKGRVGWMALKVDLEKAYDRLSWCFIEDTLRDIG  1287
             +FV G+QI DN L   EIL++   ++K  + G MA+K+D+ KAYDR+ W F+   +  +G
Sbjct  470   AFVAGKQIQDNILVVHEILHSLNHQSKDMQKG-MAIKLDMAKAYDRVEWEFLFSMMSKLG  528

Query  1286  F  1284
             F
Sbjct  529   F  529


 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/263 (26%), Positives = 112/263 (43%), Gaps = 3/263 (1%)
 Frame = -1

Query  3068  WNCQGAASPSFRRTLKYFLRLHKPSLICLFEPKISRAQANEICSSLGFDEWIRVEAVGYS  2889
             WNCQG         L    RLH P ++ L E K    +   +  SLG +    V   G S
Sbjct  6     WNCQGIGGDLTVDNLLEANRLHTPDIVILLETKNKSHRYGFLKXSLGLEYMFAVXPHGLS  65

Query  2888  GGIWLFCSVSINIEILYTHPQFIAFQVYDNV-SAPWLMSVVYGCLDMALRRHLFADLS*Y  2712
             GG+ +F      + +L +    I  +++D + +  W +  +Y   D   R+  +  L   
Sbjct  66    GGLCVFWKDGSQVTLLKSENFVIEMKIWDEILNKQWRLFAIYASTDEKKRKDQWKRLGKR  125

Query  2711  FFNPQGTWLAMGDFNSVTCQSEVSNKETFSMSRCTDFNDWIFMEELIDLGFTGSSYTWIR  2532
                     L + DFN + C  E         S   DF +++   EL+DLG+ G  +TW  
Sbjct  126   IEQESDCCLLIRDFNDILCNEEKEGGNYRPASSMRDFREFVARNELMDLGYEGYPFTWRN  185

Query  2531  GLDTPSFKGARLDRALSNVE*SLRFPDAKVTHLPMIGSDHSPLLISITTCPQQFCSSRFK  2352
               ++   +  RLDR L+ +  +  + D  + HL + GSDH+ L++S T   Q     +F 
Sbjct  186   NRESLPIQ-QRLDRGLATMGWNNTYLDTTIRHLVLEGSDHAMLVLS-TELIQVRRGRKFS  243

Query  2351  FNMAWTTHYSFQACVQSVWRSDL  2283
             ++  W+     +  V   W   L
Sbjct  244   YDARWSKLEECRELVAHEWEGHL  266



>ref|XP_008356436.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1089

 Score =   214 bits (545),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/436 (34%), Positives = 223/436 (51%), Gaps = 20/436 (5%)
 Frame = -3

Query  1308  GYSPRYWL*PYWIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAER  1129
             G++P +     WI+    C+++     L NG  T +I P+ GLRQGDP+SP LF+LC E 
Sbjct  303   GFAPLFC---KWIKE---CISTVSFSILINGTPTGYILPQXGLRQGDPLSPFLFLLCTEG  356

Query  1128  LSHMVDSSVRSGNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCS  949
              S ++   +  G   G + T     ++HL FADD V FG     +A  + + L ++   S
Sbjct  357   XSMLLRKGLEQGALHGFRFTPNGIPLTHLLFADDXVVFGNXTVDEAKAVVEVLKVYARGS  416

Query  948   GQKINLQKSSLFFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILE  769
             GQ+INL KSS+FFS  T+   +  I  TLGI      GK+LGL +  G  KK  F  + +
Sbjct  417   GQEINLTKSSVFFSPKTSNRIKMEIEETLGIQCKQGFGKYLGLQADFGLSKKVVFAEVRD  476

Query  768   RIKarlsg*ssrtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSR  589
             ++ ARL G + + LS  G  V++++V  A+P Y+M    +P GV   +E+ I  F     
Sbjct  477   KVXARLXGWTEQFLSQXGKEVLIKAVAMALPNYAMSCFKLPIGVCRDVEKAIXNFWXKGN  536

Query  588   EGKNKCHLVKWGIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYD  409
             + +   H V W  VT  K +GGLG K ++  NLAFLAK+ WRLS + +    ++F+ KY 
Sbjct  537   DQRKXVHWVSWERVTKQKKSGGLGFKDIQCFNLAFLAKIGWRLSLNPSSJLASVFRDKYH  596

Query  408   FDPSVWSSWQPKRNSSNAWKGILQALHIFRNGIKWHVRNGRATRFWLDSWLLDRPLFE-E  232
                S   + + K N+S  WKGI  A  + +NGI+W V NG       D W      F   
Sbjct  597   PGRSFNEAGRGK-NTSWGWKGIFXAXKVLQNGIRWRVGNGXCINIREDXWFPKPSTFRIR  655

Query  231   ASAPIAPSSLNNLV---ANYWISN-EGWDWDMLDRVLPEHILNKLSTFVLQEDTLLGDRL  64
                 +  + +++L+   +N W +N     +   D V    I   LS F  +      DRL
Sbjct  656   PREDLDATMVSDLIXPGSNSWKANIISASFHREDAVTILSI--XLSQFGXE------DRL  707

Query  63    VWYKEPNGLFSVSSAY  16
             V +   NG++SV S Y
Sbjct  708   VXHHSXNGVYSVKSGY  723


 Score =   175 bits (444),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 149/269 (55%), Gaps = 3/269 (1%)
 Frame = -1

Query  2084  QEELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVY  1905
             +EE+ W  +SR +W+K GD+NT+F+   T  +R  + +  + D+ G     D  +     
Sbjct  37    EEEVYWKVKSRVQWLKEGDKNTKFFHAQTLKRRRLNLIRGIEDSHGVWHEQDKEINDTAI  96

Query  1904  DYFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDG  1725
              YF  LF +       N        + +ED  ++ AP +  +I  A+  + P  A GPDG
Sbjct  97    AYFADLFQSSRPSQIENIERNVEARITQEDNIALTAPVSSGEILLAVSQIPPSXAXGPDG  156

Query  1724  FTPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLC  1545
             F+  F+   W  VG  +      F+  G L    N T L LIPKV+ P+ + Q+ PI LC
Sbjct  157   FSGCFYQDHWDXVGEDVVKIXQAFWHSGTLLXKLNHTNLVLIPKVKCPKNMAQYXPIALC  216

Query  1544  NVVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAF--RTKKGRVG  1371
             NV+YK++ KV+  RLK ++ K++G +QS+FV G+QI DN L   E+L++   + ++ + G
Sbjct  217   NVIYKILAKVLTNRLKLVMPKVIGDNQSAFVAGKQIQDNILXVHEVLHSLLHQRREDQAG  276

Query  1370  WMALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
              MA+K+D+ KAYDR+ W F+   +  +GF
Sbjct  277   -MAIKLDMAKAYDRVEWDFLITXMAXMGF  304



>gb|AAF69169.1|AC007915_21 F27F5.21 [Arabidopsis thaliana]
Length=1023

 Score =   195 bits (495),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 149/267 (56%), Gaps = 1/267 (0%)
 Frame = -1

Query  2081  EELIWFQRSREEWIKSGDRNTRFYQVATTVKRNQSRVSKLVDADGHLICDDGLLLKHVYD  1902
             EE  W+Q+SR  W+K GD N++++   T  +R ++R+  L D +G    +D  +      
Sbjct  182   EEQYWYQKSRSLWMKVGDNNSKYFHALTKQRRARNRIIGLHDENGKWFAEDKDVQHIAVS  241

Query  1901  YFLGLFTTEVDVNRTNFCYGCFPPLLEEDWASVNAPFTPEDIKTALFDMVPCKASGPDGF  1722
             YF  LF      N           + ++    +  P T ++++ ALF M P KA GPDG 
Sbjct  242   YFETLFNKSNPQNIAESLSEVKTLITDQINDFLTTPATEDEVRAALFLMHPEKAPGPDGM  301

Query  1721  TPGFFHKTWPTVGTSLFSFVHRFFEDGILPPGCNDTILSLIPKVQNPERITQFRPIGLCN  1542
             T  FF K W T+   +   V+ F +DG+     N T + LIPK + P R+T+ RPI LCN
Sbjct  302   TALFFQKPWATIKMDMLFLVNSFLQDGVFDKQLNTTNICLIPKTERPTRMTELRPISLCN  361

Query  1541  VVYKLITKVMMIRLKDMVRKLVGPHQSSFVHGRQITDNTLAYQEILNAFRTKKGRVG-WM  1365
             V YK+I+K++  RLK ++  L+    S+FV GR I+DN L  QE+ +  RT     G +M
Sbjct  362   VGYKIISKILCQRLKKILPSLISETHSAFVEGRLISDNILIAQEMFHGLRTNPSCKGKFM  421

Query  1364  ALKVDLEKAYDRLSWCFIEDTLRDIGF  1284
             A+K D+ KAYDR+ W FIE+ L+ +GF
Sbjct  422   AIKTDMSKAYDRVEWNFIEELLKKMGF  448


 Score =   194 bits (492),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 203/391 (52%), Gaps = 10/391 (3%)
 Frame = -3

Query  1275  WIRNIMCCVTSPRLVALWNGQLTDWISPRKGLRQGDPISPLLFVLCAERLSHMVDSSVRS  1096
             WI  IM C+T+ +   L NGQ    I P++GLRQGDP+SP LF+LC E L   +  + + 
Sbjct  452   WISWIMWCITTVQYRVLLNGQPRGLIVPKRGLRQGDPLSPYLFILCTEVLIANIRKAEQE  511

Query  1095  GNWKGVKVTRIAPNMSHLFFADDLVFFGEANSIQALEMKKCLDLFCSCSGQKINLQKSSL  916
                 G+KV   +P++SHL FA+D +FF +AN  Q   +   L  + + SGQ IN  KSS+
Sbjct  512   KLITGIKVATASPSVSHLLFANDSLFFCKANKEQCGVILGILKQYEAVSGQMINFSKSSI  571

Query  915   FFSKNTNLGTQQNIAATLGIPSVLDMGKHLGLPSIHGRLKKDSFDNILERIKarlsg*ss  736
              F        +  I + LGI S+  MG +LGLP   G  K   F  + +R++ R++G S+
Sbjct  572   QFGHKVGDDIKAEIKSALGIHSIGGMGSYLGLPESLGGSKTRIFSFVRDRLQTRINGWSA  631

Query  735   rtlslag*HVMVQSVLSAIPYYSMKSTLIPSGVIDSIERLIRGFLWGSREGKNKCHLVKW  556
             + LS  G  VM++SV++ +P Y M    +P  +   +   +  F W S       H + W
Sbjct  632   KFLSKGGKEVMIKSVVAVLPTYVMSCFRLPKTITSKLTSAVAKFWWSSDGESRGMHWMAW  691

Query  555   GIVTNSKANGGLGIKSLKHMNLAFLAKLAWRLSQDGNCLWTNLFKAKYDFDPSVWSSWQP  376
               + +SKA+GGLG +S+   N A LAK  WRL    + L+  +FK +Y F  S       
Sbjct  692   NKLCSSKADGGLGFRSVNDFNSALLAKQLWRLITVPDSLFAKVFKGRY-FRKSNPLDKLK  750

Query  375   KRNSSNAWKGILQALHIFRNGI